4IBNA

Crystal structure of lc9-rnase h1, a type 1 rnase h with the type 2 active-site motif
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
SDIPTPLVAVYADESCLGNGREGENPGGAGVLVEYARPGGAGDIVRRDVWVSEPATTNNRMALRSVIEAFRAIGHKGTRFRVVFTTDSRYIVDGMTRWVHDWAQRGWKRKSGAIENLALWQEAVQAVNGHAVEWRWVRGHAGHAQNEYANHLAVTAAGGQTQSGGLVDSGYEEWAARVSTAASRMRLEPFPDAAAFRPSPALPVVAAGRPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of metagenome-derived LC9-RNase H1 with atypical DEDN active site motif
pubmed doi rcsb
source organism Uncultured organism
molecule tags Hydrolase
molecule keywords Ribonuclease H
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2012-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ibnA01
4FJIA 1HNIA 4R5PA 5C25A 4KRFA 3NGYA 3AVCA 3VA0A 1JLEA 2XY5A 2PYJA 1RBUA 2YHAA 3AVBA 1X1PA 4C8OA 3LP1A 4HCCA 1ASWA 1BQMA 5SZTA 4W5NA 1B92A 1JLGA 5HRNA 3V1OA 4CJWA 4CHPA 3OS1A 1EXQA 2PY5A 1KFDA 1VSLA 3B6PA 3O3GA 3SQ0A 4FLWA 2YNGA 5J1EA 1SKRA 4O55A 4KKOA 4M3UA 3KLGA 4M3ZA 4E7KA 1RBVA 3VA3A 4J2BA 2RPIA 2AJQA 3D45A 4LY7A 4DU1A 1RT3A 2OA8A 4OPKA 4LH4A 4CEFA 2P1JA 3CQ8A 2R7YA 1NOYA 4UQGA 1BI4B 2A1RA 4F8RA 3VQDA 2FBVA 4QCLA 2QKKA 3CFRA 2G8UA 4KHQA 1RT4A 1KLNA 2HVHA 5HBMA 4CIGA 3LP0A 4AH9A 1N5YA 3K58A 3IS9A 3AA5X 4NYFA 1BHLA 2X6NA 3B6OA 3OYEA 4CFAA 3ISNC 3HYFA 3NGZA 4CERA 3TWHA 1RT7A 3QETA 1VSKA 3L2RA 1ASVA 3ZSWA 4DSFA 1T05A 4FK0A 3DLRA 3HPHA 3T3FA 1Y97A 4AHCA 3L2VA 1S6PA 4FLUA 4FJ7A 3HVTA 3JSMA 3AO4A 5HP1A 4M3WA 4F3TA 4E0DA 1KSPA 4DSJA 3T1AA 3QESA 1JL1A 5DK5A 1LW2A 4CGDA 3RMAA 2XY6A 1NK9A 1Q8IA 2E6MA 3OS2A 4Z4IA 1I3AA 4FJ8A 3LAKA 1WSGA 3SUQA 1NJWA 2LSNA 1JLFA 1EETA 5CY4A 4JRPA 4FLZA 3IG1A 4MFBA 1Q9YA 2G8KA 1T7PA 3OYGA 2NUBA 1EX4A 3BGRA 4JRQA 2HMIA 2IAJA 4IG0A 1RNHA 1VRUA 1C1CA 4NCAA 1A5WA 1BGXT 1FKPA 1WLJA 4KB1A 5J2MA 4Z4GA 3PX0A 3V81A 1LAWA 2KFNA 1K6YA 2G8VA 2X78A 4C8LA 1S9EA 4QAGA 4ELVA 4HUFA 3MEEA 4M41A 2BGGA 4CGJA 3NGIA 3TAEA 3OJUA 3TAQA 3S3MA 4ZHRA 1RBTA 3AVGA 1LV5A 3K59A 3CM5A 1X9MA 1L3SA 2DFEA 4OLBA 4BWJA 4Z4CA 2F8SA 4KAZA 1GOBA 1TK8A 2YV0X 4DQSA 4CF9A 1YVUA 1SKSA 1BQNA 2G8HA 4PQUA 2X74A 3VQCA 4LD0A 4FM0A 1U49A 4FJGA 1UAXA 4Z0UA 5D3GA 1YTUA 2D5RA 4MQ3A 4OKEA 1NK4A 1C1BA 1TKZA 2IGIA 3HJFA 2DTUA 3LZIA 1EKEA 4KHUA 1C1AA 4CE9A 3ZT1A 1DTQA 1VRTA 4DTRA 4DFMA 1RT1A 1ITGA 3DLHA 4CJ3A 4K8XA 3IRXA 1I39A 4AHTA 3U3GA 4CJEA 1XHZA 2KZZA 2RKIA 3PX6A 1L3TA 4M45A 3D0PA 3OYJA 3QNNA 1VSIA 4FZYA 4B9NA 2D0BA 3OYMA 5J2QA 4KHYA 1CZBA 4FJXA 1X9SA 4ELTA 1B9DA 4CHQA 4NCBA 1UOCA 1L3VA 3DOKA 1QSLA 4DQPA 2HHSA 2OPRA 4EP4A 4KPYA 1RDBA 1VSFA 1J5OA 2VWKA 3TI0A 1F21A 2KQ2A 1XC9A 4AILC 3KD5E 4DMNA 1NJYA 4W5OA 1IKVA 3HT3A 2IDOA 3K5MA 3SJJA 4FVMA 4BE2A 4CCHA 3KD1E 1S9GA 3V4IA 1HNVA 1YT3A 3LZJA 3SCXA 3NCIA 4CESA 4ELUA 1XWLA 2D0AA 1RTIA 1J53A 1VSJA 2ITGA 3VQAA 3RRGA 3PX4A 3H08A 3AA2A 1RILA 4CJQA 1TK5A 4CGFA 3ZSRA 3CFPA 2OPSA 2DY4A 3O4NA 3VQ6A 4CJKA 3HPOA 4DLEA 3QERA 1WNSA 2YKMA 4CEBA 4FJLA 2IS3A 4LSNA 2B5JA 3ZT2A 2B4JA 1TVRA 5KTQA 4FZZA 3OYLA 5J2NA 1S1XA 4FJHA 3ZSYA 4JS4A 3AVFA 1DTTA 4CGGA 4IG3A 4DG1A 1C0TA 2E4LA 3ZSZA 3SNNA 3RMDA 2O4GA 3OYBA 3LPTA 5EU7A 4CJPA 4N56A 3VQ4A 2XO7A 3DLBA 3QEPA 3LP3A 1QSYA 5CYQA 1SL0A 1W9HA 4J2AA 4C8KA 4FJ9A 4YFUA 1NJXA 4E3SA 4DTUA 3TABA 1DLOA 2FBYA 3RRHA 2HHTA 3OVNA 3L2WA 4BE0A 2ATQA 4DTNA 2OPQA 4FK2A 1QS4A 4CJRA 2QKBA 2PYLA 2GV9A 3IAYA 1LW0A 1ZBUA 3CG7A 1S1TA 4LH5A 1D8YA 4FLVA 1ZBIA 3M8QA 4CJ5A 3V9ZA 4OKJA 3V1QA 1NK0A 3AVKA 3M8SA 1QQCA 4DFKA 3C95A 4EZ6A 2WONA 4CJFA 1HQUA 4PY5A 4DS4A 3JYTA 2I5JA 3HK2A 3HP6A 2F8TA 4CEOA 3RMBA 3MEGA 1RBRA 2WOMA 5KI6A 4RW8A 3DLEA 4I2PA 4EP5A 1WAJA 3AV9A 1SKWA 4JLHA 1FK9A 3HP9A 4AHUA 3SQ4A 2HHXA 1NK5A 4CJUA 4BE1A 1KCFA 2HNDA 4DU4A 1TV6A 3MXIA 1HJRA 2Z1IA 3WNHA 3RWUA 1VSEA 1JL2A 1EP4A 1S1VA 4CHNA 4O5BA 3LPUA 4CF8A 3M8RA 4FLYA 4M3YA 3MXJA 1TL3A 3DLKA 1U45A 1GOAA 3DI6A 3OS0A 3TR8A 4W5TA 3NHGA 3HL8A 4DSLA 4F2SA 1UWBA 2HVIA 2HNYA 1TAQA 4I2QA 3VQ7A 4AHRA 5CYMA 3ULDA 1X9WA 1VSHA 5KRTA 5HRPA 3SPZA 4XIUA 2A1SA 3V9WA 1KFSA 2ZQBA 3DRRA 1JXEA 4N5SA 4Z4FA 1J54A 1HMVA 3VQBA 3ZT0A 1W0HA 3SUPA 1BL3A 4E19A 3SPYA 4KV8A 4ID1A 2EX3A 1B9FA 2YNIA 2DFHA 4DU3A 1RDDA 4DQIA 4CJVA 4FJKA 4IFVA 1BCOA 3O3FA 3OYNA 3TAMA 4F3OA 1HYSA 3ZCMA 2RF2A 2ZE2A 3LAMA 3T19A 4B9SA 2VG5A 4H4MA 2Z1HA 4C8MA 4DWIA 1BIZA 3AVMA 1D9DA 3DRSA 4ID5A 3ZSOA 1NKBA 4Z4EA 3ZSVA 4FLXA 4B9LA 3NF7A 5HLFA 1CXQA 4CGHA 1IG9A 4CFDA 4WE1A 1NK8A 2FBTA 2QXFA 3QINA 1LAVA 2QK9A 3NAEA 4DS5A 3TAGA 4CHOA 3SZ2A 3C6TA 1WSHA 2XHBA 1R0AA 3P83D 4E7IA 1CZ9A 3AO3A 3P5JA 4ICLA 3E01A 5FRNA 5FRMA 4E7LA 3V6DA 4DSEA 1TGOA 3OYDA 4GVMA 2X6SA 4CF1A 1JLBA 3QNOA 1RTDA 4CIEA 3L3UA 1HYZA 2KFZA 2XY7A 1A5XA 4PUOA 3AVLA 4FJ5A 1C6VA 1YTAA 1S6QA 2KTQA 1S1UA 4DFPA 1J9AA 3WNFA 4IKFA 1XHXA 4QOZB 4HCBA 3S9HA 4M3TA 2XRIA 4DTSA 4DF8A 3PY8A 2P5OA 4CJSA 1QHTA 3MECA 3AVJA 3CM6A 2BDPA 2OYQA 1QTMA 1RTHA 1TL1A 1JKHA 4FXDA 5FROA 3RMCA 1HQEA 4CJ4A 4CEQA 4OPJA 2D0CA 1JLQA 2BE2A 3KK1A 3I8DA 2Y1IA 4FYDA 4N41A 1WSJA 1TKXA 4PA1A 4GW6A 3TARA 3L8BA 5KGWA 1S1WA 4YNQA 4FM1A 4DTPA 3QEXA 4B9VA 2Z1GA 3TAFA 4CK3A 4E1NA 4ZTJA 3AVIA 1T8EA 4CEEA 1IKYA 3MXMA 4JS5A 3NE6A 3VN5A 3KK3A 3UIQA 4DTOA 3HVRA 1LWFA 4CHYA 1WSIA 2FC0A 5T7BA 1S5JA 1RDCA 2W42A 1IO2A 4B9MA 1A5VA 1SL2A 1IKWA 3U6FA 2Y1JA 3MEDA 2B6AA 5JS1A 1KTQA 3LALA 4IFYA 3OJSA 1NOZA 3NF9A 4W5QA 3LP2A 4B8AB 2G8FA 4O44A 3PV8A 1HRHA 1LWCA 3MAQA 4AHSA 3SUNA 4H8KA 3OYKA 1RCHA 3HSTB 3ITHA 1U48A 4I7FA 4B8CA 2HW3A 5HRSA 3HXMA 1Q9XA 4CFCA 4CHZA 1NJZA 3M8PA 1TAUA 4KI6A 3KLHA 4J2DA 4M3RA 4CJLA 2F96A 4FJJA 3OYAA 1U4BA 4B9TA 2OZSA 4KFBA 4LSLA 3AO2A 1JXBA 4RG8A 3QEIA 4HUGA 1QSSA 4GMJB 3ZT3A 3KIOA 4OKKA 1KVAA 2ZD1A 1TKTA 3K2PA 1IH7A 4I9LA 3RR7A 5KRSA 4FLTA 3OYFA 2YNHA 4FM2A 3L2QA 3SI6A 4KTQA 1FKOA 3F73A 2JGUA 3NH2A 3DRPA 3DYAA 3OY9A 4DSKA 4DTMA 2XY8A 3SQ2A 1CLQA 3C94A 5C42A 3NBPA 1HPZA 3DLGA 5CZ2A 3AVNA 4AHVA 4CFBA 1C0MA 3ZSXA 3KLEA 4DQRA 4RW4A 1N6QA 4KHNA 4M3XA 1C0UA 3TAPA 4O0IA 3KLIA 1T03A 4J2EA 3PO5A 1SUQA 4DLGA 4KHWA 2HHUA 4B3OA 4OVLA 5HRRA 3LWMA 4DTXA 3S3NA 3WNEA 3ZT4A 1CXUA 5I3UA 2HHQA 1KLMA 3HPGA 3LANA 5K14A 4HUEA 4KTZA 4E7JA 3V1RA 1RT5A 3SUOA 4CF2A 5C24A 1ZBLA 4FZXC 1U47A 1BIUA 4TSXA 4CEAA 1KVCA 3QEWA 5DMRA 1SL1A 3K5NA 1SV5A 1XI1A 1UA0A 2HHWA 1Z26A 1U04A 3V9SA 4PWDA 5J2PA 4IBNA 3KK2A 4OLAA 2G8WA 4CECA 1D5AA 1GOCA 1UA1A 3SQ1A 2E6LA 1ZBFA 2YKNA 3FFIA 4M42A 3BDPA 3C6UA 2O4IA 4RW6A 1KRPA 1NKEA 3VQ5A 3U3YA 3OYHA 4CEDA 2KZMA 5HROA 4DFJA 4IDKA 4H4OA 3A2FA 3EYZA 2ETJA 3K57A 4CK1A 4HTUA 3QIPA 3L2UA 2GBZA 1ASUA 3SV4A 3K5OA 1JLAA 1RT6A 3S3OA 3QIOA 3AO5A 3QLHA 3L3VA 4KI4A 2P51A 4BDPA 3DOLA 1VSMA 1BISA 1RBSA 1Z25A 3CFOA 4B08A 3G10A 3KLFA 4G1QA 1WAFA 4E7HA 2HHVA 2JLEA 2IC3A 4RW9A 3ASMA 3O3HA 2PZSA 1BCMA 4DSIA 4K8ZA 3DMJA 1VK0A 3ALYA 4E89A 2GUIA 4CGIA 3RTVA 3QO9A 3PO4A 1JLCA 2OZMA 4EZ9A 3HO1A 1FXXA 4F2RA 2HB5A 3KJVA 4FW1A 3KTQA 5I42A 4Z4HA 3OYCA 4Q0BA 5SWMA 4ZTFA 3VQEA 4CK2A 3P1GA 3AVAA 4Y1DA 4BDYA 3V9XA 3NFAA 3NF6A 3SYZA 4FK4A 3VQ8A 4Y1CA 1ZBHA 3VQ9A 1BI4A 3LWLA 4L8RB 4FJMA 1L5UA 4CEZA 2RN2A 3NDKA 2G8IA 1RT2A 1IKXA 2FBXA 2IOCA 4BACA 4FJNA 3DM2A 1WSFA 3KKSA 3V9UA 1WN7A 3QEVA 4HVJA 2DFFA 3EY1A 1HYVA 4FW2A 2BANA 2Q3SA 4FCYA 2VG6A 4B9UA 5E41A 4KO0A 3VQPA 5KGXA 3AA4A 3WNGA 3OYIA 3THVA 3VQQA 4O0JA 1TKDA 2OPPA 1LWEA 2YNFA 3TANA 3SV3A 4NYNA 5JS2A 4N76A 3HM9A 3CYMA 1ZYQA 4KREA 1RDAA 4N47A 5CZ1A 3ZSQA 3K5LA 4DF4A 4DTJA 4BWMA 2VG7A 3NF8A 1D9FA 1NK6A 2EHGA 4KHSA 1REVA 4CIFA 4Q5VA 3LDSA 4W5RA 3RR8A 1VSDA 3AVHA 3O4QA 4OGCA 4OGEA 1NKCA 3PUFA 4KB0A 2KW4A 3AO1A 3AA3A 2P5GA 1NK7A 2YHBA 4CF0A 4DQQA 3KKRA 1MU2A 1O1WA 3NH1A 2HNZA 4KTWA 1QE1A 3NH0A 1G15A 1RTJA 3F9KA 4RW7A 4I9QA 4NCGA 3I0SA 2Z1JA 4E1MA 5FDLA 4OJRA 4HHTA 4O4GA 3EZ5A 3G0ZA 3I0RA 4C8NA 2VWJA 1TK0A 4BDZA 1L3UA 1WSEA 4F4KA 1KVBA 4CJTA
chains in the Genus database with same CATH superfamily
