4IBNA

Crystal structure of lc9-rnase h1, a type 1 rnase h with the type 2 active-site motif
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
SDIPTPLVAVYADESCLGNGREGENPGGAGVLVEYARPGGAGDIVRRDVWVSEPATTNNRMALRSVIEAFRAIGHKGTRFRVVFTTDSRYIVDGMTRWVHDWAQRGWKRKSGAIENLALWQEAVQAVNGHAVEWRWVRGHAGHAQNEYANHLAVTAAGGQTQSGGLVDSGYEEWAARVSTAASRMRLEPFPDAAAFRPSPALPVVAAGRPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of metagenome-derived LC9-RNase H1 with atypical DEDN active site motif
pubmed doi rcsb
source organism Uncultured organism
molecule tags Hydrolase
molecule keywords Ribonuclease H
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2012-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ibnA01
2X78A 2I5JA 1UA1A 4CHZA 3RRHA 4B9UA 1TAQA 4OKEA 4FLZA 4C8NA 4CIFA 1Q9YA 2ZE2A 3QIPA 3QEWA 4KPYA 4DQRA 4M45A 3L2QA 4J2BA 1S1WA 3AVFA 4AHUA 5J2MA 1KSPA 4FLYA 3ZSZA 3HPGA 4FK0A 3SZ2A 4DSIA 4O0IA 4CERA 4M3RA 3TAEA 1TK5A 3NBPA 3OY9A 4M3ZA 3ZSYA 1IKVA 2KZMA 2IC3A 4FJXA 4UQGA 4CESA 5FRNA 2PZSA 5KTQA 4ZTJA 2QKKA 4CGIA 1BI4B 3AO4A 3TI0A 1TKXA 3S3NA 1RTHA 1KCFA 4QAGA 3LWLA 4N76A 3ULDA 3NH2A 1XHXA 3SUQA 4IG0A 1HQEA 3OYJA 3TAMA 3ZT2A 4Q0BA 1FK9A 4RW8A 3SJJA 4Z4EA 4KTWA 1LWFA 2HHVA 1RBSA 1JLEA 1Z26A 4DTRA 4FJ5A 4CHOA 3DLRA 2G8VA 2QKBA 2FBYA 1NK4A 5CYMA 3SYZA 3T3FA 3AVHA 4FJ7A 3P5JA 4HUGA 4C8KA 4CJ3A 4CEQA 2B4JA 4PUOA 1WSFA 3AVMA 1DTTA 5HRPA 4L8RB 1BIZA 1L3TA 3HP9A 2OPSA 4ICLA 4AHSA 3KD5E 3AA5X 4RW6A 1NJWA 4WE1A 4ELUA 4CJRA 4FJ9A 2VG6A 3OYDA 1U4BA 5FROA 3KLEA 4FYDA 1WSIA 3CFRA 1U47A 3ZT0A 1BIUA 4NYFA 3NGIA 4DQSA 3VQCA 5E41A 4OVLA 1TKTA 2EX3A 2Z1JA 2XHBA 3LZIA 1EX4A 4EZ6A 2Z1HA 1VSHA 2D5RA 3HJFA 1WSHA 4FJLA 3RRGA 2FBVA 4HTUA 1BQNA 4LY7A 4DTSA 4K8ZA 4KTQA 4CF1A 2PYLA 3NE6A 3QO9A 3HK2A 1UA0A 3VA3A 1VRTA 2A1RA 1VSIA 3VQEA 4DSLA 3G0ZA 4CJ5A 3ZCMA 3PV8A 3OYKA 1J9AA 2XY8A 1D9DA 1RT7A 3H08A 4FJIA 4KHQA 