4IBMA

Crystal structure of insulin receptor kinase domain in complex with an inhibitor irfin-1
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
301
structure length
301
Chain Sequence
SVYVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPNMRPTFLEIVNLLKDDLHPSFPEVSFFHSEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Insulin receptor
publication title A highly selective dual insulin receptor (IR)/insulin-like growth factor 1 receptor (IGF-1R) inhibitor derived from an extracellular signal-regulated kinase (ERK) inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 99
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ibmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ibmA01
4FIJA 5LVPA 3OVVA 4RIOA 1SNXA 2AUHA 4F1TA 3DFAA 4O22A 5ETAA 4IAYA 3ZH8A 3LAUA 1M2PA 3NYXA 3AC1A 5JRSA 5L8JA 3TJDA 5DGZA 3IW4A 4PMTA 4S31A 3EN9A 3HMIA 4D55A 3M11A 5DH3A 5DLSA 1YDSE 4D4VA 1AD5A 1OVEA 2OKRA 2V22A 2CCIA 3QA8A 1S9IA 2JC6A 3PP1A 2BIYA 3R8MA 3KCFA 3DB6A 2H6DA 2R9SA 4R1YA 3N4UA 3UG1A 3DK3A 2R0UA 4EWQA 4LRMA 4QQ5A 5IQGA 2XNEA 3PA5A 4BI2A 5JT2A 3QAME 2J6MA 4BDJA 3H3CA 4PTGA 3ORNA 5HCYA 4E4NA 3OY3A 2HZ0A 1G8SA 2WMAA 3KRXA 3QXPA 2A2AA 2X9FA 3NDMA 4PMSA 3ODYX 3RHXA 4UN0C 4ZLOA 4ZY4A 5IA2A 4TYIA 2CPKE 2BAQA 1EH4A 4YGAA 4BCQA 3ENMA 1BMKA 4DH1A 2J4ZA 4YTIA 5CAUA 4D5KA 3TACA 2IZTA 3FZPA 4FZDB 4FIHA 1XKKA 4H58A 3S2PA 4BWPA 1KOAA 5J1VA 3D2IA 2XS0A 2VWZA 1FINA 3EFLA 3JYAA 4F08A 2EWAA 2ZJWA 3BQRA 5J7HA 3LCKA 4GJ2A 4C4IA 1P5EA 4FA2A 4MQ1A 4BGGA 3DK6A 3U8WA 2ETKA 2XYNA 3L9PA 4QTEA 3MIAA 3QRKA 2C6EA 2H9VA 4ERWA 4NFNA 1PXOA 4QMMA 3KGAA 2C1BA 3RHKA 4ANMA 2PMLX 5L2QA 3T3UA 1A9UA 4O0UA 4BTKA 5HKMA 5AAGA 3BBWA 4FL2A 4HPUE 2J90A 4F7NA 2VGPA 2OZAA 3UJGA 1XH8A 2Z7LA 1FMKA 4FX3A 2VO6A 1DAYA 5HOAA 3PLSA 4FKOA 3I60A 2C69A 4IB5A 3TZ8A 3WF5A 4E8AA 4Z55A 2HENA 3FMEA 3W18A 2HZIA 1V0PA 3ZDIA 1MUOA 4EYJA 1U54A 4A9YA 3UYSA 2PWLA 2XM8A 1Q8WA 2I0VA 4FZFB 4UZHA 3OZ6A 3AD4A 4YHFA 5I9ZA 3KC3A 4D9TA 3TZMA 5E8WA 1YHSA 3TL8A 5HEZA 5D7AA 4IC8A 4DEDA 4DN5A 4BKZA 4X2JA 1PXIA 2PVRA 4P5QA 1J7UA 2W1DA 2UZNA 4LM5A 4HVSA 3NW5A 3RCJA 2WZJA 5JQ5A 2YA9A 3LFEA 3FI3A 5KCVA 4DLJA 2W1HA 3TTJA 1FOTA 4PY1A 2OICA 4CYIA 2XIRA 4MHAA 1Z9XA 1YI3A 3POZA 1AQ1A 4JG7A 3SDJA 3U55A 2CGXA 3GQLA 3QQKA 4TRLA 4AZSA 4AS0A 5L2WA 4BVUA 1URWA 3C4FA 2BROA 5L2IA 4I5MA 3KN5A 1GIHA 4Y72A 5TE0A 4D4RA 5JH6A 4DFNA 1YOJA 3FI2A 3U6HA 5C03A 2O2UA 2CMWA 5CWZA 1KE7A 2QKRA 2IVUA 3P4KA 5L6OA 2WAJA 3L8PA 1ZMVA 4L01A 1TQPA 2QC6A 5KX8A 3RINA 5ANKA 1ZZLA 4I92A 4KKEA 4ZSLA 4YNEA 4C34A 3LMHA 4BDEA 2QOHA 4YJTA 4XUFA 2IPXA 4WBOA 1M17A 5B2LA 3P79A 2QU6A 3A62A 3PVGA 1REJA 3VBQA 1IAJA 4BCJA 4QPSA 2WO6A 1GJOA 4YSJA 4U44A 1LP4A 3WZJA 2E9NA 2YWPA 4NM0A 2FYSA 2ZM1A 4I6HA 4Q5HA 4AXAA 5AAEA 4ZOGA 4BGQA 1URCA 3VBTA 5GIPE 3DAEA 2J50A 4FKSA 2GQGA 1Q8UA 4OTQA 1KE6A 3GCVA 5AP3A 2R4BA 3FJQE 1NW1A 2H96A 4IVCA 4XBUA 4ACHA 3D5XA 3QQUA 3QTZA 4I0TA 5M4UA 3FXWA 5DR2A 5JZNA 4DA5A 3KU2A 5TO8A 3D7TA 1U54B 2J2IB 3SXFA 4AUAA 5GIOE 4OAUC 1KSWA 1MRUA 2OI4X 1UA2A 3DQXA 5G6VA 1R0EA 1FVVA 1VR2A 1CKJA 4TNBA 4YZDA 3PG1A 3V5QA 3EB0A 3WI6A 4BN1A 1Y91A 4C61A 4D9UA 3G6GA 4O91A 3P0MA 1PMNA 3WZUA 2HZ4A 1GZKA 3IW8A 3MH1A 4TT7A 5M08A 2RKUA 3RI1A 4EOPA 4EOKA 5HG8A 5FTGA 1W98A 3BU5A 4MXXA 2WGJA 5IA1A 5JFVA 3OW4A 2CKEA 4HCUA 5KZIA 3KVWA 5AUVA 5LOHA 2ITYA 3GU4A 4GKHA 2IVTA 3DKFA 4G3DA 4G34A 1W84A 2C5XA 5M09A 1WBPA 2QO7A 4FSTA 3PJ2A 2IO6A 4RIYB 3IOPA 5CSHA 2BZHB 4EZ7A 4B7TA 4RG0A 1JNKA 2CCHA 3CY3A 5JGAA 1FGKA 2BMCA 3S1HA 3OCGA 5EW9A 3FLWA 1UU7A 3DDPA 4A9UA 3WZEA 4A06A 5HICA 4H1MA 4DTKA 3CLYA 4YU2A 2VD5A 3OTVA 4UWYA 4GSBA 4MF1A 4FKLA 1KE9A 3F2NA 2VU3A 4O86A 4X0MA 3MPAA 5E8UA 1B38A 4MD8E 3VAPA 5HBEA 2OZOA 3HV7A 1U5QA 4JR7A 4BHZA 4ZIMA 3HLLA 2WTCA 5BVKA 3FQEA 3MVJA 4AWIA 1U59A 2H34A 3I7BA 4M97A 4CT1A 3PA3A 4BDKA 4W9WA 4K2RA 2JD5A 2WEIA 3FDNA 5E4HA 3TV7A 4OTIA 1XBAA 3C7QA 4NW6A 4E26A 4RX9A 2LAVA 3O8PA 4QTBA 4RIWB 4XP3A 2HW6A 5A9UA 2WU6A 2WMSA 4YO4A 2YM7A 4NU1A 2QONA 3O96A 5EI8A 4EK4A 3WF9A 1GZ8A 1Q62A 1PMUA 2XNGA 2CKOA 2OLCA 4UXQA 1ERKA 2BHHA 3COKA 3G51A 3LFFA 3D7TB 2O5KA 4JNWA 3MESA 5IA5A 1PXLA 1GOLA 2YM8A 5LVLA 2UUEA 3B2WA 3POOA 4RX8A 3DKCA 3ZLYA 4M12A 3PTGA 5LCKA 4BI0A 4PUZA 1JPAA 2GNGA 4U42A 2UW3A 5FTQA 4CLIA 3DFCB 3SX9A 4A9SA 4OTPA 4WNKA 4FG9A 1YRPA 3QA0A 3KK8A 4HZSA 5H3QA 3VHKA 4CGAA 3ODZX 3L1SA 4BBFA 3R1YA 5AA8A 3OXIA 3MYGA 5AR5A 3MN3A 4E5WA 1FMOE 2RFSA 3IS5A 3QTSA 3LCTA 3GOPA 4ITIA 2OF2A 2QG5A 2XIZA 3RBWA 4YTHA 4RJ7A 3VNTA 3PY0A 4OT5A 3GNIB 4O7RA 2WU7A 4GU9A 2OO8X 3OD6X 2XIKA 3LZBA 2B4SB 3EQIA 1YXSA 3DU8A 4UBAA 4M69A 4PTEA 4FEWA 4N57A 4PV0A 2P3GX 2BZKB 4IQ6A 3O23A 4WIHA 5EDRA 4TXCA 3PXKA 2B53A 5ETFA 2W5HA 4Z7GA 4FEUA 3QYWA 4RFZA 2J9MA 4H3PA 4TN6A 3HMNA 4FOCA 2EXCX 3IG7A 1S9JA 3PE1A 3ZMMA 1UVRA 2XF0A 1JKSA 3SV0A 4X2KA 1Q41A 3QCXA 3BE9A 2PHKA 3E8DA 2FUMA 4ZS4A 5DVRA 4PRJA 3CTQA 5M4FA 5F20A 3T8OA 3V5TA 2HY81 2QHNA 1Y8YA 3OUKA 3VF9A 3RWQA 2WMVA 3C4EA 2NO3A 4TL0A 2QOKA 3IKAA 2IW6A 3A7IA 5BUEA 5HG9A 4X6QC 4ANNA 4AG8A 3JS2A 3CY2A 2B55A 1KV2A 2O3PA 4FT9A 4HGEA 4Y85A 5CXHA 4BZOA 3UQCA 4X3FA 3W2CA 2YM3A 