4FJIA 4IDHA 4KRFA 3NGYA 3CCQN 2XY5A 1N8RO 2J4RA 2PYJA 2QI2A 3AVBA 1X1PA 4C8OA 2D1KA 1ASWA 1BQMA 5SZTA 1I94K 5HRNA 3V1OA 3DXKB 3O3GA 2E1YA 4BY9C 2YNGA 4YDUC 5J1EA 4O55A 4KKOA 4M3UA 4E7KA 3O80A 2RPIA 1OH7A 2O8DB 3VQDA 1HKCA 5CE3A 5TKWA 4QS8A 3CFRA 2G8UA 1RT4A 2HVHA 4BRPA 5HBMA 4NXNK 3K58A 4EIAA 3IS9A 5HOOA 4CFAA 1K73O 4BREA 3C6HA 4NO7A 2KLAA 1BWFO 1RT7A 1VSKA 4FK0A 4DR6K 3DLRA 4FLUA 3L2VA 1RGIA 4XH4A 3QESA 2XY6A 2E6MA 3FE1A 3HRGA 4CZJA 4OPAA 3CERA 4JRPA 5BN9A 4FLZA 3E1YA 1C0FA 1T7PA 2NUBA 4R79A 2IAJA 4IG0A 1RNHA 1C1CA 1N36K 5AZJB 4FWKA 4NCAA 1YUWA 4Z4GA 1LAWA 2X78A 4C8LA 4QAGA 4ELVA 1QQOA 4HUFA 2A6AA 2BGGA 3TAEA 3NGIA 3MN7A 4UY8O 4GV3A 3HSCA 2O8BA 1L3SA 4DUZK 1TK8A 4B3TK 3CCUN 3CJAA 1NBWA 2QTDA 3B8AX 1C1BA 1BA1A 2IGIA 2DTUA 3LZIA 1C1AA 1DTQA 3QBXA 4DFMA 1E3MA 1RT1A 3QMLA 1P90A 1ITGA 3IRXA 4AHTA 2RKIA 1E4GT 1L3TA 1W7AA 1HKBA 4B9NA 2D0BA 1CZBA 2Q1NA 4FWRA 1X9SA 4C1NI 1UOCA 1QSLA 4FOIA 5GAHP 2HHSA 1VSFA 1J5OA 2VWKA 1D4XA 3D2FB 3O8MA 4AILC 4DMNA 1IKVA 3O1WA 3K5MA 2YX6A 4BE2A 3KD1E 1S9GA 5AQWA 2QKBA 4ELUA 4C1NK 4LFCK 2VWBA 1VQPN 3PX4A 5F0XA 1G99A 1RILA 2OANA 3ZETB 3CFPA 1H1VA 2OPSA 3O4NA 1WNSA 2YKMA 1NGIA 3ZT2A 1T6DA 5KTQA 5J2NA 4B1XB 3VTHA 1DEJA 4DG1A 1C0TA 3W0LA 3LM2A 2F9WA 2OCEA 2P9KA 1S3XA 4NB4A 1W2BM 1K9MO 4JI8K 5FPDA 4J2AA 1HNXK 4FJ9A 2OTJN 4DTUA 4JNEA 3KZBA 4DV5K 4BE0A 3TSQA 1W97L 5BPLA 1NG9A 1LW0A 4LC9B 2E2NA 3O1BA 1VQ5N 3V1QA 3SAGA 4DFKA 3C95A 4EZ6A 2RHKA 4PKGA 1Q7YO 4KBOA 3HP6A 3BZCA 1IG8A 1SKWA 2O8EB 1WAJA 3AV9A 1QHAA 3VEXA 1FK9A 4AHUA 2QA4N 1IV0A 1NK5A 3MXIA 1HJRA 3R9PA 4CZIA 1JL2A 3CF5L 4CHNA 2ZM6K 1IBLK 3LPUA 3M8RA 3CC2N 4FLYA 4M3YA 1TL3A 3DLKA 1U45A 3J8AA 2E2PA 4W5TA 1UWBA 4DV6K 2HVIA 2HNYA 1TAQA 4AHRA 3TTFA 3ULDA 3SPZA 5HRPA 3FFKB 1JXEA 4N5SA 4Z4FA 1J54A 1HMVA 1B9FA 1RDDA 4JHDB 3OYNA 4F3OA 4BRAA 4JHDA 4YOWA 4DUYK 4B9SA 2VG5A 2Z1HA 3O5BA 3AVMA 1D9DA 3ZSOA 4Z4EA 1KC8O 3ATUA 3WUHA 1LAVA 2UUAK 3EKSA 2QK9A 4DS5A 3TAGA 3C6TA 1WSHA 3M1FA 4DR4K 1SZ2A 4EAHD 1CZ9A 2HMPA 3TTDA 4IJNA 3NMUA 4H0XB 1TGOA 3OYDA 3BP8A 4LF4K 1JLBA 2KFZA 1A5XA 3T1HK 1OKJA 3AVLA 1S1UA 4IKFA 2XRIA 1U2VA 1U2VB 1QHTA 3AVJA 4O5FA 3VEOA 1XQSC 4CEQA 4CJ4A 4DV1K 3TPQA 3I8DA 2Y1IA 4N41A 1WSJA 2P9LA 4GW6A 3L8BA 3CPEA 3QEXA 2FSJA 2VQEK 3TAFA 4CK3A 4ZTJA 4FO0A 3AVIA 4BQZA 4CEEA 3KK3A 4LF8K 1YJWN 4DTOA 4DV3K 4CHYA 1RDCA 3IUCA 4CZKA 4B9MA 1A5VA 1YAGA 5JS1A 3NF9A 4B8AB 1VQNN 5AQSA 3MAQA 1TUYA 4H8KA 1NWKA 3HSTB 4I6MA 1HPMA 3ITHA 5AQUA 4ISFA 4CFCA 3DJCA 3MN9A 4FJJA 2OZSA 1N33K 3O6WA 1N32K 4LSLA 3T69A 1JXBA 3KIOA 1TKTA 3WXKA 1IH7A 4CW7B 5KRSA 1FKOA 2NRTA 2JGUA 3CCMN 4JAXA 4V19S 1CLQA 2QWMA 1HPZA 3DLGA 5CZ2A 3AVNA 4AHVA 5DM6L 3ZSXA 1TYQA 3W3DA 3G6EN 4CZFA 4FPAA 2V7YA 3VENA 4OVLA 3RSEB 1OVYA 3ZT4A 1KLMA 3HPGA 3LANA 5K14A 2O8CA 4TSXA 3LDQA 2HBKA 1XI1A 3V9SA 1VQ9N 3CC4N 4OLAA 4WCEL 1UA1A 3SQ1A 2E6LA 1GLFO 2YKNA 3C6UA 4A61A 2E8AA 1KRPA 3U3YA 4HTLA 3OYHA 2KZMA 5KQ8A 4CK1A 4HTUA 3QIPA 3L2UA 4FPBA 2DPNA 5AQVA 1JLAA 3HZ6A 3OW2M 3LDLA 1RT6A 4DR1K 5ADXH 3S3OA 3AO5A 3QLHA 4FSVA 2P51A 1RBSA 1Z25A 2OTLN 1WAFA 2JLEA 3KHYA 1MA9B 2IC3A 4ILGB 1QZ5A 4CGIA 2OZMA 4EZ9A 4MLEA 3KJVA 3ENHA 4ZTFA 3OTOK 4GY2B 3AVAA 5BR8K 4PKIA 3SYZA 5AQKA 2RN2A 3NDKA 4FJNA 1WSFA 3THYA 5EXWA 3THYB 3C7NA 1VQLN 4FW2A 3VQPA 5KGXA 4O8KA 1TKDA 1RFQA 3L6QA 3GOIA 3SV3A 1VQON 1ZYQA 4DV7K 1RDAA 5CZ1A 3K5LA 3D2EB 1IBMK 4BR9A 1NK6A 1BG3A 3O4QA 3AO1A 3AA3A 2P5GA 3KKRA 4JK7A 3HBTA 3VESA 4KTWA 3NH0A 4NCGA 5FDLA 4OJRA 3I0RA 4C8NA 2VWJA 1V4SA 1NKBA 1L3UA 1WSEA 5AQRA 5C25A 3OBYA 4K43A 2YHAA 3WQTA 1JLGA 3OS1A 1IJJA 1VSLA 4CBWA 1GLJO 4WFAL 5FPNA 3T7ZA 3KLGA 1RBVA 4J2BA 2W6KA 4U67L 3D45A 2OA8A 2KKZA 1Q18A 2R7YA 5BRDA 4PHTX 3SBTA 4NYFA 1BHLA 2X6NA 3B6OA 3P38A 4A57A 1SAZA 3WXLA 3OYEA 5JLFA 5IT9O 3L2RA 4DSFA 1T05A 3HPHA 4JD2A 3T3FA 1Y97A 4YOYA 3MX2A 3BY5A 3HVTA 3AO4A 3CJCA 4F3TA 5JLHA 3E9LA 1KSPA 5M1PA 4CGDA 3RMAA 1MDUB 3R6MA 3M6GA 4FJ8A 2UXCK 1NJWA 4BRDA 3IFRA 1EETA 5AQYA 1X3MA 5AJ3K 1Q9YA 1HNZK 3OYGA 3BGRA 4JRQA 3VEZA 3CHWA 2QWLA 4KB1A 3A8YA 4WYBA 1U6ZA 3DXMA 3O9RA 3I55N 2G8VA 3SMSA 2VQFK 3MDQA 3S3MA 1VQMN 5GIPA 3DAWA 1LV5A 3SMPA 2Q36A 4CI6A 1X9MA 4H5NA 4JKAA 4CBXA 1EWRA 2A40A 2WFBA 4KAZA 1GOBA 2NLXA 4EHUA 4JYAK 1BQNA 4PQUA 1UAXA 3C65A 1NK4A 4OKEA 2CGJA 3HJFA 4KHUA 4CE9A 1VRTA 4CJ3A 4JKDA 3IMXA 3R1XA 4M7YA 3LDOA 1V4TA 3WQUA 3J80O 2KZZA 1OVQA 4XH1A 3R3LA 4MO5A 5J2QA 5GINA 2A3ZA 4CHQA 4NCBA 1L3VA 4RWTA 4EP4A 1RDBA 3A5MC 5BPNA 4I6MB 5ADXA 4CCHA 2QWOA 1KD1O 1XWLA 1VSJA 2ITGA 1VQ8N 3H08A 3AARA 4CJQA 1TK5A 2DY4A 4DLEA 3HPOA 2Q0RA 4CEBA 4FJLA 4LSNA 2B4JA 5GAEP 3MN5A 1S1XA 3VPZA 1DTTA 2VGMA 4CGGA 4IG3A 3OYBA 3LPTA 4CJPA 1NGBA 4N56A 3VQ4A 5AQLA 4E3SA 2ZJQL 5KPRA 1DLOA 3L2WA 4DTNA 2OPQA 3AAQA 3IAYA 3CG7A 1HX1A 1CZAN 4OKJA 3AVKA 4CJFA 1HQUA 4PY5A 2A41A 2E88A 3ATVA 3RMBA 3MEGA 1RBRA 2WOMA 5KI6A 2GTDA 3DLEA 4I2PA 4RW8A 3JAMO 5C10A 2O8EA 3CI5A 3HP9A 2NNWA 4BR7A 2P9NB 5EX5A 3CD6N 4Z94A 4FXDA 3DI6A 3FZKA 3HL8A 2D0PA 4F2SA 4PKHA 2IVOA 5AQJA 4BRCA 3VQ7A 1YITN 1X9WA 4A62A 5CYMA 2A1SA 2ZQBA 3DRRA 3Q7CA 3VQBA 1W0HA 5JVHL 3SUPA 1NGCA 2DFHA 3VEYA 4DQIA 3P4IA 3TAMA 2FLOA 1XNRK 3ZCMA 3T19A 1J5EK 4C8MA 1BOTO 3DRSA 4OX9K 3ZSVA 5AQGA 3NF7A 1CXQA 3CJ7A 1BA0A 5M1KA 3QINA 4E7IA 4ICLA 3E01A 5FRNA 2WUSA 4E7LA 4BGAA 4LFAK 1RTDA 3L3UA 1HYZA 1QZ6A 4G9ZA 1YTAA 4JKFA 2KTQA 3WEEB 1J9AA 3WNFA 4HCBA 2QWNA 4M3TA 4DTSA 2HBJA 4DF8A 3PY8A 4IWVA 4CJSA 3MECA 3CM6A 2OYQA 1QTMA 2UU9K 4IEIA 1JKHA 3EZWA 1HQEA 3H1VX 4FYDA 5C2FA 3TARA 1S72N 1S1WA 4YNQA 4FM1A 4X65K 3GDQA 1T8EA 3MXMA 1IKYA 4DV0K 4U7BA 1NNEA 3ZEUB 3HVRA 2FC0A 5T7BA 2W42A 1IO2A 1OH5A 4DKWA 2NRXA 1DKGD 1KTQA 3LALA 3OJSA 1NOZA 4DR5K 3LP2A 2G8FA 1NM1A 1NMNA 1DGKN 2GWJA 5CHIA 5GADP 1HRHA 4AHSA 3SUNA 4F9OA 1U48A 4KH5A 4I7FA 5BN8A 2HW3A 3THWB 3M8PA 1YF5L 4M3RA 4CJLA 4K42A 2YHYA 3THXB 2AP1A 4HUGA 4X62K 4GMJB 1KVAA 3VF6A 3E9PA 3OYFA 1RDWX 2P9UA 3DRPA 3DYAA 4DSKA 4JI5K 5AQHA 1NGJA 2XY8A 3SQ2A 3C94A 1MWMA 3NBPA 2NRWA 1R59O 5LMUK 1N6QA 4KHNA 1C0MA 5BR9A 4BRKA 3TAPA 4O0IA 3MN6A 2HHUA 1EQYA 3LWMA 1CXUA 4FWPA 5AQQA 5JICA 1XUPO 4HUEA 1ZBLA 4KTZA 1RT5A 4CF2A 3CXCM 1WBDA 3K9JA 1SL1A 1SV5A 2FSNA 2QW9A 4A2BA 1U04A 4B1VA 4BR4A 1Q82O 4ISGA 4IBNA 3KK2A 1D5AA 1GOCA 4YHHK 3TTCA 5AFUA 3FFIA 3BDPA 2O4IA 2GX9A 2ZGYA 4H4OA 4CZMA 3EYZA 1XMQK 3FLCO 1JCGA 2GBZA 4BGBA 1GLCG 3QIOA 5FLXO 5EVZA 4BR2A 3CFOA 4B08A 3G10A 2I7NA 1HNWK 3M3ZA 1M90O 4RW9A 3O3HA 3ASMA 2D4WA 3L0QA 4K8ZA 3VERA 3ALYA 3VMFB 5KPTA 1JLCA 2ZWHA 2O8FB 2GEMA 3KTQA 3WXJA 1KQSM 4CK2A 2YHXA 3VGLA 1TUUA 4Y1DA 5F2RA 3V9XA 1ZBHA 2O8DA 3D6RA 2E1ZA 3SBGA 1BI4A 3BF1A 3LDNA 2IOCA 4BACA 3H45C 3KKSA 1WN7A 4IOCL 3QEVA 2DFFA 3EY1A 3UKRA 3FZFA 1HYVA 3I33A 2BANA 4B9UA 2VG6A 2OPPA 1LWEA 4MO4A 3TANA 2ZGZA 4KREA 3CYMA 4N47A 2ZJRL 4ILHA 5FPEA 2VG7A 1D9FA 2EHGA 4X64K 3A5LC 4ILJA 4Q5VA 3AVHA 3CCLN 5AQXA 4CF0A 1O1WA 3NH1A 5EY4A 1K8KA 1QE1A 1RTJA 3I0SA 2Z1JA 4E1MA 3F9MA 3EZ5A 4BDZA 1YT3A 4JKEA 1KVBA 1MWKA 4F4KA 1HNIA 4BRFA 3VA0A 5BPMA 3S41A 4HCCA 3JXUA 3LP1A 4GV6A 1JJ2M 1B92A 4CHPA 4CJWA 2PY5A 3B6PA 3SQ0A 3ENBA 4M3ZA 3BEXA 3VA3A 3TU5A 1NU0A 2AJQA 4LY7A 4DU1A 3G4SN 2UXDK 4FWOA 4OPKA 4LH4A 4CEFA 2P1JA 5TKYA 4FWQA 3H1QA 4F8RA 2QKKA 4KHQA 5AR0A 3K0SA 5BREA 2P9NA 4BVOA 4CIGA 1N5YA 4AH9A 4Y0WA 3C7NB 4AF1A 3HYFA 2HBMA 3U9ZA 4CERA 3TWHA 2CH5A 1HKGA 4JD2B 1S6PA 4FJ7A 5C0YA 2GUPA 4M3WA 4E0DA 2P9IB 4DSJA 3M5RA 3BZKA 2HF3A 3L4QA 2CGLA 1WSGA 4JI3K 5CY4A 4DB3A 3CCVN 2ZF5O 2G8KA 2FSKA 5C12A 2HMIA 4RTFD 4JI6K 2Q31A 4A2AA 1BGXT 1FKPA 3V81A 5IWAK 2KFNA 1K6YA 3JS6A 1S9EA 3D7EO 2UUCK 2PAVA 3MEEA 3DXKA 4M41A 3TAQA 1WUAA 3OJUA 4ZHRA 1RBTA 3QICA 1YJNN 1NGHA 3K59A 5M1NA 3ZX3A 1ATRA 2E20A 3GBTA 4BWJA 5LJWA 4Z4CA 2F8SA 2YV0X 4CF9A 1SKSA 2NRZA 4H03B 3VQCA 4FJGA 5D3GA 3EN9A 1YTUA 2D5RA 4MQ3A 3HOTA 1OH6A 1EKEA 2QM1A 3DLHA 4K8XA 3A5OC 4CJEA 3PX6A 4M45A 4IZ9A 3OYJA 3GL1A 3QNNA 1VSIA 3TSPA 4FZYA 4IOXA 1YVNA 4JN4A 4FJXA 1HUXA 4ELTA 1B9DA 3ZYYX 4DQPA 4KPYA 4PL8A 4BRMA 4B1YB 3TI0A 4BR5A 1XC9A 4A5AA 4W5OA 3HT3A 4B9QA 3SJJA 3V4IA 4BRQA 3NCIA 5AQMA 4CESA 3P31A 4JI0K 2D0OA 1J53A 3RRGA 3THXA 4WQ5C 3AA2A 4LF9K 3DXMB 5GAGP 3ID8A 3O9UA 2B5JA 1TVRA 4FZZA 3OYLA 1VAZA 4FJHA 4K41A 3ZSZA 2CH6A 3RMDA 3ID6A 4NLBA 3LP3A 5CYQA 3VETA 1SL0A 4YFUA 3OBWA 3QFUA 5FPMA 3TABA 3RRHA 5AQFA 1GLEG 4BG9A 4BC3A 2HOEA 4AQYK 1ILYA 1QS4A 2GV9A 2HSTA 1ZBUA 4LH5A 1S1TA 1D8YA 1ZBIA 4BQLA 3M8QA 4CJ5A 2YCHA 3CJBA 3O08A 4JEPA 1NK0A 2KHOA 3SAFA 2WONA 4CZHA 3CC7N 3VTIA 1DT9A 4IFEA 3ULEB 5M1OA 3ULEA 2UUBK 2O8BB 3DLLL 2HHXA 4CJUA 4DU4A 1TV6A 4JV5K 2Z1IA 3D2FA 3WNHA 4IOAL 3RWUA 1EP4A 1S1VA 4O5BA 4CF8A 3MXJA 1HLUA 4WFNL 2WC9A 3WXIA 1GOAA 3OS0A 4H5VA 3PIOL 3NHGA 4I2QA 1Q9XA 3I8BA 3O9QA 5AQNA 5KRTA 1KFSA 4YY3K 4XIUA 4XEIA 3V9WA 4JKBA 2RE2A 3ZT0A 1BL3A 3SPYA 2O8FA 2W41A 2E5LK 4BR0A 4DU3A 4CJVA 2A42A 4AM7A 4FJKA 1BCOA 3O3FA 1HYSA 3FR0A 4C23A 4B9LA 5HLFA 4CGHA 1IG9A 4FWMA 4WE1A 4CVNE 2NZTA 1YI2N 3SZ2A 2O8CB 1R0AA 4FOEA 3V6DA 4DSEA 4GVMA 2X6SA 5AZIB 3U9DA 4CF1A 1Y64A 3J7AP 2XY7A 4PUOA 4PL7A 4FJ5A 1C6VA 4BRNA 5LJVA 1XHXA 4MLHA 3S9HA 3MWTA 1VQ6N 2W40A 2IVPA 3BUZB 4EFHA 3HOSA 2BDPA 1Q81O 1HR0K 1SQKA 3RMCA 1E4FT 2D0CA 3KK1A 4B3MK 5JMVA 5C2DA 3SAHA 1TKXA 4DTPA 4B9VA 5C15A 1NMDA 2E2QA 3O9SA 3VN5A 4JKHA 3UIQA 1WSIA 1IKWA 3U6FA 4JI2K 2Y1JA 3C6AA 3EEQA 3O9TA 3MWPA 4W5QA 3IDHA 1ZBSA 1KAZA 3UB5A 3PV8A 1LWCA 3SLCA 3OYKA 3DWLA 4EHTA 1YIJN 1X3NA 4ISEA 4CBUA 4KHPK 4CHZA 1NJZA 1TAUA 4KI6A 2PBDA 3KLHA 4J2DA 2F96A 4KFBA 4WQ4C 4JKGA 3J7ZO 3AO2A 4RG8A 3CCEN 2ZD1A 3OHRA 2YNHA 3L2QA 3SI6A 1XNQK 4BRHA 3OY9A 4HWIA 4GNIA 5C42A 4H0OA 4CFBA 3PSIA 4RW4A 4M3XA 1C0UA 1T03A 4J2EA 4NXMK 4DLGA 3FZHA 3QDKA 1JCEA 3CCJN 1WB9A 1VQ7N 4FWLA 2UYTA 4E7JA 3SUOA 4FZXC 1U47A 1BIUA 2P9LB 3MX5A 4YORA 3VGKA 4LFBK 5DMRA 1RDUA 3CQXA 3U8XA 1UA0A 2HHWA 1Z26A 4PWDA 5J2PA 5LL6Z 4CECA 2F7TA 4YOTA 4RW6A 1GLBG 2BH1A 3J7YP 3G25A 3VQ5A 3ZX0A 1FW6A 5HROA 4IDKA 3T1YK 3A2FA 2ETJA 3KWGA 2YJFA 3TSUA 3GG4A 3K57A 1ASUA 2YHWA 3K5OA 2ZJPL 4DR2K 1ZXOA 3I56N 1NGAA 4KI4A 4GVEA 3DOLA 1BISA 2P9SB 2F9TA 2HHVA 2PZSA 1X9JA 1Z05A 1BCMA 3DMJA 3ZEUA 3PLAA 