3NAEA 1KVBA 3T1AA 4H4OA 3SQ4A 3CFPA 1WSGA 3RMBA 3AO3A 1CZBA 4HVJA 4G1QA 1TK0A 1TV6A 3HVRA 2HHQA 5HRSA 3UIQA 4CF9A 3ZT4A 4GMJB 4N56A 4DFJA 3JSMA 3C94A 3MEGA 3NF9A 4HCCA 1ITGA 1XC9A 3RMAA 3PX0A 1B9FA 4BDZA 1U45A 3E01A 1TKZA 1NK9A 2P5GA 4BE1A 2ATQA 3SV4A 4CFCA 1JLBA 2BANA 4AHCA 3KK2A 4FK2A 1ZBHA 3K5OA 3KK1A 3AO1A 4DSKA 3QINA 4CIGA 2VG7A 4M3XA 3I0SA 4CEDA 4B8AB 5DMRA 2PY5A 2QXFA 1S6PA 1S5JA 3IRXA 3T19A 4CK1A 4IKFA 4CEBA 3OS2A 3V9SA 3K57A 1RDDA 1X1PA 4B9MA 2EHGA 2FBTA 4CJSA 3OYHA 2P51A 3KKRA 3RMDA 4FXDA 4FM1A 3VQDA 5I42A 3KLGA 1DTQA 4J2DA 3DOLA 2RN2A 1RCHA 1TL3A 2HHWA 4BWMA 2O4GA 1FKPA 3DRSA 4RW4A 4B9TA 4E7JA 1WAFA 1C1CA 1S1UA 3QLHA 1QQCA 1CXUA 3BDPA 1HMVA 3EZ5A 2D0BA 4CE9A 3NH1A 1DLOA 1NJXA 5CZ1A 4CJPA 2QK9A 3DLBA 2YKMA 4R5PA 2YNGA 3K58A 4N5SA 4CGJA 1ZYQA 3ZSVA 4FM2A 3AVBA 3SV3A 3AA4A 1RBVA 4JRPA 3V9XA 5HP1A 2HW3A 2HNYA 1GOBA 3QNNA 4Z4CA 2IGIA 2BE2A 5DK5A 3TWHA 3V1RA 4JS5A 3OYGA 4DTXA 1J5OA 2G8FA 4Z4FA 2ITGA 1TK8A 2XRIA 3AVAA 3NGYA 4FLXA 2HHXA 3DLHA 4QOZB 2HB5A 1K6YA 1BISA 2JLEA 1U49A 4KTZA 3WNFA 4OPJA 4DSFA 3PO5A 4EZ9A 1JL1A 1JLAA 2DFFA 4GVMA 4CEAA 3LAMA 1C6VA 1LW0A 4NYNA 3OYIA 3K2PA 4LSLA 3LP3A 1IKXA 4O55A 2R7YA 1QSSA 3MEDA 4KKOA 3LANA 2KZZA 4FK4A 2O4IA 4C8MA 4HHTA 1TGOA 3I0RA 4I7FA 1KVAA 1LWCA 1IKYA 4FLVA 3VQ9A 4KI6A 3O4QA 4DF8A 3S9HA 1RDBA 4B08A 5JS2A 1YVUA 3AV9A 3TAQA 1CLQA 3F73A 3CQ8A 3DRRA 3PY8A 4DWIA 1KLMA 1JXBA 4N47A 4DTJA 3F9KA 5HRRA 1JXEA 2Z1IA 3NF6A 3QEXA 4N41A 4KB1A 3LPTA 4E19A 2OYQA 1TVRA 4DS5A 3ZSOA 1D8YA 5D3GA 1RBTA 4FJMA 5HLFA 1S1VA 1BL3A 3ZSXA 3V6DA 4M41A 3QEPA 4FLWA 3IG1A 3HT3A 2RKIA 1JLGA 3PUFA 1VK0A 3HSTB 4CJWA 3QEVA 2XY7A 3M8PA 3K59A 1FXXA 3SUNA 4M3WA 4DFMA 4KI4A 4PY5A 1I3AA 1NK5A 5C42A 4E7KA 4AH9A 4KB0A 4DS4A 2VWKA 3LPUA 3HYFA 4H4MA 1T05A 2A1SA 4FCYA 3VA0A 4O0JA 1ZBIA 1EP4A 2F96A 3OS0A 4CF0A 1UAXA 1A5VA 2G8KA 1QE1A 2X74A 4KHNA 3KIOA 3C6TA 3LAKA 3KD1E 