4FNZA 4AACA 3QRTA 4M3QA 2QURA 4MQ2A 4MXZA 4IX3A 4AZEA 4AT3A 3QUPA 4HJOA 3G6HA 4YZBA 4W4XA 1H25A 1H0VA 3GCQA 4DGGA 3F2RA 4CRLA 4FTIA 5KO1A 4QP1A 2JDTA 3MS9A 5D12A 3R9HA 4FV1A 4EH9A 3TDVA 5A4QA 1MQBA 4AGCA 3RWPA 2BFXA 4ZTMA 1Y6BA 4L42A 5CVFA 3T9IA 4QYYA 1ZY5A 3FXXA 3AT4A 3Q6UA 3QTUA 5FP6A 2B7AA 3I6UA 3TWJA 2XKEA 3PVWA 1UNLA 5IQFA 4M13A 1E1XA 4QPMA 5KBRA 3M2WA 4H3QA 4C3FA 2JBPA 2BRBA 5AEPA 3BKBA 5A4CA 4P90A 5B0XA 5CU0A 1XH6A 3DCVA 4ANBA 5CSPA 2CNUA 3NVKI 3Q60A 4LL5A 2OJIA 2YM6A 3BHTA 4UMTA 5FM3A 2VTSA 2I6LA 4BFMA 1LEZA 3C0IA 1QPCA 3IW6A 4CZYB 1PXNA 2F4JA 3UP2A 3CXWA 1CKIA 5BVFA 4FGRA 2JLDA 4KBAA 4QMLA 5HU9A 4ALWA 2QKWB 5CANA 5EOBA 5DNRA 1GNGA 4R1VA 1I09A 1JSVA 2FH9A 3C0GA 2ZB1A 3NIZA 4MX9A 4RQVA 3UTOA 3KVXA 3R8ZA 3FEGA 3RAIA 4C4JA 3HUBA 2YJRA 4EC9A 3C4CA 1NVRA 2XB7A 1M7NA 2JKKA 1IAHA 5L8LA 4Y83A 2GS2A 3KK9A 3GB2A 4L52A 5AP7A 1M2QA 5GZ9A 2PUUA 4KKHA 3QKKA 5CVGA 2BDWA 4F09A 4CLJA 4NKSA 3GC9A 3FXZA 4TNDA 5CEPA 5GZAA 5JRQA 5K3YA 4B9DA 4FMQA 2I0HA 5HG5A 3NUPA 3E8EA 1KE5A 3HUCA 3DV3A 3ELJA 4IW0A 3AD6A 1OECA 3LVPA 5BQ0A 2CKQA 5HD4A 4GS6A 3HAMA 4K1BA 4K11A 4K18A 4ZTLA 4G9RA 5CZIA 1A06A 2EVAA 3R02A 4OTDA 4ASDA 3ORTA 2R3OA 4QMXA 5HIBA 2YABA 2WQNA 4J1RA 2YITA 4FKVA 4RIXB 1OBDA 4IX6A 3UVQA 4IANA 4F70A 3A61A 4RRVA 4RBLA 3UO5A 2HCKA 4PWNA 1UU8A 5B2KA 2C5NA 3V6SA 2VWWA 5E8VA 3ZEWA 5HNIX 3PE2A 2KTYA 4FKPA 3DTWA 3AC2A 1GY3A 3MVHA 4MH7A 3G90X 3LFCA 4XOYA 4A07A 4DEHA 3C4ZA 3CD8A 4LG4A 4X21A 3EFWA 4EH3A 4NIFA 1W8CA 2Z7QA 3RKBA 4BC6A 3O0GA 3VQHA 4F9CA 5CAQA 4IAZA 5EQPA 5M56A 3K2LA 2J0JA 2P4IA 5EYCA 5BVEA 4NCTC 3WBLA 3GC8A 4BI1A 4E20A 5FXSA 3KF4A 3SRVA 2RFEA 2XJ2A 4IC7A 2GHLA 3OBGA 3QZFA 2R3LA 3LM5A 4LUDA 3RGFA 4XLVA 4O7WA 1F0QA 4BCPA 2QI8A 3HV5A 4FE2A 3F5XA 4XCUA 1ATPE 3B2TA 3ET7A 3GFWA 3JY0A 3ZDUA 3R7EA 3TJCA 3LMGA 3DZOA 3LFAA 1Q4LA 1Q8YA 4CXAA 1W83A 4NEUA 3NNXA 4AW5A 2OWBA 4LOPA 4DITA 4F65A 4IAKA 4V04A 4F6UA 4HVIA 3ALOA 5BX0A 4BR3A 3ORMA 3CGFA 3F7WA 4V01A 5C1QB 3M42A 4JQ8A 3BYVA 4EH4A 3F5PA 2YEXA 3O8TA 3LCSA 2W4KA 3NYOA 2GTNA 4YP8A 3WZDA 5CF8A 2F49A 5CZHA 1OITA 2SRCA 3EZRA 3VWAA 1H01A 4N0SA 3AGLA 3VJOA 2V7OA 5C4KA 2UW6A 4UALA 5CQUA 4D2SA 3RALA 4ENXA 4JQEA 4OTHA 4S32A 3RK9A 5A46A 4PNKA 2HY0A 2YJSA 3QGWA 4O7ZA 2YACA 3CR0A 4K0YA 1PYXA 3FHIA 3EQFA 5IUIA 4IACA 2YCRA 3MDYA 2HELA 4N70A 5AV2A 1CMKE 3ANRA 4JI9A 5CEKA 5KMMA 5FTOA 1PF8A 4TTHB 3VUIA 3ZM4A 1U46A 2JEDA 1NY3A 2QHMA 3BX5A 2ZV9A 2X81A 3GU8A 3OP5A 3OT3A 4PL4A 3I1AA 4L00A 4RVTA 4YZ9A 4OR5A 1PHKA 4O1PA 1XH7A 1KUTA 3ZO2A 3BCEA 4OGRA 5JGBA 1O6KA 5M51A 5CNNA 5ANOA 2V55A 4R8QA 2I0EA 2UW7A 3EQGA 4TWPA 4FEQA 5AP4A 2DWBA 4YZNA 5EM6A 5F9EA 4J71A 3CPBA 3HAVA 1Q3DA 3E8NA 3FYJX 3KFAA 4NIFB 5FXQA 4MWHA 4AGWA 2F7EE 3MPMA 3W2PA 4FEVA 3F82A 4QQCA 3BHYA 3W8LA 2JKMA 2PUPA 3TCPA 4FVPA 4E4MA 4TY1A 3RMFA 4QP3A 3R73A 2GFCA 1ZOHA 3JVSA 3IECA 3PIXA 2BTSA 4O7YA 1SYKA 3R8LA 4HCVA 2AC3A 3D94A 4DYMA 4NM5A 3NIEA 4C2WA 3BBTB 1WBSA 2JKOA 4LGHA 5AJQA 3O7LD 1BUHA 2XBJA 5AM6A 3R22A 2R3HA 3EL8A 3SHEA 2XCHA 4BDDA 1OB3A 3OG7A 4QMNA 4I23A 2Y7JA 1OUYA 4EOOA 2ZV7A 4Z7HA 4U8ZA 3I5NA 3FLYA 3ZO4A 1YQJA 3D2KA 4I94A 5FEEA 3BGQA 2UZTA 5C01A 2W1ZA 5F4NA 4DH7A 1J1CA 5EDQA 1FVRA 3NX8A 2ITTA 3QD3A 3VRZA 2W05A 2QLUA 4LOQA 3PG3A 5HO8A 4F0IA 1OBGA 5CSXA 2YDJA 2G2IA 2WTVA 2OSCA 2CGVA 1H1RA 3NCGA 4GFGA 3RK5A 5BYYA 5M44A 3EL7A 5HIDA 2YWVA 2OG8A 3Q04A 5DR9A 3DKGA 2ZV8A 4UWBA 5D7VA 5IUHA 2GMXA 5GHVA 3UNKA 3VS6A 4X3JA 4BDIA 2I0YA 2ZAZA 1ZY4A 2QOFA 2F57A 4P4CA 3IDBA 4RMZA 2YFXA 4FI1A 4JG8A 4XLIA 3F3UA 3OHTA 3LM0A 4OTFA 4QRCA 4EHVA 3LCDA 1STCE 3BYOA 2GHGA 4S30A 1ZYSA 3VO3A 2WQMA 3VUGA 2X6DA 2EU9A 1XH5A 4GU6A 1M2RA 2W9ZB 3E7VA 4HNIA 4FTJA 3IO7A 4BCKA 4MWIA 5JGDA 4XV9A 4QP6A 1NA7A 1TQMA 4LMNA 1WCCA 4AN3A 4LL0A 5FBOA 1O9UA 4G5PA 4M66A 4G1WA 4Y5QA 5AR4A 3SQQA 3W33A 2UW5A 3V5JA 4GMYA 4C38A 4E4XA 1BL7A 5IG1A 5EOLA 2C3KA 2XRWA 5C8MA 4PMPA 4FKQA 3MBLA 4A4OA 5K4JA 3DXPA 4FZAB 5HTIA 2UVYA 5IQCA 5C9CA 4NH1A 4D0WA 3TT0A 2UZLA 3MI9A 4FIEA 1ZRZA 2BIKB 4UXLA 1OL5A 4KKGA 4UV0A 4AA5A 4EHGA 5CAVA 4GH2A 5CU3A 2WTKC 3UGCA 4FTRA 1QL6A 2B52A 4KNBA 5AR7A 3ZTXA 3NUSA 4D2VA 4W4WA 1WBWA 2YCQA 3FZOA 4CTCA 4BDGA 3H10A 4X2GA 3QZGA 5CTPA 2JFLA 4D4YA 2PZYA 3D4QA 2E2BA 3CEKA 4I5HA 3TKUA 3WF7A 3N4VA 5H2UA 4PX6A 4CTBA 5DT3A 4BTJA 5IU2A 2IZRA 3KRLA 5ETIA 3P9JA 3EKKA 1W7HA 3QTXA 2EXMA 4JAJA 1CSNA 5H8EA 4QTDA 3D5VA 4QD6A 3U9CA 4O6EA 3UO4A 3LJ2A 4JIAA 1JLUE 3R1NA 5CU4A 2QO2A 3BQCA 2UZDA 2Y8OA 2Z8CA 3NWWA 4ACDA 3OXZA 4JXFA 4FTTA 4UZDA 5J9ZA 4YJQA 2W1CA 2Y0AA 3MJ2A 5LVNA 3ZC5A 4AGDA 4FTAA 4L45A 4D4SA 4RWJA 3QRUA 3R1QA 4TYGA 4O2PA 3NYNA 1YXTA 2VX3A 5DT4A 5EHLA 4YBJA 4R3PA 3DLZA 4JDKA 5KZ0A 4GT5A 2GS6A 4EHEA 4OTWA 4D2RA 4KBCA 4LRJA 2WTWA 2HK5A 3E88A 2YAKA 4MBJA 3VS0A 4QPAA 3PXZA 4EJNA 5A54A 3Q4CA 2OH0E 3U6IA 5CS6A 1XR1A 4FTQA 3I7CA 3HRCA 4FF8A 3QXOA 4AE6A 4C8BA 4GV1A 3GI3A 3A60A 3AMAA 3VULA 3U6JA 1CM8A 2VWIA 4QT1A 3U51A 2R64A 3F2AA 4XX9A 5CF5A 4G9CA 1AGWA 5CVHA 4FV5A 3ZRMA 4EYMA 4RC4A 1NVQA 2C30A 5EKOA 5IQIA 4LGGA 5E7RA 3CTJA 3ITZA 3MH3A 3R2YA 5BVDA 2VTJA 4F9WA 3A8XA 4N4SA 5LWMA 5EQEA 5LQFA 3H9FA 5H9BA 2X9EA 5EH0A 2I1MA 3BLHA 