3PO4A 2IVNA 3QO9A 1QQMA 4F2RA 2P9UB 3O4WA 2HB5A 3HO1A 5BRHA 4B1WB 5AQZA 1VHXA 5SWMA 3UE5A 1YJ9N 3A5NC 3P1GA 4BDYA 3NF6A 4FK4A 4BRGA 4IXCA 4L8RB 2FF3B 2G8IA 1RT2A 1IKXA 4YOXA 3DM2A 3V9UA 3G71N 4YOUA 2WTUA 4WF9L 4H0YB 3N4PA 4BG8A 4CJ7A 4FCYA 5E84A 5AZJA 5E41A 4KO0A 3WNGA 3AA4A 3CJ1A 3QB0A 2NRVA 4O0JA 3VQQA 3OYIA 3ENOA 3THVA 1GLAG 2YNFA 4QS9A 1T44A 3PIPL 2F4VK 1NGDA 1KXPA 4DTJA 2VGNA 3NF8A 3VEWA 1REVA 1XC3A 4B3SK 1VSDA 4OGEA 3AAPA 3PUFA 2GWKA 4KB0A 2KW4A 2I7PA 1NK7A 2YHBA 3VGMA 4BC2A 1MU2A 3AGRA 3CCRN 1LOTB 1NGEA 4MDBA 1G15A 3EE9A 4I9QA 4H5TA 4HHTA 4CIFA 4R5PA 3AVCA 1JLEA 1RBUA 1KAXA 4W5NA 3R8EA 3U4LA 1EXQA 4LF5K 1KFDA 1HJOA 4FLWA 1SKRA 5AQTA 4DV2K 1RT3A 3CQ8A 4H0PA 1NOYA 4UQGA 1BI4B 2FF6A 2A1RA 2FBVA 4QCLA 1BDGA 1KLNA 3LP0A 2EWSA 3AA5X 4DHYA 4FL9A 3ISNC 3LDPA 3NGZA 3QETA 3CPWM 1ASVA 3ZSWA 5HL7L 5ELZA 4AHCA 3OA9A 1QVGM 3JSMA 5HP1A 5LMNK 1ATSA 2Q0UA 3T1AA 1NK9A 1JL1A 5DK5A 1LW2A 1Q8IA 3OS2A 4Z4IA 1I3AA 3LAKA 3SUQA 2LSNA 3KWIA 1JLFA 4NLCA 5M1FA 3IG1A 4MFBA 4DV4K 1QVFM 1K8KB 2QWQA 4BC5A 1EX4A 5H1SQ 1GLLO 1VRUA 4FWSA 3FZMA 1YHQN 1A5WA 1WLJA 5J2MA 3PX0A 1ATNA 2HF4A 3D2EA 4CGJA 2Q97A 3AVGA 3CM5A 3MMVA 2DFEA 4OLBA 1BU6O 4J8FA 3HI0A 4DQSA 1YVUA 2G8HA 4KH6A 2X74A 4FM0A 4LD0A 3J81O 1U49A 4K0KK 3CJ9A 4Z0UA 1TKZA 2JWLA 3PSFA 3SK3A 3ZT1A 4DTRA 2YJEA 3CMAN 1I39A 3U3GA 3A0IX 1XHZA 2HBLA 4BVPA 3D0PA 1K8AO 1BUPA 3OYMA 2JWKA 4KHYA 4FWNA 3DOKA 2OPRA 3GE1A 3CIPA 3EO3A 2ASOA 2V52B 4LF6K 1F21A 2KQ2A 3KD5E 4CZLA 1NJIO 4B3RK 3SJHA 1NJYA 5A2QO 2IDOA 4FVMA 4JK8A 1HNVA 3LZJA 3SCXA 3K9KA 1JCFA 2D0AA 1RTIA 3VQAA 2P9PB 2P9PA 4CGFA 3ZSRA 1YXQA 3VQ6A 4CJKA 3QERA 3EE8A 2IS3A 3HM8A 4WQ5A 3ZSYA 4JS4A 3AVFA 3WEEA 3MK6A 2E4LA 3SNNA 2P9KB 2YI1A 3LL3A 5GIOA 3KK7A 2O4GA 4OO1J 5EU7A 2XO7A 3DLBA 3QEPA 4CZGA 1QSYA 4AM6A 1W9HA 3UKUA 4C8KA 1NJXA 3EKUA 3UKUB 2FBYA 2QXLA 3CMEN 2HHTA 3OVNA 1O13A 2ATQA 4FK2A 4CJRA 1SS6A 2PYLA 1LCUA 3FGUA 4FLVA 1S22A 3F5TA 4JKCA 4JI4K 3V9ZA 3RVCA 1QQCA 3M8SA 3CETA 3VEVA 4DS4A 4JI1K 3JYTA 2I5JA 3HK2A 4YOVA 3LM9A 2F8TA 3L4IA 4CEOA 4EP5A 4M7XA 4JLHA 3SQ4A 4BE1A 1KCFA 2HNDA 1P8ZA 1VSEA 3HTVA 5AQOA 1T3VA 3TR8A 4DSLA 4O8UA 4JK9A 3E9OA 1VSHA 2V51B 2WBNA 1C0GA 3WT0A 5EOYA 4E19A 4KV8A 4ID1A 2EX3A 2YNIA 4IFVA 2RF2A 2ZE2A 3LAMA 2V7ZA 4FVUA 4H4MA 4DWIA 1BIZA 5MLCQ 4CD3A 4ID5A 2PFUA 4FLXA 2AA4A 4CFDA 1NK8A 2FBTA 2QXFA 4GKKK 1FJGK 4MDAA 3NAEA 4A59A 4CHOA 2XHBA 1T6CA 3P83D 3AO3A 3P5JA 4A5BA 1EO1A 5FRMA 4H0VB 4DR7K 5F1XA 3QNOA 1VQKN 4CIEA 3EL2A 4BROA 5BRFA 1N34K 4E1JA 1S6QA 1XMOK 1KAYA 4DFPA 5CR4A 4QOZB 5AFUH 4IO8A 2P5OA 1QQNA 1RTHA 4XH5A 1TL1A 4K25A 1EWQA 5FROA 4OPJA 2BUPA 1JLQA 2BE2A 4PA1A 3AY9A 2QWPA 5KGWA 2Z1GA 4E1NA 2BTFA 4CZEA 4JS5A 3NE6A 4GV9A 1LWFA 1S5JA 1SL2A 3QBWA 3ZX2A 3C0BA 3H3NO 3MEDA 4LF7K 2B6AA 2UXBK 1NGFA 4IFYA 3NVKA 4QS7A 4O44A 3F2KA 4M63C 2GELA 1RCHA 3N4QA 4B8CA 5HRSA 3HXMA 4X66K 1Z6RA 4L3QA 3UKRB 2QWRA 4JI7K 5AQPA 3OYAA 1U4BA 1M1KO 4B9TA 3QEIA 1QSSA 3ZT3A 4OKKA 3K2PA 3RR7A 4I9LA 3ZETA 4DCHA 4OPHA 5I9EB 4FLTA 4FM2A 3CCSN 4KTQA 3F73A 3NH2A 4H5RA 5M1QA 4DTMA 4WQ4A 2ITMA 4WFBL 3P39A 1TYQB 3KLEA 1ZC6A 4DQRA 3H46O 5AQIA 2H3GX 3KLIA 3PO5A 1SUQA 5DM7L 2Q2RA 4BC4A 4DR3K 3AGKA 4KHWA 3RSEA 5E26A 4B3OA 1NLVA 5HRRA 4DTXA 3S3NA 3WNEA 3E66A 5I3UA 2HHQA 4KH4A 4GKJK 3CQYA 1WOQA 3V1RA 3H6EA 5C24A 4CEAA 1KVCA 3QEWA 3K5NA 3KVGA 3QFPA 5AZIA 2G8WA 1ZBFA 4M42A 1NGGA 1NKEA 3IKMA 4CEDA 4DFJA 4CD1A 5LY3A 3NVMA 3WXMB 3SV4A 3Q7BA 3VF2A 2W6LA 1IBKK 4H5WA 3L3VA 4BDPA 1VSMA 3KLFA 2P9SA 2VYPA 2ASPA 4G1QA 5KQDA 4E7HA 4IJAA 2NRRA 4B1ZA 4DSIA 1J6ZA 2HHHK 1VK0A 4E89A 3RTVA 2GUIA 1VQ4N 1FXXA 1BO5O 4FW1A 5I42A 4IO9L 2P9IA 4Z4HA 3MCAB 4IEEA 3OYCA 4Q0BA 3VQEA 2E2OA 3NFAA 3VQ8A 4Y1CA 3VQ9A 4B1UB 3LWLA 4FJMA 1L5UA 4CEZA 2FBXA 4BRLA 3THWA 4HVJA 2CGKA 2Q3SA 2A5XA 4JKGB 1WBBA 1ESVA 4YDUA 3MCPA 4NYNA 5JS2A 4N76A 3HM9A 1GLDG 4RCHA 4DF4A 3ZSQA 4DQ8A 5B8HA 2QEXN 4BWMA 3FZLA 4KHSA 3LDSA 3RR8A 4W5RA 1OH8A 2FXUA 4OGCA 1NKCA 3BF3A 5JVGL 3ZLJA 4DQQA 5KPZA 1Q86O 2HNZA 4H0TB 3F9KA 4RW7A 2VCPA 2NRHA 3H3OB 4O4GA 4BRIA 2ASMA 3G0ZA 3VOVA 1TK0A 3VF4A 2IIRA 4CJTA
chains in the Genus database with same CATH topology
4FJIA 1HNIA 4R5PA 5C25A 4KRFA 3NGYA 3AVCA 3VA0A 1JLEA 2XY5A 2PYJA 1RBUA 2YHAA 3AVBA 1X1PA 4C8OA 3LP1A 4HCCA 1ASWA 1BQMA 5SZTA 4W5NA 1B92A 1JLGA 5HRNA 3V1OA 4CJWA 4CHPA 3OS1A 1EXQA 2PY5A 1KFDA 1VSLA 3B6PA 3O3GA 3SQ0A 4FLWA 2YNGA 5J1EA 1SKRA 4O55A 4KKOA 4M3UA 3KLGA 4M3ZA 4E7KA 1RBVA 3VA3A 4J2BA 2RPIA 2AJQA 3D45A 4LY7A 4DU1A 1RT3A 2OA8A 4OPKA 4LH4A 4CEFA 2P1JA 3CQ8A 2R7YA 1NOYA 4UQGA 1BI4B 2A1RA 4F8RA 3VQDA 2FBVA 4QCLA 2QKKA 3CFRA 2G8UA 4KHQA 1RT4A 1KLNA 2HVHA 5HBMA 4CIGA 3LP0A 4AH9A 1N5YA 3K58A 3IS9A 3AA5X 4NYFA 1BHLA 2X6NA 3B6OA 3OYEA 4CFAA 3ISNC 3HYFA 3NGZA 4CERA 3TWHA 1RT7A 3QETA 1VSKA 3L2RA 1ASVA 3ZSWA 4DSFA 1T05A 4FK0A 3DLRA 3HPHA 3T3FA 1Y97A 4AHCA 3L2VA 1S6PA 4FLUA 4FJ7A 3HVTA 3JSMA 3AO4A 5HP1A 4M3WA 4F3TA 4E0DA 1KSPA 4DSJA 3T1AA 3QESA 1JL1A 5DK5A 1LW2A 4CGDA 3RMAA 2XY6A 1NK9A 1Q8IA 2E6MA 3OS2A 4Z4IA 1I3AA 4FJ8A 3LAKA 1WSGA 3SUQA 1NJWA 2LSNA 1JLFA 1EETA 5CY4A 4JRPA 4FLZA 3IG1A 4MFBA 1Q9YA 2G8KA 1T7PA 3OYGA 2NUBA 1EX4A 3BGRA 4JRQA 2HMIA 2IAJA 4IG0A 1RNHA 1VRUA 1C1CA 4NCAA 1A5WA 1BGXT 1FKPA 1WLJA 4KB1A 5J2MA 4Z4GA 3PX0A 3V81A 1LAWA 2KFNA 1K6YA 2G8VA 2X78A 4C8LA 1S9EA 4QAGA 4ELVA 4HUFA 3MEEA 4M41A 2BGGA 4CGJA 3NGIA 3TAEA 3OJUA 3TAQA 3S3MA 4ZHRA 1RBTA 3AVGA 1LV5A 3K59A 3CM5A 1X9MA 1L3SA 2DFEA 4OLBA 4BWJA 4Z4CA 2F8SA 4KAZA 1GOBA 1TK8A 2YV0X 4DQSA 4CF9A 1YVUA 1SKSA 1BQNA 2G8HA 4PQUA 2X74A 3VQCA 4LD0A 4FM0A 1U49A 4FJGA 1UAXA 4Z0UA 5D3GA 1YTUA 2D5RA 4MQ3A 4OKEA 1NK4A 1C1BA 1TKZA 2IGIA 3HJFA 2DTUA 3LZIA 1EKEA 4KHUA 1C1AA 4CE9A 3ZT1A 1DTQA 1VRTA 4DTRA 4DFMA 1RT1A 1ITGA 3DLHA 4CJ3A 4K8XA 3IRXA 1I39A 4AHTA 3U3GA 4CJEA 1XHZA 2KZZA 2RKIA 3PX6A 1L3TA 4M45A 3D0PA 3OYJA 3QNNA 1VSIA 4FZYA 4B9NA 2D0BA 3OYMA 5J2QA 4KHYA 1CZBA 4FJXA 1X9SA 4ELTA 1B9DA 4CHQA 4NCBA 1UOCA 1L3VA 3DOKA 1QSLA 4DQPA 2HHSA 2OPRA 4EP4A 4KPYA 1RDBA 1VSFA 1J5OA 2VWKA 3TI0A 1F21A 2KQ2A 1XC9A 4AILC 3KD5E 4DMNA 1NJYA 4W5OA 1IKVA 3HT3A 2IDOA 3K5MA 3SJJA 4FVMA 4BE2A 4CCHA 3KD1E 1S9GA 3V4IA 1HNVA 1YT3A 3LZJA 3SCXA 3NCIA 4CESA 4ELUA 1XWLA 2D0AA 1RTIA 1J53A 1VSJA 2ITGA 3VQAA 3RRGA 3PX4A 3H08A 3AA2A 1RILA 4CJQA 1TK5A 4CGFA 3ZSRA 3CFPA 2OPSA 2DY4A 3O4NA 3VQ6A 4CJKA 3HPOA 4DLEA 3QERA 1WNSA 2YKMA 4CEBA 4FJLA 2IS3A 4LSNA 2B5JA 3ZT2A 2B4JA 1TVRA 5KTQA 4FZZA 3OYLA 5J2NA 1S1XA 4FJHA 3ZSYA 4JS4A 3AVFA 1DTTA 4CGGA 4IG3A 4DG1A 1C0TA 2E4LA 3ZSZA 3SNNA 3RMDA 2O4GA 3OYBA 3LPTA 5EU7A 4CJPA 4N56A 3VQ4A 2XO7A 3DLBA 3QEPA 3LP3A 1QSYA 5CYQA 1SL0A 1W9HA 4J2AA 4C8KA 4FJ9A 4YFUA 1NJXA 4E3SA 4DTUA 3TABA 1DLOA 2FBYA 3RRHA 2HHTA 3OVNA 3L2WA 4BE0A 2ATQA 4DTNA 2OPQA 4FK2A 1QS4A 4CJRA 2QKBA 2PYLA 2GV9A 3IAYA 1LW0A 1ZBUA 3CG7A 1S1TA 4LH5A 1D8YA 4FLVA 1ZBIA 3M8QA 4CJ5A 3V9ZA 4OKJA 3V1QA 1NK0A 3AVKA 3M8SA 1QQCA 4DFKA 3C95A 4EZ6A 2WONA 4CJFA 1HQUA 4PY5A 4DS4A 3JYTA 2I5JA 3HK2A 3HP6A 2F8TA 4CEOA 3RMBA 3MEGA 1RBRA 2WOMA 5KI6A 4RW8A 3DLEA 4I2PA 4EP5A 1WAJA 3AV9A 1SKWA 4JLHA 1FK9A 3HP9A 4AHUA 3SQ4A 2HHXA 1NK5A 4CJUA 4BE1A 1KCFA 2HNDA 4DU4A 1TV6A 3MXIA 1HJRA 2Z1IA 3WNHA 3RWUA 1VSEA 1JL2A 1EP4A 1S1VA 4CHNA 4O5BA 3LPUA 4CF8A 3M8RA 4FLYA 4M3YA 3MXJA 1TL3A 3DLKA 1U45A 1GOAA 3DI6A 3OS0A 3TR8A 4W5TA 3NHGA 3HL8A 4DSLA 4F2SA 1UWBA 2HVIA 2HNYA 1TAQA 4I2QA 3VQ7A 4AHRA 5CYMA 3ULDA 1X9WA 1VSHA 5KRTA 5HRPA 3SPZA 4XIUA 2A1SA 3V9WA 1KFSA 2ZQBA 3DRRA 1JXEA 4N5SA 4Z4FA 1J54A 1HMVA 3VQBA 3ZT0A 1W0HA 3SUPA 1BL3A 4E19A 3SPYA 4KV8A 4ID1A 2EX3A 1B9FA 2YNIA 2DFHA 4DU3A 1RDDA 4DQIA 4CJVA 4FJKA 4IFVA 1BCOA 3O3FA 3OYNA 3TAMA 4F3OA 1HYSA 3ZCMA 2RF2A 2ZE2A 3LAMA 3T19A 4B9SA 2VG5A 4H4MA 2Z1HA 4C8MA 4DWIA 1BIZA 3AVMA 1D9DA 3DRSA 4ID5A 3ZSOA 1NKBA 4Z4EA 3ZSVA 4FLXA 4B9LA 3NF7A 5HLFA 1CXQA 4CGHA 1IG9A 4CFDA 4WE1A 1NK8A 2FBTA 2QXFA 3QINA 1LAVA 2QK9A 3NAEA 4DS5A 3TAGA 4CHOA 3SZ2A 3C6TA 1WSHA 2XHBA 1R0AA 3P83D 4E7IA 1CZ9A 3AO3A 3P5JA 4ICLA 3E01A 5FRNA 5FRMA 4E7LA 3V6DA 4DSEA 1TGOA 3OYDA 4GVMA 2X6SA 4CF1A 1JLBA 3QNOA 1RTDA 4CIEA 3L3UA 1HYZA 2KFZA 2XY7A 1A5XA 4PUOA 3AVLA 4FJ5A 1C6VA 1YTAA 1S6QA 2KTQA 1S1UA 4DFPA 1J9AA 3WNFA 4IKFA 1XHXA 4QOZB 4HCBA 3S9HA 4M3TA 2XRIA 4DTSA 4DF8A 3PY8A 2P5OA 4CJSA 1QHTA 3MECA 3AVJA 3CM6A 2BDPA 2OYQA 1QTMA 1RTHA 1TL1A 1JKHA 4FXDA 5FROA 3RMCA 1HQEA 4CJ4A 4CEQA 4OPJA 2D0CA 1JLQA 2BE2A 3KK1A 3I8DA 2Y1IA 4FYDA 4N41A 1WSJA 1TKXA 4PA1A 4GW6A 3TARA 3L8BA 5KGWA 1S1WA 4YNQA 4FM1A 4DTPA 3QEXA 4B9VA 2Z1GA 3TAFA 4CK3A 4E1NA 4ZTJA 3AVIA 1T8EA 4CEEA 1IKYA 3MXMA 4JS5A 3NE6A 3VN5A 3KK3A 3UIQA 4DTOA 3HVRA 1LWFA 4CHYA 1WSIA 2FC0A 5T7BA 1S5JA 1RDCA 2W42A 1IO2A 4B9MA 1A5VA 1SL2A 1IKWA 3U6FA 2Y1JA 3MEDA 2B6AA 5JS1A 1KTQA 3LALA 4IFYA 3OJSA 1NOZA 3NF9A 4W5QA 3LP2A 4B8AB 2G8FA 4O44A 3PV8A 1HRHA 1LWCA 3MAQA 4AHSA 3SUNA 4H8KA 3OYKA 1RCHA 3HSTB 3ITHA 1U48A 4I7FA 4B8CA 2HW3A 5HRSA 3HXMA 1Q9XA 4CFCA 4CHZA 1NJZA 3M8PA 1TAUA 4KI6A 3KLHA 4J2DA 4M3RA 4CJLA 2F96A 4FJJA 3OYAA 