4IBNA

Crystal structure of lc9-rnase h1, a type 1 rnase h with the type 2 active-site motif
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
SDIPTPLVAVYADESCLGNGREGENPGGAGVLVEYARPGGAGDIVRRDVWVSEPATTNNRMALRSVIEAFRAIGHKGTRFRVVFTTDSRYIVDGMTRWVHDWAQRGWKRKSGAIENLALWQEAVQAVNGHAVEWRWVRGHAGHAQNEYANHLAVTAAGGQTQSGGLVDSGYEEWAARVSTAASRMRLEPFPDAAAFRPSPALPVVAAGRPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease H
publication title Crystal structure of metagenome-derived LC9-RNase H1 with atypical DEDN active site motif
pubmed doi rcsb
source organism Uncultured organism
molecule tags Hydrolase
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2012-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ibnA01
3LP1A 1YTUA 4K8XA 4DLGA 5HLFA 3QEXA 4DSFA 3RMCA 5HRSA 5I3UA 4G1QA 4W5OA 3WNFA 3KLGA 3SQ2A 3WNGA 3CM5A 4N56A 2BGGA 3KLFA 4LSNA 2X6SA 1FK9A 3TWHA 3SNNA 3O3FA 4I9QA 1L3TA 5C25A 4I2QA 1VSFA 3RRHA 4F2RA 3ZT2A 4GW6A 3QEPA 1ASWA 2HHXA 2OPQA 4CFAA 4L8RB 3VQAA 2XO7A 2G8VA 4FJ9A 4AHUA 2QKKA 4FJHA 4DTRA 4CJ3A 3QNNA 4FJKA 4KTWA 4CEEA 4CK3A 1CZBA 3T19A 5E41A 4DTUA 4IFYA 3IS9A 4CHQA 3DLEA 3VQBA 5T7BA 3CFPA 4N5SA 4CIGA 3TABA 3AO4A 4F3TA 1LW2A 1NOYA 1LWFA 1TAUA 3SPZA 3KJVA 2F8TA 4BWJA 3AO3A 4OKKA 3LP2A 2D0AA 4DTJA 4O4GA 2KZZA 1N6QA 4K8ZA 4HTUA 2DFHA 1U48A 4EP5A 4I2PA 3ZSOA 2BANA 1SL0A 2P51A 1UA1A 1QSYA 1FKPA 3LAKA 3OYAA 3HPOA 3CFOA 3G10A 1Z26A 4NYNA 4PQUA 3TAGA 1NOZA 4FLVA 4CEBA 1X9WA 2X74A 4Z4FA 1S1TA 1LWCA 3OJUA 1EETA 3HP9A 3QLHA 1IO2A 1WSFA 3K5OA 4HUGA 2E6MA 2Y1JA 3UIQA 3M8QA 4MQ3A 4AHVA 4OPJA 3SUPA 4B9SA 4M3TA 3HO1A 4FCYA 3TAPA 4LSLA 3AVKA 2NUBA 3HYFA 4CGIA 1L3VA 4I9LA 1HQEA 1SL2A 4B9UA 4Z4CA 2IS3A 2YV0X 1KLNA 2IGIA 3QO9A 4Z4IA 1D5AA 1VRTA 4M3YA 4Z0UA 1K6YA 2GV9A 3M8SA 3U3YA 2XHBA 3MAQA 3SPYA 4IG0A 4CJPA 4IDKA 3KLIA 3SI6A 3AVLA 3VA0A 4FJ7A 2W42A 3AA3A 1BIZA 4KAZA 4PY5A 1CLQA 4TSXA 4JLHA 2PY5A 4CF2A 4KI6A 1HNVA 4KO0A 5HRNA 4DF8A 4OLAA 3AO1A 2Q3SA 1S6PA 5FDLA 4CGHA 3HVRA 3V4IA 4KB0A 3LZJA 1RCHA 4DQRA 4N41A 1TKTA 4FJXA 1RBTA 4JS5A 2IOCA 2JLEA 4CJQA 3V9WA 5C24A 4M3RA 3NH0A 4CEDA 4NCAA 1GOAA 1RT3A 1A5XA 1YTAA 3E01A 3HPGA 1TKDA 1SUQA 1VSHA 1RTDA 2DTUA 4CEQA 1ZBLA 4H4MA 3RMBA 4DSKA 4CHPA 2FC0A 3DLGA 3THVA 2X6NA 1U4BA 2FBVA 5HRRA 3SYZA 2B4JA 4FLYA 2HHSA 3B6PA 1C0TA 3QESA 1RBRA 3NGYA 4Y1DA 3OYIA 4DFKA 2IAJA 1X9MA 1SKSA 2FBTA 4EZ9A 4FJLA 1KVCA 1QQCA 4CE9A 1RDAA 4W5QA 3WNEA 4EP4A 4HUEA 3IRXA 4FM1A 2XY6A 1LV5A 3OYEA 4E1NA 4DG1A 1QSLA 1VSIA 1HYVA 1QSSA 2G8KA 4KHQA 4N47A 1S9GA 3PX6A 1XC9A 4CFDA 3D0PA 4ELTA 4IKFA 4FJJA 1TKXA 3DLKA 3QETA 1EXQA 2O4GA 1RDDA 1MU2A 4GVMA 5J2PA 1BCMA 4OKEA 4FXDA 3NH1A 1DTQA 3L2QA 1BGXT 1RDBA 3NBPA 4CIEA 1NKBA 2ZE2A 4IBNA 3EZ5A 2HNDA 3O3HA 2OPRA 4DQIA 3KD5E 4RW8A 3ZT0A 4FM0A 4CJRA 3AVJA 2D0BA 1LW0A 1SKRA 3DLHA 1RBSA 2X78A 3PX4A 3RMAA 2EHGA 2GUIA 3VN5A 3OYKA 3S9HA 3K57A 1ASUA 1KFSA 1EX4A 3LZIA 3CM6A 3LP0A 3OYLA 3TR8A 2OZMA 2OYQA 4PWDA 2KTQA 4W5RA 1X1PA 3T1AA 3AO5A 3ASMA 3NF9A 4NCGA 3S3MA 2E4LA 3CG7A 1NK5A 4CJFA 4FZZA 2D5RA 4CERA 4FLUA 1C1CA 3OVNA 1KCFA 1WSJA 4ID5A 1EP4A 2P1JA 3NF8A 4Y1CA 5EU7A 3V9ZA 1SKWA 2YNGA 1D8YA 4AHSA 3TI0A 3L2UA 4C8LA 1VSMA 4CGGA 1GOBA 1Y97A 3OYGA 5J2QA 3U6FA 2G8FA 4M3ZA 1BISA 3QEIA 3QEVA 4QOZB 4DSJA 2GBZA 1NJWA 4OKJA 1BCOA 3M8RA 2WOMA 1QHTA 5CZ1A 4HVJA 3V9UA 2HMIA 4HUFA 4DU1A 4FLZA 3V1RA 5HP1A 4ZTFA 3SQ1A 5KGWA 1W0HA 4FJ5A 1RBUA 4BE2A 4DTSA 4CEAA 3KLEA 4MFBA 3F73A 4OJRA 3G0ZA 3NAEA 3VQPA 1JKHA 3NFAA 3V1OA 3WNHA 4DFMA 1LWEA 2LSNA 3MECA 3SV3A 3QERA 4HCBA 1S6QA 4E0DA 4HCCA 2HVHA 2OPSA 2HVIA 5FRMA 3MXMA 3NF7A 3DRPA 3NGZA 5DMRA 1NJXA 3EY1A 1LAWA 4J2AA 2HHTA 2HHVA 3V6DA 4LH4A 1KTQA 3O4QA 1HQUA 4CEOA 1S1WA 1A5WA 4OVLA 1QE1A 2VWJA 1WSIA 4O0JA 1IKYA 5KGXA 1EKEA 4DFJA 1VSEA 1C1BA 1QS4A 4C8MA 4BE0A 1B92A 4AHCA 2ATQA 3AVIA 3HL8A 4KTZA 3V1QA 3ZT3A 1G15A 1S5JA 1TL1A 4BWMA 3DLBA 2IC3A 1XI1A 1UAXA 1C0MA 1RNHA 3KK3A 3HT3A 4W5TA 4JS4A 3JSMA 1NKCA 1QTMA 2G8HA 2F8SA 2HHQA 3KLHA 1TKZA 1DTTA 2QK9A 1N5YA 4YNQA 4PUOA 1JXBA 3AA2A 1TVRA 4DMNA 2KFZA 3VQCA 1VSLA 2YNHA 1Q9YA 4KREA 2XRIA 3RWUA 3LP3A 2Z1IA 1TV6A 3IG1A 4KB1A 3K5MA 1NJZA 2P5OA 1VK0A 1CZ9A 5D3GA 1RTJA 2RF2A 3AVHA 4LY7A 3ZT4A 3DYAA 5I42A 3ALYA 1NK4A 2O4IA 4FJGA 2Z1GA 3ZSQA 4DQQA 3ZSXA 3T3FA 1NK8A 1TK8A 4CK1A 5CYQA 3TAQA 3HK2A 4Q0BA 4NCBA 3D45A 4XIUA 1X9SA 1L5UA 3VQDA 3OYJA 3QIPA 5DK5A 4CEZA 2WONA 4RW7A 2VG5A 2YKNA 4O5BA 3K59A 4IFVA 3KKSA 4M3WA 1ASVA 3I0RA 1KSPA 3PO4A 3RRGA 4ICLA 4OPKA 3NGIA 4ID1A 3SQ0A 4Z4GA 4CF0A 3O4NA 5J2NA 3AVMA 2G8IA 3DM2A 3MXJA 4IG3A 3CQ8A 1J54A 1RILA 3MEGA 5JS1A 4DWIA 1ZBIA 1JL2A 1WAFA 4QAGA 3EYZA 1L3UA 4KKOA 3NDKA 3JYTA 3NCIA 3A2FA 1NKEA 4GMJB 1KRPA 3KIOA 1JL1A 4FLXA 1KFDA 3AVBA 1RDCA 3FFIA 4E7KA 3HP6A 3DOKA 4J2BA 1U47A 1VRUA 4LH5A 1WLJA 3L2WA 4Z4HA 3ULDA 1U04A 1IKWA 3OS0A 4CIFA 4E7JA 1HRHA 3OY9A 3L2VA 4FJMA 4DSEA 4RW6A 4DF4A 2HHWA 1I3AA 3C94A 1XHZA 1ZBHA 4BDPA 4CF9A 1O1WA 3PV8A 1I39A 4DQSA 3ITHA 2RKIA 2XY7A 1F21A 3DLRA 3DRRA 1JLBA 1J9AA 1BQMA 1GOCA 4KI4A 3VQ5A 3ZSWA 1HPZA 4R5PA 3P83D 3DI6A 3O3GA 3L2RA 3IAYA 1BL3A 3KKRA 1S1XA 3HXMA 4DTOA 2PYJA 3OYHA 1YVUA 3RMDA 2DY4A 1JXEA 2FBYA 3I0SA 1WN7A 3M8PA 3VQ9A 4O0IA 4OGEA 1JLEA 4CEFA 5J2MA 2A1RA 1JLGA 4C8OA 4BDZA 4FZXC 4JRPA 4KRFA 1BQNA 1FKOA 3HPHA 1KVBA 3K5NA 3MXIA 4B08A 1NK6A 1S9EA 1XHXA 4CJ4A 1KLMA 2BDPA 2OA8A 2KFNA 1JLQA 2RPIA 3RTVA 3VQQA 4CF8A 4E1MA 4W5NA 1RT6A 1TK0A 1BHLA 1BIUA 3VA3A 4ELUA 1SL1A 2HB5A 2PZSA 2IDOA 5C42A 3OYMA 3NE6A 1YT3A 3K5LA 4FK4A 3MEDA 4QCLA 2QXFA 4FZYA 3S3NA 1ZBUA 1WNSA 4KHYA 3L3UA 1KVAA 4WE1A 4E7HA 3KTQA 2KZMA 4CF1A 1D9FA 1RTHA 1XWLA 4M3UA 5SWMA 4DTPA 1C1AA 1TL3A 3VQEA 4YFUA 4DTXA 4F2SA 3PUFA 4B8CA 4E3SA 1B9DA 3NH2A 4FYDA 1C6VA 1Z25A 4UQGA 1RT2A 1ZYQA 3C6TA 4KHNA 3HM9A 1VSKA 2ITGA 2HNYA 1HNIA 4EZ6A 4B9NA 3OYFA 1SV5A 5CY4A 3OYDA 4FJIA 2OPPA 4OLBA 4OGCA 4KTQA 1ITGA 3AA5X 5HBMA 3CYMA 2B5JA 3OYNA 3CFRA 4AILC 3F9KA 1IKXA 1J53A 3B6OA 1WSEA 3MEEA 1T8EA 1T7PA 3KD1E 4CK2A 4CJUA 1IKVA 3K2PA 3NF6A 2ETJA 1L3SA 4FLTA 1BI4A 3AV9A 1JLCA 3TARA 2YNFA 3QEWA 4DTNA 4FK0A 3LANA 2Y1IA 1T03A 1T05A 3PO5A 2QKBA 4FW1A 1REVA 3V9SA 4JRQA 2JGUA 4B8AB 3ZSVA 4E89A 1A5VA 1RBVA 4CJTA 5CZ2A 2HHUA 4PA1A 4CHYA 2P5GA 4KFBA 5JS2A 4FW2A 4NYFA 5SZTA 4FK2A 3C6UA 4H8KA 1NJYA 1BI4B 1W9HA 1IG9A 2I5JA 4J2EA 1VSDA 1RT5A 3VQ7A 1IH7A 4FVMA 4DS5A 1U49A 3AVFA 4DU3A 3VQ4A 2PYLA 1NK7A 5KI6A 4CFCA 3I8DA 3TAFA 3ISNC 2VG7A 3AO2A 3VQ6A 5HROA 4DS4A 4LD0A 4KPYA 4CFBA 4DLEA 4CGJA 4FLWA 1NK0A 3QIOA 1RT7A 4CJ5A 3C95A 1RTIA 3OS1A 4DSLA 2FBXA 4CGDA 3U3GA 4B9VA 1HJRA 3HVTA 4KHWA 4CGFA 3SUOA 4FJNA 4ZHRA 5KTQA 3KK2A 4CHZA 1S1UA 4KHSA 3DOLA 3LALA 3OS2A 4AHRA 2A1SA 2HNZA 3HJFA 4N76A 3P5JA 4CJWA 1RT1A 3H08A 4CJKA 1RT4A 2D0CA 4FM2A 3SUNA 4J2DA 4FJ8A 4E7LA 1CXQA 3VQ8A 1ZBFA 2KW4A 4RG8A 3BDPA 2RN2A 4CECA 3SZ2A 2XY8A 3RR7A 1R0AA 4AHTA 3V9XA 1UOCA 2ZD1A 4DU4A 4F8RA 3KK1A 4CJSA 4O55A 4Q5VA 1HYZA 4CHOA 3SV4A 2YKMA 4H4OA 3OYCA 4B9TA 1FXXA 4I7FA 1UWBA 3NHGA 1WSHA 4CJEA 3SQ4A 4O44A 4M42A 3OJSA 5HRPA 3AVGA 3ZCMA 3RR8A 3LPUA 1WSGA 4DTMA 2G8UA 4KHUA 4B3OA 2YNIA 2KQ2A 3DRSA 3ZT1A 3V81A 3OYBA 1LAVA 1TGOA 1HMVA 3SCXA 5FRNA 3LWMA 2G8WA 3ZSYA 3LWLA 4B9LA 1J5OA 4BE1A 3TANA 1NK9A 4M41A 2E6LA 1Q8IA 2DFEA 4DQPA 3PX0A 3S3OA 1D9DA 3SJJA 3PY8A 4BDYA 4C8KA 4DSIA 4Z4EA 2AJQA 1CXUA 4ZTJA 1DLOA 2R7YA 2ZQBA 1B9FA 4CCHA 4ELVA 2BE2A 1HYSA 2VG6A 3AVNA 4F4KA 3TAMA 4CJLA 4RW4A 4F3OA 2Z1JA 2Z1HA 5KRTA 3LAMA 4C8NA 1C0UA 3LDSA 2OZSA 5K14A 5CYMA 3QNOA 4M3XA 4B9MA 3K58A 3AA4A 3AVAA 3DMJA 4M45A 3SUQA 3QINA 5J1EA 2VWKA 4BACA 3P1GA 3BGRA 4E19A 1U45A 1Q9XA 4CHNA 1VSJA 4AH9A 2YHAA 3ZSZA 4RW9A 2DFFA 2YHBA 3AVCA 5KRSA 4E7IA 3TAEA 2XY5A 3L3VA 1TAQA 4DFPA 3HSTB 1UA0A 1S1VA 2EX3A 2HW3A 3LPTA 3L8BA 4HHTA 1JLAA 1JLFA 2F96A 4KV8A 4CESA 4CJVA 1TK5A 1WAJA 5FROA 2B6AA 3ZSRA
chains in the Genus database with same CATH superfamily