5GJDA 5TOZA 2UZWE 4BBEA 4EHZA 5LWNA 2GNIA 2W4OA 4C7TA 4AQCA 5KNJA 5AUUA 2XK3A 4AZWA 3RNIA 3DNDA 5EI2A 4RX5A 3MA3A 4TWOA 4K6ZA 3UVRA 3JPVA 5L2TA 3SA0A 4D28A 4M0YA 4MD9E 3TTIA 3PZEA 3HP2A 3PJ1A 4NTSA 3LQ3A 1JKKA 3VUHA 4YSMA 4ZLYA 4L68A 2VTNA 3R7YA 5ETCA 4AFEA 2W1GA 2Z2WA 2XRUA 4A9RA 4FIGA 3ZBFA 2WELA 4G5JA 5M06A 4BHNA 2E9PA 3FKOA 3I0OA 1BLXA 3R8PA 2OFUA 2YIXA 3K5VA 3AC5A 3UQGA 5KMIA 3FC2A 1J1BA 1PMVA 3D5UA 3H0ZA 1H00A 1PY5A 1YOMA 2VWUA 3VC4A 3ZC6A 2ZOQA 5EKNA 2VZ6A 3S00A 5BVNA 5ANGA 1R39A 2UZOA 5ITAA 3H4JA 2QR7A 3LLTA 3TNQB 4QP7A 2YLFA 2XK9A 3QQGA 1KOBA 3G0FA 4ANOA 4DFYA 2X1NA 4DH8A 2V62A 4ZMFA 2VUWA 4R7IA 4BB4A 4QMWA 3DBDA 4EKLA 4FV6A 1ZZ2A 3IGOA 2VX1A 5F1ZA 4MBLA 3K3JA 5CENA 5EG3A 3HP5A 3A7JA 4WUAA 2OIDA 2VWXA 1U5RA 2W1IA 4MD7E 4A4XA 4FZ6A 4XJ0A 3R83A 2XKDA 3NNUA 4HYIA 3NW7A 4I20A 4I24A 4RIYA 4ZK5A 3RZBA 4H05A 5IQEA 1OIRA 2C68A 4XH6A 4X3FC 4LQMA 3P23A 4GK3A 3K3IA 3MWUA 3CJGA 3QF9A 1QPJA 1T45A 3UBDA 3FZTA 4FG7A 4EBVA 4GIIA 3NUUA 2WMXA 2XBAA 2A1AB 4CSVA 4MVFA 3TKHA 2VTMA 3DLSA 1H1PA 3TNHA 2CNVA 4EH8A 3DOGA 5HVYA 5L8KA 5B7VA 4GYIA 5FG8A 2QLQA 2J5EA 2F7XE 2PMNX 2QD9A 3KMUA 3PY1A 4HOKA 4RZVA 4BTFA 1LEWA 2GNLA 4DCEA 2A0CX 5K4IA 4RIWA 5TF9A 2JIUA 1YKRA 4PP7A 4I5PA 3Q2JA 4F7SA 2X4FA 4FSWA 3W16A 5I4NA 4JLCA 3BE2A 3TG1A 3QZHA 1OI9A 3ORXA 2X4ZA 4IZ5A 4Q9SA 4DLIA 1JAMA 2GCDA 4P5ZA 2OBJA 4Q2AA 1IA9A 2FVDA 5AIRA 1ZMUA 2OJ9A 3F5UA 4IHPA 4UMQA 3ROCA 4PMMA 5EHYA 3BELA 2W5BA 4L46A 3RM6A 5J5SA 2XCKA 3A7FA 5AUYA 4OLIA 3PJ3A 2R3IA 2CHLA 3K54A 4EK3A 4R6VA 1PW2A 3PY3A 3QC4A 1WZYA 2QG7A 5AIKA 1OL6A 2HXQA 2R3NA 3F69A 3EZVA 4OW8A 4U3YA 4I3ZA 3R7VA 3TZ7A 3U4UA 3QQLA 4HVDA 4DCAA 1UV5A 1VEBA 5E8ZA 5CASA 4R7BA 5DI1A 5E8YA 2QOLA 2XEZA 2ZDTA 2ZV2A 5M55A 3TV6A 1XH9A 3HNGA 5IF1A 4FBXA 4AW2A 5IEYA 5JK3A 1V0BA 4JAIA 4ANQA 2VWYA 3BU3A 4IZ7A 3G2FA 4IWPA 2HWOA 2FSOX 4D58A 5C8NA 5HBJA 3VS1A 3L9LA 4ZZMA 5DRBA 5HVJA 3G5DA 3NR9A 1G8AA 2ITQA 3L9NA 2GS7A 3GXLA 4IJ9A 2J5FA 2YM5A 3VS5A 4BIBA 4ZLZA 2WIHA 5KMKA 3HMMA 4APPA 3OWLA 4GRBA 1F3MC 3R1SA 2BRMA 4ZEGA 3T9TA 5I9UA 4YMJA 1NVSA 3W2RA 4NK9A 4YPSA 4G3CA 3LE6A 3ORPA 3R00A 4CMUA 3UZTA 5C8KA 3D0EA 4Y73A 3U87A 3HYHA 2C3JA 2XKFA 3G33A 3C51A 2PVLA 3R63A 4LGDA 2F9GA 5IQHA 3DTCA 2DYLA 4GJ3A 5DRDA 2RIOA 2VV9A 3EQRA 4QP2A 2OIQA 3CD3A 1O6YA 4NKAA 1JKLA 4NSTA 4RJ8A 4ZTRA 3TXOA 4A4LA 5DIAA 4GUBA 5EM7A 2CLQA 4FTNA 1H1QA 2BDFA 2OW3A 4GG5A 4MF0A 4RPVA 5FWKK 3R9NA 4V0GB 4W4YA 4DG0E 4CVAA 4G3EA 4DEEA 3VUKA 4U80A 3QTQA 3VS4A 2B9JA 4B99A 5CEIA 2ONLA 3NNWA 2UZEA 4FYOA 4QMSA 2WMRA 1M7QA 2C5VA 3LFSA 4GIHA 4YC6A 5IA3A 4UYAA 4BKYA 4Z9LA 3RAWA 2Y4IB 3GU6A 2EB2A 2IN6A 3EN6A 3LJ0A 3NAXA 4NJDA 4JOAA 3FY0A 3IW7A 4DFZE 4IM2A 2A19B 2UVZA 4FR4A 4QMUA 3K5UA 3D14A 2WD1A 3DS6A 2Z60A 3IDPA 2BR1A 3NUYA 3LXLA 3MGYA 1APME 1Y57A 2IZSA 2W1EA 4JBPA 3P5KA 4Y46A 4IH8A 4Q9ZA 3C0HA 3MFUA 4JR3A 4E6CA 4QQTA 5JSMA 4O0VA 4O7SA 4CG9A 3DY7A 4LOOA 2XIXA 5A6OA 3KRWA 2Z7SA 4CFVA 1Q97A 1YW2A 2BPMA 5DEYA 3R7UA 4ASXA 5HCZA 1L8TA 3BYSA 2WKMA 3TI1A 4IBMA 5E8XA 5J95A 4AZVA 1IEPA 4RA4A 4DBNA 4NYEA 2DQ7X 2J0KA 3AC4A 4L3LA 3RCDA 1JOWB 3JR1A 1BL6A 4U45A 4Y5HA 3ETAA 3TN8A 3MY1A 5DWRA 3U54A 3SAYA 2GHMA 1DI8A 3HVCA 5HGIA 3R8UA 2CGUA 4ALUA 1E9HA 2WOUA 4KD1A 5CX9A 3COHA 3VW8A 3QQFA 2UZVA 3D15A 4BDBA 5CAPA 1BI7A 4RFMA 4DGLC 2VX0A 5CEQA 4MXAA 4RWIA 3UDBA 3FLZA 4L43A 1RW8A 1IASA 3AGMA 4FVRA 5K5NA 5IISA 2QNJA 3TIZA 4CKIA 5AX3A 2OXYA 4KA3A 2PVFA 5HVKA 3P86A 1G5SA 5DOSA 4R5YA 5D41A 4AW1A 3O71A 3KKVA 1J7LA 2B1PA 5HLNA 2X7FA 3E8CA 3NYVA 5CXZA 1W82A 2QOIA 2FO0A 5E92A 5AR8A 3W2SA 5AV1A 3MH0A 5AAFA 3SGCA 4WBBB 5BUJA 4IAAA 2FSLX 2PVMA 4FIFA 2PL0A 1WVYA 5IPJA 4LUEA 3PRFA 2YHVA 4L44A 2GQSA 4IVDA 3CCNA 4KUJA 3OWPA 2JKQA 4BYIA 1OPJA 4M15A 2O0UA 5GJFA 4F6SA 4MEDA 4ENYA 1ZWSA 4W9XA 1LPUA 5I9VA 3TUCA 3TNWA 3I81A 4RIXA 4CKRA 3BV3A 2F7ZE 2HAKA 2WMQA 4O96A 4RSSA 3VW6A 1WBOA 4F0FA 2IVSA 5CSVA 4ACMA 1Y8GA 3OY1A 3QYZA 3ZCLA 2YIQA 5KMNA 4QMZA 3ZBXA 5IQAA 1ZOGA 1WVXA 2PVNA 2BZJA 1R78A 2OF4A 4BDHA 1PMEA 5T6KA 4RC2A 4UMPA 5T68A 3QTIA 4GG7A 2W96B 2W99B 3CE3A 3QL8A 4EOSA 1RDQE 5CQWA 5H8GA 3I4BA 3PPZA 3QC9A 4HYUA 2J51A 4YJOA 4ASZA 3CTHA 4GK2A 2CN8A 4F7LA 5J5TA 4AP7A 4IE9A 2ITWA 3M1SA 3FQSA 5LXMA 3OFMA 5CYIA 2IVVA 3CGOA 4EONA 5HU3A 4WD5A 5LVMA 5J9LA 4RVLA 3QBNA 4CT2A 5IKWA 1RJBA 1YDRE 2JBOA 3JUHA 2C4GA 3G9LX 3PXRA 4FTCA 4EI4A 3A7HA 4DH3A 4LV8A 1H24A 2GDOA 5CT0A 1IA8A 3P08A 5CLPA 2XA4A 5DFPA 3R8VA 4CQGA 3PSCA 3II5A 5KHWA 2VTQA 2QVSE 2X8EA 5CF6A 5KMOA 4AGUA 2PVJA 4BZDA 5BYLA 4O81A 3P1AA 3UOKA 2O63A 4Z3VA 3PIZA 3BWJA 3CP9A 2I7QA 5FRIA 3ROYA 3W2OA 4U0IA 4PQNA 3PSDA 2O65A 4BBMA 3E64A 2J0MB 3Q9XA 4JBQA 3WIGA 5I9YA 3C5IA 2WHBA 2Y6OA 5FD2A 1JSTA 2O8YA 3EIDA 4E6AA 5J1WA 3Q53A 2XJ1A 2OFVA 3EHAA 3R04A 4JQ7A 3D9VA 2YIWA 2ZMCA 4IZAA 4UY9A 4WNPA 1ZLTA 5EI6A 3R9DA 4D1SA 4OAVB 3V5WA 3CQWA 3GC7A 3IQ7A 3QX2A 4JVGA 4EK6A 2XK7A 2R3QA 4ID7A 5L6WL 3GBZA 1XJDA 2C0OA 2XM9A 4GCJA 4MNEA 5M4IA 4XRLA 3MA6A 4QTAA 4TZRA 4ZTQA 4MKCA 3QWJA 3S4QA 5ACBC 3VBYA 3VBWA 4DTAA 5FEQA 3FMDA 3JY9A 5B2MA 4F99A 5EHOA 2C3LA 1YHWA 4BL1A 1OL1A 3FL5A 1ZYLA 3F3WA 5EYKA 4CQEA 4J99A 3DNEA 2X2MA 2WFYA 