1U4BA 4B9TA 2OZSA 4KFBA 4LSLA 3AO2A 1JXBA 4RG8A 3QEIA 4HUGA 1QSSA 4GMJB 3ZT3A 3KIOA 4OKKA 1KVAA 2ZD1A 1TKTA 3K2PA 1IH7A 4I9LA 3RR7A 5KRSA 4FLTA 3OYFA 2YNHA 4FM2A 3L2QA 3SI6A 4KTQA 1FKOA 3F73A 2JGUA 3NH2A 3DRPA 3DYAA 3OY9A 4DSKA 4DTMA 2XY8A 3SQ2A 1CLQA 3C94A 5C42A 3NBPA 1HPZA 3DLGA 5CZ2A 3AVNA 4AHVA 4CFBA 1C0MA 3ZSXA 3KLEA 4DQRA 4RW4A 1N6QA 4KHNA 4M3XA 1C0UA 3TAPA 4O0IA 3KLIA 1T03A 4J2EA 3PO5A 1SUQA 4DLGA 4KHWA 2HHUA 4B3OA 4OVLA 5HRRA 3LWMA 4DTXA 3S3NA 3WNEA 3ZT4A 1CXUA 5I3UA 2HHQA 1KLMA 3HPGA 3LANA 5K14A 4HUEA 4KTZA 4E7JA 3V1RA 1RT5A 3SUOA 4CF2A 5C24A 1ZBLA 4FZXC 1U47A 1BIUA 4TSXA 4CEAA 1KVCA 3QEWA 5DMRA 1SL1A 3K5NA 1SV5A 1XI1A 1UA0A 2HHWA 1Z26A 1U04A 3V9SA 4PWDA 5J2PA 4IBNA 3KK2A 4OLAA 2G8WA 4CECA 1D5AA 1GOCA 1UA1A 3SQ1A 2E6LA 1ZBFA 2YKNA 3FFIA 4M42A 3BDPA 3C6UA 2O4IA 4RW6A 1KRPA 1NKEA 3VQ5A 3U3YA 3OYHA 4CEDA 2KZMA 5HROA 4DFJA 4IDKA 4H4OA 3A2FA 3EYZA 2ETJA 3K57A 4CK1A 4HTUA 3QIPA 3L2UA 2GBZA 1ASUA 3SV4A 3K5OA 1JLAA 1RT6A 3S3OA 3QIOA 3AO5A 3QLHA 3L3VA 4KI4A 2P51A 4BDPA 3DOLA 1VSMA 1BISA 1RBSA 1Z25A 3CFOA 4B08A 3G10A 3KLFA 4G1QA 1WAFA 4E7HA 2HHVA 2JLEA 2IC3A 4RW9A 3ASMA 3O3HA 2PZSA 1BCMA 4DSIA 4K8ZA 3DMJA 1VK0A 3ALYA 4E89A 2GUIA 4CGIA 3RTVA 3QO9A 3PO4A 1JLCA 2OZMA 4EZ9A 3HO1A 1FXXA 4F2RA 2HB5A 3KJVA 4FW1A 3KTQA 5I42A 4Z4HA 3OYCA 4Q0BA 5SWMA 4ZTFA 3VQEA 4CK2A 3P1GA 3AVAA 4Y1DA 4BDYA 3V9XA 3NFAA 3NF6A 3SYZA 4FK4A 3VQ8A 4Y1CA 1ZBHA 3VQ9A 1BI4A 3LWLA 4L8RB 4FJMA 1L5UA 4CEZA 2RN2A 3NDKA 2G8IA 1RT2A 1IKXA 2FBXA 2IOCA 4BACA 4FJNA 3DM2A 1WSFA 3KKSA 3V9UA 1WN7A 3QEVA 4HVJA 2DFFA 3EY1A 1HYVA 4FW2A 2BANA 2Q3SA 4FCYA 2VG6A 4B9UA 5E41A 4KO0A 3VQPA 5KGXA 3AA4A 3WNGA 3OYIA 3THVA 3VQQA 4O0JA 1TKDA 2OPPA 1LWEA 2YNFA 3TANA 3SV3A 4NYNA 5JS2A 4N76A 3HM9A 3CYMA 1ZYQA 4KREA 1RDAA 4N47A 5CZ1A 3ZSQA 3K5LA 4DF4A 4DTJA 4BWMA 2VG7A 3NF8A 1D9FA 1NK6A 2EHGA 4KHSA 1REVA 4CIFA 4Q5VA 3LDSA 4W5RA 3RR8A 1VSDA 3AVHA 3O4QA 4OGCA 4OGEA 1NKCA 3PUFA 4KB0A 2KW4A 3AO1A 3AA3A 2P5GA 1NK7A 2YHBA 4CF0A 4DQQA 3KKRA 1MU2A 1O1WA 3NH1A 2HNZA 4KTWA 1QE1A 3NH0A 1G15A 1RTJA 3F9KA 4RW7A 4I9QA 4NCGA 3I0SA 2Z1JA 4E1MA 5FDLA 4OJRA 4HHTA 4O4GA 3EZ5A 3G0ZA 3I0RA 4C8NA 2VWJA 1TK0A 4BDZA 1L3UA 1WSEA 4F4KA 1KVBA 4CJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FJI A;  1HNI A;  4R5P A;  5C25 A;  4KRF A;  3NGY A;  3AVC A;  3VA0 A;  1JLE A;  2XY5 A;  2PYJ A;  1RBU A;  2YHA A;  3AVB A;  1X1P A;  4C8O A;  3LP1 A;  4HCC A;  1ASW A;  1BQM A;  5SZT A;  4W5N A;  1B92 A;  1JLG A;  5HRN A;  3V1O A;  4CJW A;  4CHP A;  3OS1 A;  1EXQ A;  2PY5 A;  1KFD A;  1VSL A;  3B6P A;  3O3G A;  3SQ0 A;  4FLW A;  2YNG A;  5J1E A;  1SKR A;  4O55 A;  4KKO A;  4M3U A;  3KLG A;  4M3Z A;  4E7K A;  1RBV A;  3VA3 A;  4J2B A;  2RPI A;  2AJQ A;  3D45 A;  4LY7 A;  4DU1 A;  1RT3 A;  2OA8 A;  4OPK A;  4LH4 A;  4CEF A;  2P1J A;  3CQ8 A;  2R7Y A;  1NOY A;  4UQG A;  1BI4 B;  2A1R A;  4F8R A;  3VQD A;  2FBV A;  4QCL A;  2QKK A;  3CFR A;  2G8U A;  4KHQ A;  1RT4 A;  1KLN A;  2HVH A;  5HBM A;  4CIG A;  3LP0 A;  4AH9 A;  1N5Y A;  3K58 A;  3IS9 A;  3AA5 X;  4NYF A;  1BHL A;  2X6N A;  3B6O A;  3OYE A;  4CFA A;  3ISN C;  3HYF A;  3NGZ A;  4CER A;  3TWH A;  1RT7 A;  3QET A;  1VSK A;  3L2R A;  1ASV A;  3ZSW A;  4DSF A;  1T05 A;  4FK0 A;  3DLR A;  3HPH A;  3T3F A;  1Y97 A;  4AHC A;  3L2V A;  1S6P A;  4FLU A;  4FJ7 A;  3HVT A;  3JSM A;  3AO4 A;  5HP1 A;  4M3W A;  4F3T A;  4E0D A;  1KSP A;  4DSJ A;  3T1A A;  3QES A;  1JL1 A;  5DK5 A;  1LW2 A;  4CGD A;  3RMA A;  2XY6 A;  1NK9 A;  1Q8I A;  2E6M A;  3OS2 A;  4Z4I A;  1I3A A;  4FJ8 A;  3LAK A;  1WSG A;  3SUQ A;  1NJW A;  2LSN A;  1JLF A;  1EET A;  5CY4 A;  4JRP A;  4FLZ A;  3IG1 A;  4MFB A;  1Q9Y A;  2G8K A;  1T7P A;  3OYG A;  2NUB A;  1EX4 A;  3BGR A;  4JRQ A;  2HMI A;  2IAJ A;  4IG0 A;  1RNH A;  1VRU A;  1C1C A;  4NCA A;  1A5W A;  1BGX T;  1FKP A;  1WLJ A;  4KB1 A;  5J2M A;  4Z4G A;  3PX0 A;  3V81 A;  1LAW A;  2KFN A;  1K6Y A;  2G8V A;  2X78 A;  4C8L A;  1S9E A;  4QAG A;  4ELV A;  4HUF A;  3MEE A;  4M41 A;  2BGG A;  4CGJ A;  3NGI A;  3TAE A;  3OJU A;  3TAQ A;  3S3M A;  4ZHR A;  1RBT A;  3AVG A;  1LV5 A;  3K59 A;  3CM5 A;  1X9M A;  1L3S A;  2DFE A;  4OLB A;  4BWJ A;  4Z4C A;  2F8S A;  4KAZ A;  1GOB A;  1TK8 A;  2YV0 X;  4DQS A;  4CF9 A;  1YVU A;  1SKS A;  1BQN A;  2G8H A;  4PQU A;  2X74 A;  3VQC A;  4LD0 A;  4FM0 A;  1U49 A;  4FJG A;  1UAX A;  4Z0U A;  5D3G A;  1YTU A;  2D5R A;  4MQ3 A;  4OKE A;  1NK4 A;  1C1B A;  1TKZ A;  2IGI A;  3HJF A;  2DTU A;  3LZI A;  1EKE A;  4KHU A;  1C1A A;  4CE9 A;  3ZT1 A;  1DTQ A;  1VRT A;  4DTR A;  4DFM A;  1RT1 A;  1ITG A;  3DLH A;  4CJ3 A;  4K8X A;  3IRX A;  1I39 A;  4AHT A;  3U3G A;  4CJE A;  1XHZ A;  2KZZ A;  2RKI A;  3PX6 A;  1L3T A;  4M45 A;  3D0P A;  3OYJ A;  3QNN A;  1VSI A;  4FZY A;  4B9N A;  2D0B A;  3OYM A;  5J2Q A;  4KHY A;  1CZB A;  4FJX A;  1X9S A;  4ELT A;  1B9D A;  4CHQ A;  4NCB A;  1UOC A;  1L3V A;  3DOK A;  1QSL A;  4DQP A;  2HHS A;  2OPR A;  4EP4 A;  4KPY A;  1RDB A;  1VSF A;  1J5O A;  2VWK A;  3TI0 A;  1F21 A;  2KQ2 A;  1XC9 A;  4AIL C;  3KD5 E;  4DMN A;  1NJY A;  4W5O A;  1IKV A;  3HT3 A;  2IDO A;  3K5M A;  3SJJ A;  4FVM A;  4BE2 A;  4CCH A;  3KD1 E;  1S9G A;  3V4I A;  1HNV A;  1YT3 A;  3LZJ A;  3SCX A;  3NCI A;  4CES A;  4ELU A;  1XWL A;  2D0A A;  1RTI A;  1J53 A;  1VSJ A;  2ITG A;  3VQA A;  3RRG A;  3PX4 A;  3H08 A;  3AA2 A;  1RIL A;  4CJQ A;  1TK5 A;  4CGF A;  3ZSR A;  3CFP A;  2OPS A;  2DY4 A;  3O4N A;  3VQ6 A;  4CJK A;  3HPO A;  4DLE A;  3QER A;  1WNS A;  2YKM A;  4CEB A;  4FJL A;  2IS3 A;  4LSN A;  2B5J A;  3ZT2 A;  2B4J A;  1TVR A;  5KTQ A;  4FZZ A;  3OYL A;  5J2N A;  1S1X A;  4FJH A;  3ZSY A;  4JS4 A;  3AVF A;  1DTT A;  4CGG A;  4IG3 A;  4DG1 A;  1C0T A;  2E4L A;  3ZSZ A;  3SNN A;  3RMD A;  2O4G A;  3OYB A;  3LPT A;  5EU7 A;  4CJP A;  4N56 A;  3VQ4 A;  2XO7 A;  3DLB A;  3QEP A;  3LP3 A;  1QSY A;  5CYQ A;  1SL0 A;  1W9H A;  4J2A A;  4C8K A;  4FJ9 A;  4YFU A;  1NJX A;  4E3S A;  4DTU A;  3TAB A;  1DLO A;  2FBY A;  3RRH A;  2HHT A;  3OVN A;  3L2W A;  4BE0 A;  2ATQ A;  4DTN A;  2OPQ A;  4FK2 A;  1QS4 A;  4CJR A;  2QKB A;  2PYL A;  2GV9 A;  3IAY A;  1LW0 A;  1ZBU A;  3CG7 A;  1S1T A;  4LH5 A;  1D8Y A;  4FLV A;  1ZBI A;  3M8Q A;  4CJ5 A;  3V9Z A;  4OKJ A;  3V1Q A;  1NK0 A;  3AVK A;  3M8S A;  1QQC A;  4DFK A;  3C95 A;  4EZ6 A;  2WON A;  4CJF A;  1HQU A;  4PY5 A;  4DS4 A;  3JYT A;  2I5J A;  3HK2 A;  3HP6 A;  2F8T A;  4CEO A;  3RMB A;  3MEG A;  1RBR A;  2WOM A;  5KI6 A;  4RW8 A;  3DLE A;  4I2P A;  4EP5 A;  1WAJ A;  3AV9 A;  1SKW A;  4JLH A;  1FK9 A;  3HP9 A;  4AHU A;  3SQ4 A;  2HHX A;  1NK5 A;  4CJU A;  4BE1 A;  1KCF A;  2HND A;  4DU4 A;  1TV6 A;  3MXI A;  1HJR A;  2Z1I A;  3WNH A;  3RWU A;  1VSE A;  1JL2 A;  1EP4 A;  1S1V A;  4CHN A;  4O5B A;  3LPU A;  4CF8 A;  3M8R A;  4FLY A;  4M3Y A;  3MXJ A;  1TL3 A;  3DLK A;  1U45 A;  1GOA A;  3DI6 A;  3OS0 A;  3TR8 A;  4W5T A;  3NHG A;  3HL8 A;  4DSL A;  4F2S A;  1UWB A;  2HVI A;  2HNY A;  1TAQ A;  4I2Q A;  3VQ7 A;  4AHR A;  5CYM A;  3ULD A;  1X9W A;  1VSH A;  5KRT A;  5HRP A;  3SPZ A;  4XIU A;  2A1S A;  3V9W A;  1KFS A;  2ZQB A;  3DRR A;  1JXE A;  4N5S A;  4Z4F A;  1J54 A;  1HMV A;  3VQB A;  3ZT0 A;  1W0H A;  3SUP A;  1BL3 A;  4E19 A;  3SPY A;  4KV8 A;  4ID1 A;  2EX3 A;  1B9F A;  2YNI A;  2DFH A;  4DU3 A;  1RDD A;  4DQI A;  4CJV A;  4FJK A;  4IFV A;  1BCO A;  3O3F A;  3OYN A;  3TAM A;  4F3O A;  1HYS A;  3ZCM A;  2RF2 A;  2ZE2 A;  3LAM A;  3T19 A;  4B9S A;  2VG5 A;  4H4M A;  2Z1H A;  4C8M A;  4DWI A;  1BIZ A;  3AVM A;  1D9D A;  3DRS A;  4ID5 A;  3ZSO A;  1NKB A;  4Z4E A;  3ZSV A;  4FLX A;  4B9L A;  3NF7 A;  5HLF A;  1CXQ A;  4CGH A;  1IG9 A;  4CFD A;  4WE1 A;  1NK8 A;  2FBT A;  2QXF A;  3QIN A;  1LAV A;  2QK9 A;  3NAE A;  4DS5 A;  3TAG A;  4CHO A;  3SZ2 A;  3C6T A;  1WSH A;  2XHB A;  1R0A A;  3P83 D;  4E7I A;  1CZ9 A;  3AO3 A;  3P5J A;  4ICL A;  3E01 A;  5FRN A;  5FRM A;  4E7L A;  3V6D A;  4DSE A;  1TGO A;  3OYD A;  4GVM A;  2X6S A;  4CF1 A;  1JLB A;  3QNO A;  1RTD A;  4CIE A;  3L3U A;  1HYZ A;  2KFZ A;  2XY7 A;  1A5X A;  4PUO A;  3AVL A;  4FJ5 A;  1C6V A;  1YTA A;  1S6Q A;  2KTQ A;  1S1U A;  4DFP A;  1J9A A;  3WNF A;  4IKF A;  1XHX A;  4QOZ B;  4HCB A;  3S9H A;  4M3T A;  2XRI A;  4DTS A;  4DF8 A;  3PY8 A;  2P5O A;  4CJS A;  1QHT A;  3MEC A;  3AVJ A;  3CM6 A;  2BDP A;  2OYQ A;  1QTM A;  1RTH A;  1TL1 A;  1JKH A;  4FXD A;  5FRO A;  3RMC A;  1HQE A;  4CJ4 A;  4CEQ A;  4OPJ A;  2D0C A;  1JLQ A;  2BE2 A;  3KK1 A;  3I8D A;  2Y1I A;  4FYD A;  4N41 A;  1WSJ A;  1TKX A;  4PA1 A;  4GW6 A;  3TAR A;  3L8B A;  5KGW A;  1S1W A;  4YNQ A;  4FM1 A;  4DTP A;  3QEX A;  4B9V A;  2Z1G A;  3TAF A;  4CK3 A;  4E1N A;  4ZTJ A;  3AVI A;  1T8E A;  4CEE A;  1IKY A;  3MXM A;  4JS5 A;  3NE6 A;  3VN5 A;  3KK3 A;  3UIQ A;  4DTO A;  3HVR A;  1LWF A;  4CHY A;  1WSI A;  2FC0 A;  5T7B