3QEXA 5HRSA 4G1QA 3KLGA 3SQ2A 3CM5A 2JWLA 2BGGA 4LSNA 2HMPA 3O3FA 1L3TA 4XH1A 1ASWA 2OPQA 2G8VA 4CJ7A 4DTRA 2FSKA 4CK3A 3T19A 4DTUA 3ZX3A 3IS9A 4XH5A 3AGRA 3DLEA 5AQPA 3TABA 5AQHA 1NGBA 3EZWA 1TAUA 3SPZA 1NBWA 3E66A 4BQLA 2F8TA 4O4GA 3HI0A 3H3NO 3VF2A 2P51A 4NYNA 4DV1K 4PQUA 1RGIA 1IBMK 4LF5K 4CEBA 2X74A 1NGCA 1WSFA 3BF3A 3J7AP 3K5OA 3D2EB 3QFPA 4YOUA 4NXNK 4M3TA 3H45C 1VQ6N 3W3DA 4FCYA 1L3VA 3VGMA 2IS3A 2YV0X 2ZF5O 2IGIA 4AF1A 2O8BA 4YDUC 3VF4A 4CZIA 2D1KA 1EO1A 4X62K 4CZJA 3SPYA 3VA0A 5F0XA 5EY4A 1KAXA 1CLQA 4JLHA 4CF2A 4RCHA 4KO0A 4IEIA 3VEYA 5HRNA 3F5TA 4DF8A 4OLAA 1S6PA 5LMNK 3V4IA 1D4XA 1LCUA 5KQDA 1IJJA 4FJXA 4XEIA 2QI2A 3ZX2A 4WF9L 4CZMA 1SUQA 1VSHA 4WQ4C 1RTDA 4CBXA 3RMBA 3TSQA 2FC0A 3DLGA 5GADP 2FBVA 1TUUA 3ULEB 3K9KA 3NGYA 3OYIA 1X9MA 3UKRB 1GLDG 4EZ9A 4FJLA 4JD2B 3C7NB 4W5QA 2XY6A 4HUEA 3IRXA 4Z4IA 1HYVA 5AQNA 4JI5K 4N47A 3TSPA 3A0IX 2P9UA 3VETA 4JKBA 4IKFA 3QETA 1ILYA 3CC4N 2O4GA 1RDDA 4GVMA 3KK7A 5J2PA 3SMPA 1BCMA 1JJ2M 4BRNA 1U6ZA 4MO5A 4PKIA 4CIEA 3KD5E 3CCLN 4RW8A 4FM0A 4CJRA 1SKRA 2X78A 1QQMA 3H46O 2GUIA 5E84A 1NNEA 1KFSA 3K57A 1YIJN 1C0FA 3LZIA 3CM6A 4PWDA 2KTQA 2OYQA 1WBDA 4W5RA 4B3RK 1XNRK 3CG7A 1CZAN 4FZZA 4CERA 3C6HA 3OVNA 1EP4A 2QW9A 2HW3A 2O4IA 1D8YA 1GOBA 3FZKA 3U6FA 5GAEP 3CI5A 3QEVA 1LOTB 1DKGD 2AP1A 3WXMB 1QHTA 5CZ1A 3V9UA 4CZHA 3V1RA 2Q2RA 4JHDB 1RBUA 3OBYA 4LFAK 4MFBA 2UXCK 3VQPA 3MECA 3DXMB 2HVIA 4E0DA 4HCCA 1NGGA 5GIOA 3MN9A 3NGZA 3EY1A 2DPNA 4LH4A 3H1VX 4CEOA 3LL3A 3WUHA 1S1WA 1A5WA 2P9PB 1WSIA 4H0VB 4O0JA 4DFJA 3E1YA 1C1BA 1QS4A 2A6AA 3HL8A 3AVIA 4I6MA 2NLXA 4K41A 5KPTA 1UAXA 3THWA 3KK3A 2PAVA 4C23A 3IMXA 4L3QA 3JSMA 1QTMA 3E9LA 5AQVA 4PUOA 1JXBA 3MWPA 5HL7L 4FWOA 2YNHA 1Q9YA 1WBBA 1SQKA 2Z1IA 3QFUA 1TV6A 3IG1A 4RTFD 2P5OA 4DCHA 2RF2A 3A5NC 3ALYA 4JI0K 4FJGA 4WYBA 4BC3A 4CK1A 5CYQA 1NGAA 4YOXA 3D45A 4A5AA 4XIUA 1X9SA 3VQDA 3CJ9A 4DV6K 4RW7A 2HSTA 2VG5A 2YKNA 4O5BA 4M3WA 1ATSA 4RWTA 3PO4A 2E1ZA 2E88A 5AQQA 3SQ0A 5DM6L 4CF0A 3GL1A 5J2NA 3AVMA 3MEGA 3WQTA 4DWIA 4HWIA 1JL2A 3O8MA 4QAGA 3EYZA 4JKAA 4KKOA 3JYTA 4GMJB 3TTDA 4GV9A 1W97L 1E3MA 4J2BA 4O8KA 4LH5A 3L2WA 3ULDA 1Q18A 4Z4HA 2E2PA 2V52B 3R6MA 4JKHA 3OY9A 4FWPA 4FJMA 4RW6A 3QBXA 1I3AA 3C94A 3T1YK 1ZBHA 4IOAL 2HHWA 3ID8A 4BDPA 2RKIA 5CHIA 1F21A 1E4GT 4C1NI 3DRRA 1JLBA 1J9AA 1Z05A 1HPZA 4R5PA 1P90A 3P83D 3L2RA 2Q31A 2PYJA 3DXKB 1SAZA 3I0SA 5BRHA 2P9LA 5AQSA 4OGEA 4FOIA 1BA0A 4BRCA 3CJ1A 2I7NA 4B08A 1S9EA 4K43A 3WT0A 1KLMA 2OA8A 1YUWA 2Q97A 2RPIA 3RTVA 1TK0A 5KPRA 1VAZA 3K5LA 4FK4A 2GEMA 2NRRA 3L3UA 1XWLA 4LF6K 4M3UA 5SWMA 5AQRA 1Q7YO 3WXJA 1B9DA 3NH2A 4DV0K 3NVMA 1VSKA 3OYFA 4G9ZA 5AQJA 2OPPA 3AA5X 3OA9A 3OYNA 2B5JA 3M3ZA 2O8DA 4JI8K 3B6OA 1WSEA 3MEEA 3SLCA 1T7PA 3KD1E 4CK2A 4CJUA 2WTUA 3LM9A 1QZ6A 4BQZA 2ETJA 5CE3A 3VMFB 3GG4A 1VQ5N 3AV9A 3K0SA 4DTNA 1T05A 4FW1A 4JI7K 5KQ8A 3V9SA 2IVPA 2O8CA 4JRQA 3Q7CA 2HHUA 1RBVA 1NGFA 4CHYA 1NWKA 4NYFA 4NO7A 3C6UA 1W9HA 4B1YB 4DS5A 5FPMA 1XC3A 4CFCA 3K9JA 3TAFA 3PSFA 3CCVN 1EWRA 1WOQA 5HROA 1O13A 4FLWA 3N4QA 1YI2N 1NK0A 3QIOA 4CJ5A 3C95A 4DSLA 5KTQA 2GUPA 1W7AA 4LF8K 2A1SA 3P5JA 4CJWA 5C12A 3SUNA 4FJ8A 4E7LA 2OCEA 3H1QA 1ZBFA 2KW4A 2V51B 3LDQA 4AHTA 3V9XA 2ZD1A 3KK1A 4YY3K 4Q5VA 3NVKA 1HYZA 4H4OA 4CJEA 3CCUN 3OJSA 3ZCMA 3RR8A 1ESVA 3V81A 1K73O 5FRNA 1J5OA 4BE1A 4M41A 2FSNA 3P38A 1Q8IA 5AR0A 1GLCG 3L4QA 1NM1A 4EHUA 4X64K 2R7YA 2ZQBA 2PBDA 4DR3K 1IV0A 1HYSA 4H03B 4CJLA 1ZBSA 3R8EA 4F3OA 2Z1JA 3LAMA 1BO5O 1C0UA 4GVEA 1NGJA 5K14A 5CYMA 3QNOA 3CHWA 2D0PA 3K58A 3QINA 4JI2K 5J1EA 2OANA 3CPWM 3BGRA 4AH9A 5BPNA 4DSIA 2YHBA 1UA0A 3L3VA 3CCMN 1S1VA 3LPTA 4HHTA 1JLFA 2F96A 1TK5A 1HNZK 1X3MA 1WAJA 5FROA 3H3OB 3ID6A 5BRDA 5AQWA 4K8XA 2HF4A 5JLHA 4DSFA 2QWPA 4BREA 2P9SA 3WNGA 4WFAL 4JNEA 4N56A 4FWNA 3QICA 4GNIA 4DUZK 4I9QA 5C25A 3CC2N 3QB0A 1Y64A 5BN9A 4BC4A 3FE1A 4GW6A 3IDHA 3QEPA 4CFAA 4FJ9A 1HKGA 2QKKA 3ZEUA 3W0LA 3JXUA 4IDHA 3GE1A 5E41A 3MDQA 1YJ9N 3WXKA 3EE8A 4IFYA 1RDWX 3VQBA 3CFPA 4CIGA 1TYQA 1YF5L 4F3TA 4CW7B 1LW2A 1M1KO 2HHHK 4ISEA 4MLEA 1M90O 2D0AA 4DTJA 3E9PA 1N6QA 4OO1J 4HTUA 4J8FA 4EP5A 4I2PA 3ZSOA 4WCEL 2BANA 5C15A 1UA1A 1QSYA 3OYAA 3CFOA 1BDGA 2QWNA 3TAGA 2P9KA 1X9WA 3OJUA 1EETA 2FSJA 3HP9A 3UB5A 3QLHA 5JLFA 4HUGA 3J7YP 2E6MA 3M8QA 4AHVA 1NJIO 4OPJA 3HO1A 3C6AA 1BG3A 3HYFA 5AFUH 1SL2A 2G8IA 4FSVA 1VQ7N 3QO9A 3DLLL 3EEQA 1K6YA 2GV9A 3M8SA 3O1BA 3CJAA 3U3YA 3IKMA 2XHBA 3MAQA 4IG0A 4BR0A 3QBWA 4IDKA 4CJPA 3SI6A 3AVLA 4FJ7A 3AA3A 3MN7A 2YJEA 3A5LC 2PY5A 2Q3SA 3HVRA 3LZJA 3EKSA 4DQRA 2P9IB 3RSEA 2IOCA 2JLEA 4DV3K 1NGHA 1RT3A 1YTAA 5FLXO 1TKDA 1ZBLA 4H4MA 4CHPA 2B4JA 4ISGA 2JWKA 3QESA 4Y1DA 2IAJA 2RHKA 1QQCA 5BR8K 1QSLA 2E8AA 1VSIA 3CQXA 4V19S 1S9GA 4IWVA 4KBOA 3J81O 1XC9A 4ELTA 4FJJA 1EXQA 2VGNA 4OKEA 3L2QA 1DEJA 3NBPA 4JKGA 2HNDA 3O3HA 1J5EK 4BRLA 1HKCA 1LW0A 4IXCA 2QWRA 2P9UB 3I33A 1ASUA 3P39A 4PL8A 4X66K 3WEEA 3TR8A 1X1PA 3T1AA 3ASMA 3NF9A 3HOSA 1S72N 4FLUA 4ID5A 2I7PA 3V9ZA 4FZXC 4Y1CA 1GLBG 4ILJA 3TI0A 4C8LA 5EX5A 1Y97A 3CQYA 5J2QA 4DSJA 2GBZA 1NJWA 2YX6A 3M8RA 2WOMA 3HM8A 4B1VA 5HP1A 4EIAA 3I56N 4BRMA 4BG9A 4CEAA 3KLEA 3NAEA 2O8FA 4OJRA 4DFMA 1JKHA 3WNHA 4A62A 4BRIA 3QERA 1S6QA 2OPSA 5FRMA 3I55N 3NF7A 5DMRA 1LAWA 4J2AA 2HHTA 3V6DA 1KTQA 1NGIA 3PIPL 4CVNE 2CGJA 5KGXA 1IKYA 4AQYK 1VSEA 2P9NA 2YCHA 4CD3A 1C0GA 1G15A 4JKFA 4NLCA 4WFBL 1XI1A 3AAPA 1RNHA 3A8YA 2G8HA 2HHQA 3KLHA 2QEXN 1DTTA 2QK9A 4YNQA 3AA2A 2CH6A 4BRQA 4DMNA 5M1FA 4KREA 2ZGZA 4I6MB 3UKUA 4KB1A 2A42A 5EXWA 1VK0A 3KWIA 3THWB 3ATUA 4NB4A 1MWKA 3AVHA 3CJ7A 1NK4A 2Z1GA 5M1QA 4DQQA 4K25A 4LC9B 1L5UA 3OYJA 1X9JA 5DK5A 4CEZA 2A40A 1YJWN 3I0RA 2E2QA 3IUCA 1XMQK 3VF6A 3RRGA 2RE2A 3ENOA 4ICLA 4OPKA 3NGIA 4Z4GA 3O4NA 4H0OA 5JS1A 1WAFA 3NDKA 1NKEA 3RVCA 3KIOA 1JL1A 4IO8A 4FLXA 2KKZA 1RDCA 3AVBA 3FFIA 1N8RO 4FWMA 1WLJA 1HX1A 4CIFA 4E7JA 2ASMA 4DSEA 3LDNA 4DF4A 1FW6A 4CF9A 3PV8A 5EOYA 3H6EA 2ZM6K 3J8AA 5BRFA 4KI4A 1BQMA 1GOCA 3IAYA 1BL3A 1VQKN 1S1XA 2W41A 2DY4A 4O0IA 4DR4K 3BZCA 2A1RA 4C8OA 4BDZA 1MDUB 1BQNA 1KVBA 5AQYA 2BUPA 1NK6A 4GKJK 1XHXA 2F9WA 2BDPA 1JLQA 5AQFA 5JVHL 4E1MA 1BIUA 2NNWA 4ELUA 1SL1A 2HB5A 2IDOA 3OYMA 1YT3A 4BGAA 4KHYA 3S3NA 1WNSA 1KVAA 4CF1A 4A61A 4BRKA 5ADXH 1VQMN 1XMOK 3C6TA 1KC8O 2ITGA 1HNIA 1HPMA 4IOCL 3O4WA 4EZ6A 4Z94A 4B1UB 4FWQA 3ENBA 2W6LA 4LF9K 4HTLA 3OYDA 4B3SK 3D2FA 5HBMA 1G99A 3VENA 1VQLN 3CCSN 3K2PA 1T3VA 2VWBA 3L0QA 2JGUA 4B8AB 4CD1A 4BR7A 5M1NA 3BF1A 4KFBA 4FW2A 4ILHA 1IG9A 4H0PA 4OX9K 3CIPA 1VSDA 3VQ7A 1IH7A 4FVMA 2O8CB 2PYLA 4Y0WA 4BRPA 2VQFK 4BR5A 3R1XA 4PL7A 3SAHA 2VG7A 3VQ6A 3QDKA 4DQ8A 4DLEA 5GIPA 3CPEA 4CGJA 1OH6A 3CCRN 4GY2B 2FBXA 4CGDA 2F9TA 3HVTA 4O8UA 4CGFA 3HBTA 4QS9A 3CCEN 4CHZA 1S1UA 4KHSA 3DOLA 4DR6K 3LALA 4AHRA 4K42A 3H08A 4CJKA 3LDOA 1OH7A 1HLUA 4B9QA 4CI6A 3SK3A 3BDPA 1MA9B 4CECA 1S3XA 4DU4A 1BA1A 4KH4A 4CJSA 3G71N 4O55A 4FPBA 3ULEA 3J7ZO 3SV4A 4FL9A 1GLJO 4B9TA 4I7FA 2NRHA 3UKRA 3SQ4A 1WSHA 1Q82O 4JD2A 2UUAK 3C7NA 3CMEN 4B3OA 3OYBA 1TGOA 1HMVA 3SCXA 3TANA 1NK9A 3S3OA 3PY8A 4BDYA 1CXUA 1B9FA 4ELVA 4FVUA 4F4KA 4RW4A 5KRTA 3CD6N 1H1VA 3CETA 2GWJA 1XQSC 4M45A 3SUQA 3CC7N 2IIRA 3VEZA 3P1GA 2FF6A 4E19A 1Q9XA 1VSJA 5KRSA 4RW9A 2DFFA 3AVCA 3TAEA 4LF4K 4DFPA 2EWSA 3L8BA 4LF7K 3KHYA 3O9QA 5I9EB 3LP1A 1YTUA 1QQNA 4BR9A 5HLFA 2VGMA 5LJWA 3RMCA 2Q1NA 1NMNA 3MCAB 3WNFA 1E4FT 1N36K 3O6WA 3B8AX 4I2QA 1VSFA 3ZT2A 1U2VB 2NRXA 4AHUA 2NZTA 3MN5A 1IBLK 4FJHA 4FJKA 4KTWA 4CEEA 2P9SB 5BPLA 3SBGA 3SAFA 4CHQA 5T7BA 5C2DA 4H0YB 3R3LA 4N5SA 3Q7BA 3ZEUB 1LWFA 1NOYA 4JKEA 3KJVA 4BWJA 3LP2A 2KZZA 2E2NA 4H5NA 4K8ZA 4JK8A 2DFHA 3M1FA 4CBUA 3QMLA 1FKPA 4BVOA 3G10A 1K9MO 2KLAA 4H5TA 1LWCA 3VGKA 4H5RA 1IO2A 1T6DA 3SUPA 4B9SA 3TAPA 3AVKA 4CGIA 4I9LA 1HQEA 4B9UA 4Z4CA 3G4SN 1VRTA 2P9KB 1T44A 4M3YA 4Z0UA 4YOWA 5AZIA 3KLIA 2W42A 1OVQA 5AZJA 3SBTA 4E1JA 3O5BA 5M1KA 4KI6A 1HNVA 4JKCA 5FDLA 2QTDA 4FWRA 1ATNA 1RBTA 4JS5A 5BR9A 4CJQA 3V9WA 3BP8A 5C24A 4B3MK 4M3RA 3NH0A 4CEDA 1VHXA 4FOEA 2A41A 4AM6A 1A5XA 3E01A 1VQPN 4CEQA 2HHSA 3B6PA 1C0TA 3RSEB 2W6KA 5E26A 3WXLA 3MK6A 2ASOA 1KVCA 4CE9A 1K8KA 3WNEA 5AQOA 4LFCK 4BROA 3CJBA 3THYA 3D0PA 4A2BA 4DHYA 1TKXA 3DLKA 1N33K 1NGDA 2HBLA 4FXDA 1QQOA 2GWKA 3NH1A 1BGXT 3HRGA 1NKBA 1HNXK 2ZE2A 2F4VK 3TSUA 3ZT0A 4UY8O 3DLHA 3PX4A 3RMAA 5H1SQ 5AQTA 3OYKA 2WUSA 3O9UA 3GBTA 3VEVA 1EX4A 5DM7L 2OZMA 2GTDA 2W40A 4NCGA 3MX2A 3S3MA 4JKGB 4CJFA 3A5OC 4H0XB 4NXMK 1OH5A 1C1CA 1SKWA 2P1JA 5EU7A 4Z4EA 2YNGA 5MLCQ 4CGGA 3OYGA 4M3ZA 3WEEB 1BISA 3ZX0A 4OKJA 3PLAA 4MO4A 4HVJA 4KHPK 2HMIA 4HUFA 4DU1A 4FLZA 4ZTFA 1JCGA 3THXA 4FJ5A 4DTSA 3CF5L 3NFAA 3VEXA 4PHTX 1LWEA 2LSNA 2NRVA 3AARA 2HVHA 3MXMA 3DRPA 4ISFA 2QWOA 3D6RA 4DV7K 2HHVA 3CCQN 1HQUA 2Q0UA 4OVLA 2VWJA 2O8FB 4C8MA 1DT9A 5AQIA 4KTZA 2H3GX 3ZT3A 1S5JA 3OBWA 2IC3A 1C0MA 3HZ6A 1OKJA 3F2KA 1NKCA 2F8SA 2P9NB 4XH4A 2XRIA 3U8XA 3EO3A 3K5MA 5D3GA 2YI1A 4JI4K 4LY7A 5I42A 3BUZB 2A5XA 3EL2A 3ZSXA 1Q81O 3HK2A 4PKGA 4Q0BA 4B1WB 3ZLJA 2Q0RA 1T6CA 3UKUB 2O8BB 3QIPA 4YORA 2WONA 3K59A 2BH1A 1KSPA 1VQON 5TKYA 1NU0A 3MXJA 4YOYA 1J54A 1RILA 4BY9C 4IEEA 3NCIA 2KHOA 3UE5A 4E7KA 1KFDA 2A3ZA 1U47A 1VRUA 1U04A 1IKWA 3OS0A 4YOVA 1V4SA 1XHZA 4IJAA 1VQ9N 1O1WA 3L6QA 1I39A 3ITHA 5A2QO 2XY7A 1BUPA 3TU5A 1JCEA 4JK9A 3VQ5A 3ZSWA 2ZGYA 3O3GA 3DI6A 4FO0A 2CGKA 3HXMA 4DTOA 5EVZA 1YVUA 4KH6A 1JXEA 2FBYA 1YHQN 4CZFA 4CEFA 5J2MA 1JLGA 2WFBA 1FKOA 2HOEA 3CMAN 3MXIA 2KFNA 4W5NA 3VQQA 1RT6A 1BHLA 1JCFA 2NRZA 3ZETA 5C42A 4K0KK 3P4IA 1BU6O 3L4IA 4JAXA 3MEDA 4QCLA 3PSIA 3MCPA 4MLHA 2E1YA 3MMVA 4DTPA 3KZBA 4YFUA 4DTXA 5C0YA 3VGLA 4B8CA 4E3SA 1Z25A 1ZYQA 2ZJPL 3HM9A 3CXCM 3CCJN 2E20A 1KD1O 1BOTO 4OGCA 3CYMA 3CFRA 3F9KA 1IKXA 1J53A 1T8EA 2E2OA 1QZ5A 3NF6A 4FLTA 1BI4A 1JLCA 3TARA 2YNFA 4CBWA 3LANA 2Y1IA 4GV3A 3PO5A 1QVFM 2QKBA 3F9MA 1REVA 3A5MC 3AY9A 3D2FB 3ZSVA 5CZ2A 4B1ZA 5JS2A 5SZTA 4BGBA 2UUBK 4H8KA 1RDUA 4BR4A 4LFBK 2HBMA 3AGKA 1RT5A 4DKWA 3VQ4A 4DR1K 1NK7A 3ZYYX 5M1PA 2O8EA 3O1WA 5JMVA 4B3TK 3AAQA 4KPYA 5LL6Z 1RT7A 3OS1A 4DR2K 3U3GA 4B9VA 1Q86O 4KHWA 3VESA 4FJNA 4ZHRA 3MWTA 2PFUA 2P9IA 3OS2A 