1RTJA 3AVKA 2KTQA 4DLEA 5HROA 1W0HA 1KTQA 4OKKA 4CEOA 1HJRA 2DY4A 1C1BA 3AA3A 1TL1A 2IDOA 3DOKA 1NK0A 5FRMA 1REVA 1Q9XA 3TR8A 3THVA 3RR7A 3LWMA 4FJNA 4KRFA 3CYMA 1VRUA 3DI6A 4FJJA 2FC0A 4IFYA 3AVLA 1F21A 4LH4A 1WLJA 1RILA 2KQ2A 4AHTA 1LAVA 3TABA 1U04A 3KJVA 3ZSRA 3KLHA 2HVIA 3JYTA 4M3UA 1HYZA 3A2FA 3EYZA 3P83D 4DU1A 4DU4A 4DU3A 2XY6A 4KAZA 5EU7A 3DLGA 3ZT3A 4FJHA 2HHUA 1BCOA 2YNFA 2Z1GA 2X6NA 3TAPA 1NKEA 3V9ZA 3IAYA 4BACA 4CEFA 1U48A 1QTMA 2HHSA 2GUIA 4F4KA 1BI4A 2HMIA 4YFUA 3QETA 1XI1A 2G8UA 3SQ2A 2Q3SA 1SKRA 1S6QA 1CZ9A 4CJLA 2G8WA 1YT3A 3OYEA 4CJKA 4BE0A 3NH0A 1RBRA 3KLIA 4CFDA 3L3UA 3L3VA 4AHRA 3PX4A 3ZSQA 1NK7A 1BGXT 4CGHA 4OJRA 4YNQA 4FW1A 4H8KA 5FDLA 2FBXA 3WNEA 1EKEA 2DFHA 3LP0A 3OVNA 3HM9A 4DQQA 1SL2A 2E6MA 1KRPA 3RWUA 3O3FA 4DTMA 5SZTA 3C6UA 1JL2A 4IFVA 4CHYA 1G15A 2VG5A 3KK3A 4CHPA 3L8BA 1A5XA 3OYBA 4B9VA 5JS1A 1IH7A 1X9SA 2LSNA 1O1WA 4NCGA 3NGZA 2OZMA 3SCXA 1C0MA 2YNHA 1IG9A 1NOYA 1RT5A 4FJKA 1ASVA 4FM0A 4E3SA 4BDYA 3PX6A 4RG8A 2YHAA 4KO0A 2DFEA 1L3UA 2PYJA 4OGEA 4CF8A 4I9LA 2RPIA 1KVCA 3FFIA 2D0CA 4J2EA 4OKJA 4CJ4A 2AJQA 3P1GA 4PA1A 3ZT1A 3LDSA 4GW6A 4CJTA 1TAUA 2GV9A 3L2WA 4CJEA 3VQPA 1VSLA 3KTQA 5C25A 4I9QA 4BE2A 3M8RA 3SQ0A 3CFOA 1WNSA 3AO5A 5J1EA 3EY1A 5K14A 3S3MA 3K5LA 3QNOA 3AVGA 1X9WA 4I2QA 4B9SA 1WN7A 1RTIA 4CK3A 3D0PA 2WOMA 4ZHRA 1WAJA 2W42A 2OZSA 4E7IA 4O44A 3L2VA 4FLTA 2Y1IA 4LSNA 3K5MA 4DFKA 3D45A 1BHLA 1NKBA 3AVNA 4EP4A 3DM2A 4JLHA 3HPHA 4DQIA 3VQ4A 1RBUA 1UWBA 1VSFA 3NF8A 1YTAA 1D5AA 4F2RA 1N5YA 3S3OA 3DLEA 1RT6A 4E1NA 4DLGA 4LH5A 3K5NA 3ZSWA 2G8IA 1XWLA 1SL0A 3QEIA 4PWDA 4LD0A 4KV8A 3CM6A 2IS3A 3MAQA 3RR8A 2XY5A 2E4LA 2IAJA 4KHYA 1LAWA 2ZD1A 2HNZA 2B6AA 1T8EA 3L2UA 4Z4HA 3KLFA 1YTUA 1EETA 4IG3A 4RW9A 1SKWA 3MECA 3DRPA 4CK2A 3SNNA 4B8CA 5CZ2A 1W9HA 5KRSA 2KFZA 3HVTA 4CHNA 4DF4A 4F2SA 5HRNA 3M8QA 4W5RA 3HPOA 2OPRA 3ITHA 4FLUA 3DMJA 1B9DA 1Z25A 2P1JA 