A;  1S5J A;  1RDC A;  2W42 A;  1IO2 A;  4B9M A;  1A5V A;  1SL2 A;  1IKW A;  3U6F A;  2Y1J A;  3MED A;  2B6A A;  5JS1 A;  1KTQ A;  3LAL A;  4IFY A;  3OJS A;  1NOZ A;  3NF9 A;  4W5Q A;  3LP2 A;  4B8A B;  2G8F A;  4O44 A;  3PV8 A;  1HRH A;  1LWC A;  3MAQ A;  4AHS A;  3SUN A;  4H8K A;  3OYK A;  1RCH A;  3HST B;  3ITH A;  1U48 A;  4I7F A;  4B8C A;  2HW3 A;  5HRS A;  3HXM A;  1Q9X A;  4CFC A;  4CHZ A;  1NJZ A;  3M8P A;  1TAU A;  4KI6 A;  3KLH A;  4J2D A;  4M3R A;  4CJL A;  2F96 A;  4FJJ A;  3OYA A;  1U4B A;  4B9T A;  2OZS A;  4KFB A;  4LSL A;  3AO2 A;  1JXB A;  4RG8 A;  3QEI A;  4HUG A;  1QSS A;  4GMJ B;  3ZT3 A;  3KIO A;  4OKK A;  1KVA A;  2ZD1 A;  1TKT A;  3K2P A;  1IH7 A;  4I9L A;  3RR7 A;  5KRS A;  4FLT A;  3OYF A;  2YNH A;  4FM2 A;  3L2Q A;  3SI6 A;  4KTQ A;  1FKO A;  3F73 A;  2JGU A;  3NH2 A;  3DRP A;  3DYA A;  3OY9 A;  4DSK A;  4DTM A;  2XY8 A;  3SQ2 A;  1CLQ A;  3C94 A;  5C42 A;  3NBP A;  1HPZ A;  3DLG A;  5CZ2 A;  3AVN A;  4AHV A;  4CFB A;  1C0M A;  3ZSX A;  3KLE A;  4DQR A;  4RW4 A;  1N6Q A;  4KHN A;  4M3X A;  1C0U A;  3TAP A;  4O0I A;  3KLI A;  1T03 A;  4J2E A;  3PO5 A;  1SUQ A;  4DLG A;  4KHW A;  2HHU A;  4B3O A;  4OVL A;  5HRR A;  3LWM A;  4DTX A;  3S3N A;  3WNE A;  3ZT4 A;  1CXU A;  5I3U A;  2HHQ A;  1KLM A;  3HPG A;  3LAN A;  5K14 A;  4HUE A;  4KTZ A;  4E7J A;  3V1R A;  1RT5 A;  3SUO A;  4CF2 A;  5C24 A;  1ZBL A;  4FZX C;  1U47 A;  1BIU A;  4TSX A;  4CEA A;  1KVC A;  3QEW A;  5DMR A;  1SL1 A;  3K5N A;  1SV5 A;  1XI1 A;  1UA0 A;  2HHW A;  1Z26 A;  1U04 A;  3V9S A;  4PWD A;  5J2P A;  4IBN A;  3KK2 A;  4OLA A;  2G8W A;  4CEC A;  1D5A A;  1GOC A;  1UA1 A;  3SQ1 A;  2E6L A;  1ZBF A;  2YKN A;  3FFI A;  4M42 A;  3BDP A;  3C6U A;  2O4I A;  4RW6 A;  1KRP A;  1NKE A;  3VQ5 A;  3U3Y A;  3OYH A;  4CED A;  2KZM A;  5HRO A;  4DFJ A;  4IDK A;  4H4O A;  3A2F A;  3EYZ A;  2ETJ A;  3K57 A;  4CK1 A;  4HTU A;  3QIP A;  3L2U A;  2GBZ A;  1ASU A;  3SV4 A;  3K5O A;  1JLA A;  1RT6 A;  3S3O A;  3QIO A;  3AO5 A;  3QLH A;  3L3V A;  4KI4 A;  2P51 A;  4BDP A;  3DOL A;  1VSM A;  1BIS A;  1RBS A;  1Z25 A;  3CFO A;  4B08 A;  3G10 A;  3KLF A;  4G1Q A;  1WAF A;  4E7H A;  2HHV A;  2JLE A;  2IC3 A;  4RW9 A;  3ASM A;  3O3H A;  2PZS A;  1BCM A;  4DSI A;  4K8Z A;  3DMJ A;  1VK0 A;  3ALY A;  4E89 A;  2GUI A;  4CGI A;  3RTV A;  3QO9 A;  3PO4 A;  1JLC A;  2OZM A;  4EZ9 A;  3HO1 A;  1FXX A;  4F2R A;  2HB5 A;  3KJV A;  4FW1 A;  3KTQ A;  5I42 A;  4Z4H A;  3OYC A;  4Q0B A;  5SWM A;  4ZTF A;  3VQE A;  4CK2 A;  3P1G A;  3AVA A;  4Y1D A;  4BDY A;  3V9X A;  3NFA A;  3NF6 A;  3SYZ A;  4FK4 A;  3VQ8 A;  4Y1C A;  1ZBH A;  3VQ9 A;  1BI4 A;  3LWL A;  4L8R B;  4FJM A;  1L5U A;  4CEZ A;  2RN2 A;  3NDK A;  2G8I A;  1RT2 A;  1IKX A;  2FBX A;  2IOC A;  4BAC A;  4FJN A;  3DM2 A;  1WSF A;  3KKS A;  3V9U A;  1WN7 A;  3QEV A;  4HVJ A;  2DFF A;  3EY1 A;  1HYV A;  4FW2 A;  2BAN A;  2Q3S A;  4FCY A;  2VG6 A;  4B9U A;  5E41 A;  4KO0 A;  3VQP A;  5KGX A;  3AA4 A;  3WNG A;  3OYI A;  3THV A;  3VQQ A;  4O0J A;  1TKD A;  2OPP A;  1LWE A;  2YNF A;  3TAN A;  3SV3 A;  4NYN A;  5JS2 A;  4N76 A;  3HM9 A;  3CYM A;  1ZYQ A;  4KRE A;  1RDA A;  4N47 A;  5CZ1 A;  3ZSQ A;  3K5L A;  4DF4 A;  4DTJ A;  4BWM A;  2VG7 A;  3NF8 A;  1D9F A;  1NK6 A;  2EHG A;  4KHS A;  1REV A;  4CIF A;  4Q5V A;  3LDS A;  4W5R A;  3RR8 A;  1VSD A;  3AVH A;  3O4Q A;  4OGC A;  4OGE A;  1NKC A;  3PUF A;  4KB0 A;  2KW4 A;  3AO1 A;  3AA3 A;  2P5G A;  1NK7 A;  2YHB A;  4CF0 A;  4DQQ A;  3KKR A;  1MU2 A;  1O1W A;  3NH1 A;  2HNZ A;  4KTW A;  1QE1 A;  3NH0 A;  1G15 A;  1RTJ A;  3F9K A;  4RW7 A;  4I9Q A;  4NCG A;  3I0S A;  2Z1J A;  4E1M A;  5FDL A;  4OJR A;  4HHT A;  4O4G A;  3EZ5 A;  3G0Z A;  3I0R A;  4C8N A;  2VWJ A;  1TK0 A;  4BDZ A;  1L3U A;  1WSE A;  4F4K A;  1KVB A;  4CJT A; 
#chains in the Genus database with same CATH topology
 4FJI A;  4IDH A;  4KRF A;  3NGY A;  3CCQ N;  2XY5 A;  1N8R O;  2J4R A;  2PYJ A;  2QI2 A;  3AVB A;  1X1P A;  4C8O A;  2D1K A;  1ASW A;  1BQM A;  5SZT A;  1I94 K;  5HRN A;  3V1O A;  3DXK B;  3O3G A;  2E1Y A;  4BY9 C;  2YNG A;  4YDU C;  5J1E A;  4O55 A;  4KKO A;  4M3U A;  4E7K A;  3O80 A;  2RPI A;  1OH7 A;  2O8D B;  3VQD A;  1HKC A;  5CE3 A;  5TKW A;  4QS8 A;  3CFR A;  2G8U A;  1RT4 A;  2HVH A;  4BRP A;  5HBM A;  4NXN K;  3K58 A;  4EIA A;  3IS9 A;  5HOO A;  4CFA A;  1K73 O;  4BRE A;  3C6H A;  4NO7 A;  2KLA A;  1BWF O;  1RT7 A;  1VSK A;  4FK0 A;  4DR6 K;  3DLR A;  4FLU A;  3L2V A;  1RGI A;  4XH4 A;  3QES A;  2XY6 A;  2E6M A;  3FE1 A;  3HRG A;  4CZJ A;  4OPA A;  3CER A;  4JRP A;  5BN9 A;  4FLZ A;  3E1Y A;  1C0F A;  1T7P A;  2NUB A;  4R79 A;  2IAJ A;  4IG0 A;  1RNH A;  1C1C A;  1N36 K;  5AZJ B;  4FWK A;  4NCA A;  1YUW A;  4Z4G A;  1LAW A;  2X78 A;  4C8L A;  4QAG A;  4ELV A;  1QQO A;  4HUF A;  2A6A A;  2BGG A;  3TAE A;  3NGI A;  3MN7 A;  4UY8 O;  4GV3 A;  3HSC A;  2O8B A;  1L3S A;  4DUZ K;  1TK8 A;  4B3T K;  3CCU N;  3CJA A;  1NBW A;  2QTD A;  3B8A X;  1C1B A;  1BA1 A;  2IGI A;  2DTU A;  3LZI A;  1C1A A;  1DTQ A;  3QBX A;  4DFM A;  1E3M A;  1RT1 A;  3QML A;  1P90 A;  1ITG A;  3IRX A;  4AHT A;  2RKI A;  1E4G T;  1L3T A;  1W7A A;  1HKB A;  4B9N A;  2D0B A;  1CZB A;  2Q1N A;  4FWR A;  1X9S A;  4C1N I;  1UOC A;  1QSL A;  4FOI A;  5GAH P;  2HHS A;  1VSF A;  1J5O A;  2VWK A;  1D4X A;  3D2F B;  3O8M A;  4AIL C;  4DMN A;  1IKV A;  3O1W A;  3K5M A;  2YX6 A;  4BE2 A;  3KD1 E;  1S9G A;  5AQW A;  2QKB A;  4ELU A;  4C1N K;  4LFC K;  2VWB A;  1VQP N;  3PX4 A;  5F0X A;  1G99 A;  1RIL A;  2OAN A;  3ZET B;  3CFP A;  1H1V A;  2OPS A;  3O4N A;  1WNS A;  2YKM A;  1NGI A;  3ZT2 A;  1T6D A;  5KTQ A;  5J2N A;  4B1X B;  3VTH A;  1DEJ A;  4DG1 A;  1C0T A;  3W0L A;  3LM2 A;  2F9W A;  2OCE A;  2P9K A;  1S3X A;  4NB4 A;  1W2B M;  1K9M O;  4JI8 K;  5FPD A;  4J2A A;  1HNX K;  4FJ9 A;  2OTJ N;  4DTU A;  4JNE A;  3KZB A;  4DV5 K;  4BE0 A;  3TSQ A;  1W97 L;  5BPL A;  1NG9 A;  1LW0 A;  4LC9 B;  2E2N A;  3O1B A;  1VQ5 N;  3V1Q A;  3SAG A;  4DFK A;  3C95 A;  4EZ6 A;  2RHK A;  4PKG A;  1Q7Y O;  4KBO A;  3HP6 A;  3BZC A;  1IG8 A;  1SKW A;  2O8E B;  1WAJ A;  3AV9 A;  1QHA A;  3VEX A;  1FK9 A;  4AHU A;  2QA4 N;  1IV0 A;  1NK5 A;  3MXI A;  1HJR A;  3R9P A;  4CZI A;  1JL2 A;  3CF5 L;  4CHN A;  2ZM6 K;  1IBL K;  3LPU A;  3M8R A;  3CC2 N;  4FLY A;  4M3Y A;  1TL3 A;  3DLK A;  1U45 A;  3J8A A;  2E2P A;  4W5T A;  1UWB A;  4DV6 K;  2HVI A;  2HNY A;  1TAQ A;  4AHR A;  3TTF A;  3ULD A;  3SPZ A;  5HRP A;  3FFK B;  1JXE A;  4N5S A;  4Z4F A;  1J54 A;  1HMV A;  1B9F A;  1RDD A;  4JHD B;  3OYN A;  4F3O A;  4BRA A;  4JHD A;  4YOW A;  4DUY K;  4B9S A;  2VG5 A;  2Z1H A;  3O5B A;  3AVM A;  1D9D A;  3ZSO A;  4Z4E A;  1KC8 O;  3ATU A;  3WUH A;  1LAV A;  2UUA K;  3EKS A;  2QK9 A;  4DS5 A;  3TAG A;  3C6T A;  1WSH A;  3M1F A;  4DR4 K;  1SZ2 A;  4EAH D;  1CZ9 A;  2HMP A;  3TTD A;  4IJN A;  3NMU A;  4H0X B;  1TGO A;  3OYD A;  3BP8 A;  4LF4 K;  1JLB A;  2KFZ A;  1A5X A;  3T1H K;  1OKJ A;  3AVL A;  1S1U A;  4IKF A;  2XRI A;  1U2V A;  1U2V B;  1QHT A;  3AVJ A;  4O5F A;  3VEO A;  1XQS C;  4CEQ A;  4CJ4 A;  4DV1 K;  3TPQ A;  3I8D A;  2Y1I A;  4N41 A;  1WSJ A;  2P9L A;  4GW6 A;  3L8B A;  3CPE A;  3QEX A;  2FSJ A;  2VQE K;  3TAF A;  4CK3 A;  4ZTJ A;  4FO0 A;  3AVI A;  4BQZ A;  4CEE A;  3KK3 A;  4LF8 K;  1YJW N;  4DTO A;  4DV3 K;  4CHY A;  1RDC A;  3IUC A;  4CZK A;  4B9M A;  1A5V A;  1YAG A;  5JS1 A;  3NF9 A;  4B8A B;  1VQN N;  5AQS A;  3MAQ A;  1TUY A;  4H8K A;  1NWK A;  3HST B;  4I6M A;  1HPM A;  3ITH A;  5AQU A;  4ISF A;  4CFC A;  3DJC A;  3MN9 A;  4FJJ A;  2OZS A;  1N33 K;  3O6W A;  1N32 K;  4LSL A;  3T69 A;  1JXB A;  3KIO A;  1TKT A;  3WXK A;  1IH7 A;  4CW7 B;  5KRS A;  1FKO A;  2NRT A;  2JGU A;  3CCM N;  4JAX A;  4V19 S;  1CLQ A;  2QWM A;  1HPZ A;  3DLG A;  5CZ2 A;  3AVN A;  4AHV A;  5DM6 L;  3ZSX A;  1TYQ A;  3W3D A;  3G6E N;  4CZF A;  4FPA A;  2V7Y A;  3VEN A;  4OVL A;  3RSE B;  1OVY A;  3ZT4 A;  1KLM A;  3HPG A;  3LAN A;  5K14 A;  2O8C A;  4TSX A;  3LDQ A;  2HBK A;  1XI1 A;  3V9S A;  1VQ9 N;  3CC4 N;  4OLA A;  4WCE L;  1UA1 A;  3SQ1 A;  2E6L A;  1GLF O;  2YKN A;  3C6U A;  4A61 A;  2E8A A;  1KRP A;  3U3Y A;  4HTL A;  3OYH A;  2KZM A;  5KQ8 A;  4CK1 A;  4HTU A;  3QIP A;  3L2U A;  4FPB A;  2DPN A;  5AQV A;  1JLA A;  3HZ6 A;  3OW2 M;  3LDL A;  1RT6 A;  4DR1 K;  5ADX H;  3S3O A;  3AO5 A;  3QLH A;  4FSV A;  2P51 A;  1RBS A;  1Z25 A;  2OTL N;  1WAF A;  2JLE A;  3KHY A;  1MA9 B;  2IC3 A;  4ILG B;  1QZ5 A;  4CGI A;  2OZM A;  4EZ9 A;  4MLE A;  3KJV A;  3ENH A;  4ZTF A;  3OTO K;  4GY2 B;  3AVA A;  5BR8 K;  4PKI A;  3SYZ A;  5AQK A;  2RN2 A;  3NDK A;  4FJN A;  1WSF A;  3THY A;  5EXW A;  3THY B;  3C7N A;  1VQL N;  4FW2 A;  3VQP A;  5KGX A;  4O8K A;  1TKD A;  1RFQ A;  3L6Q A;  3GOI A;  3SV3 A;  1VQO N;  1ZYQ A;  4DV7 K;  1RDA A;  5CZ1 A;  