4DR7K 3HJFA 4N76A 3N4PA 1RT1A 3GOIA 1K8AO 4FM2A 3VEWA 5HOOA 2WC9A 2RN2A 3SZ2A 2FLOA 2XY8A 1R0AA 3BY5A 1UOCA 3VOVA 5IWAK 4CHOA 2YKMA 1UWBA 5HRPA 3LPUA 4WQ5A 3VERA 3ZT1A 3DRSA 5LMUK 1HJOA 4X65K 5FPNA 3LWMA 2G8WA 4BRDA 1HKBA 3TPQA 3LWLA 2D0OA 3TTFA 4DQPA 1D9DA 5AQGA 3SJJA 3ATVA 4ZTJA 1DLOA 3M5RA 4CCHA 2VG6A 3AVNA 3KVGA 5FPDA 1NG9A 2OZSA 4M3XA 3AVAA 2OTLN 1R59O 5AQMA 4BACA 2P9LB 1U45A 4E7IA 4GKKK 1TAQA 3HSTB 2EX3A 2UUCK 2CGLA 3EE9A 4CESA 2KFZA 3S41A 4DLGA 2D4WA 5I3UA 2Q36A 4W5OA 4CZEA 5AQLA 4CZLA 3KLFA 2UU9K 2X6SA 3ENHA 1FK9A 3TWHA 3SNNA 3PIOL 3RRHA 4F2RA 2HHXA 4L8RB 4PKHA 3VQAA 2XO7A 1P8ZA 2E5LK 3QNNA 4CJ3A 3O9TA 1WUAA 4WFNL 1CZBA 5C10A 3AO4A 4FWLA 3VTIA 2O8DB 5AQKA 3OW2M 3AO3A 1MWMA 4OKKA 3D2EA 5AQZA 3T69A 1BWFO 1U48A 1SL0A 3HPOA 3LAKA 3JAMO 1Z26A 2QWMA 4IJNA 1NOZA 4FLVA 4Z4FA 1S1TA 3C65A 1OH8A 3BZKA 2Y1JA 3UIQA 1NGEA 3KWGA 4MQ3A 3M6GA 5B8HA 3CERA 4LSLA 2NUBA 1EWQA 1KLNA 1D5AA 3FFKB 3WXIA 1HNWK 1GLFO 4FWKA 4IOXA 4IO9L 1FJGK 2VCPA 4JI6K 3U9ZA 3J80O 1BIZA 4KAZA 4PY5A 4TSXA 3AO1A 4CGHA 4KB0A 3LDPA 1RCHA 4N41A 5BREA 1TKTA 5AZIB 1Z6RA 4EAHD 3E9OA 2UXBK 4NCAA 5AZJB 2OTJN 1GOAA 3HPGA 2ZJRL 4ILGB 2DTUA 4DSKA 1YVNA 4KH5A 3THVA 2X6NA 1U4BA 4H0TB 5HRRA 3SYZA 1VQNN 4FLYA 1RBRA 4DFKA 3G6EN 5LY3A 1SKSA 2FBTA 5TKWA 1RDAA 4EP4A 1LV5A 2ITMA 4FM1A 1X3NA 2G8KA 3OYEA 4E1NA 4DG1A 1QSSA 4KHQA 3CJCA 3PX6A 5AJ3K 4CFDA 4BRAA 4AM7A 1MU2A 2HBKA 5JICA 3WQUA 3HOTA 1DTQA 3DAWA 1RDBA 1QHAA 4IBNA 1K8KB 3EZ5A 2OPRA 4JKDA 4DQIA 3AVJA 2D0BA 1RBSA 2EHGA 1IG8A 3VN5A 3THYB 3S9HA 3LP0A 3OYLA 4R79A 1RFQA 3AO5A 2E4LA 1NK5A 4JHDA 2UXDK 2D5RA 1KCFA 1WSJA 2WBNA 3NF8A 4IZ9A 4BG8A 4AHSA 3TTCA 3L2UA 1VSMA 3DXMA 4YDUA 2G8FA 2VYPA 3QEIA 4QOZB 1BCOA 4H5WA 5AFUA 2V7YA 3SQ1A 2P9PA 5KGWA 1W0HA 4BE2A 4BR2A 3F73A 3G0ZA 3EN9A 2YHWA 3V1OA 1ZBIA 3SV3A 4HCBA 1YJNN 1NJXA 2GX9A 2UYTA 5KPZA 3O4QA 1OVYA 4H5VA 5M1OA 1QE1A 2FXUA 3THXB 1EKEA 2IVNA 5JVGL 4DV2K 5ELZA 1B92A 4BE0A 4WQ4A 4AHCA 2GELA 5BN8A 1TYQB 2ATQA 3V1QA 4BRFA 5GAGP 1TL1A 4BWMA 4BVPA 3DLBA 1ATRA 3HT3A 4W5TA 4JS4A 3SJHA 4A59A 1TKZA 1GLAG 3T7ZA 3VEOA 5AQXA 1N5YA 1TVRA 3GDQA 3VQCA 1IBKK 1VSLA 3RWUA 4OPAA 3LP3A 2QA4N 2NRTA 1NJZA 1CZ9A 5C2FA 1RTJA 2BTFA 3ZT4A 3DYAA 4DR5K 1W2BM 1VQ8N 3ZSQA 3FZMA 3T3FA 1NK8A 1TK8A 4IFEA 1KAZA 3TAQA 4NCBA 2YHXA 4O5FA 5FPEA 1YAGA 2QXLA 1V4TA 3O9SA 4IFVA 3KKSA 1ASVA 3FR0A 4DV4K 4ID1A 1XUPO 3DM2A 4EHTA 4IG3A 5GAHP 3CQ8A 3U4LA 4QS8A 3EKUA 3FZFA 3OTOK 4BC2A 1L3UA 1KXPA 3A2FA 1SS6A 1KRPA 2QM1A 2HF3A 3DOKA 3HP6A 3SAGA 5CR4A 2F7TA 1EQYA 4JYAK 1HRHA 3DXKA 3L2VA 4CZGA 3P31A 3OHRA 4DQSA 3DLRA 4FWSA 3HSCA 3KKRA 2AA4A 3OYHA 1GLLO 3RMDA 3VQ9A 1WN7A 3M8PA 1JLEA 2FF3B 5AQUA 4M7XA 4JRPA 4KRFA 3HPHA 3K5NA 4JN4A 4CJ4A 3MX5A 4CF8A 1N32K 3O9RA 2ZJQL 3VA3A 4JK7A 2PZSA 3NMUA 3NE6A 4JEPA 2QXFA 4DB3A 4FZYA 1ZBUA 3I8BA 4WE1A 4E7HA 3KTQA 2KZMA 1D9FA 1RTHA 3LDLA 1U2VA 4JV5K 1C1AA 1TL3A 3VQEA 2ZWHA 4F2SA 1TUYA 3FZHA 5F2RA 3PUFA 3HTVA 1C6VA 4UQGA 4KHNA 1RT2A 4FYDA 3ZETB 4WQ5C 2HNYA 3D7EO 4NLBA 2CH5A 4B9NA 1SV5A 5CY4A 4FJIA 4OLBA 4KTQA 1ITGA 4AILC 4YHHK 5GINA 1IKVA 2QWQA 1L3SA 3QEWA 4BRHA 2HBJA 4FK0A 1T03A 2J4RA 4E89A 1A5VA 4MDBA 4A2AA 4A5BA 4BRGA 4CJTA 1SZ2A 1S22A 4PA1A 2P5GA 3U9DA 4FK2A 4QS7A 1NJYA 1BI4B 2I5JA 4J2EA 4YOTA 1U49A 4F9OA 3AVFA 4DU3A 1YITN 4BC5A 5KI6A 3I8DA 3ISNC 3AO2A 4DS4A 4LD0A 4CFBA 1GLEG 4U67L 1J6ZA 4GV6A 3O08A 1RTIA 3BEXA 4C1NK 4B1XB 3LM2A 4MDAA 3T1HK 4EFHA 1HJRA 1YXQA 3SUOA 2VQEK 3KK2A 2O8EB 1HR0K 2HNZA 1DGKN 5F1XA 4DV5K 1RT4A 2D0CA 2YHYA 4J2DA 1CXQA 3VQ8A 4FPAA 4M7YA 4RG8A 3RR7A 1I94K 4M63C 4F8RA 4OPHA 3C0BA 2IVOA 1QVGM 3OYCA 1FXXA 3NHGA 4O44A 4M42A 3AVGA 4A57A 1WSGA 4DTMA 2G8UA 4KHUA 3IFRA 2YNIA 2KQ2A 3G25A 1LAVA 5ADXA 1NLVA 1HUXA 2ASPA 1WB9A 2QWLA 3FGUA 3ZSYA 4B9LA 1VQ4N 1KQSM 2NRWA 2E6LA 4U7BA 1ZC6A 2DFEA 3PX0A 2AJQA 4C8KA 2V7ZA 3DWLA 3SMSA 1N34K 2BE2A 1ZXOA 3FLCO 3MN6A 3VPZA 3TAMA 3R9PA 1KAYA 2Z1HA 3O80A 4C8NA 3DJCA 3LDSA 4B9MA 3AA4A 3DMJA 4DUYK 5LJVA 5BPMA 1XNQK 2VWKA 4CHNA 1NMDA 2YHAA 3ZSZA 2XY5A 4JI1K 2YJFA 4JI3K 5IT9O 1JLAA 4CJVA 4KV8A 3FZLA 3JS6A 2B6AA 3VTHA 4CZKA 3ZSRA
chains in the Genus database with same CATH topology
3LP1A 1YTUA 4K8XA 4DLGA 5HLFA 3QEXA 4DSFA 3RMCA 5HRSA 5I3UA 4G1QA 4W5OA 3WNFA 3KLGA 3SQ2A 3WNGA 3CM5A 4N56A 2BGGA 3KLFA 4LSNA 2X6SA 1FK9A 3TWHA 3SNNA 3O3FA 4I9QA 1L3TA 5C25A 4I2QA 1VSFA 3RRHA 4F2RA 3ZT2A 4GW6A 3QEPA 1ASWA 2HHXA 2OPQA 4CFAA 4L8RB 3VQAA 2XO7A 2G8VA 4FJ9A 4AHUA 2QKKA 4FJHA 4DTRA 4CJ3A 3QNNA 4FJKA 4KTWA 4CEEA 4CK3A 1CZBA 3T19A 5E41A 4DTUA 4IFYA 3IS9A 4CHQA 3DLEA 3VQBA 5T7BA 3CFPA 4N5SA 4CIGA 3TABA 3AO4A 4F3TA 1LW2A 1NOYA 1LWFA 1TAUA 3SPZA 3KJVA 2F8TA 4BWJA 3AO3A 4OKKA 3LP2A 2D0AA 4DTJA 4O4GA 2KZZA 1N6QA 4K8ZA 4HTUA 2DFHA 1U48A 4EP5A 4I2PA 3ZSOA 2BANA 1SL0A 2P51A 1UA1A 1QSYA 1FKPA 3LAKA 3OYAA 3HPOA 3CFOA 3G10A 1Z26A 4NYNA 4PQUA 3TAGA 1NOZA 4FLVA 4CEBA 1X9WA 2X74A 4Z4FA 1S1TA 1LWCA 3OJUA 1EETA 3HP9A 3QLHA 1IO2A 1WSFA 3K5OA 4HUGA 2E6MA 2Y1JA 3UIQA 3M8QA 4MQ3A 4AHVA 4OPJA 3SUPA 4B9SA 4M3TA 3HO1A 4FCYA 3TAPA 4LSLA 3AVKA 2NUBA 3HYFA 4CGIA 1L3VA 4I9LA 1HQEA 1SL2A 4B9UA 4Z4CA 2IS3A 2YV0X 1KLNA 2IGIA 3QO9A 4Z4IA 1D5AA 1VRTA 4M3YA 4Z0UA 1K6YA 2GV9A 3M8SA 3U3YA 2XHBA 3MAQA 3SPYA 4IG0A 4CJPA 4IDKA 3KLIA 3SI6A 3AVLA 3VA0A 4FJ7A 2W42A 3AA3A 1BIZA 4KAZA 4PY5A 1CLQA 4TSXA 4JLHA 2PY5A 4CF2A 4KI6A 1HNVA 4KO0A 5HRNA 4DF8A 4OLAA 3AO1A 2Q3SA 1S6PA 5FDLA 4CGHA 3HVRA 3V4IA 4KB0A 3LZJA 1RCHA 4DQRA 4N41A 1TKTA 4FJXA 1RBTA 4JS5A 2IOCA 2JLEA 4CJQA 3V9WA 5C24A 4M3RA 3NH0A 4CEDA 4NCAA 1GOAA 1RT3A 1A5XA 1YTAA 3E01A 3HPGA 1TKDA 1SUQA 1VSHA 1RTDA 2DTUA 4CEQA 1ZBLA 4H4MA 3RMBA 4DSKA 4CHPA 2FC0A 3DLGA 3THVA 2X6NA 1U4BA 2FBVA 5HRRA 3SYZA 2B4JA 4FLYA 2HHSA 3B6PA 1C0TA 3QESA 1RBRA 3NGYA 4Y1DA 3OYIA 4DFKA 2IAJA 1X9MA 1SKSA 2FBTA 4EZ9A 4FJLA 1KVCA 1QQCA 4CE9A 1RDAA 4W5QA 3WNEA 4EP4A 4HUEA 3IRXA 4FM1A 2XY6A 1LV5A 3OYEA 4E1NA 4DG1A 1QSLA 1VSIA 1HYVA 1QSSA 2G8KA 4KHQA 4N47A 1S9GA 3PX6A 1XC9A 4CFDA 3D0PA 4ELTA 4IKFA 4FJJA 1TKXA 3DLKA 3QETA 1EXQA 2O4GA 1RDDA 1MU2A 4GVMA 5J2PA 1BCMA 4OKEA 4FXDA 3NH1A 1DTQA 3L2QA 1BGXT 1RDBA 3NBPA 4CIEA 1NKBA 2ZE2A 4IBNA 3EZ5A 2HNDA 3O3HA 2OPRA 4DQIA 3KD5E 4RW8A 3ZT0A 4FM0A 4CJRA 3AVJA 2D0BA 1LW0A 1SKRA 3DLHA 1RBSA 2X78A 3PX4A 3RMAA 2EHGA 2GUIA 3VN5A 3OYKA 3S9HA 3K57A 1ASUA 1KFSA 1EX4A 3LZIA 3CM6A 3LP0A 3OYLA 3TR8A 2OZMA 2OYQA 4PWDA 2KTQA 4W5RA 1X1PA 3T1AA 3AO5A 3ASMA 3NF9A 4NCGA 3S3MA 2E4LA 3CG7A 1NK5A 4CJFA 4FZZA 2D5RA 4CERA 4FLUA 1C1CA 3OVNA 1KCFA 1WSJA 4ID5A 1EP4A 2P1JA 3NF8A 4Y1CA 5EU7A 3V9ZA 1SKWA 2YNGA 1D8YA 4AHSA 3TI0A 3L2UA 4C8LA 1VSMA 4CGGA 1GOBA 1Y97A 3OYGA 5J2QA 3U6FA 2G8FA 4M3ZA 1BISA 3QEIA 3QEVA 4QOZB 4DSJA 2GBZA 1NJWA 4OKJA 1BCOA 3M8RA 2WOMA 1QHTA 5CZ1A 4HVJA 3V9UA 2HMIA 4HUFA 4DU1A 4FLZA 3V1RA 5HP1A 4ZTFA 3SQ1A 5KGWA 1W0HA 4FJ5A 1RBUA 4BE2A 4DTSA 4CEAA 3KLEA 4MFBA 3F73A 4OJRA 3G0ZA 3NAEA 3VQPA 1JKHA 3NFAA 3V1OA 3WNHA 4DFMA 1LWEA 2LSNA 3MECA 3SV3A 3QERA 4HCBA 1S6QA 4E0DA 4HCCA 2HVHA 2OPSA 2HVIA 5FRMA 3MXMA 3NF7A 3DRPA 3NGZA 5DMRA 1NJXA 3EY1A 1LAWA 4J2AA 2HHTA 2HHVA 3V6DA 4LH4A 1KTQA 3O4QA 1HQUA 4CEOA 1S1WA 1A5WA 4OVLA 1QE1A 2VWJA 1WSIA 4O0JA 1IKYA 5KGXA 1EKEA 4DFJA 1VSEA 1C1BA 1QS4A 4C8MA 4BE0A 1B92A 4AHCA 2ATQA 3AVIA 3HL8A 4KTZA 3V1QA 3ZT3A 1G15A 1S5JA 1TL1A 4BWMA 3DLBA 2IC3A 1XI1A 1UAXA 1C0MA 1RNHA 3KK3A 3HT3A 4W5TA 4JS4A 3JSMA 1NKCA 1QTMA 2G8HA 2F8SA 2HHQA 3KLHA 1TKZA 1DTTA 2QK9A 1N5YA 4YNQA 4PUOA 1JXBA 3AA2A 1TVRA 4DMNA 2KFZA 3VQCA 1VSLA 2YNHA 1Q9YA 4KREA 2XRIA 3RWUA 3LP3A 2Z1IA 1TV6A 3IG1A 4KB1A 3K5MA 1NJZA 2P5OA 1VK0A 1CZ9A 5D3GA 1RTJA 2RF2A 3AVHA 4LY7A 3ZT4A 3DYAA 5I42A 3ALYA 1NK4A 2O4IA 4FJGA 2Z1GA 3ZSQA 4DQQA 3ZSXA 3T3FA 1NK8A 1TK8A 4CK1A 5CYQA 3TAQA 3HK2A 4Q0BA 4NCBA 3D45A 4XIUA 1X9SA 1L5UA 3VQDA 3OYJA 3QIPA 5DK5A 4CEZA 2WONA 4RW7A 2VG5A 2YKNA 4O5BA 3K59A 4IFVA 3KKSA 4M3WA 1ASVA 3I0RA 1KSPA 3PO4A 3RRGA 4ICLA 4OPKA 3NGIA 4ID1A 3SQ0A 4Z4GA 4CF0A 3O4NA 5J2NA 3AVMA 2G8IA 3DM2A 3MXJA 4IG3A 3CQ8A 1J54A 1RILA 3MEGA 5JS1A 4DWIA 1ZBIA 1JL2A 1WAFA 4QAGA 3EYZA 1L3UA 4KKOA 3NDKA 3JYTA 3NCIA 3A2FA 1NKEA 4GMJB 1KRPA 3KIOA 1JL1A 4FLXA 1KFDA 3AVBA 1RDCA 3FFIA 4E7KA 3HP6A 3DOKA 4J2BA 1U47A 1VRUA 4LH5A 1WLJA 3L2WA 4Z4HA 3ULDA 1U04A 1IKWA 3OS0A 4CIFA 4E7JA 1HRHA 3OY9A 3L2VA 4FJMA 4DSEA 4RW6A 4DF4A 2HHWA 1I3AA 3C94A 1XHZA 1ZBHA 4BDPA 4CF9A 1O1WA 3PV8A 1I39A 4DQSA 3ITHA 2RKIA 2XY7A 1F21A 3DLRA 3DRRA 1JLBA 1J9AA 1BQMA 1GOCA 4KI4A 3VQ5A 3ZSWA 1HPZA 4R5PA 3P83D 3DI6A 3O3GA 3L2RA 3IAYA 1BL3A 3KKRA 1S1XA 3HXMA 4DTOA 2PYJA 3OYHA 1YVUA 3RMDA 2DY4A 1JXEA 2FBYA 3I0SA 1WN7A 3M8PA 3VQ9A 4O0IA 4OGEA 1JLEA 4CEFA 5J2MA 2A1RA 1JLGA 4C8OA 4BDZA 4FZXC 4JRPA 4KRFA 1BQNA 1FKOA 3HPHA 1KVBA 3K5NA 3MXIA 4B08A 1NK6A 1S9EA 1XHXA 4CJ4A 1KLMA 2BDPA 2OA8A 2KFNA 1JLQA 2RPIA 3RTVA 3VQQA 4CF8A 4E1MA 4W5NA 1RT6A 1TK0A 1BHLA 1BIUA 3VA3A 4ELUA 1SL1A 2HB5A 2PZSA 2IDOA 5C42A 3OYMA 3NE6A 1YT3A 3K5LA 4FK4A 3MEDA 4QCLA 2QXFA 4FZYA 3S3NA 1ZBUA 1WNSA 4KHYA 3L3UA 1KVAA 4WE1A 