3IONA 5EFQA 2ITNA 5D1JA 3C13A 3A99A 1ZOEA 2ZVAA 5IA0A 3UNZA 3EQDA 4EOMA 3QCYA 1J3HA 4FOBA 4RGJA 4EUUA 3Q4ZA 3CIKA 2HWPA 4LYNA 4NW5A 3S0OA 1GIIA 3E92A 3H30A 4U79A 3RPVA 4AA4A 3SG9A 4ZSJA 1OMWA 2PMIA 2UW9A 3SW4A 3ZLWA 2UZUE 3SD0A 3WOWA 4FV0A 4CFWA 4JDJA 3CC6A 4CD0A 4GK4A 2CNQA 4J8MA 2BALA 4MXCA 2BUJA 4C33A 4S34A 1YHVA 3FZSA 3WE4A 3L8XA 5M4CA 4EOIA 3KXXA 2XNNA 3DBQA 3FMMA 4C0TA 3KRRA 1UKIA 3D7ZA 2A27A 5F95A 1JKTA 3FMJA 2GSFA 3GCUA 4QYFA 3VUDA 2R5TA 4BRXA 2J7TA 3CS9A 2ZDUA 1H8FA 3LFDA 4JRNA 5KE0A 4E4LA 1YXXA 3R6XA 2ITZA 4IAFA 3KREA 4YURA 1DAWA 5IDPA 4MTAA 1UU3A 2QOCA 4K8AA 2OH4A 3B8RA 5LVOA 4AN2A 3S95A 3FMNA 4IADA 2PZRA 1YI4A 4D1ZA 4FUXA 1LUFA 2VTPA 2R7BA 4IB0A 4J97A 4JBVA 4WO5A 4ACGA 1G3NA 4J7BA 4QOXA 4CV8A 1Z5MA 4TPTA 4E5AX 3ORZA 5EDPA 4FNXA 4FKIA 3OEFX 3CKXA 1V0OA 1XH4A 3P7AA 3W8QA 4HYHA 4EUTA 4OBOA 5HE2A 4O83A 2VNYA 3E5AA 4FSMA 3R01A 3A8WA 4HGTA 4QMPA 3V51A 3F3VA 3Q9ZA 3JXWA 4MNEB 4WOVA 4HW7A 2VTLA 2BTRA 3FPQA 4YTFA 4ZZNA 3OF0A 3QHWA 2REIA 4FC0A 3DQWA 4ALVA 2JDOA 2W7XA 1SVGA 5IMEA 2E9OA 2CLXA 4NM7A 4YR8A 5M07A 4BCOA 5AR3A 4YJNA 4XMOA 3C1XA 1VYWA 4H3BA 4BZNA 2XNBA 3EWHA 5CI6A 4HPTE 4PPBA 3U4WA 1OKZA 4DHFA 5C4LA 5HI2A 1TQIA 3C50A 5A4EA 3DZQA 2BKKA 3KMWA 3G15A 4OTGA 4QMOA 4AF3A 1KE8A 4GFMA 2OXDA 3NS9A 4R3RA 3RAKA 2PSQA 4BYJA 3A2CA 2VTOA 4XV3A 4AZTA 3G9NA 4FSQA 1SVEA 3S3IA 3Q9YA 3NMUF 3COIA 3OCBA 4X7QA 5HE3A 3OC1A 4KWPA 1I44A 3MVLA 4RJ4A 4ZSEA 5TKDA 5I9WA 5HLWA 4O21A 3OS3A 4FV3A 4IJPA 3KY2A 3EYGA 3HL7A 2C6IA 1HCKA 4KB8A 1DM2A 4FNWA 5IH4A 1XBBA 4NJ3A 3W55A 2ETRA 4F4PA 4EK5A 3UVPA 2OU7A 4FGBA 1RQQA 2XYUA 4FTMA 2Z7RA 3PDTA 2RGPA 3ZXZA 4WUNA 3W10A 1SMHA 3PWYA 4LV5A 4U43A 4WNMA 4CFMA 2WTIA 5DBXA 5I0BA 2RSVA 3KQ7A 3OUNB 5L2SA 1FBNA 3FQHA 4TYEA 3ZUVA 2UW4A 4E7WA 2OJFE 1YWRA 5AADA 4TW9A 1Z57A 3WYXA 5CNOA 4JG6A 4IWOA 1OM1A 4C4EA 1OGUA 3ERKA 4RLKA 4EOLA 3QTRA 3BRBA 4J95A 3UODA 4JRVA 4CZTA 4F6WA 2FGIA 1H08A 3IOKA 3SOAA 2XH5A 3BHUA 4AT5A 4D1XA 5HBHA 1OKYA 3PUPA 3GQIA 4O0SA 4EZ3A 3LMIA 2WQEA 4ZMEA 4FK3A 3R9OA 3SVVA 5HNGA 3DXQA 5AP5A 5FBNC 1SNUA 4D5HA 5HTCA 2PU8A 1XHAA 3F6XA 4C4HA 2C6MA 3MV5A 2YISA 4BCHA 2UVXA 3PYYA 2HOGA 5E8SA 4IEBA 4O7VA 1Q99A 4L9IA 2NPQA 3RVGA 3UG2A 5LCJA 3O7LB 1OL7A 4FT7A 4QQJA 4XG9A 5HZNA 2A4LA 3HKOA 3OTUA 4E3CA 2ITPA 3BIZA 1PXKA 2QO9A 2PUNA 3RM7A 5AV4A 2PVKA 4BCMA 2HYYA 2WQBA 4GYGA 4RFYA 4O27B 5L6PA 3E7OA 3Q6WA 4L53A 4RT7A 5DHJA 4C36A 2G15A 3TUBA 4D2WA 4AZFA 5BNJA 1H27A 3HEGA 3UC3A 1UNGA 2GU8A 1R1WA 4O0TA 4MNFA 4I0SA 3ZOSA 5HD7A 2YIYA 2BRHA 3RP9A 4ZTSA 4G3GA 3F3TA 2B9FA 3LFQA 5G1XA 3QTWA 4PNIA 5CT7A 5ANDA 5AUTA 1B39A 3MFSA 2PE1A 4D2TA 4KRDA 4WSYA 4XOZA 4PTCA 3TV4A 3NUNA 3WF6A 4BDFA 4KIOA 5A6NA 5J8IA 5C27A 5DPVA 3NUXA 4U97A 5DMZA 1Y6AA 3UYTA 1P14A 3REPA 2V0DA 5JKGA 1K2PA 4EOJA 2BFYA 3NRMA 1YOLA 3ZS5A 4O7NA 2E9UA 3UIMA 4FV2A 4AT4A 4DFUA 1XQZA 2ZM3A 3HV4A 3PVBA 3QALE 3NEWA 2CN5A 4J98A 5BYZA 3BGZA 2BCJA 3RPOA 3V01A 4HVGA 2W17A 5CU6A 4FTOA 3MTFA 3ALNA 4MK0A 4YJSA 3F7ZA 3MY0A 3D5WA 4L7FA 3NVMB 1K9AA 4HNFA 4DAWA 4GVJA 2GTMA 4QMVA 4AA0A 5AUZA 4CFUA 1ND4A 2R3KA 4U7ZA 1CDKA 4U9AA 4XV2A 4U41A 3HV6A 5AV0A 2YN8A 3MJ1A 3F5GA 4DT9A 1Q24A 2QOQA 3WE8A 4PDYA 5AP0A 1H26A 4XNEA 3EJ1A 4N6YA 4CKJA 5AP1A 1GZNA 4V05A 5T3QA 4AOIA 4IDVA 4BKJA 3O50A 4BY9E 4DGNA 5DYJA 5M53A 3QHRA 5I3OA 3CQUA 1JVPP 4BCFA 2ITOA 2JDRA 2WTJA 4UWCA 5KKRB 2BAKA 4J96A 5LMKA 4PDOA 4O2ZA 1M52A 4ACCA 3FAAA 3MW1A 4QTCA 4HGSA 4IDTA 1TKIA 3C4WA 5IMXA 4EZ5A 3C4XA 3GVUA 3FMHA 1H0WA 3DA6A 3RJCA 4XG3A 4E5BA 1SM2A 5FXRA 2OJGA 2ONLC 3MTLA 4KABA 1RE8A 3V3VA 3KULB 4C37A 3QWKA 4U6RA 3V5LA 2NRYA 2C6DA 5DT0A 4FV7A 4AFJA 1HCLA 3PFQA 3H0YA 4BF2A 4NL0A 4PDPA 4JDHA 4OT6A 4XG7A 2FB8A 1SVHA 4NFMA 2B9IA 3CSVA 4CV9A 4F9YA 4H1JA 5HG7A 4MXYA 4C62A 4CRSA 5J7BA 2QODA 5HTBA 4IX4A 2X8DA 2GFSA 3Q2MA 3O51A 4KSQA 3GC0A 4G31A 1MQ4A 4D0XA 3TZ9A 4FKUA 2OGVA 3FKLA 3BI6A 2WPAA 1MRYA 2XNMA 4NTTA 3WIKA 4K33A 4F63A 4YO6A 1PRYA 4DFBA 3L8SA 2P33A 4FV9A 4JDIA 3FI8A 4FYNA 4R5SA 1GIJA 2ACXA 2GNJA 5CEOA 5AFVA 3VBXA 3LHJA 3QX4A 4RJ6A 2C1AA 2WNTA 3AT3A 3NSZA 4NWMA 5HX6A 1R3CA 3Q5ZA 4QYEA 1VJYA 3E93A 2JGZA 2OIBA 2NP8A 4F64A 3OMVA 5JN2A 2ZM4A 3AQVA 4ZJJA 2QQ7A 3BGPA 4GKIA 3BYMA 4BCIA 5D9HA 4G6NA 4O1OA 3UPXA 4FL3A 5GJGA 3F3ZA 3PPJA 4G16A 4L6QA 4RVMA 4I5CA 3E3PA 4N6ZA 1W0XC 2VTRA 3HDNA 3QKLA 1ZYDA 5BVOA 3QGYA 3VHEA 2HW7A 3UIXA 1K3AA 3HGKA 3HRBA 4OBQA 1BKXA 3UE4A 4FSRA 3DK7A 4E73A 5K0XA 4FICA 1YWVA 2OXXA 2UW8A 1P4FA 3H9RA 4H39A 4IVBA 3BU6A 1PXPA 3ZO1A 5HO6A 3QD4A 2FA2A 4OUCA 4QMQA 3E3BX 3A4OX 3UOLA 4W4VA 2G2FA 1QCFA 4BICA 5KUPA 3DAKA 3FE3A 3MB7A 4KS8A 4GFOA 2IW9A 3A7GA 3AT2A 2XVDA 2BZIB 2JITA 4DG3E 4KIKA 3ZRKA 4I6BA 3RPRA 3UNJA 3T3VA 3EQHA 4GL9A 5ANJA 3VS2A 2FSTX 4FKTA 3NW6A 4QYHA 4USDA 4IFGA 2W0JA 2V5QA 4PDSA 3QLFA 2WMUA 3HA6A 4A7CA 2ZYBA 3NLBA 4EH5A 1WMKA 3R9RA 1YI6A 2UW0A 4B4LA 3PJ8A 5I9XA 1JSUA 4V0GA 3KXNA 2YERA 1OL2A 3LXNA 4ITJA 4MAOA 2XUUA 2IG7A 4W8EA 3HV3A 2QR8A 3KRJA 5I5ZA 5FQDC 3R21A 4LRKA 5FDXA 3UZPA 3DPKA 4IB3A 4ZSAA 5DEWA 2PMOX 2VGOA 4QP9A 2VWVA 2XNPA 3FSFA 5TR6A 3SW7A 1OIQA 3VS3A 4EQCA 4KBKA 5FLFA 4CZUA 4XP2A 3HX4A 3R7OA 3OBJA 4Z16A 1PXJA 