1IO2A 3ASMA 4IBNA 4IDKA 3RTVA 3AVJA 3WNHA 4E7LA 4I2PA 4B9NA 1IKWA 1J53A 1VSEA 1ASWA 4E1MA 4HUEA 3VQAA 5J2PA 1LV5A 4JRQA 1KLNA 1L3VA 3WNGA 2ETJA 3CM5A 4FVMA 1JLQA 5J2NA 1HQUA 1NOZA 4DTOA 1SL1A 1WSJA 2HNDA 1XHZA 4DQPA 1HNIA 3VQQA 4CJQA 3NF7A 4CGFA 3LALA 3LZJA 3U6FA 1S1TA 4M3YA 4ELVA 3NDKA 4OLBA 1S9EA 1CXQA 1Q8IA 2WONA 3VQ7A 4HCBA 4E7HA 4DSEA 4C8OA 1VSKA 1VSJA 3O4NA 1WSEA 1I39A 4Y1CA 4DFPA 3TAGA 4FZZA 3V9WA 2YNIA 5CYQA 4Z4IA 2HVHA 1C0UA 2D0AA 2E6LA 4W5TA 4FW2A 3G10A 3BGRA 2F8SA 4B3OA 4BDPA 1RNHA 5C24A 4FJ8A 1SKSA 3HL8A 4AILC 3OYAA 3TAFA 5T7BA 4Z0UA 3HO1A 1NJYA 3CG7A 1NK8A 4DTUA 1C0TA 1MU2A 4CHQA 3V81A 3DLKA 5CY4A 3LP2A 1B92A 2KFNA 4CF2A 3MXMA 3PO4A 4OGCA 4C8LA 4CCHA 3SI6A 1QSYA 4XIUA 1NK6A 4K8XA 4Q5VA 3AA2A 4ID5A 3SUOA 3SPYA 1S1XA 3QERA 3SUPA 4O5BA 3TANA 4OPKA 2F8TA 4E0DA 4FZYA 1NKCA 1S9GA 2DTUA 1QHTA 3NFAA 4KFBA 4MFBA 3HXMA 1NJZA 4W5NA 1VSMA 4M3TA 3OYMA 3V4IA 3M8SA 1TKDA 3OYLA 4DMNA 2OA8A 2IOCA 3AVIA 3OS1A 4FZXC 1LW2A 2JGUA 4JS4A 3OYFA 4DTPA 2ZQBA 3SQ1A 5SWMA 1L3SA 4CECA 4KHUA 4QCLA 2NUBA 4B9LA 5KI6A 4TSXA 4NCAA 3L2RA 3VN5A 2XO7A 1BQMA 2OPQA 4EP5A 3KKSA 4AHVA 3VQ6A 2X6SA 3B6PA 3B6OA 4CEZA 1L5UA 1ZBUA 3ISNC 4CGDA 1HYSA 3IS9A 2B5JA 1HRHA 2YKNA 2OPPA 3NHGA 1SUQA 1ZBLA 1HYVA 4CEEA 2BDPA 1J54A 4RW7A 2G8HA 4NCBA 3O3HA 1GOCA 4Z4GA 1Y97A 5KGWA 4CIEA 4O4GA 4DTNA 4CFBA 1D9FA 2Y1JA 2KW4A 4DSJA 1KFDA 5I3UA 1EXQA 1RT2A 4KHWA 1X9MA 3LP1A 4PQUA 1RDAA 3V9UA 3VQ5A 1HNVA 3C95A 3OJSA 1N6QA 4E89A 1GOAA 1UOCA 3NCIA 4ELTA 4KREA 1RDCA 2P5OA 1C1AA 3AVCA 3V1QA 1RT3A 2GBZA 4DG1A 1HPZA 2YV0X 1BCMA 3OYNA 3QESA 1SV5A 4MQ3A 3ALYA 1JLFA 1QSLA 4J2AA 3OYCA 2HHTA 5J2QA 1ASUA 1ZBFA 3V1OA 3MEEA 5KGXA 4W5QA 4F3TA 1FKOA 4Y1DA 4BWJA 4CGGA 1VSDA 4FJGA 1RT4A 3AO2A 3U3YA 2BGGA 3HP6A 2YHBA 4F3OA 3SPZA 3O3GA 4M42A 3TARA 4CFAA 1T03A 3MXIA 1RTDA 5HBMA 1KFSA 5KRTA 3DYAA 3U3GA 3VQ8A 3VQBA 3MXJA 1JLCA 4CJUA 1RT1A 3QIOA 4W5OA 1T7PA 4KHSA 4F8RA 4CJFA 3RMCA 1JKHA 1A5WA 3OJUA 4ZTFA 1R0AA 1QS4A 1LWEA 2RF2A 4ID1A 4CJVA 3I8DA 4HUFA 2VWJA 4OLAA