4E7HA 3KTQA 2KZMA 4CF1A 1D9FA 1RTHA 1XWLA 4M3UA 5SWMA 4DTPA 1C1AA 1TL3A 3VQEA 4YFUA 4DTXA 4F2SA 3PUFA 4B8CA 4E3SA 1B9DA 3NH2A 4FYDA 1C6VA 1Z25A 4UQGA 1RT2A 1ZYQA 3C6TA 4KHNA 3HM9A 1VSKA 2ITGA 2HNYA 1HNIA 4EZ6A 4B9NA 3OYFA 1SV5A 5CY4A 3OYDA 4FJIA 2OPPA 4OLBA 4OGCA 4KTQA 1ITGA 3AA5X 5HBMA 3CYMA 2B5JA 3OYNA 3CFRA 4AILC 3F9KA 1IKXA 1J53A 3B6OA 1WSEA 3MEEA 1T8EA 1T7PA 3KD1E 4CK2A 4CJUA 1IKVA 3K2PA 3NF6A 2ETJA 1L3SA 4FLTA 1BI4A 3AV9A 1JLCA 3TARA 2YNFA 3QEWA 4DTNA 4FK0A 3LANA 2Y1IA 1T03A 1T05A 3PO5A 2QKBA 4FW1A 1REVA 3V9SA 4JRQA 2JGUA 4B8AB 3ZSVA 4E89A 1A5VA 1RBVA 4CJTA 5CZ2A 2HHUA 4PA1A 4CHYA 2P5GA 4KFBA 5JS2A 4FW2A 4NYFA 5SZTA 4FK2A 3C6UA 4H8KA 1NJYA 1BI4B 1W9HA 1IG9A 2I5JA 4J2EA 1VSDA 1RT5A 3VQ7A 1IH7A 4FVMA 4DS5A 1U49A 3AVFA 4DU3A 3VQ4A 2PYLA 1NK7A 5KI6A 4CFCA 3I8DA 3TAFA 3ISNC 2VG7A 3AO2A 3VQ6A 5HROA 4DS4A 4LD0A 4KPYA 4CFBA 4DLEA 4CGJA 4FLWA 1NK0A 3QIOA 1RT7A 4CJ5A 3C95A 1RTIA 3OS1A 4DSLA 2FBXA 4CGDA 3U3GA 4B9VA 1HJRA 3HVTA 4KHWA 4CGFA 3SUOA 4FJNA 4ZHRA 5KTQA 3KK2A 4CHZA 1S1UA 4KHSA 3DOLA 3LALA 3OS2A 4AHRA 2A1SA 2HNZA 3HJFA 4N76A 3P5JA 4CJWA 1RT1A 3H08A 4CJKA 1RT4A 2D0CA 4FM2A 3SUNA 4J2DA 4FJ8A 4E7LA 1CXQA 3VQ8A 1ZBFA 2KW4A 4RG8A 3BDPA 2RN2A 4CECA 3SZ2A 2XY8A 3RR7A 1R0AA 4AHTA 3V9XA 1UOCA 2ZD1A 4DU4A 4F8RA 3KK1A 4CJSA 4O55A 4Q5VA 1HYZA 4CHOA 3SV4A 2YKMA 4H4OA 3OYCA 4B9TA 1FXXA 4I7FA 1UWBA 3NHGA 1WSHA 4CJEA 3SQ4A 4O44A 4M42A 3OJSA 5HRPA 3AVGA 3ZCMA 3RR8A 3LPUA 1WSGA 4DTMA 2G8UA 4KHUA 4B3OA 2YNIA 2KQ2A 3DRSA 3ZT1A 3V81A 3OYBA 1LAVA 1TGOA 1HMVA 3SCXA 5FRNA 3LWMA 2G8WA 3ZSYA 3LWLA 4B9LA 1J5OA 4BE1A 3TANA 1NK9A 4M41A 2E6LA 1Q8IA 2DFEA 4DQPA 3PX0A 3S3OA 1D9DA 3SJJA 3PY8A 4BDYA 4C8KA 4DSIA 4Z4EA 2AJQA 1CXUA 4ZTJA 1DLOA 2R7YA 2ZQBA 1B9FA 4CCHA 4ELVA 2BE2A 1HYSA 2VG6A 3AVNA 4F4KA 3TAMA 4CJLA 4RW4A 4F3OA 2Z1JA 2Z1HA 5KRTA 3LAMA 4C8NA 1C0UA 3LDSA 2OZSA 5K14A 5CYMA 3QNOA 4M3XA 4B9MA 3K58A 3AA4A 3AVAA 3DMJA 4M45A 3SUQA 3QINA 5J1EA 2VWKA 4BACA 3P1GA 3BGRA 4E19A 1U45A 1Q9XA 4CHNA 1VSJA 4AH9A 2YHAA 3ZSZA 4RW9A 2DFFA 2YHBA 3AVCA 5KRSA 4E7IA 3TAEA 2XY5A 3L3VA 1TAQA 4DFPA 3HSTB 1UA0A 1S1VA 2EX3A 2HW3A 3LPTA 3L8BA 4HHTA 1JLAA 1JLFA 2F96A 4KV8A 4CESA 4CJVA 1TK5A 1WAJA 5FROA 2B6AA 3ZSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LP1 A;  1YTU A;  4K8X A;  4DLG A;  5HLF A;  3QEX A;  4DSF A;  3RMC A;  5HRS A;  5I3U A;  4G1Q A;  4W5O A;  3WNF A;  3KLG A;  3SQ2 A;  3WNG A;  3CM5 A;  4N56 A;  2BGG A;  3KLF A;  4LSN A;  2X6S A;  1FK9 A;  3TWH A;  3SNN A;  3O3F A;  4I9Q A;  1L3T A;  5C25 A;  4I2Q A;  1VSF A;  3RRH A;  4F2R A;  3ZT2 A;  4GW6 A;  3QEP A;  1ASW A;  2HHX A;  2OPQ A;  4CFA A;  4L8R B;  3VQA A;  2XO7 A;  2G8V A;  4FJ9 A;  4AHU A;  2QKK A;  4FJH A;  4DTR A;  4CJ3 A;  3QNN A;  4FJK A;  4KTW A;  4CEE A;  4CK3 A;  1CZB A;  3T19 A;  5E41 A;  4DTU A;  4IFY A;  3IS9 A;  4CHQ A;  3DLE A;  3VQB A;  5T7B A;  3CFP A;  4N5S A;  4CIG A;  3TAB A;  3AO4 A;  4F3T A;  1LW2 A;  1NOY A;  1LWF A;  1TAU A;  3SPZ A;  3KJV A;  2F8T A;  4BWJ A;  3AO3 A;  4OKK A;  3LP2 A;  2D0A A;  4DTJ A;  4O4G A;  2KZZ A;  1N6Q A;  4K8Z A;  4HTU A;  2DFH A;  1U48 A;  4EP5 A;  4I2P A;  3ZSO A;  2BAN A;  1SL0 A;  2P51 A;  1UA1 A;  1QSY A;  1FKP A;  3LAK A;  3OYA A;  3HPO A;  3CFO A;  3G10 A;  1Z26 A;  4NYN A;  4PQU A;  3TAG A;  1NOZ A;  4FLV A;  4CEB A;  1X9W A;  2X74 A;  4Z4F A;  1S1T A;  1LWC A;  3OJU A;  1EET A;  3HP9 A;  3QLH A;  1IO2 A;  1WSF A;  3K5O A;  4HUG A;  2E6M A;  2Y1J A;  3UIQ A;  3M8Q A;  4MQ3 A;  4AHV A;  4OPJ A;  3SUP A;  4B9S A;  4M3T A;  3HO1 A;  4FCY A;  3TAP A;  4LSL A;  3AVK A;  2NUB A;  3HYF A;  4CGI A;  1L3V A;  4I9L A;  1HQE A;  1SL2 A;  4B9U A;  4Z4C A;  2IS3 A;  2YV0 X;  1KLN A;  2IGI A;  3QO9 A;  4Z4I A;  1D5A A;  1VRT A;  4M3Y A;  4Z0U A;  1K6Y A;  2GV9 A;  3M8S A;  3U3Y A;  2XHB A;  3MAQ A;  3SPY A;  4IG0 A;  4CJP A;  4IDK A;  3KLI A;  3SI6 A;  3AVL A;  3VA0 A;  4FJ7 A;  2W42 A;  3AA3 A;  1BIZ A;  4KAZ A;  4PY5 A;  1CLQ A;  4TSX A;  4JLH A;  2PY5 A;  4CF2 A;  4KI6 A;  1HNV A;  4KO0 A;  5HRN A;  4DF8 A;  4OLA A;  3AO1 A;  2Q3S A;  1S6P A;  5FDL A;  4CGH A;  3HVR A;  3V4I A;  4KB0 A;  3LZJ A;  1RCH A;  4DQR A;  4N41 A;  1TKT A;  4FJX A;  1RBT A;  4JS5 A;  2IOC A;  2JLE A;  4CJQ A;  3V9W A;  5C24 A;  4M3R A;  3NH0 A;  4CED A;  4NCA A;  1GOA A;  1RT3 A;  1A5X A;  1YTA A;  3E01 A;  3HPG A;  1TKD A;  1SUQ A;  1VSH A;  1RTD A;  2DTU A;  4CEQ A;  1ZBL A;  4H4M A;  3RMB A;  4DSK A;  4CHP A;  2FC0 A;  3DLG A;  3THV A;  2X6N A;  1U4B A;  2FBV A;  5HRR A;  3SYZ A;  2B4J A;  4FLY A;  2HHS A;  3B6P A;  1C0T A;  3QES A;  1RBR A;  3NGY A;  4Y1D A;  3OYI A;  4DFK A;  2IAJ A;  1X9M A;  1SKS A;  2FBT A;  4EZ9 A;  4FJL A;  1KVC A;  1QQC A;  4CE9 A;  1RDA A;  4W5Q A;  3WNE A;  4EP4 A;  4HUE A;  3IRX A;  4FM1 A;  2XY6 A;  1LV5 A;  3OYE A;  4E1N A;  4DG1 A;  1QSL A;  1VSI A;  1HYV A;  1QSS A;  2G8K A;  4KHQ A;  4N47 A;  1S9G A;  3PX6 A;  1XC9 A;  4CFD A;  3D0P A;  4ELT A;  4IKF A;  4FJJ A;  1TKX A;  3DLK A;  3QET A;  1EXQ A;  2O4G A;  1RDD A;  1MU2 A;  4GVM A;  5J2P A;  1BCM A;  4OKE A;  4FXD A;  3NH1 A;  1DTQ A;  3L2Q A;  1BGX T;  1RDB A;  3NBP A;  4CIE A;  1NKB A;  2ZE2 A;  4IBN A;  3EZ5 A;  2HND A;  3O3H A;  2OPR A;  4DQI A;  3KD5 E;  4RW8 A;  3ZT0 A;  4FM0 A;  4CJR A;  3AVJ A;  2D0B A;  1LW0 A;  1SKR A;  3DLH A;  1RBS A;  2X78 A;  3PX4 A;  3RMA A;  2EHG A;  2GUI A;  3VN5 A;  3OYK A;  3S9H A;  3K57 A;  1ASU A;  1KFS A;  1EX4 A;  3LZI A;  3CM6 A;  3LP0 A;  3OYL A;  3TR8 A;  2OZM A;  2OYQ A;  4PWD A;  2KTQ A;  4W5R A;  1X1P A;  3T1A A;  3AO5 A;  3ASM A;  3NF9 A;  4NCG A;  3S3M A;  2E4L A;  3CG7 A;  1NK5 A;  4CJF A;  4FZZ A;  2D5R A;  4CER A;  4FLU A;  1C1C A;  3OVN A;  1KCF A;  1WSJ A;  4ID5 A;  1EP4 A;  2P1J A;  3NF8 A;  4Y1C A;  5EU7 A;  3V9Z A;  1SKW A;  2YNG A;  1D8Y A;  4AHS A;  3TI0 A;  3L2U A;  4C8L A;  1VSM A;  4CGG A;  1GOB A;  1Y97 A;  3OYG A;  5J2Q A;  3U6F A;  2G8F A;  4M3Z A;  1BIS A;  3QEI A;  3QEV A;  4QOZ B;  4DSJ A;  2GBZ A;  1NJW A;  4OKJ A;  1BCO A;  3M8R A;  2WOM A;  1QHT A;  5CZ1 A;  4HVJ A;  3V9U A;  2HMI A;  4HUF A;  4DU1 A;  4FLZ A;  3V1R A;  5HP1 A;  4ZTF A;  3SQ1 A;  5KGW A;  1W0H A;  4FJ5 A;  1RBU A;  4BE2 A;  4DTS A;  4CEA A;  3KLE A;  4MFB A;  3F73 A;  4OJR A;  3G0Z A;  3NAE A;  3VQP A;  1JKH A;  3NFA A;  3V1O A;  3WNH A;  4DFM A;  1LWE A;  2LSN A;  3MEC A;  3SV3 A;  3QER A;  4HCB A;  1S6Q A;  4E0D A;  4HCC A;  2HVH A;  2OPS A;  2HVI A;  5FRM A;  3MXM A;  3NF7 A;  3DRP A;  3NGZ A;  5DMR A;  1NJX A;  3EY1 A;  1LAW A;  4J2A A;  2HHT A;  2HHV A;  3V6D A;  4LH4 A;  1KTQ A;  3O4Q A;  1HQU A;  4CEO A;  1S1W A;  1A5W A;  4OVL A;  1QE1 A;  2VWJ A;  1WSI A;  4O0J A;  1IKY A;  5KGX A;  1EKE A;  4DFJ A;  1VSE A;  1C1B A;  1QS4 A;  4C8M A;  4BE0 A;  1B92 A;  4AHC A;  2ATQ A;  3AVI A;  3HL8 A;  4KTZ A;  3V1Q A;  3ZT3 A;  1G15 A;  1S5J A;  1TL1 A;  4BWM A;  3DLB A;  2IC3 A;  1XI1 A;  1UAX A;  1C0M A;  1RNH A;  3KK3 A;  3HT3 A;  4W5T A;  4JS4 A;  3JSM A;  1NKC A;  1QTM A;  2G8H A;  2F8S A;  2HHQ A;  3KLH A;  1TKZ A;  1DTT A;  2QK9 A;  1N5Y A;  4YNQ A;  4PUO A;  1JXB A;  3AA2 A;  1TVR A;  4DMN A;  2KFZ A;  3VQC A;  1VSL A;  2YNH A;  1Q9Y A;  4KRE A;  2XRI A;  3RWU A;  3LP3 A;  2Z1I A;  1TV6 A;  3IG1 A;  4KB1 A;  3K5M A;  1NJZ A;  2P5O A;  1VK0 A;  1CZ9 A;  5D3G A;  1RTJ A;  2RF2 A;  3AVH A;  4LY7 A;  3ZT4 A;  3DYA A;  5I42 A;  3ALY A;  1NK4 A;  2O4I A;  4FJG A;  2Z1G A;  3ZSQ A;  4DQQ A;  3ZSX A;  3T3F A;  1NK8 A;  1TK8 A;  4CK1 A;  5CYQ A;  3TAQ A;  3HK2 A;  4Q0B A;  4NCB A;  3D45 A;  4XIU A;  1X9S A;  1L5U A;  3VQD A;  3OYJ A;  3QIP A;  5DK5 A;  4CEZ A;  2WON A;  4RW7 A;  2VG5 A;  2YKN A;  4O5B A;  3K59 A;  4IFV A;  3KKS A;  4M3W A;  1ASV A;  3I0R A;  1KSP A;  3PO4 A;  3RRG A;  4ICL A;  4OPK A;  3NGI A;  4ID1 A;  3SQ0 A;  4Z4G A;  4CF0 A;  3O4N A;  5J2N A;  3AVM A;  2G8I A;  3DM2 A;  3MXJ A;  4IG3 A;  3CQ8 A;  1J54 A;  1RIL A;  3MEG A;  5JS1 A;  4DWI A;  1ZBI A;  1JL2 A;  1WAF A;  4QAG A;  3EYZ A;  1L3U A;  4KKO A;  3NDK A;  3JYT A;  3NCI A;  3A2F A;  1NKE A;  4GMJ B;  1KRP A;  3KIO A;  1JL1 A;  4FLX A;  1KFD A;  3AVB A;  1RDC A;  3FFI A;  4E7K A;  3HP6 A;  3DOK A;  4J2B A;  1U47 A;  1VRU A;  4LH5 A;  1WLJ A;  3L2W A;  4Z4H A;  3ULD A;  1U04 A;  1IKW A;  3OS0 A;  4CIF A;  4E7J A;  1HRH A;  3OY9 A;  3L2V A;  4FJM A;  4DSE A;  4RW6 A;  4DF4 A;  2HHW A;  1I3A A;  3C94 A;  1XHZ A;  1ZBH A;  4BDP A;  4CF9 A;  1O1W A;  3PV8 A;  1I39 A;  4DQS A;  3ITH A;  2RKI A;  2XY7 A;  1F21 A;  3DLR A;  3DRR A;  1JLB A;  1J9A A;  1BQM A;  1GOC A;  4KI4 A;  3VQ5 A;  3ZSW A;  1HPZ A;  4R5P A;  3P83 D;  3DI6 A;  3O3G A;  3L2R A;  3IAY A;  1BL3 A;  3KKR A;  1S1X A;  3HXM A;  4DTO A;  2PYJ A;  3OYH A;  1YVU A;  3RMD A;  2DY4 A;  1JXE A;  2FBY A;  3I0S A;  1WN7 A;  3M8P A;  3VQ9 A;  4O0I A;  4OGE A;  1JLE A;  4CEF A;  5J2M A;  2A1R A;  