5HCXA 4B8MA 5CAOA 3L9MA 5JFSA 5FM2A 5HNBA 1J7IA 1WBTA 2OZAB 4PPAA 4WG4A 2PVHA 5A4TA 5D11A 5DR6A 4Y95A 3W32A 5LMBA 2VWBA 3MFTA 3MH2A 3ORLA 4KSPA 4M7IA 3H9OA 4ZZOA 4YJUA 5IDNA 2XJ0A 4QYGA 5GZ8A 4DGOA 1FPUA 4L3JA 2QOOA 3R7IA 1WAKA 2G2HA 4EQUA 4II5A 1VZOA 4F7JA 4XRJA 3RK7A 3DJ5A 4QO9A 3MPTA 3R2BA 3WARA 2OK1A 3ZXTA 5AM7A 3MVMA 4O38A 3ATTA 2IZUA 4GEOA 2R3JA 4GUEA 3RPYA 2C6TA 3GP0A 3ULIA 4F1OA 4ANLA 5CALA 4WHZA 5D10A 5F94A 3HMOA 2PUIA 1H1SA 5HLPA 3EFKA 4I4EA 2C6KA 3OW3A 3FYKX 2GNHA 4I1ZA 3CPCA 2Q83A 3DB8A 3UPZA 2WEVA 4L8MA 4WG5A 3OXTA 3F9NA 1Q3WA 5K9IA 2JAVA 3N51A 5EYMA 3VVHA 2PE0A 4W8DA 4KIKB 3DXNA 5FGKA 3O2MA 1PYEA 2BAJA 2CKPA 3PXQA 2I40A 2X6EA 4P2KA 4RZWA 4YC3A 2VN9A 4YLLA 4CEGA 4HCTA 3TNIA 4NZWB 1JWHA 3BZ3A 3E62A 4H36A 4C57A 1KV1A 3FC1X 5DA3A 3V8WA 3W1FA 4GT3A 4O6LA 2NRUA 5FEDA 5JFWA 1IR3A 3KMMA 4YHTA 5HORA 2B54A 3ZYAA 3FI4A 4YJVA 4ONAA 3ZRLA 4DC2A 3Q96A 4R78A 1V1KA 1WBVA 4CYJA 5IEXA 2J0LA 4FSUA 4M84A 4KIQA 4MYGA 4ZS0A 4XHKB 3IW5A 3NZ0A 5FDPA 3GUBA 2BRGA 2VRXA 2RF9A 3KF7A 5LMAA 3ZZEA 5I3RA 5CU2A 4ZTHA 4USEA 5HQ0A 2XK4A 4S33A 4UMUA 3RNYA 3DBFA 3IK3A 3FV8A 4NUSA 2G9XA 2RFDA 2XNOA 4IWQA 3JVRA 4ZJIA 4G6OA 4FKRA 4CCUA 5IZFA 3U9NA 4JX3A 2XIYA 3PA4A 3QFVA 3FLQA 2F2CB 2WXVA 4HGLA 5CI7A 3NUAA 3AMBA 3OEZA 4C4FA 3EOCA 3NCZA 2UV2A 4IVAA 5ACKA 1E1VA 3QRJA 1P4OA 2VO3A 3PPKA 4P7EA 3CKWA 5L3AA 4EQMA 5M57A 4J52A 2Y4PA 4DF3A 4TYHA 4FTLA 2WTKB 3PVUA 4CCBA 1J91A 4RJ3A 2C5OA 1F5QA 3VIDA 5FUTA 1PXMA 4AOTA 4DBXA 3GGFA 3MIYA 3V8SA 4ZSGA 4WNOA 4CNHA 4DEIA 3UMWA 1PJKA 4FKGA 5BVWA 4IZYA 4RQKA 4C2VA 4FKWA 4EBWA 5IUGA 4EJ7A 1ZYJA 3CJFA 3KXHA 4I4FA 5DG5A 3V6RA 2DS1A 3V8TA 2WIPA 4F0GA 3DJ7A 3LFNA 1ZYCA 3IGGA 2Q0BA 1WFCA 3O8UA 4KIPA 3NAYA 3R0TA 2IJMA 3N9XA 2PVYA 2VTTA 2GNFA 3CQEA 5HE1A 2X0GA 4IB1A 3VS7A 4YHJA 5EW8A 2PE2A 2GQRA 1SZMA 3LOKA 4LMUA 5HO7A 3ORKA 5LARA 3LPBA 5JMSA 3BV2A 4TYJA 4EOQA 3ACJA 4USFA 5JFXA 3WZKA 4UYNA 3CBLA 1ZMWA 1U4DA 3FKNA 3PSBA 4FT5A 4I6FA 2EXEA 2Y9QA 3FLNC 2XK6A 2Z02A 3ZSHA 4GVAA 4XYFA 4Q5EA 3AD5A 5EM8A 5A14A 5KMJA 5CY3A 4DFLA 3PP0A 4C02A 4IIRA 4ANSA 4EH7A 4FV4A 3I0QA 4XG4A 2EB3A 4IWDA 4WT6A 4F9BA 4YTCA 5KMLA 5J79A 2PYWA 2W9FB 1OIYA 2W1FA 2R3RA 2BDJA 2X2LA 4OBPA 5HIEA 3FHRA 4IM0A 4RWLA 5BPYA 2YZLA 5DN3A 3I79A 2R7IA 2CSNA 3TM0A 4JIKA 4ZTNA 3ZONA 3FL4A 3LQ8A 4XEYA 4F1MA 3GFEA 4G3FA 3QD0A 2B9HA 3DJ6A 3AOXA 3G0EA 2VAGA 5IEVA 1OPKA 3EN4A 2AYPA 2PTKA 3LIJA 2Q0NA 3PXFA 4M14A 3VQUA 5A4LA 5IQDA 2QOBA 4O7LA 4U5JA 3EH9A 4QMTA 1WVWA 2R3FA 5BMSA 1O6LA 4M8TA 1P2AA 4ERKA 3VN9A 3FSKA 3HA8A 4TWCA 4FODA 3BPRA 5DE2A 1UU9A 1FGIA 4DE4A 4TYHB 2BHEA 3FZ1A 3P7CA 4FTKA 2YIRA 1UNHA 4I21A 2PY3A 1B6CB 5AX9A 3OOMA 4FTUA 2CGWA 3ZUUA 1CTPE 2YLEA 3ANQA 3NGAA 4IFCA 4RA5A 5KHXA 4G17A 1UKHA 2BVAA 3DAJA 3R7GA 3RZFA 4BWXA 4DG2E 4OTRA 1UWHA 2P2IA 4UMRA 2RL5A 4WRGA 4FV8A 1IG1A 2ERZE 4YC8A 3ULZA 4O7TA 3NPCA 3BHVA 2YDKA 3COMA 4XG8A 2ETMA 4FSNA 4G2FA 3KXGA 3AG9A 2WMTA 3V5PA 3VUTA 3WILA 3B8QA 3GENA 3DDQA 4RLLA 3N4TA 1Q5KA 3WYYA 5C26A 3MY5A 3R71A 3GU5A 3E63A 3HRFA 3EFJA 4FL1A 4QNAA 2C6LA 3FWQA 4M69B 3DGKA 1OKVA 3ACKA 3MSSA 2Y6MA 3SKCA 2C47A 3ZM9A 3DT1A 5ANIA 5CF4A 4XBRA 2W4JA 3QUEA 2RG6A 1CKPA 2PZIA 3ZLSA 2QU5A 4C58A 3MB6A 4BCNA 4DEBA 2RFNA 4NT4A 4EL9A 4QNYA 4AAAA 3FZRA 3DBCA 4ZY6A 4DEAA 5KKRC 4ZJVA 5IA4A 3UOHA 3I6WA 4FG8A 1OPLA 2C0IA 1MP8A 2PZPA 4FEXA 4WSQA 3GOKA 3DKOA 5JZJA 2XKCA 3GT8A 2R2PA 4YBKA 3E87A 4ARKA 2V7AA 3F66A 3IDCA 4YNOA 4EH6A 3ZFMA 2JIIA 3R28A 4X3FB 4YPDA 3F88A 4XS2A 1YDTE 3VUMA 2YCSA 4BIDA 3TUDA 4AN9A 4YZCA 5AV3A 3RAHA 3F61A 1GAGA 5E90A 2R3GA 4FNYA 4FIIA 5TT7A 3P78A 1Q61A 4G6LA 4BGHA 2HIWA 2PK9A 1WBNA 3OWKA 2KULA 3VF8A 1LR4A 4APCA 4R3CA 4O84A 3THBA 1KWPA 4DGMA 3Q4TA 2VTAA 4C4GA 4QP8A 4BWKA 3LW0A 4CFXA 2X7OA 4C3RA 3GEQA 1OIUA 4U40A 1ZAOA 2FSMX 3UIUA 1HOWA 3ID6C 3ZFXA 4LFIA 4O0WA 3EN5A 4L7SA 4I93A 2YAAA 4E93A 4JX7A 3ORIA 2C0TA 2ZMDA 2WB8A 2VTHA 2PPQA 3ZFYA 4DINA 4PPCA 1ZARA 1OZ1A 2C5YA 3PRIA 4PP9A 3MFRA 2OJJA 2VO7A 4HZRA 5AR2A 4IAIA 3LCOA 3QCSA 4FUYA 3Q4UA 1XWSA 2GPHA 2P2HA 5EQYA 3W2QA 2G1TA 2RG5A 2R0IA 2JIVA 5JQ8A 4X2FA 2VNWA 4XP0A 3PXYA 4O82A 3OROA 3R30A 2G01A 1BI8A 2ITUA 5IQBA 1BYGA 1YVJA 5A3XA 5JEBA 1BX6A 3PZHA 4KRCA 4UEUA 2IW8A 4BTMA 5HE0A 1A48A 4LI5A 4FSZA 4RJ5A 3TIYA 3QQHA 2X39A 5H8BA 4QP4A 5LMKC 3LFBA 4C35A 3ZSGA 1NXKA 4DTBA 4O0RA 3AXWA 1H1WA 5AP6A 3LLAA 1L3RE 2XP2A 3HMPA 1TVOA 1IRKA 2X2KA 4FT0A 4KINA 2R3MA 4TKSA 5K5XA 4DT8A 3Q52A 3QCQA 3VJNA 4ITHA 3QD2B 4WA9A 5E91A 3VRYA 3LKMA 5AP2A 4CG8A 2JDSA 4YZMA 2JFMA 4JS8A 3QU0A 4K77A 1H4LA 3EQBA 4MBIA 4EH2A 2B0QA 4C59A 3GCPA 1DI9A 2CDZA 1R0PA 2PZ5A 4J8NA 3FPMA 3GCSA 4K9YA 4M68A 3UZRA 4E1ZA 5E1EA 4X6RA 4C3PA 4I22A 2ITVA 4KS7A 3VBVA 4DEGA 4EC8A 4S2ZA 3ZLXA 5AMNA 4UX9A 5E1SA 3D83A 2WMWA 5AWMA 4WKQA 4CFNA 4L3PA 1T46A 4DFXE 3LQ5A 4XG2A 3BLRA 4XG6A 4YUQA 3EKNA 2XK8A 3Q9WA 4I0RA 5E8TA 3RPSA 5EYDA 4PL3A 2C3IB 4F9AA 5AA9A 4FKJA 1PKGA 3GU7A 1QMZA 1UWJA 5AUXA 5CSWA 2BKZA 2YZAA 5E9EA 4AW0A 3LJ1A 3TKIA 5EW3A 3UIBA 1DS5A 3RTPA 1Q8ZA 3Q3BA 1REKA 1X8BA 3FMLA 3HECA 1YXUA 4FZ7A 4IMYA 4YLKA 1M14A 4JJRA 5KBQA 4AE9A 4ASEA 3QQJA 1XO2B 3OT8A 3QZIA 2XMYA 4KAOA 4L67A 