chains in the Genus database with same CATH superfamily
2X78A 4BR7A 3R3LA 3HBTA 4B9UA 3L6QA 4CW7B 1HNWK 3QIPA 1XC3A 1WB9A 4J2BA 5GIPA 1ILYA 4FK0A 3HPGA 3MWTA 4DSIA 1NGGA 2ZJRL 3NBPA 3BF3A 2Q97A 1S3XA 4C23A 4K0KK 5KTQA 2QKKA 3C7NA 5LY3A 4QAGA 1KCFA 2E88A 1N8RO 3QBWA 2RHKA 3SJJA 2I7PA 1IG8A 1RBSA 1Z26A 4DTRA 3WXKA 3DLRA 4K41A 3DXMB 1YUWA 3VEOA 5CYMA 3AVHA 3WEEB 4JK8A 5AQXA 5EOYA 4MDAA 5HRPA 1BIZA 5C12A 4H0PA 1Q86O 4FJ9A 3CCMN 4CBUA 4FYDA 1NU0A 2P9NA 3ZT0A 4NYFA 3NGIA 4OVLA 5M1QA 1XNQK 1VSHA 3HJFA 3RRGA 2Q36A 5BRHA 4DTSA 5AQHA 1MWMA 3M5RA 2PYLA 4KTQA 2V52B 3U9DA 3KK7A 2A1RA 1VSIA 1IV0A 5AQFA 4DSLA 4BRKA 1ESVA 1KVBA 1G99A 4H0OA 3RMBA 1W7AA 1NGHA 3AO3A 1CZBA 5JMVA 5HRSA 4DR7K 4CF9A 3HTVA 1CZAN 3VF6A 4N56A 4DFJA 3ID6A 3MEGA 5TKYA 4YOWA 3PX0A 1U45A 3E01A 1MA9B 1VQPN 3L0QA 4BE1A 2ATQA 3K0SA 5M1NA 1NNEA 1LOTB 1ZBHA 3U8XA 3KK1A 3AO1A 4M3XA 1TUYA 1VQON 2QXFA 1W2BM 3IRXA 1QQOA 3THXA 1K8KB 3OS2A 3P31A 2P51A 1MWKA 1IJJA 4CZEA 5I42A 3O1BA 4DV5K 2RN2A 1TL3A 3DRSA 4RW4A 4B9TA 1WAFA 1QQCA 2D0BA 4CE9A 4JD2A 3VMFB 4FPAA 3K58A 5AQLA 3ZSVA 3GE1A 2IVOA 2HW3A 4A62A 2PFUA 3E9LA 5DK5A 4Z4FA 2G8FA 1N32K 4FOIA 3DLHA 4QOZB 2HB5A 1U49A 3OTOK 3WNFA 2YCHA 4OPJA 3CHWA 4PL8A 4KHPK 3O80A 4JKDA 4O55A 1QSSA 1NGAA 1VQ5N 4C8MA 3A5OC 3VEWA 4I7FA 3VQ9A 3O4QA 1RDBA 4B08A 1YVUA 2YX6A 1QZ6A 3CQ8A 1ATSA 1L3SA 3EKSA 4N47A 3QEXA 2UUAK 1EQYA 2Z1IA 4KB1A 3LPTA 2OYQA 4LFBK 5D3GA 1S1VA 1BL3A 4BRMA 3PUFA 4CJWA 3QEVA 3M8PA 4M3WA 1FXXA 4NLCA 5AJ3K 1NK5A 3HYFA 3EO3A 4JKEA 5BRFA 4YHHK 3SK3A 4FCYA 1HLUA 3BZCA 1EP4A 3CCLN 4CF0A 1QE1A 3H45C 2W40A 3KIOA 4CD3A 3C6TA 3ULEA 4DLEA 5HROA 1W0HA 5FRMA 3DLLL 1REVA 3TR8A 3LM9A 3DI6A 4FJJA 4HWIA 2FC0A 2VGNA 4BGBA 4QS9A 1RILA 3ZSRA 2E1ZA 1HKBA 4BC4A 1HYZA 4B3MK 4GY2B 4DU1A 4KAZA 3LL3A 