1JLG A;  4C8O A;  4BDZ A;  4FZX C;  4JRP A;  4KRF A;  1BQN A;  1FKO A;  3HPH A;  1KVB A;  3K5N A;  3MXI A;  4B08 A;  1NK6 A;  1S9E A;  1XHX A;  4CJ4 A;  1KLM A;  2BDP A;  2OA8 A;  2KFN A;  1JLQ A;  2RPI A;  3RTV A;  3VQQ A;  4CF8 A;  4E1M A;  4W5N A;  1RT6 A;  1TK0 A;  1BHL A;  1BIU A;  3VA3 A;  4ELU A;  1SL1 A;  2HB5 A;  2PZS A;  2IDO A;  5C42 A;  3OYM A;  3NE6 A;  1YT3 A;  3K5L A;  4FK4 A;  3MED A;  4QCL A;  2QXF A;  4FZY A;  3S3N A;  1ZBU A;  1WNS A;  4KHY A;  3L3U A;  1KVA A;  4WE1 A;  4E7H A;  3KTQ A;  2KZM A;  4CF1 A;  1D9F A;  1RTH A;  1XWL A;  4M3U A;  5SWM A;  4DTP A;  1C1A A;  1TL3 A;  3VQE A;  4YFU A;  4DTX A;  4F2S A;  3PUF A;  4B8C A;  4E3S A;  1B9D A;  3NH2 A;  4FYD A;  1C6V A;  1Z25 A;  4UQG A;  1RT2 A;  1ZYQ A;  3C6T A;  4KHN A;  3HM9 A;  1VSK A;  2ITG A;  2HNY A;  1HNI A;  4EZ6 A;  4B9N A;  3OYF A;  1SV5 A;  5CY4 A;  3OYD A;  4FJI A;  2OPP A;  4OLB A;  4OGC A;  4KTQ A;  1ITG A;  3AA5 X;  5HBM A;  3CYM A;  2B5J A;  3OYN A;  3CFR A;  4AIL C;  3F9K A;  1IKX A;  1J53 A;  3B6O A;  1WSE A;  3MEE A;  1T8E A;  1T7P A;  3KD1 E;  4CK2 A;  4CJU A;  1IKV A;  3K2P A;  3NF6 A;  2ETJ A;  1L3S A;  4FLT A;  1BI4 A;  3AV9 A;  1JLC A;  3TAR A;  2YNF A;  3QEW A;  4DTN A;  4FK0 A;  3LAN A;  2Y1I A;  1T03 A;  1T05 A;  3PO5 A;  2QKB A;  4FW1 A;  1REV A;  3V9S A;  4JRQ A;  2JGU A;  4B8A B;  3ZSV A;  4E89 A;  1A5V A;  1RBV A;  4CJT A;  5CZ2 A;  2HHU A;  4PA1 A;  4CHY A;  2P5G A;  4KFB A;  5JS2 A;  4FW2 A;  4NYF A;  5SZT A;  4FK2 A;  3C6U A;  4H8K A;  1NJY A;  1BI4 B;  1W9H A;  1IG9 A;  2I5J A;  4J2E A;  1VSD A;  1RT5 A;  3VQ7 A;  1IH7 A;  4FVM A;  4DS5 A;  1U49 A;  3AVF A;  4DU3 A;  3VQ4 A;  2PYL A;  1NK7 A;  5KI6 A;  4CFC A;  3I8D A;  3TAF A;  3ISN C;  2VG7 A;  3AO2 A;  3VQ6 A;  5HRO A;  4DS4 A;  4LD0 A;  4KPY A;  4CFB A;  4DLE A;  4CGJ A;  4FLW A;  1NK0 A;  3QIO A;  1RT7 A;  4CJ5 A;  3C95 A;  1RTI A;  3OS1 A;  4DSL A;  2FBX A;  4CGD A;  3U3G A;  4B9V A;  1HJR A;  3HVT A;  4KHW A;  4CGF A;  3SUO A;  4FJN A;  4ZHR A;  5KTQ A;  3KK2 A;  4CHZ A;  1S1U A;  4KHS A;  3DOL A;  3LAL A;  3OS2 A;  4AHR A;  2A1S A;  2HNZ A;  3HJF A;  4N76 A;  3P5J A;  4CJW A;  1RT1 A;  3H08 A;  4CJK A;  1RT4 A;  2D0C A;  4FM2 A;  3SUN A;  4J2D A;  4FJ8 A;  4E7L A;  1CXQ A;  3VQ8 A;  1ZBF A;  2KW4 A;  4RG8 A;  3BDP A;  2RN2 A;  4CEC A;  3SZ2 A;  2XY8 A;  3RR7 A;  1R0A A;  4AHT A;  3V9X A;  1UOC A;  2ZD1 A;  4DU4 A;  4F8R A;  3KK1 A;  4CJS A;  4O55 A;  4Q5V A;  1HYZ A;  4CHO A;  3SV4 A;  2YKM A;  4H4O A;  3OYC A;  4B9T A;  1FXX A;  4I7F A;  1UWB A;  3NHG A;  1WSH A;  4CJE A;  3SQ4 A;  4O44 A;  4M42 A;  3OJS A;  5HRP A;  3AVG A;  3ZCM A;  3RR8 A;  3LPU A;  1WSG A;  4DTM A;  2G8U A;  4KHU A;  4B3O A;  2YNI A;  2KQ2 A;  3DRS A;  3ZT1 A;  3V81 A;  3OYB A;  1LAV A;  1TGO A;  1HMV A;  3SCX A;  5FRN A;  3LWM A;  2G8W A;  3ZSY A;  3LWL A;  4B9L A;  1J5O A;  4BE1 A;  3TAN A;  1NK9 A;  4M41 A;  2E6L A;  1Q8I A;  2DFE A;  4DQP A;  3PX0 A;  3S3O A;  1D9D A;  3SJJ A;  3PY8 A;  4BDY A;  4C8K A;  4DSI A;  4Z4E A;  2AJQ A;  1CXU A;  4ZTJ A;  1DLO A;  2R7Y A;  2ZQB A;  1B9F A;  4CCH A;  4ELV A;  2BE2 A;  1HYS A;  2VG6 A;  3AVN A;  4F4K A;  3TAM A;  4CJL A;  4RW4 A;  4F3O A;  2Z1J A;  2Z1H A;  5KRT A;  3LAM A;  4C8N A;  1C0U A;  3LDS A;  2OZS A;  5K14 A;  5CYM A;  3QNO A;  4M3X A;  4B9M A;  3K58 A;  3AA4 A;  3AVA A;  3DMJ A;  4M45 A;  3SUQ A;  3QIN A;  5J1E A;  2VWK A;  4BAC A;  3P1G A;  3BGR A;  4E19 A;  1U45 A;  1Q9X A;  4CHN A;  1VSJ A;  4AH9 A;  2YHA A;  3ZSZ A;  4RW9 A;  2DFF A;  2YHB A;  3AVC A;  5KRS A;  4E7I A;  3TAE A;  2XY5 A;  3L3V A;  1TAQ A;  4DFP A;  3HST B;  1UA0 A;  1S1V A;  2EX3 A;  2HW3 A;  3LPT A;  3L8B A;  4HHT A;  1JLA A;  1JLF A;  2F96 A;  4KV8 A;  4CES A;  4CJV A;  1TK5 A;  1WAJ A;  5FRO A;  2B6A A;  3ZSR A; 
#chains in the Genus database with same CATH topology
 3QEX A;  5HRS A;  4G1Q A;  3KLG A;  3SQ2 A;  3CM5 A;  2JWL A;  2BGG A;  4LSN A;  2HMP A;  3O3F A;  1L3T A;  4XH1 A;  1ASW A;  2OPQ A;  2G8V A;  4CJ7 A;  4DTR A;  2FSK A;  4CK3 A;  3T19 A;  4DTU A;  3ZX3 A;  3IS9 A;  4XH5 A;  3AGR A;  3DLE A;  5AQP A;  3TAB A;  5AQH A;  1NGB A;  3EZW A;  1TAU A;  3SPZ A;  1NBW A;  3E66 A;  4BQL A;  2F8T A;  4O4G A;  3HI0 A;  3H3N O;  3VF2 A;  2P51 A;  4NYN A;  4DV1 K;  4PQU A;  1RGI A;  1IBM K;  4LF5 K;  4CEB A;  2X74 A;  1NGC A;  1WSF A;  3BF3 A;  3J7A P;  3K5O A;  3D2E B;  3QFP A;  4YOU A;  4NXN K;  4M3T A;  3H45 C;  1VQ6 N;  3W3D A;  4FCY A;  1L3V A;  3VGM A;  2IS3 A;  2YV0 X;  2ZF5 O;  2IGI A;  4AF1 A;  2O8B A;  4YDU C;  3VF4 A;  4CZI A;  2D1K A;  1EO1 A;  4X62 K;  4CZJ A;  3SPY A;  3VA0 A;  5F0X A;  5EY4 A;  1KAX A;  1CLQ A;  4JLH A;  4CF2 A;  4RCH A;  4KO0 A;  4IEI A;  3VEY A;  5HRN A;  3F5T A;  4DF8 A;  4OLA A;  1S6P A;  5LMN K;  3V4I A;  1D4X A;  1LCU A;  5KQD A;  1IJJ A;  4FJX A;  4XEI A;  2QI2 A;  3ZX2 A;  4WF9 L;  4CZM A;  1SUQ A;  1VSH A;  4WQ4 C;  1RTD A;  4CBX A;  3RMB A;  3TSQ A;  2FC0 A;  3DLG A;  5GAD P;  2FBV A;  1TUU A;  3ULE B;  3K9K A;  3NGY A;  3OYI A;  1X9M A;  3UKR B;  1GLD G;  4EZ9 A;  4FJL A;  4JD2 B;  3C7N B;  4W5Q A;  2XY6 A;  4HUE A;  3IRX A;  4Z4I A;  1HYV A;  5AQN A;  4JI5 K;  4N47 A;  3TSP A;  3A0I X;  2P9U A;  3VET A;  4JKB A;  4IKF A;  3QET A;  1ILY A;  3CC4 N;  2O4G A;  1RDD A;  4GVM A;  3KK7 A;  5J2P A;  3SMP A;  1BCM A;  1JJ2 M;  4BRN A;  1U6Z A;  4MO5 A;  4PKI A;  4CIE A;  3KD5 E;  3CCL N;  4RW8 A;  4FM0 A;  4CJR A;  1SKR A;  2X78 A;  1QQM A;  3H46 O;  2GUI A;  5E84 A;  1NNE A;  1KFS A;  3K57 A;  1YIJ N;  1C0F A;  3LZI A;  3CM6 A;  4PWD A;  2KTQ A;  2OYQ A;  1WBD A;  4W5R A;  4B3R K;  1XNR K;  3CG7 A;  1CZA N;  4FZZ A;  4CER A;  3C6H A;  3OVN A;  1EP4 A;  2QW9 A;  2HW3 A;  2O4I A;  1D8Y A;  1GOB A;  3FZK A;  3U6F A;  5GAE P;  3CI5 A;  3QEV A;  1LOT B;  1DKG D;  2AP1 A;  3WXM B;  1QHT A;  5CZ1 A;  3V9U A;  4CZH A;  3V1R A;  2Q2R A;  4JHD B;  1RBU A;  3OBY A;  4LFA K;  4MFB A;  2UXC K;  3VQP A;  3MEC A;  3DXM B;  2HVI A;  4E0D A;  4HCC A;  1NGG A;  5GIO A;  3MN9 A;  3NGZ A;  3EY1 A;  2DPN A;  4LH4 A;  3H1V X;  4CEO A;  3LL3 A;  3WUH A;  1S1W A;  1A5W A;  2P9P B;  1WSI A;  4H0V B;  4O0J A;  4DFJ A;  3E1Y A;  1C1B A;  1QS4 A;  2A6A A;  3HL8 A;  3AVI A;  4I6M A;  2NLX A;  4K41 A;  5KPT A;  1UAX A;  3THW A;  3KK3 A;  2PAV A;  4C23 A;  3IMX A;  4L3Q A;  3JSM A;  1QTM A;  3E9L A;  5AQV A;  4PUO A;  1JXB A;  3MWP A;  5HL7 L;  4FWO A;  2YNH A;  1Q9Y A;  1WBB A;  1SQK A;  2Z1I A;  3QFU A;  1TV6 A;  3IG1 A;  4RTF D;  2P5O A;  4DCH A;  2RF2 A;  3A5N C;  3ALY A;  4JI0 K;  4FJG A;  4WYB A;  4BC3 A;  4CK1 A;  5CYQ A;  1NGA A;  4YOX A;  3D45 A;  4A5A A;  4XIU A;  1X9S A;  3VQD A;  3CJ9 A;  4DV6 K;  4RW7 A;  2HST A;  2VG5 A;  2YKN A;  4O5B A;  4M3W A;  1ATS A;  4RWT A;  3PO4 A;  2E1Z A;  2E88 A;  5AQQ A;  3SQ0 A;  5DM6 L;  4CF0 A;  3GL1 A;  5J2N A;  3AVM A;  3MEG A;  3WQT A;  4DWI A;  4HWI A;  1JL2 A;  3O8M A;  4QAG A;  3EYZ A;  4JKA A;  4KKO A;  3JYT A;  4GMJ B;  3TTD A;  4GV9 A;  1W97 L;  1E3M A;  4J2B A;  4O8K A;  4LH5 A;  3L2W A;  3ULD A;  1Q18 A;  4Z4H A;  2E2P A;  2V52 B;  3R6M A;  4JKH A;  3OY9 A;  4FWP A;  4FJM A;  4RW6 A;  3QBX A;  1I3A A;  3C94 A;  3T1Y K;  1ZBH A;  4IOA L;  2HHW A;  3ID8 A;  4BDP A;  2RKI A;  5CHI A;  1F21 A;  1E4G T;  4C1N I;  3DRR A;  1JLB A;  1J9A A;  1Z05 A;  1HPZ A;  4R5P A;  1P90 A;  3P83 D;  3L2R A;  2Q31 A;  2PYJ A;  3DXK B;  1SAZ A;  3I0S A;  5BRH A;  2P9L A;  5AQS A;  4OGE A;  4FOI A;  1BA0 A;  4BRC A;  3CJ1 A;  2I7N A;  4B08 A;  1S9E A;  4K43 A;  3WT0 A;  1KLM A;  2OA8 A;  1YUW A;  2Q97 A;  2RPI A;  3RTV A;  1TK0 A;  5KPR A;  1VAZ A;  3K5L A;  4FK4 A;  2GEM A;  2NRR A;  3L3U A;  1XWL A;  4LF6 K;  4M3U A;  5SWM A;  5AQR A;  1Q7Y O;  3WXJ A;  1B9D A;  3NH2 A;  4DV0 K;  3NVM A;  1VSK A;  3OYF A;  4G9Z A;  5AQJ A;  2OPP A;  3AA5 X;  3OA9 A;  3OYN A;  2B5J A;  3M3Z A;  2O8D A;  4JI8 K;  3B6O A;  1WSE A;  3MEE A;  3SLC A;  1T7P A;  3KD1 E;  4CK2 A;  4CJU A;  2WTU A;  3LM9 A;  1QZ6 A;  4BQZ A;  2ETJ A;  5CE3 A;  3VMF B;  3GG4 A;  1VQ5 N;  3AV9 A;  3K0S A;  4DTN A;  1T05 A;  4FW1 A;  4JI7 K;  5KQ8 A;  3V9S A;  2IVP A;  2O8C A;  4JRQ A;  3Q7C A;  2HHU A;  1RBV A;  1NGF A;  4CHY A;  1NWK A;  4NYF A;  4NO7 A;  3C6U A;  1W9H A;  4B1Y B;  4DS5 A;  5FPM A;  1XC3 A;  4CFC A;  3K9J A;  3TAF A;  3PSF A;  3CCV N;  1EWR A;  1WOQ A;  5HRO A;  1O13 A;  4FLW A;  3N4Q A;  1YI2 N;  1NK0 A;  3QIO A;  4CJ5 A;  3C95 A;  4DSL A;  5KTQ A;  2GUP A;  1W7A A;  4LF8 K;  2A1S A;  3P5J A;  4CJW A;  5C12 A;  3SUN A;  4FJ8 A;  4E7L A;  2OCE A;  3H1Q A;  1ZBF A;  2KW4 A;  2V51 B;  3LDQ A;  4AHT A;  3V9X A;  2ZD1 A;  3KK1 A;  4YY3 K;  4Q5V A;  3NVK A;  1HYZ A;  4H4O A;  4CJE A;  3CCU N;  3OJS A;  3ZCM A;  3RR8 A;  1ESV A;  3V81 A;  1K73 O;  5FRN A;  1J5O A;  4BE1 A;  4M41 A;  2FSN A;  3P38 A;  1Q8I