3SG8A 4MCVA 2UZBA 3KB7A 5EK7A 3SRVB 2F2UA 2H8HA 3OWJA 3PJCA 1H28A 5BMMA 4EWHA 4R77A 5GINE 2BRNA 4B8LA 2W06A 3SXRA 1FVTA 1YWNA 3EMGA 3P7BA 2CJMA 5ICPA 3ZO3A 3PWDA 3OOGA 4JL9A 3QRIA 4IM3A 4RC3A 4BDAA 5BUIA 2PULA 1NT2A 1H07A 2QCSA 3UC4A 3BEAA 4EK8A 2XZSA 4U81A 2JDVA 4R7HA 3V04A 3FBVA 4U3ZA 4GW8A 4YJRA 2DUVA 3UOJA 2BILB 1YXVA 2WOTA 2X7GA 5HHWA 3ZZWA 2WQOA 4B6LA 3ZEPA 1MRVA 3FLSA 3BWFA 4E6DA 4ZXTA 1JBPE 3KL8A 5LJJA 3PLAE 4RVKA 4JT3A 3C9WA 3HDMA 3A4PA 3L8VA 1FQ1B 4NM3A 3SOCA 2YCFA 2C6OA 3ZU7A 3QLGA 1QPEA 4PF4A 3WF8A 3KXZA 2WTDA 4O0YA 4BDCA 1OUKA 4YLJA 3O17A 4M67A 5HESA 4BIEA 4ZY5A 4WG3A 2ITXA 3UO6A 3TNPC 4ZAUA 3UMXA 2YDIA 3ZHPC 2ESMA 4RWKA 3KCKA 2E9VA 3TDWA 3EN7A 5L4QA 5EM5A 3BHHA 2LGCA 2P55A 4WRSA 3AC8A 2HXLA 5ANEA 5AUWA 3LXKA 3PIYA 3SC1A 2R3PA 3EYHA 5CEMA 3DBEA 1OKWA 1Q8TA 1GZOA 3KN6A 4I41A 4AOJA 3KA0A 3FUPA 1ZXEA 3SLSA 3KEXA 2AC5A 4FT3A 4B0GA 5J87A 4CMTA 4I6QA 4O0XA 4FSYA 3ENHA 2NNWB 2P0CA 4FVQA 3KULA 2VO0A 2X8IA 2ZB0A 4BCGA 2Y4IC 2EUFB 4JBOA 3ATSA 2XEYA 2J0IA 1QPDA 4A9TA 2IWIA 4UB7A 4MXOA 4ORKA 4X2NA 2ERKA 5GNKA 4DH5A 3TEIA 4EEVA 3FMKA 3OCTA 2JAMA 2O64A 3Q32A 4IX5A 1XBCA 2WMBA 3QUDA 3Q5IA 4XV1A 3AC3A 4EKKA 4RX7A 3IPHA 4FK6A 4Y8DA 3BEGA 5IH5A 3KXMA 4PL5A 3UP7A 4YJPA 2HZNA 4HYSA 3SXSA 1VYZA 3QKMA 4M0ZA 3EQCA 3ZSIA 4HVHA 3AMYA 3UQFA 3BYUA 3OCSA 3EQPA 4QMYA 4E6QA 5J9YA 1JQHA 4J53A 2W5AA 5FP5A 5IH6A 5K0KA 3C5UA 4EORA 4TWNA 2YM4A 3FY2A 3NNVA 4NCTA 3I5ZA 4AX8A 3LXPA 4ZP5A 4AU8A 4CMOA 5HX8A 4GT4A 4IXPA 2VTIA 3ZUTA 3BLQA 3HZTA 4CFFA 1PKDA 4D2PA
chains in the Genus database with same CATH superfamily
4FIJA 5LVPA 3OVVA 4RIOA 1SNXA 2AUHA 4F1TA 3DFAA 4O22A 5ETAA 4IAYA 3ZH8A 4AQKA 3LAUA 1M2PA 3NYXA 3AC1A 5JRSA 5L8JA 3TJDA 5DGZA 3IW4A 4PMTA 4S31A 3EN9A 3HMIA 4D55A 3M11A 5DH3A 5DLSA 1YDSE 4D4VA 1AD5A 1OVEA 2OKRA 2V22A 2CCIA 3QA8A 1S9IA 2JC6A 3PP1A 2BIYA 3R8MA 3KCFA 3DB6A 2H6DA 2R9SA 4R1YA 3N4UA 3UG1A 3DK3A 2R0UA 4EWQA 4LRMA 4QQ5A 5IQGA 2XNEA 3PA5A 4BI2A 5JT2A 3QAME 2J6MA 4BDJA 3H3CA 4PTGA 3ORNA 5HCYA 4E4NA 3OY3A 2HZ0A 1G8SA 2WMAA 3KRXA 3QXPA 2A2AA 2X9FA 3NDMA 4PMSA 3ODYX 3RHXA 4UN0C 4ZLOA 4ZY4A 5IA2A 4TYIA 2CPKE 2BAQA 1EH4A 4YGAA 4BCQA 3ENMA 1BMKA 4DH1A 2J4ZA 4YTIA 5CAUA 4D5KA 3TACA 2IZTA 3FZPA 4FZDB 4FIHA 1XKKA 4H58A 3S2PA 4BWPA 4QDEA 1KOAA 5J1VA 3D2IA 2XS0A 2VWZA 1FINA 3EFLA 3JYAA 4F08A 2EWAA 2ZJWA 3BQRA 5J7HA 3LCKA 4GJ2A 4C4IA 1P5EA 4FA2A 4MQ1A 4BGGA 3DK6A 3U8WA 2ETKA 2XYNA 3L9PA 4QTEA 3MIAA 3QRKA 2C6EA 2H9VA 4ERWA 4NFNA 1PXOA 4QMMA 3KGAA 2C1BA 3RHKA 4ANMA 2PMLX 5L2QA 3T3UA 1A9UA 4O0UA 4BTKA 5HKMA 5AAGA 3BBWA 4FL2A 4HPUE 2J90A 4F7NA 2VGPA 2OZAA 3UJGA 1XH8A 2Z7LA 1FMKA 4FX3A 2VO6A 1DAYA 5HOAA 3PLSA 4FKOA 3I60A 2C69A 4IB5A 3TZ8A 3WF5A 4E8AA 4Z55A 2HENA 3FMEA 3W18A 2HZIA 1V0PA 3ZDIA 1MUOA 4EYJA 1U54A 4A9YA 3UYSA 2PWLA 2XM8A 1Q8WA 2I0VA 4FZFB 4UZHA 3OZ6A 3AD4A 4YHFA 5I9ZA 3KC3A 4D9TA 3TZMA 5E8WA 1YHSA 2XAMA 3TL8A 5HEZA 5D7AA 4IC8A 4DEDA 4DN5A 4BKZA 4X2JA 1PXIA 2PVRA 4P5QA 1J7UA 2W1DA 2UZNA 4LM5A 4HVSA 3NW5A 3RCJA 2WZJA 5JQ5A 2YA9A 3LFEA 3FI3A 5KCVA 4DLJA 2W1HA 3TTJA 1FOTA 4PY1A 2OICA 4CYIA 1TFFA 2XIRA 4MHAA 1Z9XA 1YI3A 3POZA 1AQ1A 4JG7A 3SDJA 3U55A 1W2CA 2CGXA 3GQLA 3QQKA 4TRLA 4AZSA 4AS0A 5L2WA 4BVUA 1URWA 3C4FA 2BROA 5L2IA 4I5MA 3KN5A 1GIHA 4Y72A 5TE0A 4D4RA 5JH6A 4DFNA 1YOJA 3FI2A 3U6HA 5C03A 2O2UA 2CMWA 5CWZA 1KE7A 2QKRA 2IVUA 3P4KA 5L6OA 2WAJA 3L8PA 1ZMVA 4L01A 1TQPA 2QC6A 5KX8A 3RINA 5ANKA 1ZZLA 4I92A 4KKEA 4ZSLA 4YNEA 4C34A 3LMHA 4BDEA 2QOHA 4YJTA 4XUFA 2IPXA 4WBOA 1M17A 5B2LA 3P79A 2QU6A 3A62A 3PVGA 1REJA 1W2FA 3VBQA 1IAJA 4BCJA 4QPSA 2WO6A 1GJOA 4YSJA 4U44A 1LP4A 3WZJA 2E9NA 2YWPA 4NM0A 2FYSA 2ZM1A 4I6HA 4Q5HA 4AXAA 5AAEA 4ZOGA 4BGQA 1URCA 3VBTA 5GIPE 3DAEA 2J50A 4FKSA 2GQGA 1Q8UA 4OTQA 1KE6A 3GCVA 5AP3A 2R4BA 3FJQE 1NW1A 2H96A 4IVCA 4XBUA 4ACHA 3D5XA 3QQUA 3QTZA 4I0TA 5M4UA 3FXWA 5DR2A 5JZNA 4DA5A 3KU2A 5TO8A 3D7TA 1U54B 2J2IB 3SXFA 4AUAA 5GIOE 4OAUC 1KSWA 1MRUA 2OI4X 1UA2A 3DQXA 5G6VA 1R0EA 1FVVA 1VR2A 1CKJA 4TNBA 4YZDA 3PG1A 3V5QA 3EB0A 3WI6A 4BN1A 1Y91A 4C61A 4D9UA 1ST0A 4AXDA 3G6GA 4O91A 3P0MA 1PMNA 3WZUA 2HZ4A 1GZKA 3IW8A 3MH1A 4TT7A 5M08A 2RKUA 3RI1A 4EOPA 4EOKA 5HG8A 5FTGA 1W98A 3BU5A 4MXXA 2WGJA 5IA1A 5JFVA 3OW4A 2CKEA 4HCUA 5KZIA 3KVWA 5AUVA 4DHIB 5LOHA 2ITYA 3GU4A 4GKHA 2IVTA 3DKFA 4G3DA 4G34A 1W84A 2C5XA 5M09A 1WBPA 2QO7A 4FSTA 3PJ2A 2IO6A 4RIYB 3IOPA 5CSHA 2BZHB 4EZ7A 4B7TA 4RG0A 1JNKA 2CCHA 3CY3A 5JGAA 1FGKA 2BMCA 3S1HA 3OCGA 5EW9A 3FLWA 1UU7A 3DDPA 4A9UA 3WZEA 4A06A 5HICA 4H1MA 4DTKA 3CLYA 4YU2A 2VD5A 3OTVA 4UWYA 4GSBA 4MF1A 4FKLA 1KE9A 3F2NA 2VU3A 4O86A 4X0MA 3MPAA 5E8UA 1B38A 4MD8E 3VAPA 5HBEA 2OZOA 3HV7A 1U5QA 4JR7A 4BHZA 4ZIMA 3HLLA 2WTCA 5BVKA 3FQEA 3MVJA 4AWIA 4AAYA 1U59A 2H34A 3I7BA 4M97A 4CT1A 3PA3A 4BDKA 4W9WA 4K2RA 2JD5A 2WEIA 3FDNA 5E4HA 3TV7A 4OTIA 1XBAA 3C7QA 4NW6A 4E26A 4RX9A 2LAVA 3O8PA 4QTBA 4RIWB 4XP3A 2HW6A 5A9UA 2WU6A 2WMSA 4YO4A 2YM7A 4NU1A 2QONA 3O96A 5EI8A 4EK4A 3WF9A 1GZ8A 1Q62A 1PMUA 2XNGA 2CKOA 2OLCA 4UXQA 1ERKA 2BHHA 3COKA 3G51A 3LFFA 3D7TB 2O5KA 4JNWA 3MESA 5IA5A 1PXLA 1GOLA 2YM8A 5LVLA 2UUEA 3B2WA 3POOA 4RX8A 3DKCA 3ZLYA 