3K5L A;  3D2E B;  1IBM K;  4BR9 A;  1NK6 A;  1BG3 A;  3O4Q A;  3AO1 A;  3AA3 A;  2P5G A;  3KKR A;  4JK7 A;  3HBT A;  3VES A;  4KTW A;  3NH0 A;  4NCG A;  5FDL A;  4OJR A;  3I0R A;  4C8N A;  2VWJ A;  1V4S A;  1NKB A;  1L3U A;  1WSE A;  5AQR A;  5C25 A;  3OBY A;  4K43 A;  2YHA A;  3WQT A;  1JLG A;  3OS1 A;  1IJJ A;  1VSL A;  4CBW A;  1GLJ O;  4WFA L;  5FPN A;  3T7Z A;  3KLG A;  1RBV A;  4J2B A;  2W6K A;  4U67 L;  3D45 A;  2OA8 A;  2KKZ A;  1Q18 A;  2R7Y A;  5BRD A;  4PHT X;  3SBT A;  4NYF A;  1BHL A;  2X6N A;  3B6O A;  3P38 A;  4A57 A;  1SAZ A;  3WXL A;  3OYE A;  5JLF A;  5IT9 O;  3L2R A;  4DSF A;  1T05 A;  3HPH A;  4JD2 A;  3T3F A;  1Y97 A;  4YOY A;  3MX2 A;  3BY5 A;  3HVT A;  3AO4 A;  3CJC A;  4F3T A;  5JLH A;  3E9L A;  1KSP A;  5M1P A;  4CGD A;  3RMA A;  1MDU B;  3R6M A;  3M6G A;  4FJ8 A;  2UXC K;  1NJW A;  4BRD A;  3IFR A;  1EET A;  5AQY A;  1X3M A;  5AJ3 K;  1Q9Y A;  1HNZ K;  3OYG A;  3BGR A;  4JRQ A;  3VEZ A;  3CHW A;  2QWL A;  4KB1 A;  3A8Y A;  4WYB A;  1U6Z A;  3DXM A;  3O9R A;  3I55 N;  2G8V A;  3SMS A;  2VQF K;  3MDQ A;  3S3M A;  1VQM N;  5GIP A;  3DAW A;  1LV5 A;  3SMP A;  2Q36 A;  4CI6 A;  1X9M A;  4H5N A;  4JKA A;  4CBX A;  1EWR A;  2A40 A;  2WFB A;  4KAZ A;  1GOB A;  2NLX A;  4EHU A;  4JYA K;  1BQN A;  4PQU A;  1UAX A;  3C65 A;  1NK4 A;  4OKE A;  2CGJ A;  3HJF A;  4KHU A;  4CE9 A;  1VRT A;  4CJ3 A;  4JKD A;  3IMX A;  3R1X A;  4M7Y A;  3LDO A;  1V4T A;  3WQU A;  3J80 O;  2KZZ A;  1OVQ A;  4XH1 A;  3R3L A;  4MO5 A;  5J2Q A;  5GIN A;  2A3Z A;  4CHQ A;  4NCB A;  1L3V A;  4RWT A;  4EP4 A;  1RDB A;  3A5M C;  5BPN A;  4I6M B;  5ADX A;  4CCH A;  2QWO A;  1KD1 O;  1XWL A;  1VSJ A;  2ITG A;  1VQ8 N;  3H08 A;  3AAR A;  4CJQ A;  1TK5 A;  2DY4 A;  4DLE A;  3HPO A;  2Q0R A;  4CEB A;  4FJL A;  4LSN A;  2B4J A;  5GAE P;  3MN5 A;  1S1X A;  3VPZ A;  1DTT A;  2VGM A;  4CGG A;  4IG3 A;  3OYB A;  3LPT A;  4CJP A;  1NGB A;  4N56 A;  3VQ4 A;  5AQL A;  4E3S A;  2ZJQ L;  5KPR A;  1DLO A;  3L2W A;  4DTN A;  2OPQ A;  3AAQ A;  3IAY A;  3CG7 A;  1HX1 A;  1CZA N;  4OKJ A;  3AVK A;  4CJF A;  1HQU A;  4PY5 A;  2A41 A;  2E88 A;  3ATV A;  3RMB A;  3MEG A;  1RBR A;  2WOM A;  5KI6 A;  2GTD A;  3DLE A;  4I2P A;  4RW8 A;  3JAM O;  5C10 A;  2O8E A;  3CI5 A;  3HP9 A;  2NNW A;  4BR7 A;  2P9N B;  5EX5 A;  3CD6 N;  4Z94 A;  4FXD A;  3DI6 A;  3FZK A;  3HL8 A;  2D0P A;  4F2S A;  4PKH A;  2IVO A;  5AQJ A;  4BRC A;  3VQ7 A;  1YIT N;  1X9W A;  4A62 A;  5CYM A;  2A1S A;  2ZQB A;  3DRR A;  3Q7C A;  3VQB A;  1W0H A;  5JVH L;  3SUP A;  1NGC A;  2DFH A;  3VEY A;  4DQI A;  3P4I A;  3TAM A;  2FLO A;  1XNR K;  3ZCM A;  3T19 A;  1J5E K;  4C8M A;  1BOT O;  3DRS A;  4OX9 K;  3ZSV A;  5AQG A;  3NF7 A;  1CXQ A;  3CJ7 A;  1BA0 A;  5M1K A;  3QIN A;  4E7I A;  4ICL A;  3E01 A;  5FRN A;  2WUS A;  4E7L A;  4BGA A;  4LFA K;  1RTD A;  3L3U A;  1HYZ A;  1QZ6 A;  4G9Z A;  1YTA A;  4JKF A;  2KTQ A;  3WEE B;  1J9A A;  3WNF A;  4HCB A;  2QWN A;  4M3T A;  4DTS A;  2HBJ A;  4DF8 A;  3PY8 A;  4IWV A;  4CJS A;  3MEC A;  3CM6 A;  2OYQ A;  1QTM A;  2UU9 K;  4IEI A;  1JKH A;  3EZW A;  1HQE A;  3H1V X;  4FYD A;  5C2F A;  3TAR A;  1S72 N;  1S1W A;  4YNQ A;  4FM1 A;  4X65 K;  3GDQ A;  1T8E A;  3MXM A;  1IKY A;  4DV0 K;  4U7B A;  1NNE A;  3ZEU B;  3HVR A;  2FC0 A;  5T7B A;  2W42 A;  1IO2 A;  1OH5 A;  4DKW A;  2NRX A;  1DKG D;  1KTQ A;  3LAL A;  3OJS A;  1NOZ A;  4DR5 K;  3LP2 A;  2G8F A;  1NM1 A;  1NMN A;  1DGK N;  2GWJ A;  5CHI A;  5GAD P;  1HRH A;  4AHS A;  3SUN A;  4F9O A;  1U48 A;  4KH5 A;  4I7F A;  5BN8 A;  2HW3 A;  3THW B;  3M8P A;  1YF5 L;  4M3R A;  4CJL A;  4K42 A;  2YHY A;  3THX B;  2AP1 A;  4HUG A;  4X62 K;  4GMJ B;  1KVA A;  3VF6 A;  3E9P A;  3OYF A;  1RDW X;  2P9U A;  3DRP A;  3DYA A;  4DSK A;  4JI5 K;  5AQH A;  1NGJ A;  2XY8 A;  3SQ2 A;  3C94 A;  1MWM A;  3NBP A;  2NRW A;  1R59 O;  5LMU K;  1N6Q A;  4KHN A;  1C0M A;  5BR9 A;  4BRK A;  3TAP A;  4O0I A;  3MN6 A;  2HHU A;  1EQY A;  3LWM A;  1CXU A;  4FWP A;  5AQQ A;  5JIC A;  1XUP O;  4HUE A;  1ZBL A;  4KTZ A;  1RT5 A;  4CF2 A;  3CXC M;  1WBD A;  3K9J A;  1SL1 A;  1SV5 A;  2FSN A;  2QW9 A;  4A2B A;  1U04 A;  4B1V A;  4BR4 A;  1Q82 O;  4ISG A;  4IBN A;  3KK2 A;  1D5A A;  1GOC A;  4YHH K;  3TTC A;  5AFU A;  3FFI A;  3BDP A;  2O4I A;  2GX9 A;  2ZGY A;  4H4O A;  4CZM A;  3EYZ A;  1XMQ K;  3FLC O;  1JCG A;  2GBZ A;  4BGB A;  1GLC G;  3QIO A;  5FLX O;  5EVZ A;  4BR2 A;  3CFO A;  4B08 A;  3G10 A;  2I7N A;  1HNW K;  3M3Z A;  1M90 O;  4RW9 A;  3O3H A;  3ASM A;  2D4W A;  3L0Q A;  4K8Z A;  3VER A;  3ALY A;  3VMF B;  5KPT A;  1JLC A;  2ZWH A;  2O8F B;  2GEM A;  3KTQ A;  3WXJ A;  1KQS M;  4CK2 A;  2YHX A;  3VGL A;  1TUU A;  4Y1D A;  5F2R A;  3V9X A;  1ZBH A;  2O8D A;  3D6R A;  2E1Z A;  3SBG A;  1BI4 A;  3BF1 A;  3LDN A;  2IOC A;  4BAC A;  3H45 C;  3KKS A;  1WN7 A;  4IOC L;  3QEV A;  2DFF A;  3EY1 A;  3UKR A;  3FZF A;  1HYV A;  3I33 A;  2BAN A;  4B9U A;  2VG6 A;  2OPP A;  1LWE A;  4MO4 A;  3TAN A;  2ZGZ A;  4KRE A;  3CYM A;  4N47 A;  2ZJR L;  4ILH A;  5FPE A;  2VG7 A;  1D9F A;  2EHG A;  4X64 K;  3A5L C;  4ILJ A;  4Q5V A;  3AVH A;  3CCL N;  5AQX A;  4CF0 A;  1O1W A;  3NH1 A;  5EY4 A;  1K8K A;  1QE1 A;  1RTJ A;  3I0S A;  2Z1J A;  4E1M A;  3F9M A;  3EZ5 A;  4BDZ A;  1YT3 A;  4JKE A;  1KVB A;  1MWK A;  4F4K A;  1HNI A;  4BRF A;  3VA0 A;  5BPM A;  3S41 A;  4HCC A;  3JXU A;  3LP1 A;  4GV6 A;  1JJ2 M;  1B92 A;  4CHP A;  4CJW A;  2PY5 A;  3B6P A;  3SQ0 A;  3ENB A;  4M3Z A;  3BEX A;  3VA3 A;  3TU5 A;  1NU0 A;  2AJQ A;  4LY7 A;  4DU1 A;  3G4S N;  2UXD K;  4FWO A;  4OPK A;  4LH4 A;  4CEF A;  2P1J A;  5TKY A;  4FWQ A;  3H1Q A;  4F8R A;  2QKK A;  4KHQ A;  5AR0 A;  3K0S A;  5BRE A;  2P9N A;  4BVO A;  4CIG A;  1N5Y A;  4AH9 A;  4Y0W A;  3C7N B;  4AF1 A;  3HYF A;  2HBM A;  3U9Z A;  4CER A;  3TWH A;  2CH5 A;  1HKG A;  4JD2 B;  1S6P A;  4FJ7 A;  5C0Y A;  2GUP A;  4M3W A;  4E0D A;  2P9I B;  4DSJ A;  3M5R A;  3BZK A;  2HF3 A;  3L4Q A;  2CGL A;  1WSG A;  4JI3 K;  5CY4 A;  4DB3 A;  3CCV N;  2ZF5 O;  2G8K A;  2FSK A;  5C12 A;  2HMI A;  4RTF D;  4JI6 K;  2Q31 A;  4A2A A;  1BGX T;  1FKP A;  3V81 A;  5IWA K;  2KFN A;  1K6Y A;  3JS6 A;  1S9E A;  3D7E O;  2UUC K;  2PAV A;  3MEE A;  3DXK A;  4M41 A;  3TAQ A;  1WUA A;  3OJU A;  4ZHR A;  1RBT A;  3QIC A;  1YJN N;  1NGH A;  3K59 A;  5M1N A;  3ZX3 A;  1ATR A;  2E20 A;  3GBT A;  4BWJ A;  5LJW A;  4Z4C A;  2F8S A;  2YV0 X;  4CF9 A;  1SKS A;  2NRZ A;  4H03 B;  3VQC A;  4FJG A;  5D3G A;  3EN9 A;  1YTU A;  2D5R A;  4MQ3 A;  3HOT A;  1OH6 A;  1EKE A;  2QM1 A;  3DLH A;  4K8X A;  3A5O C;  4CJE A;  3PX6 A;  4M45 A;  4IZ9 A;  3OYJ A;  3GL1 A;  3QNN A;  1VSI A;  3TSP A;  4FZY A;  4IOX A;  1YVN A;  4JN4 A;  4FJX A;  1HUX A;  4ELT A;  1B9D A;  3ZYY X;  4DQP A;  4KPY A;  4PL8 A;  4BRM A;  4B1Y B;  3TI0 A;  4BR5 A;  1XC9 A;  4A5A A;  4W5O A;  3HT3 A;  4B9Q A;  3SJJ A;  3V4I A;  4BRQ A;  3NCI A;  5AQM A;  4CES A;  3P31 A;  4JI0 K;  2D0O A;  1J53 A;  3RRG A;  3THX A;  4WQ5 C;  3AA2 A;  4LF9 K;  3DXM B;  5GAG P;  3ID8 A;  3O9U A;  2B5J A;  1TVR A;  4FZZ A;  3OYL A;  1VAZ A;  4FJH A;  4K41 A;  3ZSZ A;  2CH6 A;  3RMD A;  3ID6 A;  4NLB A;  3LP3 A;  5CYQ A;  3VET A;  1SL0 A;  4YFU A;  3OBW A;  3QFU A;  5FPM A;  3TAB A;  3RRH A;  5AQF A;  1GLE G;  4BG9 A;  4BC3 A;  2HOE A;  4AQY K;  1ILY A;  1QS4 A;  2GV9 A;  2HST A;  1ZBU A;  4LH5 A;  1S1T A;  1D8Y A;  1ZBI A;  4BQL A;  3M8Q A;  4CJ5 A;  2YCH A;  3CJB A;  3O08 A;  4JEP A;  1NK0 A;  2KHO A;  3SAF A;  2WON A;  4CZH A;  3CC7 N;  3VTI A;  1DT9 A;  4IFE A;  3ULE B;  5M1O A;  3ULE A;  2UUB K;  2O8B B;  3DLL L;  2HHX A;  4CJU A;  4DU4 A;  1TV6 A;  4JV5 K;  2Z1I A;  3D2F A;  3WNH A;  4IOA L;  3RWU A;  1EP4 A;  1S1V A;  4O5B A;  4CF8 A;  3MXJ A;  1HLU A;  4WFN L;  2WC9 A;  3WXI A;  1GOA A;  3OS0 A;  4H5V A;  3PIO L;  3NHG A;  4I2Q A;  1Q9X A;  3I8B A;  3O9Q A;  5AQN A;  5KRT A;  1KFS A;  4YY3 K;  4XIU A;  4XEI A;  3V9W A;  4JKB A;  2RE2 A;  3ZT0 A;  1BL3 A;  3SPY A;  2O8F A;  2W41 A;  2E5L K;  4BR0 A;  4DU3 A;  4CJV A;  2A42 A;  4AM7 A;  4FJK A;  1BCO A;  3O3F A;  1HYS A;  3FR0 A;  4C23 A;  4B9L A;  5HLF A;  4CGH A;  1IG9 A;  4FWM A;  4WE1 A;  4CVN E;  2NZT A;  1YI2 N;  3SZ2 A;  2O8C B;  1R0A A;  4FOE A;  3V6D A;  4DSE A;  4GVM A;  2X6S A;  5AZI B;  3U9D A;  4CF1 A;  1Y64 A;  3J7A P;  2XY7 A;  4PUO A;  4PL7 A;  4FJ5 A;  1C6V A;  4BRN A;  5LJV A;  1XHX A;  4MLH A;  3S9H A;  3MWT A;  1VQ6 N;  2W40 A;  2IVP A;  3BUZ B;  4EFH A;  3HOS A;  2BDP A;  1Q81 O;  1HR0 K;  1SQK A;  3RMC A;  1E4F T;  2D0C A;  3KK1 A;  4B3M K;  5JMV A;  5C2D A;  3SAH A;  1TKX A;  4DTP A;  4B9V A;  5C15 A;  1NMD A;  2E2Q A;  3O9S A;  3VN5 A;  4JKH A;  3UIQ A;  1WSI A;  1IKW A;  3U6F A;  4JI2 K;  2Y1J A;  3C6A A;  3EEQ A;  3O9T A;  3MWP A;  4W5Q A;  3IDH A;  1ZBS A;  1KAZ A;  3UB5 A;  3PV8 A;  1LWC