A;  5AR0 A;  1GLC G;  3L4Q A;  1NM1 A;  4EHU A;  4X64 K;  2R7Y A;  2ZQB A;  2PBD A;  4DR3 K;  1IV0 A;  1HYS A;  4H03 B;  4CJL A;  1ZBS A;  3R8E A;  4F3O A;  2Z1J A;  3LAM A;  1BO5 O;  1C0U A;  4GVE A;  1NGJ A;  5K14 A;  5CYM A;  3QNO A;  3CHW A;  2D0P A;  3K58 A;  3QIN A;  4JI2 K;  5J1E A;  2OAN A;  3CPW M;  3BGR A;  4AH9 A;  5BPN A;  4DSI A;  2YHB A;  1UA0 A;  3L3V A;  3CCM N;  1S1V A;  3LPT A;  4HHT A;  1JLF A;  2F96 A;  1TK5 A;  1HNZ K;  1X3M A;  1WAJ A;  5FRO A;  3H3O B;  3ID6 A;  5BRD A;  5AQW A;  4K8X A;  2HF4 A;  5JLH A;  4DSF A;  2QWP A;  4BRE A;  2P9S A;  3WNG A;  4WFA L;  4JNE A;  4N56 A;  4FWN A;  3QIC A;  4GNI A;  4DUZ K;  4I9Q A;  5C25 A;  3CC2 N;  3QB0 A;  1Y64 A;  5BN9 A;  4BC4 A;  3FE1 A;  4GW6 A;  3IDH A;  3QEP A;  4CFA A;  4FJ9 A;  1HKG A;  2QKK A;  3ZEU A;  3W0L A;  3JXU A;  4IDH A;  3GE1 A;  5E41 A;  3MDQ A;  1YJ9 N;  3WXK A;  3EE8 A;  4IFY A;  1RDW X;  3VQB A;  3CFP A;  4CIG A;  1TYQ A;  1YF5 L;  4F3T A;  4CW7 B;  1LW2 A;  1M1K O;  2HHH K;  4ISE A;  4MLE A;  1M90 O;  2D0A A;  4DTJ A;  3E9P A;  1N6Q A;  4OO1 J;  4HTU A;  4J8F A;  4EP5 A;  4I2P A;  3ZSO A;  4WCE L;  2BAN A;  5C15 A;  1UA1 A;  1QSY A;  3OYA A;  3CFO A;  1BDG A;  2QWN A;  3TAG A;  2P9K A;  1X9W A;  3OJU A;  1EET A;  2FSJ A;  3HP9 A;  3UB5 A;  3QLH A;  5JLF A;  4HUG A;  3J7Y P;  2E6M A;  3M8Q A;  4AHV A;  1NJI O;  4OPJ A;  3HO1 A;  3C6A A;  1BG3 A;  3HYF A;  5AFU H;  1SL2 A;  2G8I A;  4FSV A;  1VQ7 N;  3QO9 A;  3DLL L;  3EEQ A;  1K6Y A;  2GV9 A;  3M8S A;  3O1B A;  3CJA A;  3U3Y A;  3IKM A;  2XHB A;  3MAQ A;  4IG0 A;  4BR0 A;  3QBW A;  4IDK A;  4CJP A;  3SI6 A;  3AVL A;  4FJ7 A;  3AA3 A;  3MN7 A;  2YJE A;  3A5L C;  2PY5 A;  2Q3S A;  3HVR A;  3LZJ A;  3EKS A;  4DQR A;  2P9I B;  3RSE A;  2IOC A;  2JLE A;  4DV3 K;  1NGH A;  1RT3 A;  1YTA A;  5FLX O;  1TKD A;  1ZBL A;  4H4M A;  4CHP A;  2B4J A;  4ISG A;  2JWK A;  3QES A;  4Y1D A;  2IAJ A;  2RHK A;  1QQC A;  5BR8 K;  1QSL A;  2E8A A;  1VSI A;  3CQX A;  4V19 S;  1S9G A;  4IWV A;  4KBO A;  3J81 O;  1XC9 A;  4ELT A;  4FJJ A;  1EXQ A;  2VGN A;  4OKE A;  3L2Q A;  1DEJ A;  3NBP A;  4JKG A;  2HND A;  3O3H A;  1J5E K;  4BRL A;  1HKC A;  1LW0 A;  4IXC A;  2QWR A;  2P9U B;  3I33 A;  1ASU A;  3P39 A;  4PL8 A;  4X66 K;  3WEE A;  3TR8 A;  1X1P A;  3T1A A;  3ASM A;  3NF9 A;  3HOS A;  1S72 N;  4FLU A;  4ID5 A;  2I7P A;  3V9Z A;  4FZX C;  4Y1C A;  1GLB G;  4ILJ A;  3TI0 A;  4C8L A;  5EX5 A;  1Y97 A;  3CQY A;  5J2Q A;  4DSJ A;  2GBZ A;  1NJW A;  2YX6 A;  3M8R A;  2WOM A;  3HM8 A;  4B1V A;  5HP1 A;  4EIA A;  3I56 N;  4BRM A;  4BG9 A;  4CEA A;  3KLE A;  3NAE A;  2O8F A;  4OJR A;  4DFM A;  1JKH A;  3WNH A;  4A62 A;  4BRI A;  3QER A;  1S6Q A;  2OPS A;  5FRM A;  3I55 N;  3NF7 A;  5DMR A;  1LAW A;  4J2A A;  2HHT A;  3V6D A;  1KTQ A;  1NGI A;  3PIP L;  4CVN E;  2CGJ A;  5KGX A;  1IKY A;  4AQY K;  1VSE A;  2P9N A;  2YCH A;  4CD3 A;  1C0G A;  1G15 A;  4JKF A;  4NLC A;  4WFB L;  1XI1 A;  3AAP A;  1RNH A;  3A8Y A;  2G8H A;  2HHQ A;  3KLH A;  2QEX N;  1DTT A;  2QK9 A;  4YNQ A;  3AA2 A;  2CH6 A;  4BRQ A;  4DMN A;  5M1F A;  4KRE A;  2ZGZ A;  4I6M B;  3UKU A;  4KB1 A;  2A42 A;  5EXW A;  1VK0 A;  3KWI A;  3THW B;  3ATU A;  4NB4 A;  1MWK A;  3AVH A;  3CJ7 A;  1NK4 A;  2Z1G A;  5M1Q A;  4DQQ A;  4K25 A;  4LC9 B;  1L5U A;  3OYJ A;  1X9J A;  5DK5 A;  4CEZ A;  2A40 A;  1YJW N;  3I0R A;  2E2Q A;  3IUC A;  1XMQ K;  3VF6 A;  3RRG A;  2RE2 A;  3ENO A;  4ICL A;  4OPK A;  3NGI A;  4Z4G A;  3O4N A;  4H0O A;  5JS1 A;  1WAF A;  3NDK A;  1NKE A;  3RVC A;  3KIO A;  1JL1 A;  4IO8 A;  4FLX A;  2KKZ A;  1RDC A;  3AVB A;  3FFI A;  1N8R O;  4FWM A;  1WLJ A;  1HX1 A;  4CIF A;  4E7J A;  2ASM A;  4DSE A;  3LDN A;  4DF4 A;  1FW6 A;  4CF9 A;  3PV8 A;  5EOY A;  3H6E A;  2ZM6 K;  3J8A A;  5BRF A;  4KI4 A;  1BQM A;  1GOC A;  3IAY A;  1BL3 A;  1VQK N;  1S1X A;  2W41 A;  2DY4 A;  4O0I A;  4DR4 K;  3BZC A;  2A1R A;  4C8O A;  4BDZ A;  1MDU B;  1BQN A;  1KVB A;  5AQY A;  2BUP A;  1NK6 A;  4GKJ K;  1XHX A;  2F9W A;  2BDP A;  1JLQ A;  5AQF A;  5JVH L;  4E1M A;  1BIU A;  2NNW A;  4ELU A;  1SL1 A;  2HB5 A;  2IDO A;  3OYM A;  1YT3 A;  4BGA A;  4KHY A;  3S3N A;  1WNS A;  1KVA A;  4CF1 A;  4A61 A;  4BRK A;  5ADX H;  1VQM N;  1XMO K;  3C6T A;  1KC8 O;  2ITG A;  1HNI A;  1HPM A;  4IOC L;  3O4W A;  4EZ6 A;  4Z94 A;  4B1U B;  4FWQ A;  3ENB A;  2W6L A;  4LF9 K;  4HTL A;  3OYD A;  4B3S K;  3D2F A;  5HBM A;  1G99 A;  3VEN A;  1VQL N;  3CCS N;  3K2P A;  1T3V A;  2VWB A;  3L0Q A;  2JGU A;  4B8A B;  4CD1 A;  4BR7 A;  5M1N A;  3BF1 A;  4KFB A;  4FW2 A;  4ILH A;  1IG9 A;  4H0P A;  4OX9 K;  3CIP A;  1VSD A;  3VQ7 A;  1IH7 A;  4FVM A;  2O8C B;  2PYL A;  4Y0W A;  4BRP A;  2VQF K;  4BR5 A;  3R1X A;  4PL7 A;  3SAH A;  2VG7 A;  3VQ6 A;  3QDK A;  4DQ8 A;  4DLE A;  5GIP A;  3CPE A;  4CGJ A;  1OH6 A;  3CCR N;  4GY2 B;  2FBX A;  4CGD A;  2F9T A;  3HVT A;  4O8U A;  4CGF A;  3HBT A;  4QS9 A;  3CCE N;  4CHZ A;  1S1U A;  4KHS A;  3DOL A;  4DR6 K;  3LAL A;  4AHR A;  4K42 A;  3H08 A;  4CJK A;  3LDO A;  1OH7 A;  1HLU A;  4B9Q A;  4CI6 A;  3SK3 A;  3BDP A;  1MA9 B;  4CEC A;  1S3X A;  4DU4 A;  1BA1 A;  4KH4 A;  4CJS A;  3G71 N;  4O55 A;  4FPB A;  3ULE A;  3J7Z O;  3SV4 A;  4FL9 A;  1GLJ O;  4B9T A;  4I7F A;  2NRH A;  3UKR A;  3SQ4 A;  1WSH A;  1Q82 O;  4JD2 A;  2UUA K;  3C7N A;  3CME N;  4B3O A;  3OYB A;  1TGO A;  1HMV A;  3SCX A;  3TAN A;  1NK9 A;  3S3O A;  3PY8 A;  4BDY A;  1CXU A;  1B9F A;  4ELV A;  4FVU A;  4F4K A;  4RW4 A;  5KRT A;  3CD6 N;  1H1V A;  3CET A;  2GWJ A;  1XQS C;  4M45 A;  3SUQ A;  3CC7 N;  2IIR A;  3VEZ A;  3P1G A;  2FF6 A;  4E19 A;  1Q9X A;  1VSJ A;  5KRS A;  4RW9 A;  2DFF A;  3AVC A;  3TAE A;  4LF4 K;  4DFP A;  2EWS A;  3L8B A;  4LF7 K;  3KHY A;  3O9Q A;  5I9E B;  3LP1 A;  1YTU A;  1QQN A;  4BR9 A;  5HLF A;  2VGM A;  5LJW A;  3RMC A;  2Q1N A;  1NMN A;  3MCA B;  3WNF A;  1E4F T;  1N36 K;  3O6W A;  3B8A X;  4I2Q A;  1VSF A;  3ZT2 A;  1U2V B;  2NRX A;  4AHU A;  2NZT A;  3MN5 A;  1IBL K;  4FJH A;  4FJK A;  4KTW A;  4CEE A;  2P9S B;  5BPL A;  3SBG A;  3SAF A;  4CHQ A;  5T7B A;  5C2D A;  4H0Y B;  3R3L A;  4N5S A;  3Q7B A;  3ZEU B;  1LWF A;  1NOY A;  4JKE A;  3KJV A;  4BWJ A;  3LP2 A;  2KZZ A;  2E2N A;  4H5N A;  4K8Z A;  4JK8 A;  2DFH A;  3M1F A;  4CBU A;  3QML A;  1FKP A;  4BVO A;  3G10 A;  1K9M O;  2KLA A;  4H5T A;  1LWC A;  3VGK A;  4H5R A;  1IO2 A;  1T6D A;  3SUP A;  4B9S A;  3TAP A;  3AVK A;  4CGI A;  4I9L A;  1HQE A;  4B9U A;  4Z4C A;  3G4S N;  1VRT A;  2P9K B;  1T44 A;  4M3Y A;  4Z0U A;  4YOW A;  5AZI A;  3KLI A;  2W42 A;  1OVQ A;  5AZJ A;  3SBT A;  4E1J A;  3O5B A;  5M1K A;  4KI6 A;  1HNV A;  4JKC A;  5FDL A;  2QTD A;  4FWR A;  1ATN A;  1RBT A;  4JS5 A;  5BR9 A;  4CJQ A;  3V9W A;  3BP8 A;  5C24 A;  4B3M K;  4M3R A;  3NH0 A;  4CED A;  1VHX A;  4FOE A;  2A41 A;  4AM6 A;  1A5X A;  3E01 A;  1VQP N;  4CEQ A;  2HHS A;  3B6P A;  1C0T A;  3RSE B;  2W6K A;  5E26 A;  3WXL A;  3MK6 A;  2ASO A;  1KVC A;  4CE9 A;  1K8K A;  3WNE A;  5AQO A;  4LFC K;  4BRO A;  3CJB A;  3THY A;  3D0P A;  4A2B A;  4DHY A;  1TKX A;  3DLK A;  1N33 K;  1NGD A;  2HBL A;  4FXD A;  1QQO A;  2GWK A;  3NH1 A;  1BGX T;  3HRG A;  1NKB A;  1HNX K;  2ZE2 A;  2F4V K;  3TSU A;  3ZT0 A;  4UY8 O;  3DLH A;  3PX4 A;  3RMA A;  5H1S Q;  5AQT A;  3OYK A;  2WUS A;  3O9U A;  3GBT A;  3VEV A;  1EX4 A;  5DM7 L;  2OZM A;  2GTD A;  2W40 A;  4NCG A;  3MX2 A;  3S3M A;  4JKG B;  4CJF A;  3A5O C;  4H0X B;  4NXM K;  1OH5 A;  1C1C A;  1SKW A;  2P1J A;  5EU7 A;  4Z4E A;  2YNG A;  5MLC Q;  4CGG A;  3OYG A;  4M3Z A;  3WEE B;  1BIS A;  3ZX0 A;  4OKJ A;  3PLA A;  4MO4 A;  4HVJ A;  4KHP K;  2HMI A;  4HUF A;  4DU1 A;  4FLZ A;  4ZTF A;  1JCG A;  3THX A;  4FJ5 A;  4DTS A;  3CF5 L;  3NFA A;  3VEX A;  4PHT X;  1LWE A;  2LSN A;  2NRV A;  3AAR A;  2HVH A;  3MXM A;  3DRP A;  4ISF A;  2QWO A;  3D6R A;  4DV7 K;  2HHV A;  3CCQ N;  1HQU A;  2Q0U A;  4OVL A;  2VWJ A;  2O8F B;  4C8M A;  1DT9 A;  5AQI A;  4KTZ A;  2H3G X;  3ZT3 A;  1S5J A;  3OBW A;  2IC3 A;  1C0M A;  3HZ6 A;  1OKJ A;  3F2K A;  1NKC A;  2F8S A;  2P9N B;  4XH4 A;  2XRI A;  3U8X A;  3EO3 A;  3K5M A;  5D3G A;  2YI1 A;  4JI4 K;  4LY7 A;  5I42 A;  3BUZ B;  2A5X A;  3EL2 A;  3ZSX A;  1Q81 O;  3HK2 A;  4PKG A;  4Q0B A;  4B1W B;  3ZLJ A;  2Q0R A;  1T6C A;  3UKU B;  2O8B B;  3QIP A;  4YOR A;  2WON A;  3K59 A;  2BH1 A;  1KSP A;  1VQO N;  5TKY A;  1NU0 A;  3MXJ A;  4YOY A;  1J54 A;  1RIL A;  4BY9 C;  4IEE A;  3NCI A;  2KHO A;  3UE5 A;  4E7K A;  1KFD A;  2A3Z A;  1U47 A;  1VRU A;  1U04 A;  1IKW A;  3OS0 A;  4YOV A;  1V4S A;  1XHZ A;  4IJA A;  1VQ9 N;  1O1W A;  3L6Q A;  1I39 A;  3ITH A;  5A2Q O;  2XY7 A;  1BUP A;  3TU5 A;  1JCE A;  4JK9 A;  3VQ5 A;  3ZSW A;  2ZGY A;  3O3G A;  3DI6 A;  4FO0 A;  2CGK A;  3HXM A;  4DTO A;  5EVZ A;  1YVU A;  4KH6 A;  1JXE A;  2FBY A;  