4M12A 3PTGA 5LCKA 4BI0A 4PUZA 1JPAA 2GNGA 4U42A 2UW3A 5FTQA 4CLIA 3DFCB 3SX9A 4A9SA 4OTPA 4WNKA 4FG9A 1YRPA 3QA0A 3KK8A 4HZSA 5H3QA 3VHKA 4CGAA 3ODZX 3L1SA 4BBFA 3R1YA 5AA8A 3OXIA 3MYGA 5AR5A 3MN3A 4E5WA 1FMOE 2RFSA 3IS5A 3QTSA 3LCTA 3GOPA 4ITIA 2OF2A 2QG5A 2XIZA 3RBWA 4YTHA 4RJ7A 3VNTA 3PY0A 4OT5A 3GNIB 4O7RA 2WU7A 4GU9A 2OO8X 3OD6X 2XIKA 3LZBA 2B4SB 3EQIA 1YXSA 3DU8A 4UBAA 4M69A 4PTEA 4FEWA 4N57A 4PV0A 2P3GX 2BZKB 4IQ6A 3O23A 4WIHA 5EDRA 4TXCA 3PXKA 2B53A 5ETFA 2W5HA 4Z7GA 4FEUA 3QYWA 4RFZA 2J9MA 4H3PA 4TN6A 3HMNA 4FOCA 2EXCX 3IG7A 1S9JA 3PE1A 3ZMMA 1UVRA 2XF0A 1JKSA 3SV0A 4X2KA 1Q41A 3QCXA 3BE9A 2PHKA 3E8DA 2FUMA 4ZS4A 5DVRA 4PRJA 3CTQA 5M4FA 5F20A 3T8OA 3V5TA 2HY81 2QHNA 1Y8YA 3OUKA 3VF9A 3RWQA 2WMVA 3C4EA 2NO3A 4TL0A 2QOKA 3IKAA 2IW6A 3A7IA 5BUEA 5HG9A 4X6QC 4ANNA 4AG8A 3JS2A 3CY2A 2B55A 1KV2A 2O3PA 4FT9A 4HGEA 4Y85A 5CXHA 4BZOA 3UQCA 4X3FA 3W2CA 2YM3A 4FNZA 4AACA 3QRTA 4M3QA 3ML1A 2QURA 4MQ2A 4MXZA 4IX3A 4AZEA 4AT3A 3QUPA 4HJOA 3G6HA 4YZBA 4W4XA 1H25A 1H0VA 3GCQA 4DGGA 4AXEA 3F2RA 4CRLA 4FTIA 5KO1A 4QP1A 2JDTA 3MS9A 5D12A 3R9HA 4FV1A 4EH9A 3TDVA 5A4QA 1MQBA 4AGCA 3RWPA 2BFXA 4ZTMA 1Y6BA 4L42A 5CVFA 3T9IA 4QYYA 1ZY5A 3FXXA 3AT4A 3Q6UA 3QTUA 5FP6A 2B7AA 3I6UA 3TWJA 2XKEA 3PVWA 1UNLA 5IQFA 4M13A 1E1XA 4QPMA 5KBRA 3M2WA 4H3QA 4C3FA 2JBPA 2BRBA 5AEPA 2IF8A 3BKBA 5A4CA 4P90A 5B0XA 5CU0A 1XH6A 3DCVA 4ANBA 5CSPA 2CNUA 3NVKI 3Q60A 4LL5A 2OJIA 2YM6A 3BHTA 4UMTA 5FM3A 2VTSA 2I6LA 4BFMA 1LEZA 3C0IA 1QPCA 3IW6A 4CZYB 1PXNA 2F4JA 3UP2A 3CXWA 1CKIA 2X0PA 5BVFA 4FGRA 2JLDA 4KBAA 4QMLA 5HU9A 4ALWA 2QKWB 5CANA 5EOBA 5DNRA 1GNGA 4R1VA 1I09A 1JSVA 2FH9A 3C0GA 2ZB1A 3NIZA 4MX9A 4RQVA 3UTOA 3KVXA 3R8ZA 3FEGA 3RAIA 4C4JA 3HUBA 2YJRA 4EC9A 3C4CA 1NVRA 2XB7A 1M7NA 2JKKA 1IAHA 5L8LA 4Y83A 2GS2A 3KK9A 3GB2A 4L52A 5AP7A 1M2QA 5GZ9A 2PUUA 4KKHA 3QKKA 5CVGA 2BDWA 4F09A 4CLJA 4NKSA 3GC9A 3FXZA 4TNDA 5CEPA 5GZAA 5JRQA 5K3YA 4B9DA 4O4EA 4FMQA 2I0HA 5HG5A 3NUPA 3E8EA 1KE5A 3HUCA 3DV3A 3ELJA 4O4DA 4IW0A 3AD6A 4QDVA 1OECA 3LVPA 5BQ0A 2CKQA 5HD4A 4GS6A 3HAMA 4K1BA 4K11A 4K18A 4ZTLA 2AEGA 4MUQA 4G9RA 4O4BB 5CZIA 1A06A 2EVAA 3R02A 4OTDA 4ASDA 3ORTA 2R3OA 4QMXA 5HIBA 2YABA 2WQNA 4J1RA 2YITA 4FKVA 4RIXB 1OBDA 4IX6A 3UVQA 4IANA 4F70A 3A61A 4RRVA 4RBLA 3UO5A 2HCKA 4PWNA 4AXFA 1UU8A 5B2KA 2C5NA 3V6SA 2VWWA 4AXCA 5E8VA 4F78A 3ZEWA 5HNIX 3PE2A 2KTYA 4FKPA 3DTWA 3AC2A 1GY3A 3MVHA 4MH7A 3G90X 3LFCA 4XOYA 4A07A 4DEHA 3C4ZA 3CD8A 4LG4A 4X21A 3EFWA 4EH3A 4NIFA 1W8CA 2Z7QA 3RKBA 4BC6A 3O0GA 3VQHA 4F9CA 5CAQA 4IAZA 5EQPA 5M56A 3K2LA 2J0JA 2P4IA 5EYCA 5BVEA 4NCTC 3WBLA 3GC8A 4BI1A 4E20A 5FXSA 3KF4A 3SRVA 2RFEA 2XJ2A 4IC7A 2GHLA 3OBGA 3QZFA 2R3LA 3LM5A 4LUDA 3RGFA 4XLVA 4O7WA 1F0QA 4BCPA 2QI8A 3HV5A 4FE2A 3F5XA 4XCUA 1ATPE 3B2TA 3ET7A 3GFWA 3JY0A 3ZDUA 3R7EA 3TJCA 3LMGA 3DZOA 3LFAA 1Q4LA 1Q8YA 4CXAA 1W83A 4NEUA 3NNXA 4AW5A 2OWBA 4LOPA 4DITA 4F65A 4IAKA 4V04A 4F6UA 4HVIA 3ALOA 5BX0A 4BR3A 3ORMA 3CGFA 3F7WA 4V01A 5C1QB 3M42A 4JQ8A 3BYVA 4EH4A 3F5PA 2YEXA 3O8TA 3LCSA 2W4KA 3NYOA 2GTNA 4YP8A 3WZDA 5CF8A 2F49A 5CZHA 1OITA 2SRCA 3EZRA 3VWAA 1H01A 4N0SA 3AGLA 3VJOA 2V7OA 5C4KA 2UW6A 4UALA 5CQUA 4D2SA 3RALA 2A98A 4ENXA 4JQEA 4OTHA 4S32A 3RK9A 5A46A 4PNKA 2HY0A 2YJSA 3QGWA 4O7ZA 2YACA 3CR0A 4K0YA 1PYXA 3FHIA 3EQFA 5IUIA 4IACA 2YCRA 3MDYA 2HELA 4N70A 5AV2A 1CMKE 3ANRA 4JI9A 5CEKA 5KMMA 5FTOA 1PF8A 4TTHB 3VUIA 3ZM4A 1U46A 2JEDA 1NY3A 2QHMA 3BX5A 2ZV9A 2X81A 3GU8A 3OP5A 3OT3A 4PL4A 3I1AA 4L00A 4RVTA 4YZ9A 4OR5A 1PHKA 4O1PA 1XH7A 1KUTA 3ZO2A 3BCEA 4OGRA 5JGBA 1O6KA 5M51A 5CNNA 5ANOA 2V55A 4R8QA 2I0EA 2UW7A 3EQGA 4TWPA 4FEQA 5AP4A 2DWBA 4YZNA 5EM6A 5F9EA 4J71A 3CPBA 3HAVA 1Q3DA 3E8NA 3FYJX 3KFAA 4NIFB 5FXQA 4MWHA 4AGWA 2F7EE 3MPMA 3W2PA 4FEVA 3F82A 4QQCA 3BHYA 3W8LA 2JKMA 2PUPA 3TCPA 4FVPA 4E4MA 4TY1A 3RMFA 4QP3A 3R73A 2GFCA 1ZOHA 3JVSA 3IECA 3PIXA 2BTSA 4O7YA 1SYKA 3R8LA 4HCVA 4DDIA 2AC3A 3D94A 4DYMA 4NM5A 3NIEA 4C2WA 3BBTB 1WBSA 2JKOA 4LGHA 5AJQA 3O7LD 1BUHA 2XBJA 5AM6A 3R22A 2R3HA 3EL8A 3SHEA 2XCHA 4BDDA 1OB3A 3OG7A 4QMNA 4I23A 2Y7JA 1OUYA 4EOOA 2ZV7A 4Z7HA 4U8ZA 3I5NA 3FLYA 3ZO4A 1YQJA 3D2KA 4I94A 5FEEA 3BGQA 2UZTA 5C01A 2W1ZA 5F4NA 4DH7A 1J1CA 5EDQA 1FVRA 3NX8A 2ITTA 3QD3A 3VRZA 2W05A 2QLUA 4LOQA 3PG3A 5HO8A 4F0IA 1OBGA 5CSXA 2YDJA 2G2IA 2WTVA 2OSCA 2CGVA 1H1RA 3NCGA 4GFGA 3RK5A 5BYYA 5M44A 3EL7A 5HIDA 2YWVA 2OG8A 3Q04A 5DR9A 3DKGA 2ZV8A 4UWBA 5D7VA 5IUHA 2GMXA 5GHVA 3UNKA 3VS6A 4X3JA 4BDIA 2I0YA 2ZAZA 1ZY4A 2QOFA 2F57A 4P4CA 3IDBA 4RMZA 2YFXA 4FI1A 4JG8A 4XLIA 3F3UA 3OHTA 3LM0A 4OTFA 4QRCA 4EHVA 3LCDA 1STCE 3BL7A 3BYOA 2GHGA 4S30A 1ZYSA 3VO3A 2WQMA 3VUGA 2X6DA 2EU9A 1XH5A 4GU6A 1M2RA 2W9ZB 1VLRA 3E7VA 4HNIA 4FTJA 3IO7A 4BCKA 4MWIA 5JGDA 4XV9A 4QP6A 1NA7A 1TQMA 4LMNA 1WCCA 4AN3A 4LL0A 5FBOA 1O9UA 4G5PA 4M66A 4G1WA 4Y5QA 5AR4A 3SQQA 3W33A 2UW5A 3V5JA 4GMYA 4C38A 4E4XA 1BL7A 5IG1A 5EOLA 2C3KA 2XRWA 5C8MA 4PMPA 4FKQA 3MBLA 4A4OA 5K4JA 3DXPA 4FZAB 5HTIA 2UVYA 5IQCA 5C9CA 4NH1A 4D0WA 3TT0A 2UZLA 3MI9A 4FIEA 1ZRZA 2BIKB 4UXLA 1OL5A 4KKGA 4UV0A 4AA5A 4EHGA 5CAVA 4GH2A 5CU3A 2WTKC 3UGCA 4FTRA 1QL6A 2B52A 4KNBA 5AR7A 