3ZT3A 4DB3A 2Z1GA 1NKEA 3IAYA 3V9ZA 4BACA 1NGEA 1U48A 2HMIA 3CQXA 1XI1A 2G8UA 3A0IX 1S6QA 3Q7CA 1W97L 4BE0A 3MX2A 3KLIA 3P38A 2E5LK 4BRLA 4K25A 3L3VA 2P9LB 1YHQN 4YNQA 4H8KA 4IZ9A 2FBXA 4DQQA 1KRPA 3LP0A 1HJOA 4CJ7A 3O3FA 4DTMA 5SZTA 4CHYA 4B9VA 3OYBA 2GTDA 4PKHA 2OTJN 4BR2A 1C0MA 1RT5A 2QWOA 2ZWHA 3OA9A 2O8CA 3AAQA 1YAGA 2PYJA 4DUZK 4CF8A 3TTFA 2D0CA 2KKZA 2CGJA 1VHXA 2AJQA 5AQSA 2OANA 5AFUA 4CJEA 1TYQA 1VSLA 3KTQA 3M8RA 5BREA 5K14A 3QNOA 4JKGA 4PKGA 4ZHRA 4LF9K 4CZIA 2W42A 2OZSA 4IJNA 4O44A 2Y1IA 4LSNA 2WFBA 5FPMA 4NB4A 3CF5L 1BHLA 5TKWA 3DM2A 3HPHA 3VQ4A 3BP8A 1UWBA 2V51B 5BPMA 1N5YA 4DLGA 3ZSWA 4LD0A 1NGJA 3RR8A 2RE2A 2E4LA 1GLBG 4KHYA 1YTUA 2B6AA 1EETA 3HM8A 3MECA 2QWRA 4CK2A 3SNNA 4B8CA 4DQ8A 5CZ2A 4BR0A 3HVTA 1HR0K 4H0VB 1IO2A 2ASOA 4ILGB 3QFPA 2NNWA 1J53A 4GNIA 4E1MA 4JRQA 4JV5K 4XH5A 4FVMA 1JLQA 3SAFA 2NRVA 4DTOA 1SL1A 3H3NO 1XHZA 4H5VA 4CJQA 3SBTA 5AQZA 3I55N 3LZJA 1S1TA 4M3YA 3SAHA 1QVGM 2O8DB 1NBWA 3PIOL 4C8OA 4JI4K 1VSJA 1OH5A 1I39A 4FWKA 4Y1CA 3AGRA 3TU5A 3V9WA 2VQFK 4Z4IA 2HVHA 3OW2M 3VEZA 4EIAA 3R8EA 4GKJK 2VCPA 4FJ8A 4BRAA 1NJYA 1J5EK 3PSFA 4FWPA 3DLKA 5CY4A 3LP2A 4CF2A 4CCHA 3F2KA 1QSYA 5JLFA 4FWRA 4XIUA 4K8XA 3SUOA 1S1XA 3SUPA 4O5BA 4OPKA 4FZYA 3IKMA 2DTUA 4W5NA 2QWMA 1VSMA 3MDQA 3VOVA 4DMNA 2IOCA 4FZXC 3OYFA 4K42A 2VWBA 4JK9A 3GBTA 4B9QA 1VQMN 2P9UB 3L2RA 2DPNA 3A5LC 3KKSA 4BVOA 4AHVA 3ZETA 3IUCA 2HHHK 3ISNC 3A8YA 2B5JA 3H3OB 2YKNA 4RW7A 2G8HA 1GOCA 1M90O 5KGWA 4CIEA 4CFBA 5I3UA 3OJSA 3C95A 4A5BA 1BO5O 3A5NC 4ELTA 4JYAK 4JKGB 3UE5A 3MCAB 5C2DA 3V1QA 1BWFO 3QESA 3CIPA 1JLFA 4J2AA 3BEXA 1ZBFA 1JCGA 5KGXA 4LFAK 4CGGA 4BWJA 3W3DA 3F5TA 4FJGA 1RT4A 4H0YB 3HP6A 3TSUA 1HKCA 1ATNA 3FZHA 4BRNA 1BU6O 5KRTA 2A40A 3U3GA 3VQBA 4W5OA 1A5WA 3OJUA 5F1XA 4ZTFA 5EXWA 3MN7A 5BPLA 4CJVA 2I5JA 1UA1A 3HZ6A 4CHZA 3CCEN 4CZMA 4OKEA 4FLZA 4C8NA 2ZE2A 4DQRA 1OH8A 1KSPA 4AHUA 