1YHQ N;  4CZF A;  4CEF A;  5J2M A;  1JLG A;  2WFB A;  1FKO A;  2HOE A;  3CMA N;  3MXI A;  2KFN A;  4W5N A;  3VQQ A;  1RT6 A;  1BHL A;  1JCF A;  2NRZ A;  3ZET A;  5C42 A;  4K0K K;  3P4I A;  1BU6 O;  3L4I A;  4JAX A;  3MED A;  4QCL A;  3PSI A;  3MCP A;  4MLH A;  2E1Y A;  3MMV A;  4DTP A;  3KZB A;  4YFU A;  4DTX A;  5C0Y A;  3VGL A;  4B8C A;  4E3S A;  1Z25 A;  1ZYQ A;  2ZJP L;  3HM9 A;  3CXC M;  3CCJ N;  2E20 A;  1KD1 O;  1BOT O;  4OGC A;  3CYM A;  3CFR A;  3F9K A;  1IKX A;  1J53 A;  1T8E A;  2E2O A;  1QZ5 A;  3NF6 A;  4FLT A;  1BI4 A;  1JLC A;  3TAR A;  2YNF A;  4CBW A;  3LAN A;  2Y1I A;  4GV3 A;  3PO5 A;  1QVF M;  2QKB A;  3F9M A;  1REV A;  3A5M C;  3AY9 A;  3D2F B;  3ZSV A;  5CZ2 A;  4B1Z A;  5JS2 A;  5SZT A;  4BGB A;  2UUB K;  4H8K A;  1RDU A;  4BR4 A;  4LFB K;  2HBM A;  3AGK A;  1RT5 A;  4DKW A;  3VQ4 A;  4DR1 K;  1NK7 A;  3ZYY X;  5M1P A;  2O8E A;  3O1W A;  5JMV A;  4B3T K;  3AAQ A;  4KPY A;  5LL6 Z;  1RT7 A;  3OS1 A;  4DR2 K;  3U3G A;  4B9V A;  1Q86 O;  4KHW A;  3VES A;  4FJN A;  4ZHR A;  3MWT A;  2PFU A;  2P9I A;  3OS2 A;  4DR7 K;  3HJF A;  4N76 A;  3N4P A;  1RT1 A;  3GOI A;  1K8A O;  4FM2 A;  3VEW A;  5HOO A;  2WC9 A;  2RN2 A;  3SZ2 A;  2FLO A;  2XY8 A;  1R0A A;  3BY5 A;  1UOC A;  3VOV A;  5IWA K;  4CHO A;  2YKM A;  1UWB A;  5HRP A;  3LPU A;  4WQ5 A;  3VER A;  3ZT1 A;  3DRS A;  5LMU K;  1HJO A;  4X65 K;  5FPN A;  3LWM A;  2G8W A;  4BRD A;  1HKB A;  3TPQ A;  3LWL A;  2D0O A;  3TTF A;  4DQP A;  1D9D A;  5AQG A;  3SJJ A;  3ATV A;  4ZTJ A;  1DLO A;  3M5R A;  4CCH A;  2VG6 A;  3AVN A;  3KVG A;  5FPD A;  1NG9 A;  2OZS A;  4M3X A;  3AVA A;  2OTL N;  1R59 O;  5AQM A;  4BAC A;  2P9L B;  1U45 A;  4E7I A;  4GKK K;  1TAQ A;  3HST B;  2EX3 A;  2UUC K;  2CGL A;  3EE9 A;  4CES A;  2KFZ A;  3S41 A;  4DLG A;  2D4W A;  5I3U A;  2Q36 A;  4W5O A;  4CZE A;  5AQL A;  4CZL A;  3KLF A;  2UU9 K;  2X6S A;  3ENH A;  1FK9 A;  3TWH A;  3SNN A;  3PIO L;  3RRH A;  4F2R A;  2HHX A;  4L8R B;  4PKH A;  3VQA A;  2XO7 A;  1P8Z A;  2E5L K;  3QNN A;  4CJ3 A;  3O9T A;  1WUA A;  4WFN L;  1CZB A;  5C10 A;  3AO4 A;  4FWL A;  3VTI A;  2O8D B;  5AQK A;  3OW2 M;  3AO3 A;  1MWM A;  4OKK A;  3D2E A;  5AQZ A;  3T69 A;  1BWF O;  1U48 A;  1SL0 A;  3HPO A;  3LAK A;  3JAM O;  1Z26 A;  2QWM A;  4IJN A;  1NOZ A;  4FLV A;  4Z4F A;  1S1T A;  3C65 A;  1OH8 A;  3BZK A;  2Y1J A;  3UIQ A;  1NGE A;  3KWG A;  4MQ3 A;  3M6G A;  5B8H A;  3CER A;  4LSL A;  2NUB A;  1EWQ A;  1KLN A;  1D5A A;  3FFK B;  3WXI A;  1HNW K;  1GLF O;  4FWK A;  4IOX A;  4IO9 L;  1FJG K;  2VCP A;  4JI6 K;  3U9Z A;  3J80 O;  1BIZ A;  4KAZ A;  4PY5 A;  4TSX A;  3AO1 A;  4CGH A;  4KB0 A;  3LDP A;  1RCH A;  4N41 A;  5BRE A;  1TKT A;  5AZI B;  1Z6R A;  4EAH D;  3E9O A;  2UXB K;  4NCA A;  5AZJ B;  2OTJ N;  1GOA A;  3HPG A;  2ZJR L;  4ILG B;  2DTU A;  4DSK A;  1YVN A;  4KH5 A;  3THV A;  2X6N A;  1U4B A;  4H0T B;  5HRR A;  3SYZ A;  1VQN N;  4FLY A;  1RBR A;  4DFK A;  3G6E N;  5LY3 A;  1SKS A;  2FBT A;  5TKW A;  1RDA A;  4EP4 A;  1LV5 A;  2ITM A;  4FM1 A;  1X3N A;  2G8K A;  3OYE A;  4E1N A;  4DG1 A;  1QSS A;  4KHQ A;  3CJC A;  3PX6 A;  5AJ3 K;  4CFD A;  4BRA A;  4AM7 A;  1MU2 A;  2HBK A;  5JIC A;  3WQU A;  3HOT A;  1DTQ A;  3DAW A;  1RDB A;  1QHA A;  4IBN A;  1K8K B;  3EZ5 A;  2OPR A;  4JKD A;  4DQI A;  3AVJ A;  2D0B A;  1RBS A;  2EHG A;  1IG8 A;  3VN5 A;  3THY B;  3S9H A;  3LP0 A;  3OYL A;  4R79 A;  1RFQ A;  3AO5 A;  2E4L A;  1NK5 A;  4JHD A;  2UXD K;  2D5R A;  1KCF A;  1WSJ A;  2WBN A;  3NF8 A;  4IZ9 A;  4BG8 A;  4AHS A;  3TTC A;  3L2U A;  1VSM A;  3DXM A;  4YDU A;  2G8F A;  2VYP A;  3QEI A;  4QOZ B;  1BCO A;  4H5W A;  5AFU A;  2V7Y A;  3SQ1 A;  2P9P A;  5KGW A;  1W0H A;  4BE2 A;  4BR2 A;  3F73 A;  3G0Z A;  3EN9 A;  2YHW A;  3V1O A;  1ZBI A;  3SV3 A;  4HCB A;  1YJN N;  1NJX A;  2GX9 A;  2UYT A;  5KPZ A;  3O4Q A;  1OVY A;  4H5V A;  5M1O A;  1QE1 A;  2FXU A;  3THX B;  1EKE A;  2IVN A;  5JVG L;  4DV2 K;  5ELZ A;  1B92 A;  4BE0 A;  4WQ4 A;  4AHC A;  2GEL A;  5BN8 A;  1TYQ B;  2ATQ A;  3V1Q A;  4BRF A;  5GAG P;  1TL1 A;  4BWM A;  4BVP A;  3DLB A;  1ATR A;  3HT3 A;  4W5T A;  4JS4 A;  3SJH A;  4A59 A;  1TKZ A;  1GLA G;  3T7Z A;  3VEO A;  5AQX A;  1N5Y A;  1TVR A;  3GDQ A;  3VQC A;  1IBK K;  1VSL A;  3RWU A;  4OPA A;  3LP3 A;  2QA4 N;  2NRT A;  1NJZ A;  1CZ9 A;  5C2F A;  1RTJ A;  2BTF A;  3ZT4 A;  3DYA A;  4DR5 K;  1W2B M;  1VQ8 N;  3ZSQ A;  3FZM A;  3T3F A;  1NK8 A;  1TK8 A;  4IFE A;  1KAZ A;  3TAQ A;  4NCB A;  2YHX A;  4O5F A;  5FPE A;  1YAG A;  2QXL A;  1V4T A;  3O9S A;  4IFV A;  3KKS A;  1ASV A;  3FR0 A;  4DV4 K;  4ID1 A;  1XUP O;  3DM2 A;  4EHT A;  4IG3 A;  5GAH P;  3CQ8 A;  3U4L A;  4QS8 A;  3EKU A;  3FZF A;  3OTO K;  4BC2 A;  1L3U A;  1KXP A;  3A2F A;  1SS6 A;  1KRP A;  2QM1 A;  2HF3 A;  3DOK A;  3HP6 A;  3SAG A;  5CR4 A;  2F7T A;  1EQY A;  4JYA K;  1HRH A;  3DXK A;  3L2V A;  4CZG A;  3P31 A;  3OHR A;  4DQS A;  3DLR A;  4FWS A;  3HSC A;  3KKR A;  2AA4 A;  3OYH A;  1GLL O;  3RMD A;  3VQ9 A;  1WN7 A;  3M8P A;  1JLE A;  2FF3 B;  5AQU A;  4M7X A;  4JRP A;  4KRF A;  3HPH A;  3K5N A;  4JN4 A;  4CJ4 A;  3MX5 A;  4CF8 A;  1N32 K;  3O9R A;  2ZJQ L;  3VA3 A;  4JK7 A;  2PZS A;  3NMU A;  3NE6 A;  4JEP A;  2QXF A;  4DB3 A;  4FZY A;  1ZBU A;  3I8B A;  4WE1 A;  4E7H A;  3KTQ A;  2KZM A;  1D9F A;  1RTH A;  3LDL A;  1U2V A;  4JV5 K;  1C1A A;  1TL3 A;  3VQE A;  2ZWH A;  4F2S A;  1TUY A;  3FZH A;  5F2R A;  3PUF A;  3HTV A;  1C6V A;  4UQG A;  4KHN A;  1RT2 A;  4FYD A;  3ZET B;  4WQ5 C;  2HNY A;  3D7E O;  4NLB A;  2CH5 A;  4B9N A;  1SV5 A;  5CY4 A;  4FJI A;  4OLB A;  4KTQ A;  1ITG A;  4AIL C;  4YHH K;  5GIN A;  1IKV A;  2QWQ A;  1L3S A;  3QEW A;  4BRH A;  2HBJ A;  4FK0 A;  1T03 A;  2J4R A;  4E89 A;  1A5V A;  4MDB A;  4A2A A;  4A5B A;  4BRG A;  4CJT A;  1SZ2 A;  1S22 A;  4PA1 A;  2P5G A;  3U9D A;  4FK2 A;  4QS7 A;  1NJY A;  1BI4 B;  2I5J A;  4J2E A;  4YOT A;  1U49 A;  4F9O A;  3AVF A;  4DU3 A;  1YIT N;  4BC5 A;  5KI6 A;  3I8D A;  3ISN C;  3AO2 A;  4DS4 A;  4LD0 A;  4CFB A;  1GLE G;  4U67 L;  1J6Z A;  4GV6 A;  3O08 A;  1RTI A;  3BEX A;  4C1N K;  4B1X B;  3LM2 A;  4MDA A;  3T1H K;  4EFH A;  1HJR A;  1YXQ A;  3SUO A;  2VQE K;  3KK2 A;  2O8E B;  1HR0 K;  2HNZ A;  1DGK N;  5F1X A;  4DV5 K;  1RT4 A;  2D0C A;  2YHY A;  4J2D A;  1CXQ A;  3VQ8 A;  4FPA A;  4M7Y A;  4RG8 A;  3RR7 A;  1I94 K;  4M63 C;  4F8R A;  4OPH A;  3C0B A;  2IVO A;  1QVG M;  3OYC A;  1FXX A;  3NHG A;  4O44 A;  4M42 A;  3AVG A;  4A57 A;  1WSG A;  4DTM A;  2G8U A;  4KHU A;  3IFR A;  2YNI A;  2KQ2 A;  3G25 A;  1LAV A;  5ADX A;  1NLV A;  1HUX A;  2ASP A;  1WB9 A;  2QWL A;  3FGU A;  3ZSY A;  4B9L A;  1VQ4 N;  1KQS M;  2NRW A;  2E6L A;  4U7B A;  1ZC6 A;  2DFE A;  3PX0 A;  2AJQ A;  4C8K A;  2V7Z A;  3DWL A;  3SMS A;  1N34 K;  2BE2 A;  1ZXO A;  3FLC O;  3MN6 A;  3VPZ A;  3TAM A;  3R9P A;  1KAY A;  2Z1H A;  3O80 A;  4C8N A;  3DJC A;  3LDS A;  4B9M A;  3AA4 A;  3DMJ A;  4DUY K;  5LJV A;  5BPM A;  1XNQ K;  2VWK A;  4CHN A;  1NMD A;  2YHA A;  3ZSZ A;  2XY5 A;  4JI1 K;  2YJF A;  4JI3 K;  5IT9 O;  1JLA A;  4CJV A;  4KV8 A;  3FZL A;  3JS6 A;  2B6A A;  3VTH A;  4CZK A;  3ZSR A; 
#chains in the Genus database with same CATH homology
 3LP1 A;  1YTU A;  4K8X A;  4DLG A;  5HLF A;  3QEX A;  4DSF A;  3RMC A;  5HRS A;  5I3U A;  4G1Q A;  4W5O A;  3WNF A;  3KLG A;  3SQ2 A;  3WNG A;  3CM5 A;  4N56 A;  2BGG A;  3KLF A;  4LSN A;  2X6S A;  1FK9 A;  3TWH A;  3SNN A;  3O3F A;  4I9Q A;  1L3T A;  5C25 A;  4I2Q A;  1VSF A;  3RRH A;  4F2R A;  3ZT2 A;  4GW6 A;  3QEP A;  1ASW A;  2HHX A;  2OPQ A;  4CFA A;  4L8R B;  3VQA A;  2XO7 A;  2G8V A;  4FJ9 A;  4AHU A;  2QKK A;  4FJH A;  4DTR A;  4CJ3 A;  3QNN A;  4FJK A;  4KTW A;  4CEE A;  4CK3 A;  1CZB A;  3T19 A;  5E41 A;  4DTU A;  4IFY A;  3IS9 A;  4CHQ A;  3DLE A;  3VQB A;  5T7B A;  3CFP A;  4N5S A;  4CIG A;  3TAB A;  3AO4 A;  4F3T A;  1LW2 A;  1NOY A;  1LWF A;  1TAU A;  3SPZ A;  3KJV A;  2F8T A;  4BWJ A;  3AO3 A;  4OKK A;  3LP2 A;  2D0A A;  4DTJ A;  4O4G A;  2KZZ A;  1N6Q A;  4K8Z A;  4HTU A;  2DFH A;  1U48 A;  4EP5 A;  4I2P A;  3ZSO A;  2BAN A;  1SL0 A;  2P51 A;  1UA1 A;  1QSY A;  1FKP A;  3LAK A;  3OYA A;  3HPO A;  3CFO A;  3G10 A;  1Z26 A;  4NYN A;  4PQU A;  3TAG A;  1NOZ A;  4FLV A;  4CEB A;  1X9W A;  2X74 A;  4Z4F A;  1S1T A;  1LWC A;  3OJU A;  1EET A;  3HP9 A;  3QLH A;  1IO2 A;  1WSF A;  3K5O A;  4HUG A;  2E6M A;  2Y1J A;  3UIQ A;  3M8Q A;  4MQ3 A;  4AHV A;  4OPJ A;  3SUP A;  4B9S A;  4M3T A;  3HO1 A;  4FCY A;  3TAP A;  4LSL A;  3AVK A;  2NUB A;  3HYF A;  4CGI A;  1L3V A;  4I9L A;  1HQE A;  1SL2 A;  4B9U A;  4Z4C A;  2IS3 A;  2YV0 X;  1KLN A;  2IGI A;  3QO9 A;  4Z4I A;  1D5A A;  1VRT A;  4M3Y A;  4Z0U A;  1K6Y A;  2GV9 A;  3M8S A;  3U3Y A;  2XHB A;  3MAQ A;  3SPY A;  4IG0 A;  4CJP A;  4IDK A;  3KLI A;  3SI6 A;  3AVL A;  