3ZTXA 3NUSA 4D2VA 4W4WA 1WBWA 2YCQA 3FZOA 4CTCA 4BDGA 3H10A 4X2GA 3QZGA 5CTPA 2JFLA 4D4YA 2PZYA 3D4QA 2E2BA 3CEKA 4I5HA 3TKUA 3WF7A 3N4VA 5H2UA 4PX6A 4CTBA 5DT3A 4BTJA 5IU2A 2IZRA 3KRLA 5ETIA 3P9JA 3EKKA 1W7HA 3QTXA 2EXMA 4JAJA 1CSNA 1XMMA 5H8EA 4QTDA 3D5VA 4QD6A 3U9CA 4O6EA 3UO4A 3LJ2A 4JIAA 1JLUE 3R1NA 5CU4A 2QO2A 3BQCA 2UZDA 2Y8OA 2Z8CA 3NWWA 4ACDA 3OXZA 4JXFA 4FTTA 4UZDA 5J9ZA 4YJQA 2W1CA 2Y0AA 3MJ2A 5LVNA 3ZC5A 4AGDA 4FTAA 4L45A 4D4SA 4RWJA 3QRUA 3R1QA 4TYGA 4O2PA 3NYNA 1YXTA 2VX3A 5DT4A 5EHLA 4O4CA 4YBJA 4R3PA 3DLZA 4JDKA 5KZ0A 4GT5A 2GS6A 4EHEA 4OTWA 4D2RA 4KBCA 4LV7A 4LRJA 2WTWA 2HK5A 3E88A 2YAKA 4MBJA 3VS0A 4QPAA 3PXZA 4EJNA 5A54A 3Q4CA 2OH0E 3U6IA 5CS6A 1XR1A 4FTQA 3I7CA 3HRCA 4FF8A 3QXOA 4AE6A 4C8BA 4GV1A 3GI3A 3A60A 3AMAA 3VULA 3U6JA 1CM8A 2VWIA 4QT1A 3U51A 2R64A 3F2AA 4XX9A 5CF5A 4G9CA 1AGWA 5CVHA 4FV5A 3ZRMA 4EYMA 4RC4A 1NVQA 2C30A 5EKOA 5IQIA 4LGGA 5E7RA 3CTJA 3ITZA 3MH3A 3R2YA 5BVDA 2VTJA 4F9WA 3A8XA 4N4SA 5LWMA 5EQEA 5LQFA 3H9FA 5H9BA 2X9EA 5EH0A 2I1MA 3BLHA 5GJDA 5TOZA 2UZWE 4BBEA 4EHZA 5LWNA 2GNIA 2W4OA 4C7TA 4AQCA 5KNJA 5AUUA 2XK3A 4AZWA 3RNIA 3DNDA 5EI2A 4RX5A 3MA3A 4TWOA 2XAOA 4K6ZA 3UVRA 3JPVA 5L2TA 3SA0A 4D28A 4M0YA 4MD9E 3TTIA 4BJJB 3PZEA 3HP2A 3PJ1A 4NTSA 3LQ3A 1JKKA 3VUHA 4YSMA 4ZLYA 4L68A 2VTNA 3R7YA 5ETCA 4AFEA 2W1GA 2Z2WA 2XRUA 4A9RA 4FIGA 3ZBFA 2WELA 4G5JA 5M06A 3W0NA 4BHNA 2E9PA 3FKOA 3I0OA 1BLXA 3R8PA 2OFUA 2YIXA 3K5VA 3AC5A 3UQGA 5KMIA 3FC2A 1J1BA 1PMVA 3D5UA 3H0ZA 1H00A 1PY5A 1YOMA 2VWUA 3VC4A 3ZC6A 2ZOQA 5EKNA 2VZ6A 3S00A 5BVNA 5ANGA 1R39A 2UZOA 5ITAA 3H4JA 2QR7A 3LLTA 3TNQB 4QP7A 2YLFA 2XK9A 3QQGA 1KOBA 3G0FA 4ANOA 4DFYA 2X1NA 4DH8A 2V62A 4ZMFA 2VUWA 4R7IA 4BB4A 4QMWA 3DBDA 4EKLA 3UDTA 4FV6A 1ZZ2A 3IGOA 2VX1A 5F1ZA 4MBLA 3K3JA 5CENA 5EG3A 3HP5A 3A7JA 4WUAA 2OIDA 2VWXA 1U5RA 2W1IA 4MD7E 4A4XA 4FZ6A 4XJ0A 3R83A 2XKDA 3NNUA 4HYIA 3NW7A 4I20A 4I24A 4RIYA 4ZK5A 3RZBA 4H05A 5IQEA 1OIRA 2C68A 4XH6A 4X3FC 4LQMA 3P23A 4GK3A 3K3IA 3MWUA 3CJGA 3NFFB 3QF9A 1QPJA 1T45A 3UBDA 3FZTA 4FG7A 4EBVA 4GIIA 3NUUA 2WMXA 2XBAA 2A1AB 4CSVA 4MVFA 3TKHA 2VTMA 3DLSA 1H1PA 3TNHA 2CNVA 4JMQA 4EH8A 3W0QA 3DOGA 5HVYA 5L8KA 5B7VA 4GYIA 5FG8A 2QLQA 2J5EA 2F7XE 3W0OA 2PMNX 2QD9A 3KMUA 3PY1A 4HOKA 4RZVA 4BTFA 1LEWA 2GNLA 4DCEA 2A0CX 5K4IA 4RIWA 5TF9A 2JIUA 1YKRA 4PP7A 4I5PA 3Q2JA 4F7SA 2X4FA 4FSWA 3W16A 5I4NA 4JLCA 3BE2A 3TG1A 3QZHA 1OI9A 3ORXA 2X4ZA 4IZ5A 4Q9SA 4DLIA 1JAMA 2GCDA 4P5ZA 2OBJA 4Q2AA 1IA9A 2FVDA 5AIRA 1ZMUA 2OJ9A 3F5UA 4IHPA 4UMQA 3ROCA 3BLAA 4PMMA 5EHYA 3BELA 2W5BA 4L46A 3RM6A 5J5SA 2XCKA 3A7FA 5AUYA 4OLIA 3PJ3A 2R3IA 2CHLA 3K54A 4EK3A 4R6VA 1PW2A 3PY3A 3QC4A 1WZYA 2QG7A 5AIKA 1OL6A 2HXQA 2R3NA 3F69A 3EZVA 4OW8A 4U3YA 4I3ZA 3R7VA 3TZ7A 3U4UA 3QQLA 4HVDA 4DCAA 1UV5A 1VEBA 5E8ZA 5CASA 4R7BA 5DI1A 5E8YA 2QOLA 2XEZA 2ZDTA 2ZV2A 5M55A 3TV6A 1XH9A 3HNGA 5IF1A 4FBXA 4AW2A 5IEYA 5JK3A 1V0BA 4JAIA 4ANQA 2VWYA 3BU3A 4IZ7A 3G2FA 4IWPA 2HWOA 2FSOX 4D58A 5C8NA 5HBJA 3VS1A 3L9LA 4ZZMA 5DRBA 5HVJA 3G5DA 3NR9A 1G8AA 2ITQA 3L9NA 2GS7A 3GXLA 4IJ9A 2J5FA 2YM5A 3VS5A 4BIBA 4ZLZA 2WIHA 5KMKA 3HMMA 4APPA 3OWLA 4GRBA 1F3MC 3R1SA 3PFYA 2BRMA 4ZEGA 3T9TA 5I9UA 4YMJA 1NVSA 3W2RA 4NK9A 4YPSA 4G3CA 3LE6A 3ORPA 3R00A 4CMUA 3UZTA 5C8KA 3D0EA 4Y73A 3U87A 3HYHA 2C3JA 2XKFA 3G33A 3C51A 2PVLA 3R63A 4LGDA 2F9GA 5IQHA 3DTCA 2DYLA 4GJ3A 5DRDA 2RIOA 2VV9A 3EQRA 4QP2A 2OIQA 3CD3A 1O6YA 4NKAA 1JKLA 4NSTA 4RJ8A 4ZTRA 3TXOA 4A4LA 5DIAA 4GUBA 5EM7A 2CLQA 4FTNA 1H1QA 2BDFA 2OW3A 4GG5A 4MF0A 4RPVA 5FWKK 3R9NA 4V0GB 4W4YA 4DG0E 4CVAA 4G3EA 4DEEA 3VUKA 4U80A 3QTQA 3VS4A 3AKJA 2B9JA 4B99A 5CEIA 2ONLA 3NNWA 2UZEA 4FYOA 4QMSA 2WMRA 1M7QA 2C5VA 3LFSA 4GIHA 4YC6A 5IA3A 4UYAA 4BKYA 4Z9LA 3RAWA 2Y4IB 3GU6A 2EB2A 2IN6A 3EN6A 3LJ0A 3NAXA 4NJDA 4JOAA 3AKKA 3FY0A 3IW7A 4DFZE 4IM2A 2A19B 2UVZA 4FR4A 4QMUA 3K5UA 3D14A 2WD1A 3DS6A 2Z60A 3IDPA 2BR1A 3NUYA 3LXLA 3MGYA 1APME 1Y57A 2IZSA 2W1EA 4JBPA 3P5KA 4Y46A 4IH8A 4Q9ZA 3C0HA 3MFUA 4JR3A 4E6CA 4QQTA 5JSMA 4O0VA 4O7SA 4CG9A 3DY7A 4LOOA 2XIXA 5A6OA 3KRWA 2Z7SA 4CFVA 1Q97A 1YW2A 2BPMA 5DEYA 3R7UA 4ASXA 5HCZA 1L8TA 3BYSA 2WKMA 3TI1A 4IBMA 5E8XA 5J95A 4AZVA 1IEPA 4RA4A 4DBNA 4NYEA 2DQ7X 4DHJA 2J0KA 3AC4A 4L3LA 3RCDA 1JOWB 3JR1A 1BL6A 4U45A 4Y5HA 3ETAA 3TN8A 3MY1A 5DWRA 3U54A 3SAYA 2GHMA 1DI8A 3HVCA 5HGIA 3R8UA 2CGUA 4ALUA 1E9HA 2WOUA 4KD1A 5CX9A 3COHA 3VW8A 3QQFA 2UZVA 3D15A 4BDBA 5CAPA 1BI7A 4RFMA 4DGLC 2VX0A 4LDTA 5CEQA 4MXAA 4RWIA 3UDBA 3FLZA 4L43A 1RW8A 1IASA 3AGMA 4FVRA 5K5NA 5IISA 2QNJA 3TIZA 4CKIA 5AX3A 2OXYA 4KA3A 2PVFA 5HVKA 3P86A 1G5SA 5DOSA 4R5YA 5D41A 4AW1A 3O71A 3KKVA 1J7LA 2B1PA 5HLNA 2X7FA 3E8CA 3NYVA 5CXZA 1W82A 2QOIA 2FO0A 5E92A 5AR8A 3W2SA 5AV1A 3MH0A 5AAFA 3SGCA 4WBBB 5BUJA 4IAAA 2FSLX 2PVMA 4FIFA 2PL0A 1WVYA 5IPJA 4LUEA 3PRFA 2YHVA 4L44A 2GQSA 4IVDA 3CCNA 4KUJA 3OWPA 2JKQA 4BYIA 1OPJA 4M15A 2O0UA 5GJFA 4F6SA 4MEDA 4ENYA 3UDZA 1ZWSA 4W9XA 1LPUA 5I9VA 3TUCA 3TNWA 3I81A 4RIXA 4CKRA 3BV3A 2F7ZE 2HAKA 2WMQA 4O96A 4RSSA 3VW6A 1WBOA 4F0FA 2IVSA 5CSVA 4ACMA 1Y8GA 3OY1A 3QYZA 3ZCLA 2YIQA 5KMNA 4QMZA 3ZBXA 5IQAA 1ZOGA 1WVXA 2PVNA 2BZJA 1R78A