A;  3SLC A;  3OYK A;  3DWL A;  4EHT A;  1YIJ N;  1X3N A;  4ISE A;  4CBU A;  4KHP K;  4CHZ A;  1NJZ A;  1TAU A;  4KI6 A;  2PBD A;  3KLH A;  4J2D A;  2F96 A;  4KFB A;  4WQ4 C;  4JKG A;  3J7Z O;  3AO2 A;  4RG8 A;  3CCE N;  2ZD1 A;  3OHR A;  2YNH A;  3L2Q A;  3SI6 A;  1XNQ K;  4BRH A;  3OY9 A;  4HWI A;  4GNI A;  5C42 A;  4H0O A;  4CFB A;  3PSI A;  4RW4 A;  4M3X A;  1C0U A;  1T03 A;  4J2E A;  4NXM K;  4DLG A;  3FZH A;  3QDK A;  1JCE A;  3CCJ N;  1WB9 A;  1VQ7 N;  4FWL A;  2UYT A;  4E7J A;  3SUO A;  4FZX C;  1U47 A;  1BIU A;  2P9L B;  3MX5 A;  4YOR A;  3VGK A;  4LFB K;  5DMR A;  1RDU A;  3CQX A;  3U8X A;  1UA0 A;  2HHW A;  1Z26 A;  4PWD A;  5J2P A;  5LL6 Z;  4CEC A;  2F7T A;  4YOT A;  4RW6 A;  1GLB G;  2BH1 A;  3J7Y P;  3G25 A;  3VQ5 A;  3ZX0 A;  1FW6 A;  5HRO A;  4IDK A;  3T1Y K;  3A2F A;  2ETJ A;  3KWG A;  2YJF A;  3TSU A;  3GG4 A;  3K57 A;  1ASU A;  2YHW A;  3K5O A;  2ZJP L;  4DR2 K;  1ZXO A;  3I56 N;  1NGA A;  4KI4 A;  4GVE A;  3DOL A;  1BIS A;  2P9S B;  2F9T A;  2HHV A;  2PZS A;  1X9J A;  1Z05 A;  1BCM A;  3DMJ A;  3ZEU A;  3PLA A;  3PO4 A;  2IVN A;  3QO9 A;  1QQM A;  4F2R A;  2P9U B;  3O4W A;  2HB5 A;  3HO1 A;  5BRH A;  4B1W B;  5AQZ A;  1VHX A;  5SWM A;  3UE5 A;  1YJ9 N;  3A5N C;  3P1G A;  4BDY A;  3NF6 A;  4FK4 A;  4BRG A;  4IXC A;  4L8R B;  2FF3 B;  2G8I A;  1RT2 A;  1IKX A;  4YOX A;  3DM2 A;  3V9U A;  3G71 N;  4YOU A;  2WTU A;  4WF9 L;  4H0Y B;  3N4P A;  4BG8 A;  4CJ7 A;  4FCY A;  5E84 A;  5AZJ A;  5E41 A;  4KO0 A;  3WNG A;  3AA4 A;  3CJ1 A;  3QB0 A;  2NRV A;  4O0J A;  3VQQ A;  3OYI A;  3ENO A;  3THV A;  1GLA G;  2YNF A;  4QS9 A;  1T44 A;  3PIP L;  2F4V K;  1NGD A;  1KXP A;  4DTJ A;  2VGN A;  3NF8 A;  3VEW A;  1REV A;  1XC3 A;  4B3S K;  1VSD A;  4OGE A;  3AAP A;  3PUF A;  2GWK A;  4KB0 A;  2KW4 A;  2I7P A;  1NK7 A;  2YHB A;  3VGM A;  4BC2 A;  1MU2 A;  3AGR A;  3CCR N;  1LOT B;  1NGE A;  4MDB A;  1G15 A;  3EE9 A;  4I9Q A;  4H5T A;  4HHT A;  4CIF A;  4R5P A;  3AVC A;  1JLE A;  1RBU A;  1KAX A;  4W5N A;  3R8E A;  3U4L A;  1EXQ A;  4LF5 K;  1KFD A;  1HJO A;  4FLW A;  1SKR A;  5AQT A;  4DV2 K;  1RT3 A;  3CQ8 A;  4H0P A;  1NOY A;  4UQG A;  1BI4 B;  2FF6 A;  2A1R A;  2FBV A;  4QCL A;  1BDG A;  1KLN A;  3LP0 A;  2EWS A;  3AA5 X;  4DHY A;  4FL9 A;  3ISN C;  3LDP A;  3NGZ A;  3QET A;  3CPW M;  1ASV A;  3ZSW A;  5HL7 L;  5ELZ A;  4AHC A;  3OA9 A;  1QVG M;  3JSM A;  5HP1 A;  5LMN K;  1ATS A;  2Q0U A;  3T1A A;  1NK9 A;  1JL1 A;  5DK5 A;  1LW2 A;  1Q8I A;  3OS2 A;  4Z4I A;  1I3A A;  3LAK A;  3SUQ A;  2LSN A;  3KWI A;  1JLF A;  4NLC A;  5M1F A;  3IG1 A;  4MFB A;  4DV4 K;  1QVF M;  1K8K B;  2QWQ A;  4BC5 A;  1EX4 A;  5H1S Q;  1GLL O;  1VRU A;  4FWS A;  3FZM A;  1YHQ N;  1A5W A;  1WLJ A;  5J2M A;  3PX0 A;  1ATN A;  2HF4 A;  3D2E A;  4CGJ A;  2Q97 A;  3AVG A;  3CM5 A;  3MMV A;  2DFE A;  4OLB A;  1BU6 O;  4J8F A;  3HI0 A;  4DQS A;  1YVU A;  2G8H A;  4KH6 A;  2X74 A;  4FM0 A;  4LD0 A;  3J81 O;  1U49 A;  4K0K K;  3CJ9 A;  4Z0U A;  1TKZ A;  2JWL A;  3PSF A;  3SK3 A;  3ZT1 A;  4DTR A;  2YJE A;  3CMA N;  1I39 A;  3U3G A;  3A0I X;  1XHZ A;  2HBL A;  4BVP A;  3D0P A;  1K8A O;  1BUP A;  3OYM A;  2JWK A;  4KHY A;  4FWN A;  3DOK A;  2OPR A;  3GE1 A;  3CIP A;  3EO3 A;  2ASO A;  2V52 B;  4LF6 K;  1F21 A;  2KQ2 A;  3KD5 E;  4CZL A;  1NJI O;  4B3R K;  3SJH A;  1NJY A;  5A2Q O;  2IDO A;  4FVM A;  4JK8 A;  1HNV A;  3LZJ A;  3SCX A;  3K9K A;  1JCF A;  2D0A A;  1RTI A;  3VQA A;  2P9P B;  2P9P A;  4CGF A;  3ZSR A;  1YXQ A;  3VQ6 A;  4CJK A;  3QER A;  3EE8 A;  2IS3 A;  3HM8 A;  4WQ5 A;  3ZSY A;  4JS4 A;  3AVF A;  3WEE A;  3MK6 A;  2E4L A;  3SNN A;  2P9K B;  2YI1 A;  3LL3 A;  5GIO A;  3KK7 A;  2O4G A;  4OO1 J;  5EU7 A;  2XO7 A;  3DLB A;  3QEP A;  4CZG A;  1QSY A;  4AM6 A;  1W9H A;  3UKU A;  4C8K A;  1NJX A;  3EKU A;  3UKU B;  2FBY A;  2QXL A;  3CME N;  2HHT A;  3OVN A;  1O13 A;  2ATQ A;  4FK2 A;  4CJR A;  1SS6 A;  2PYL A;  1LCU A;  3FGU A;  4FLV A;  1S22 A;  3F5T A;  4JKC A;  4JI4 K;  3V9Z A;  3RVC A;  1QQC A;  3M8S A;  3CET A;  3VEV A;  4DS4 A;  4JI1 K;  3JYT A;  2I5J A;  3HK2 A;  4YOV A;  3LM9 A;  2F8T A;  3L4I A;  4CEO A;  4EP5 A;  4M7X A;  4JLH A;  3SQ4 A;  4BE1 A;  1KCF A;  2HND A;  1P8Z A;  1VSE A;  3HTV A;  5AQO A;  1T3V A;  3TR8 A;  4DSL A;  4O8U A;  4JK9 A;  3E9O A;  1VSH A;  2V51 B;  2WBN A;  1C0G A;  3WT0 A;  5EOY A;  4E19 A;  4KV8 A;  4ID1 A;  2EX3 A;  2YNI A;  4IFV A;  2RF2 A;  2ZE2 A;  3LAM A;  2V7Z A;  4FVU A;  4H4M A;  4DWI A;  1BIZ A;  5MLC Q;  4CD3 A;  4ID5 A;  2PFU A;  4FLX A;  2AA4 A;  4CFD A;  1NK8 A;  2FBT A;  2QXF A;  4GKK K;  1FJG K;  4MDA A;  3NAE A;  4A59 A;  4CHO A;  2XHB A;  1T6C A;  3P83 D;  3AO3 A;  3P5J A;  4A5B A;  1EO1 A;  5FRM A;  4H0V B;  4DR7 K;  5F1X A;  3QNO A;  1VQK N;  4CIE A;  3EL2 A;  4BRO A;  5BRF A;  1N34 K;  4E1J A;  1S6Q A;  1XMO K;  1KAY A;  4DFP A;  5CR4 A;  4QOZ B;  5AFU H;  4IO8 A;  2P5O A;  1QQN A;  1RTH A;  4XH5 A;  1TL1 A;  4K25 A;  1EWQ A;  5FRO A;  4OPJ A;  2BUP A;  1JLQ A;  2BE2 A;  4PA1 A;  3AY9 A;  2QWP A;  5KGW A;  2Z1G A;  4E1N A;  2BTF A;  4CZE A;  4JS5 A;  3NE6 A;  4GV9 A;  1LWF A;  1S5J A;  1SL2 A;  3QBW A;  3ZX2 A;  3C0B A;  3H3N O;  3MED A;  4LF7 K;  2B6A A;  2UXB K;  1NGF A;  4IFY A;  3NVK A;  4QS7 A;  4O44 A;  3F2K A;  4M63 C;  2GEL A;  1RCH A;  3N4Q A;  4B8C A;  5HRS A;  3HXM A;  4X66 K;  1Z6R A;  4L3Q A;  3UKR B;  2QWR A;  4JI7 K;  5AQP A;  3OYA A;  1U4B A;  1M1K O;  4B9T A;  3QEI A;  1QSS A;  3ZT3 A;  4OKK A;  3K2P A;  3RR7 A;  4I9L A;  3ZET A;  4DCH A;  4OPH A;  5I9E B;  4FLT A;  4FM2 A;  3CCS N;  4KTQ A;  3F73 A;  3NH2 A;  4H5R A;  5M1Q A;  4DTM A;  4WQ4 A;  2ITM A;  4WFB L;  3P39 A;  1TYQ B;  3KLE A;  1ZC6 A;  4DQR A;  3H46 O;  5AQI A;  2H3G X;  3KLI A;  3PO5 A;  1SUQ A;  5DM7 L;  2Q2R A;  4BC4 A;  4DR3 K;  3AGK A;  4KHW A;  3RSE A;  5E26 A;  4B3O A;  1NLV A;  5HRR A;  4DTX A;  3S3N A;  3WNE A;  3E66 A;  5I3U A;  2HHQ A;  4KH4 A;  4GKJ K;  3CQY A;  1WOQ A;  3V1R A;  3H6E A;  5C24 A;  4CEA A;  1KVC A;  3QEW A;  3K5N A;  3KVG A;  3QFP A;  5AZI A;  2G8W A;  1ZBF A;  4M42 A;  1NGG A;  1NKE A;  3IKM A;  4CED A;  4DFJ A;  4CD1 A;  5LY3 A;  3NVM A;  3WXM B;  3SV4 A;  3Q7B A;  3VF2 A;  2W6L A;  1IBK K;  4H5W A;  3L3V A;  4BDP A;  1VSM A;  3KLF A;  2P9S A;  2VYP A;  2ASP A;  4G1Q A;  5KQD A;  4E7H A;  4IJA A;  2NRR A;  4B1Z A;  4DSI A;  1J6Z A;  2HHH K;  1VK0 A;  4E89 A;  3RTV A;  2GUI A;  1VQ4 N;  1FXX A;  1BO5 O;  4FW1 A;  5I42 A;  4IO9 L;  2P9I A;  4Z4H A;  3MCA B;  4IEE A;  3OYC A;  4Q0B A;  3VQE A;  2E2O A;  3NFA A;  3VQ8 A;  4Y1C A;  3VQ9 A;  4B1U B;  3LWL A;  4FJM A;  1L5U A;  4CEZ A;  2FBX A;  4BRL A;  3THW A;  4HVJ A;  2CGK A;  2Q3S A;  2A5X A;  4JKG B;  1WBB A;  1ESV A;  4YDU A;  3MCP A;  4NYN A;  5JS2 A;  4N76 A;  3HM9 A;  1GLD G;  4RCH A;  4DF4 A;  3ZSQ A;  4DQ8 A;  5B8H A;  2QEX N;  4BWM A;  3FZL A;  4KHS A;  3LDS A;  3RR8 A;  4W5R A;  1OH8 A;  2FXU A;  4OGC A;  1NKC A;  3BF3 A;  5JVG L;  3ZLJ A;  4DQQ A;  5KPZ A;  1Q86 O;  2HNZ A;  4H0T B;  3F9K A;  4RW7 A;  2VCP A;  2NRH A;  3H3O B;  4O4G A;  4BRI A;  2ASM A;  3G0Z A;  3VOV A;  1TK0 A;  3VF4 A;  2IIR A;  4CJT A; 
#chains in the Genus database with same CATH homology
 4FJI A;  1HNI A;  4R5P A;  5C25 A;  4KRF A;  3NGY A;  3AVC A;  3VA0 A;  1JLE A;  2XY5 A;  2PYJ A;  1RBU A;  2YHA A;  3AVB A;  1X1P A;  4C8O A;  3LP1 A;  4HCC A;  1ASW A;  1BQM A;  5SZT A;  4W5N A;  1B92 A;  1JLG A;  5HRN A;  3V1O A;  4CJW A;  4CHP A;  3OS1 A;  1EXQ A;  2PY5 A;  1KFD A;  1VSL A;  3B6P A;  3O3G A;  3SQ0 A;  4FLW A;  2YNG A;  5J1E A;  1SKR A;  4O55 A;  4KKO A;  4M3U A;  3KLG A;  4M3Z A;  4E7K A;  1RBV A;  3VA3 A;  4J2B A;  2RPI A;  2AJQ A;  3D45 A;  4LY7 A;  4DU1 A;  1RT3 A;  2OA8 A;  4OPK A;  4LH4 A;  4CEF A;  2P1J A;  3CQ8 A;  2R7Y A;  1NOY A;  4UQG A;  1BI4 B;  2A1R A;  4F8R A;  3VQD A;  2FBV A;  4QCL A;  2QKK A;  3CFR A;  2G8U A;  4KHQ A;  1RT4 A;  1KLN A;  2HVH A;  5HBM A;  4CIG A;  3LP0 A;  4AH9 A;  1N5Y A;  3K58 A;  3IS9 A;  3AA5 X;  4NYF A;  1BHL A;  2X6N A;  3B6O A;  3OYE A;  4CFA A;  3ISN C;  3HYF A;  3NGZ A;  4CER A;  3TWH A;  1RT7 A;  3QET A;  1VSK A;  3L2R A;  1ASV A;  3ZSW A;  4DSF A;  1T05 A;  4FK0 A;  3DLR A;  3HPH A;  3T3F A;  1Y97 A;  4AHC A;  3L2V A;  1S6P A;  4FLU A;  4FJ7 A;  3HVT A;  3JSM A;  3AO4 A;  5HP1 A;  4M3W A;  4F3T A;  4E0D A;  1KSP A;  4DSJ A;  3T1A A;  3QES A;  1JL1 A;  5DK5 A;  1LW2 A;  4CGD A;  3RMA A;  2XY6 A;  1NK9 A;  1Q8I A;  2E6M A;  3OS2 A;  4Z4I A;  1I3A A;  4FJ8 A;  3LAK A;  1WSG A;  3SUQ A;  1NJW A;  2LSN A;  1JLF A;  1EET A;  5CY4 A;  4JRP A;  4FLZ A;  3IG1 A;  4MFB A;  1Q9Y A;  2G8K A;  1T7P A;  3OYG A;  2NUB A;  1EX4 A;  3BGR A;  4JRQ A;  2HMI A;  2IAJ A;  4IG0 A;  1RNH A;  1VRU A;  1C1C A;  4NCA A;  1A5W A;  1BGX T;  1FKP A;  1WLJ A;  4KB1 A;  5J2M A;  4Z4G A;  