3VA0 A;  4FJ7 A;  2W42 A;  3AA3 A;  1BIZ A;  4KAZ A;  4PY5 A;  1CLQ A;  4TSX A;  4JLH A;  2PY5 A;  4CF2 A;  4KI6 A;  1HNV A;  4KO0 A;  5HRN A;  4DF8 A;  4OLA A;  3AO1 A;  2Q3S A;  1S6P A;  5FDL A;  4CGH A;  3HVR A;  3V4I A;  4KB0 A;  3LZJ A;  1RCH A;  4DQR A;  4N41 A;  1TKT A;  4FJX A;  1RBT A;  4JS5 A;  2IOC A;  2JLE A;  4CJQ A;  3V9W A;  5C24 A;  4M3R A;  3NH0 A;  4CED A;  4NCA A;  1GOA A;  1RT3 A;  1A5X A;  1YTA A;  3E01 A;  3HPG A;  1TKD A;  1SUQ A;  1VSH A;  1RTD A;  2DTU A;  4CEQ A;  1ZBL A;  4H4M A;  3RMB A;  4DSK A;  4CHP A;  2FC0 A;  3DLG A;  3THV A;  2X6N A;  1U4B A;  2FBV A;  5HRR A;  3SYZ A;  2B4J A;  4FLY A;  2HHS A;  3B6P A;  1C0T A;  3QES A;  1RBR A;  3NGY A;  4Y1D A;  3OYI A;  4DFK A;  2IAJ A;  1X9M A;  1SKS A;  2FBT A;  4EZ9 A;  4FJL A;  1KVC A;  1QQC A;  4CE9 A;  1RDA A;  4W5Q A;  3WNE A;  4EP4 A;  4HUE A;  3IRX A;  4FM1 A;  2XY6 A;  1LV5 A;  3OYE A;  4E1N A;  4DG1 A;  1QSL A;  1VSI A;  1HYV A;  1QSS A;  2G8K A;  4KHQ A;  4N47 A;  1S9G A;  3PX6 A;  1XC9 A;  4CFD A;  3D0P A;  4ELT A;  4IKF A;  4FJJ A;  1TKX A;  3DLK A;  3QET A;  1EXQ A;  2O4G A;  1RDD A;  1MU2 A;  4GVM A;  5J2P A;  1BCM A;  4OKE A;  4FXD A;  3NH1 A;  1DTQ A;  3L2Q A;  1BGX T;  1RDB A;  3NBP A;  4CIE A;  1NKB A;  2ZE2 A;  4IBN A;  3EZ5 A;  2HND A;  3O3H A;  2OPR A;  4DQI A;  3KD5 E;  4RW8 A;  3ZT0 A;  4FM0 A;  4CJR A;  3AVJ A;  2D0B A;  1LW0 A;  1SKR A;  3DLH A;  1RBS A;  2X78 A;  3PX4 A;  3RMA A;  2EHG A;  2GUI A;  3VN5 A;  3OYK A;  3S9H A;  3K57 A;  1ASU A;  1KFS A;  1EX4 A;  3LZI A;  3CM6 A;  3LP0 A;  3OYL A;  3TR8 A;  2OZM A;  2OYQ A;  4PWD A;  2KTQ A;  4W5R A;  1X1P A;  3T1A A;  3AO5 A;  3ASM A;  3NF9 A;  4NCG A;  3S3M A;  2E4L A;  3CG7 A;  1NK5 A;  4CJF A;  4FZZ A;  2D5R A;  4CER A;  4FLU A;  1C1C A;  3OVN A;  1KCF A;  1WSJ A;  4ID5 A;  1EP4 A;  2P1J A;  3NF8 A;  4Y1C A;  5EU7 A;  3V9Z A;  1SKW A;  2YNG A;  1D8Y A;  4AHS A;  3TI0 A;  3L2U A;  4C8L A;  1VSM A;  4CGG A;  1GOB A;  1Y97 A;  3OYG A;  5J2Q A;  3U6F A;  2G8F A;  4M3Z A;  1BIS A;  3QEI A;  3QEV A;  4QOZ B;  4DSJ A;  2GBZ A;  1NJW A;  4OKJ A;  1BCO A;  3M8R A;  2WOM A;  1QHT A;  5CZ1 A;  4HVJ A;  3V9U A;  2HMI A;  4HUF A;  4DU1 A;  4FLZ A;  3V1R A;  5HP1 A;  4ZTF A;  3SQ1 A;  5KGW A;  1W0H A;  4FJ5 A;  1RBU A;  4BE2 A;  4DTS A;  4CEA A;  3KLE A;  4MFB A;  3F73 A;  4OJR A;  3G0Z A;  3NAE A;  3VQP A;  1JKH A;  3NFA A;  3V1O A;  3WNH A;  4DFM A;  1LWE A;  2LSN A;  3MEC A;  3SV3 A;  3QER A;  4HCB A;  1S6Q A;  4E0D A;  4HCC A;  2HVH A;  2OPS A;  2HVI A;  5FRM A;  3MXM A;  3NF7 A;  3DRP A;  3NGZ A;  5DMR A;  1NJX A;  3EY1 A;  1LAW A;  4J2A A;  2HHT A;  2HHV A;  3V6D A;  4LH4 A;  1KTQ A;  3O4Q A;  1HQU A;  4CEO A;  1S1W A;  1A5W A;  4OVL A;  1QE1 A;  2VWJ A;  1WSI A;  4O0J A;  1IKY A;  5KGX A;  1EKE A;  4DFJ A;  1VSE A;  1C1B A;  1QS4 A;  4C8M A;  4BE0 A;  1B92 A;  4AHC A;  2ATQ A;  3AVI A;  3HL8 A;  4KTZ A;  3V1Q A;  3ZT3 A;  1G15 A;  1S5J A;  1TL1 A;  4BWM A;  3DLB A;  2IC3 A;  1XI1 A;  1UAX A;  1C0M A;  1RNH A;  3KK3 A;  3HT3 A;  4W5T A;  4JS4 A;  3JSM A;  1NKC A;  1QTM A;  2G8H A;  2F8S A;  2HHQ A;  3KLH A;  1TKZ A;  1DTT A;  2QK9 A;  1N5Y A;  4YNQ A;  4PUO A;  1JXB A;  3AA2 A;  1TVR A;  4DMN A;  2KFZ A;  3VQC A;  1VSL A;  2YNH A;  1Q9Y A;  4KRE A;  2XRI A;  3RWU A;  3LP3 A;  2Z1I A;  1TV6 A;  3IG1 A;  4KB1 A;  3K5M A;  1NJZ A;  2P5O A;  1VK0 A;  1CZ9 A;  5D3G A;  1RTJ A;  2RF2 A;  3AVH A;  4LY7 A;  3ZT4 A;  3DYA A;  5I42 A;  3ALY A;  1NK4 A;  2O4I A;  4FJG A;  2Z1G A;  3ZSQ A;  4DQQ A;  3ZSX A;  3T3F A;  1NK8 A;  1TK8 A;  4CK1 A;  5CYQ A;  3TAQ A;  3HK2 A;  4Q0B A;  4NCB A;  3D45 A;  4XIU A;  1X9S A;  1L5U A;  3VQD A;  3OYJ A;  3QIP A;  5DK5 A;  4CEZ A;  2WON A;  4RW7 A;  2VG5 A;  2YKN A;  4O5B A;  3K59 A;  4IFV A;  3KKS A;  4M3W A;  1ASV A;  3I0R A;  1KSP A;  3PO4 A;  3RRG A;  4ICL A;  4OPK A;  3NGI A;  4ID1 A;  3SQ0 A;  4Z4G A;  4CF0 A;  3O4N A;  5J2N A;  3AVM A;  2G8I A;  3DM2 A;  3MXJ A;  4IG3 A;  3CQ8 A;  1J54 A;  1RIL A;  3MEG A;  5JS1 A;  4DWI A;  1ZBI A;  1JL2 A;  1WAF A;  4QAG A;  3EYZ A;  1L3U A;  4KKO A;  3NDK A;  3JYT A;  3NCI A;  3A2F A;  1NKE A;  4GMJ B;  1KRP A;  3KIO A;  1JL1 A;  4FLX A;  1KFD A;  3AVB A;  1RDC A;  3FFI A;  4E7K A;  3HP6 A;  3DOK A;  4J2B A;  1U47 A;  1VRU A;  4LH5 A;  1WLJ A;  3L2W A;  4Z4H A;  3ULD A;  1U04 A;  1IKW A;  3OS0 A;  4CIF A;  4E7J A;  1HRH A;  3OY9 A;  3L2V A;  4FJM A;  4DSE A;  4RW6 A;  4DF4 A;  2HHW A;  1I3A A;  3C94 A;  1XHZ A;  1ZBH A;  4BDP A;  4CF9 A;  1O1W A;  3PV8 A;  1I39 A;  4DQS A;  3ITH A;  2RKI A;  2XY7 A;  1F21 A;  3DLR A;  3DRR A;  1JLB A;  1J9A A;  1BQM A;  1GOC A;  4KI4 A;  3VQ5 A;  3ZSW A;  1HPZ A;  4R5P A;  3P83 D;  3DI6 A;  3O3G A;  3L2R A;  3IAY A;  1BL3 A;  3KKR A;  1S1X A;  3HXM A;  4DTO A;  2PYJ A;  3OYH A;  1YVU A;  3RMD A;  2DY4 A;  1JXE A;  2FBY A;  3I0S A;  1WN7 A;  3M8P A;  3VQ9 A;  4O0I A;  4OGE A;  1JLE A;  4CEF A;  5J2M A;  2A1R A;  1JLG A;  4C8O A;  4BDZ A;  4FZX C;  4JRP A;  4KRF A;  1BQN A;  1FKO A;  3HPH A;  1KVB A;  3K5N A;  3MXI A;  4B08 A;  1NK6 A;  1S9E A;  1XHX A;  4CJ4 A;  1KLM A;  2BDP A;  2OA8 A;  2KFN A;  1JLQ A;  2RPI A;  3RTV A;  3VQQ A;  4CF8 A;  4E1M A;  4W5N A;  1RT6 A;  1TK0 A;  1BHL A;  1BIU A;  3VA3 A;  4ELU A;  1SL1 A;  2HB5 A;  2PZS A;  2IDO A;  5C42 A;  3OYM A;  3NE6 A;  1YT3 A;  3K5L A;  4FK4 A;  3MED A;  4QCL A;  2QXF A;  4FZY A;  3S3N A;  1ZBU A;  1WNS A;  4KHY A;  3L3U A;  1KVA A;  4WE1 A;  4E7H A;  3KTQ A;  2KZM A;  4CF1 A;  1D9F A;  1RTH A;  1XWL A;  4M3U A;  5SWM A;  4DTP A;  1C1A A;  1TL3 A;  3VQE A;  4YFU A;  4DTX A;  4F2S A;  3PUF A;  4B8C A;  4E3S A;  1B9D A;  3NH2 A;  4FYD A;  1C6V A;  1Z25 A;  4UQG A;  1RT2 A;  1ZYQ A;  3C6T A;  4KHN A;  3HM9 A;  1VSK A;  2ITG A;  2HNY A;  1HNI A;  4EZ6 A;  4B9N A;  3OYF A;  1SV5 A;  5CY4 A;  3OYD A;  4FJI A;  2OPP A;  4OLB A;  4OGC A;  4KTQ A;  1ITG A;  3AA5 X;  5HBM A;  3CYM A;  2B5J A;  3OYN A;  3CFR A;  4AIL C;  3F9K A;  1IKX A;  1J53 A;  3B6O A;  1WSE A;  3MEE A;  1T8E A;  1T7P A;  3KD1 E;  4CK2 A;  4CJU A;  1IKV A;  3K2P A;  3NF6 A;  2ETJ A;  1L3S A;  4FLT A;  1BI4 A;  3AV9 A;  1JLC A;  3TAR A;  2YNF A;  3QEW A;  4DTN A;  4FK0 A;  3LAN A;  2Y1I A;  1T03 A;  1T05 A;  3PO5 A;  2QKB A;  4FW1 A;  1REV A;  3V9S A;  4JRQ A;  2JGU A;  4B8A B;  3ZSV A;  4E89 A;  1A5V A;  1RBV A;  4CJT A;  5CZ2 A;  2HHU A;  4PA1 A;  4CHY A;  2P5G A;  4KFB A;  5JS2 A;  4FW2 A;  4NYF A;  5SZT A;  4FK2 A;  3C6U A;  4H8K A;  1NJY A;  1BI4 B;  1W9H A;  1IG9 A;  2I5J A;  4J2E A;  1VSD A;  1RT5 A;  3VQ7 A;  1IH7 A;  4FVM A;  4DS5 A;  1U49 A;  3AVF A;  4DU3 A;  3VQ4 A;  2PYL A;  1NK7 A;  5KI6 A;  4CFC A;  3I8D A;  3TAF A;  3ISN C;  2VG7 A;  3AO2 A;  3VQ6 A;  5HRO A;  4DS4 A;  4LD0 A;  4KPY A;  4CFB A;  4DLE A;  4CGJ A;  4FLW A;  1NK0 A;  3QIO A;  1RT7 A;  4CJ5 A;  3C95 A;  1RTI A;  3OS1 A;  4DSL A;  2FBX A;  4CGD A;  3U3G A;  4B9V A;  1HJR A;  3HVT A;  4KHW A;  4CGF A;  3SUO A;  4FJN A;  4ZHR A;  5KTQ A;  3KK2 A;  4CHZ A;  1S1U A;  4KHS A;  3DOL A;  3LAL A;  3OS2 A;  4AHR A;  2A1S A;  2HNZ A;  3HJF A;  4N76 A;  3P5J A;  4CJW A;  1RT1 A;  3H08 A;  4CJK A;  1RT4 A;  2D0C A;  4FM2 A;  3SUN A;  4J2D A;  4FJ8 A;  4E7L A;  1CXQ A;  3VQ8 A;  1ZBF A;  2KW4 A;  4RG8 A;  3BDP A;  2RN2 A;  4CEC A;  3SZ2 A;  2XY8 A;  3RR7 A;  1R0A A;  4AHT A;  3V9X A;  1UOC A;  2ZD1 A;  4DU4 A;  4F8R A;  3KK1 A;  4CJS A;  4O55 A;  4Q5V A;  1HYZ A;  4CHO A;  3SV4 A;  2YKM A;  4H4O A;  3OYC A;  4B9T A;  1FXX A;  4I7F A;  1UWB A;  3NHG A;  1WSH A;  4CJE A;  3SQ4 A;  4O44 A;  4M42 A;  3OJS A;  5HRP A;  3AVG A;  3ZCM A;  3RR8 A;  3LPU A;  1WSG A;  4DTM A;  2G8U A;  4KHU A;  4B3O A;  2YNI A;  2KQ2 A;  3DRS A;  3ZT1 A;  3V81 A;  3OYB A;  1LAV A;  1TGO A;  1HMV A;  3SCX A;  5FRN A;  3LWM A;  2G8W A;  3ZSY A;  3LWL A;  4B9L A;  1J5O A;  4BE1 A;  3TAN A;  1NK9 A;  4M41 A;  2E6L A;  1Q8I A;  2DFE A;  4DQP A;  3PX0 A;  3S3O A;  1D9D A;  3SJJ A;  3PY8 A;  4BDY A;  4C8K A;  4DSI A;  4Z4E A;  2AJQ A;  1CXU A;  4ZTJ A;  1DLO A;  2R7Y A;  2ZQB A;  1B9F A;  4CCH A;  4ELV A;  2BE2 A;  1HYS A;  2VG6 A;  3AVN A;  4F4K A;  3TAM A;  4CJL A;  4RW4 A;  4F3O A;  2Z1J A;  2Z1H A;  5KRT A;  3LAM A;  4C8N A;  1C0U A;  3LDS A;  2OZS A;  5K14 A;  5CYM A;  3QNO A;  4M3X A;  4B9M A;  3K58 A;  3AA4 A;  3AVA A;  3DMJ A;  4M45 A;  3SUQ A;  3QIN A;  5J1E A;  2VWK A;  4BAC A;  3P1G A;  3BGR A;  4E19 A;  1U45 A;  1Q9X A;  4CHN A;  1VSJ A;  4AH9 A;  2YHA A;  3ZSZ A;  4RW9 A;  2DFF A;  2YHB A;  3AVC A;  5KRS A;  4E7I A;  3TAE A;  2XY5 A;  3L3V A;  1TAQ A;  4DFP A;  3HST B;  1UA0 A;  1S1V A;  2EX3 A;  2HW3 A;  3LPT A;  3L8B A;  4HHT A;  1JLA A;  1JLF A;  2F96 A;  4KV8 A;  4CES A;  4CJV A;  1TK5 A;  1WAJ A;  5FRO A;  2B6A A;  3ZSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...