3PX0 A;  3V81 A;  1LAW A;  2KFN A;  1K6Y A;  2G8V A;  2X78 A;  4C8L A;  1S9E A;  4QAG A;  4ELV A;  4HUF A;  3MEE A;  4M41 A;  2BGG A;  4CGJ A;  3NGI A;  3TAE A;  3OJU A;  3TAQ A;  3S3M A;  4ZHR A;  1RBT A;  3AVG A;  1LV5 A;  3K59 A;  3CM5 A;  1X9M A;  1L3S A;  2DFE A;  4OLB A;  4BWJ A;  4Z4C A;  2F8S A;  4KAZ A;  1GOB A;  1TK8 A;  2YV0 X;  4DQS A;  4CF9 A;  1YVU A;  1SKS A;  1BQN A;  2G8H A;  4PQU A;  2X74 A;  3VQC A;  4LD0 A;  4FM0 A;  1U49 A;  4FJG A;  1UAX A;  4Z0U A;  5D3G A;  1YTU A;  2D5R A;  4MQ3 A;  4OKE A;  1NK4 A;  1C1B A;  1TKZ A;  2IGI A;  3HJF A;  2DTU A;  3LZI A;  1EKE A;  4KHU A;  1C1A A;  4CE9 A;  3ZT1 A;  1DTQ A;  1VRT A;  4DTR A;  4DFM A;  1RT1 A;  1ITG A;  3DLH A;  4CJ3 A;  4K8X A;  3IRX A;  1I39 A;  4AHT A;  3U3G A;  4CJE A;  1XHZ A;  2KZZ A;  2RKI A;  3PX6 A;  1L3T A;  4M45 A;  3D0P A;  3OYJ A;  3QNN A;  1VSI A;  4FZY A;  4B9N A;  2D0B A;  3OYM A;  5J2Q A;  4KHY A;  1CZB A;  4FJX A;  1X9S A;  4ELT A;  1B9D A;  4CHQ A;  4NCB A;  1UOC A;  1L3V A;  3DOK A;  1QSL A;  4DQP A;  2HHS A;  2OPR A;  4EP4 A;  4KPY A;  1RDB A;  1VSF A;  1J5O A;  2VWK A;  3TI0 A;  1F21 A;  2KQ2 A;  1XC9 A;  4AIL C;  3KD5 E;  4DMN A;  1NJY A;  4W5O A;  1IKV A;  3HT3 A;  2IDO A;  3K5M A;  3SJJ A;  4FVM A;  4BE2 A;  4CCH A;  3KD1 E;  1S9G A;  3V4I A;  1HNV A;  1YT3 A;  3LZJ A;  3SCX A;  3NCI A;  4CES A;  4ELU A;  1XWL A;  2D0A A;  1RTI A;  1J53 A;  1VSJ A;  2ITG A;  3VQA A;  3RRG A;  3PX4 A;  3H08 A;  3AA2 A;  1RIL A;  4CJQ A;  1TK5 A;  4CGF A;  3ZSR A;  3CFP A;  2OPS A;  2DY4 A;  3O4N A;  3VQ6 A;  4CJK A;  3HPO A;  4DLE A;  3QER A;  1WNS A;  2YKM A;  4CEB A;  4FJL A;  2IS3 A;  4LSN A;  2B5J A;  3ZT2 A;  2B4J A;  1TVR A;  5KTQ A;  4FZZ A;  3OYL A;  5J2N A;  1S1X A;  4FJH A;  3ZSY A;  4JS4 A;  3AVF A;  1DTT A;  4CGG A;  4IG3 A;  4DG1 A;  1C0T A;  2E4L A;  3ZSZ A;  3SNN A;  3RMD A;  2O4G A;  3OYB A;  3LPT A;  5EU7 A;  4CJP A;  4N56 A;  3VQ4 A;  2XO7 A;  3DLB A;  3QEP A;  3LP3 A;  1QSY A;  5CYQ A;  1SL0 A;  1W9H A;  4J2A A;  4C8K A;  4FJ9 A;  4YFU A;  1NJX A;  4E3S A;  4DTU A;  3TAB A;  1DLO A;  2FBY A;  3RRH A;  2HHT A;  3OVN A;  3L2W A;  4BE0 A;  2ATQ A;  4DTN A;  2OPQ A;  4FK2 A;  1QS4 A;  4CJR A;  2QKB A;  2PYL A;  2GV9 A;  3IAY A;  1LW0 A;  1ZBU A;  3CG7 A;  1S1T A;  4LH5 A;  1D8Y A;  4FLV A;  1ZBI A;  3M8Q A;  4CJ5 A;  3V9Z A;  4OKJ A;  3V1Q A;  1NK0 A;  3AVK A;  3M8S A;  1QQC A;  4DFK A;  3C95 A;  4EZ6 A;  2WON A;  4CJF A;  1HQU A;  4PY5 A;  4DS4 A;  3JYT A;  2I5J A;  3HK2 A;  3HP6 A;  2F8T A;  4CEO A;  3RMB A;  3MEG A;  1RBR A;  2WOM A;  5KI6 A;  4RW8 A;  3DLE A;  4I2P A;  4EP5 A;  1WAJ A;  3AV9 A;  1SKW A;  4JLH A;  1FK9 A;  3HP9 A;  4AHU A;  3SQ4 A;  2HHX A;  1NK5 A;  4CJU A;  4BE1 A;  1KCF A;  2HND A;  4DU4 A;  1TV6 A;  3MXI A;  1HJR A;  2Z1I A;  3WNH A;  3RWU A;  1VSE A;  1JL2 A;  1EP4 A;  1S1V A;  4CHN A;  4O5B A;  3LPU A;  4CF8 A;  3M8R A;  4FLY A;  4M3Y A;  3MXJ A;  1TL3 A;  3DLK A;  1U45 A;  1GOA A;  3DI6 A;  3OS0 A;  3TR8 A;  4W5T A;  3NHG A;  3HL8 A;  4DSL A;  4F2S A;  1UWB A;  2HVI A;  2HNY A;  1TAQ A;  4I2Q A;  3VQ7 A;  4AHR A;  5CYM A;  3ULD A;  1X9W A;  1VSH A;  5KRT A;  5HRP A;  3SPZ A;  4XIU A;  2A1S A;  3V9W A;  1KFS A;  2ZQB A;  3DRR A;  1JXE A;  4N5S A;  4Z4F A;  1J54 A;  1HMV A;  3VQB A;  3ZT0 A;  1W0H A;  3SUP A;  1BL3 A;  4E19 A;  3SPY A;  4KV8 A;  4ID1 A;  2EX3 A;  1B9F A;  2YNI A;  2DFH A;  4DU3 A;  1RDD A;  4DQI A;  4CJV A;  4FJK A;  4IFV A;  1BCO A;  3O3F A;  3OYN A;  3TAM A;  4F3O A;  1HYS A;  3ZCM A;  2RF2 A;  2ZE2 A;  3LAM A;  3T19 A;  4B9S A;  2VG5 A;  4H4M A;  2Z1H A;  4C8M A;  4DWI A;  1BIZ A;  3AVM A;  1D9D A;  3DRS A;  4ID5 A;  3ZSO A;  1NKB A;  4Z4E A;  3ZSV A;  4FLX A;  4B9L A;  3NF7 A;  5HLF A;  1CXQ A;  4CGH A;  1IG9 A;  4CFD A;  4WE1 A;  1NK8 A;  2FBT A;  2QXF A;  3QIN A;  1LAV A;  2QK9 A;  3NAE A;  4DS5 A;  3TAG A;  4CHO A;  3SZ2 A;  3C6T A;  1WSH A;  2XHB A;  1R0A A;  3P83 D;  4E7I A;  1CZ9 A;  3AO3 A;  3P5J A;  4ICL A;  3E01 A;  5FRN A;  5FRM A;  4E7L A;  3V6D A;  4DSE A;  1TGO A;  3OYD A;  4GVM A;  2X6S A;  4CF1 A;  1JLB A;  3QNO A;  1RTD A;  4CIE A;  3L3U A;  1HYZ A;  2KFZ A;  2XY7 A;  1A5X A;  4PUO A;  3AVL A;  4FJ5 A;  1C6V A;  1YTA A;  1S6Q A;  2KTQ A;  1S1U A;  4DFP A;  1J9A A;  3WNF A;  4IKF A;  1XHX A;  4QOZ B;  4HCB A;  3S9H A;  4M3T A;  2XRI A;  4DTS A;  4DF8 A;  3PY8 A;  2P5O A;  4CJS A;  1QHT A;  3MEC A;  3AVJ A;  3CM6 A;  2BDP A;  2OYQ A;  1QTM A;  1RTH A;  1TL1 A;  1JKH A;  4FXD A;  5FRO A;  3RMC A;  1HQE A;  4CJ4 A;  4CEQ A;  4OPJ A;  2D0C A;  1JLQ A;  2BE2 A;  3KK1 A;  3I8D A;  2Y1I A;  4FYD A;  4N41 A;  1WSJ A;  1TKX A;  4PA1 A;  4GW6 A;  3TAR A;  3L8B A;  5KGW A;  1S1W A;  4YNQ A;  4FM1 A;  4DTP A;  3QEX A;  4B9V A;  2Z1G A;  3TAF A;  4CK3 A;  4E1N A;  4ZTJ A;  3AVI A;  1T8E A;  4CEE A;  1IKY A;  3MXM A;  4JS5 A;  3NE6 A;  3VN5 A;  3KK3 A;  3UIQ A;  4DTO A;  3HVR A;  1LWF A;  4CHY A;  1WSI A;  2FC0 A;  5T7B A;  1S5J A;  1RDC A;  2W42 A;  1IO2 A;  4B9M A;  1A5V A;  1SL2 A;  1IKW A;  3U6F A;  2Y1J A;  3MED A;  2B6A A;  5JS1 A;  1KTQ A;  3LAL A;  4IFY A;  3OJS A;  1NOZ A;  3NF9 A;  4W5Q A;  3LP2 A;  4B8A B;  2G8F A;  4O44 A;  3PV8 A;  1HRH A;  1LWC A;  3MAQ A;  4AHS A;  3SUN A;  4H8K A;  3OYK A;  1RCH A;  3HST B;  3ITH A;  1U48 A;  4I7F A;  4B8C A;  2HW3 A;  5HRS A;  3HXM A;  1Q9X A;  4CFC A;  4CHZ A;  1NJZ A;  3M8P A;  1TAU A;  4KI6 A;  3KLH A;  4J2D A;  4M3R A;  4CJL A;  2F96 A;  4FJJ A;  3OYA A;  1U4B A;  4B9T A;  2OZS A;  4KFB A;  4LSL A;  3AO2 A;  1JXB A;  4RG8 A;  3QEI A;  4HUG A;  1QSS A;  4GMJ B;  3ZT3 A;  3KIO A;  4OKK A;  1KVA A;  2ZD1 A;  1TKT A;  3K2P A;  1IH7 A;  4I9L A;  3RR7 A;  5KRS A;  4FLT A;  3OYF A;  2YNH A;  4FM2 A;  3L2Q A;  3SI6 A;  4KTQ A;  1FKO A;  3F73 A;  2JGU A;  3NH2 A;  3DRP A;  3DYA A;  3OY9 A;  4DSK A;  4DTM A;  2XY8 A;  3SQ2 A;  1CLQ A;  3C94 A;  5C42 A;  3NBP A;  1HPZ A;  3DLG A;  5CZ2 A;  3AVN A;  4AHV A;  4CFB A;  1C0M A;  3ZSX A;  3KLE A;  4DQR A;  4RW4 A;  1N6Q A;  4KHN A;  4M3X A;  1C0U A;  3TAP A;  4O0I A;  3KLI A;  1T03 A;  4J2E A;  3PO5 A;  1SUQ A;  4DLG A;  4KHW A;  2HHU A;  4B3O A;  4OVL A;  5HRR A;  3LWM A;  4DTX A;  3S3N A;  3WNE A;  3ZT4 A;  1CXU A;  5I3U A;  2HHQ A;  1KLM A;  3HPG A;  3LAN A;  5K14 A;  4HUE A;  4KTZ A;  4E7J A;  3V1R A;  1RT5 A;  3SUO A;  4CF2 A;  5C24 A;  1ZBL A;  4FZX C;  1U47 A;  1BIU A;  4TSX A;  4CEA A;  1KVC A;  3QEW A;  5DMR A;  1SL1 A;  3K5N A;  1SV5 A;  1XI1 A;  1UA0 A;  2HHW A;  1Z26 A;  1U04 A;  3V9S A;  4PWD A;  5J2P A;  4IBN A;  3KK2 A;  4OLA A;  2G8W A;  4CEC A;  1D5A A;  1GOC A;  1UA1 A;  3SQ1 A;  2E6L A;  1ZBF A;  2YKN A;  3FFI A;  4M42 A;  3BDP A;  3C6U A;  2O4I A;  4RW6 A;  1KRP A;  1NKE A;  3VQ5 A;  3U3Y A;  3OYH A;  4CED A;  2KZM A;  5HRO A;  4DFJ A;  4IDK A;  4H4O A;  3A2F A;  3EYZ A;  2ETJ A;  3K57 A;  4CK1 A;  4HTU A;  3QIP A;  3L2U A;  2GBZ A;  1ASU A;  3SV4 A;  3K5O A;  1JLA A;  1RT6 A;  3S3O A;  3QIO A;  3AO5 A;  3QLH A;  3L3V A;  4KI4 A;  2P51 A;  4BDP A;  3DOL A;  1VSM A;  1BIS A;  1RBS A;  1Z25 A;  3CFO A;  4B08 A;  3G10 A;  3KLF A;  4G1Q A;  1WAF A;  4E7H A;  2HHV A;  2JLE A;  2IC3 A;  4RW9 A;  3ASM A;  3O3H A;  2PZS A;  1BCM A;  4DSI A;  4K8Z A;  3DMJ A;  1VK0 A;  3ALY A;  4E89 A;  2GUI A;  4CGI A;  3RTV A;  3QO9 A;  3PO4 A;  1JLC A;  2OZM A;  4EZ9 A;  3HO1 A;  1FXX A;  4F2R A;  2HB5 A;  3KJV A;  4FW1 A;  3KTQ A;  5I42 A;  4Z4H A;  3OYC A;  4Q0B A;  5SWM A;  4ZTF A;  3VQE A;  4CK2 A;  3P1G A;  3AVA A;  4Y1D A;  4BDY A;  3V9X A;  3NFA A;  3NF6 A;  3SYZ A;  4FK4 A;  3VQ8 A;  4Y1C A;  1ZBH A;  3VQ9 A;  1BI4 A;  3LWL A;  4L8R B;  4FJM A;  1L5U A;  4CEZ A;  2RN2 A;  3NDK A;  2G8I A;  1RT2 A;  1IKX A;  2FBX A;  2IOC A;  4BAC A;  4FJN A;  3DM2 A;  1WSF A;  3KKS A;  3V9U A;  1WN7 A;  3QEV A;  4HVJ A;  2DFF A;  3EY1 A;  1HYV A;  4FW2 A;  2BAN A;  2Q3S A;  4FCY A;  2VG6 A;  4B9U A;  5E41 A;  4KO0 A;  3VQP A;  5KGX A;  3AA4 A;  3WNG A;  3OYI A;  3THV A;  3VQQ A;  4O0J A;  1TKD A;  2OPP A;  1LWE A;  2YNF A;  3TAN A;  3SV3 A;  4NYN A;  5JS2 A;  4N76 A;  3HM9 A;  3CYM A;  1ZYQ A;  4KRE A;  1RDA A;  4N47 A;  5CZ1 A;  3ZSQ A;  3K5L A;  4DF4 A;  4DTJ A;  4BWM A;  2VG7 A;  3NF8 A;  1D9F A;  1NK6 A;  2EHG A;  4KHS A;  1REV A;  4CIF A;  4Q5V A;  3LDS A;  4W5R A;  3RR8 A;  1VSD A;  3AVH A;  3O4Q A;  4OGC A;  4OGE A;  1NKC A;  3PUF A;  4KB0 A;  2KW4 A;  3AO1 A;  3AA3 A;  2P5G A;  1NK7 A;  2YHB A;  4CF0 A;  4DQQ A;  3KKR A;  1MU2 A;  1O1W A;  3NH1 A;  2HNZ A;  4KTW A;  1QE1 A;  3NH0 A;  1G15 A;  1RTJ A;  3F9K A;  4RW7 A;  4I9Q A;  4NCG A;  3I0S A;  2Z1J A;  4E1M A;  5FDL A;  4OJR A;  4HHT A;  4O4G A;  3EZ5 A;  3G0Z A;  3I0R A;  4C8N A;  2VWJ A;  1TK0 A;  4BDZ A;  1L3U A;  1WSE A;  4F4K A;  1KVB A;  4CJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...