2ZF5O 3ZSZA 4O0IA 4CERA 5M1OA 2F9WA 3TAEA 4DUYK 3VETA 4DKWA 5EY4A 4UQGA 2A6AA 4CESA 4JKAA 3OHRA 4ISGA 1SQKA 3TI0A 1TKXA 5AR0A 3S3NA 4N76A 3LWLA 3NH2A 3SUQA 1BG3A 1HQEA 2P9IB 1BA1A 4RW8A 3FGUA 4YOYA 3CPEA 4FJ5A 4CHOA 2FBYA 1RDWX 4H03B 3T3FA 1K8AO 4HUGA 4PUOA 4E1JA 3AVMA 4U7BA 1L3TA 3HI0A 4M63C 5DM7L 3AA5X 4ELUA 2GX9A 2F4VK 2ASMA 3ULEB 1YIJN 5FROA 2P9IA 1WSIA 3CFRA 5IWAK 1VQ8N 5AZIB 3EEQA 1NGBA 3LZIA 1EX4A 2Z1HA 3SMSA 3CJCA 4IEIA 3WXJA 4HTUA 4BQLA 4LY7A 4K8ZA 4CF1A 3ATUA 3NE6A 3QO9A 5JVGL 3VA3A 3WQUA 3VQEA 4IO9L 2HSTA 4BRQA 1J9AA 2WUSA 2A5XA 1U2VB 4FJIA 3HOSA 3CFPA 1WSGA 2Q1NA 4HVJA 2HHQA 3HVRA 4EAHD 1OH6A 4JK7A 4QS7A 2O8EA 1B9FA 3FZLA 3THWA 1NK9A 3BUZB 3SV4A 3KK2A 4CIGA 1XMOK 5AQQA 2WBNA 4B8AB 2F7TA 5AQMA 1S6PA 3LDOA 3W0LA 4DHYA 1S5JA 1JJ2M 2O8BA 4CK1A 1YI2N 4H5WA 3VF2A 4CEBA 3E9OA 4YOUA 1X1PA 4X62K 1NG9A 2FXUA 2QW9A 3TSQA 3OYHA 4FXDA 3KLGA 1DTQA 4GV3A 3DOLA 2HHWA 4BWMA 2E20A 3RSEB 4E7JA 5KQDA 1HMVA 3NH1A 1DLOA 1JCFA 1NJXA 3GDQA 3RSEA 4CJPA 1N36K 4DR2K 3EE8A 1ZYQA 1OKJA 4GVEA 4IO8A 3SV3A 2IIRA 3AA4A 1RBVA 2F9TA 3V9XA 3THYB 2IVPA 3U9ZA 4WQ4C 3UKUA 1GOBA 3QNNA 2BE2A 3ENHA 1TK8A 2VYPA 3NGYA 3G25A 4A61A 1BISA 3J81O 4NLBA 4KTZA 1JLAA 3FLCO 3LAMA 3RVCA 1S22A 3OYIA 3EZWA 3K2PA 3LP3A 1IKXA 1N34K 3LANA 4BREA 2KZZA 4FK4A 3CI5A 4HHTA 1TGOA 3IMXA 3KHYA 4A5AA 4DF8A 3WT0A 3S9HA 5JS2A 3AV9A 4JHDB 4CZFA 3PY8A 1HNZK 1KLMA 3F9KA 3NF6A 4KBOA 3ZSOA 4CBWA 4DS5A 1D8YA 5AQGA 3V6DA 5HLFA 5GAGP 3F9MA 4BRDA 2RKIA 3HSTB 2XY7A 3K59A 5GAHP 3VF4A 4KB0A 4E7KA 5GAEP 4AH9A 3E66A 3CD6N 2A1SA 4O0JA 1ZBIA 3OS0A 3WXIA 4J8FA 1UAXA 3E9PA 2P9NB 3O9RA 5B8HA 3KZBA 4MO5A 5LJWA 3KD1E 3AVKA 1BA0A 4IXCA 4CEOA 3O9QA 1HJRA 2DY4A 1C1BA 3VPZA 3MMVA 5C15A 1TL1A 3J7AP 1Q9XA 4F9OA 1OVQA 3LWMA 3M6GA 3J7YP 3CYMA 1VRUA 5BPNA 1SZ2A 1T6DA 3AVLA 1SAZA 3P83D 1K9MO 2XY6A 5EU7A 3DLGA 4A59A 2HHUA 5LMNK 1BCOA 2ASPA 4IDHA 1QTMA 2HHSA 2GUIA 3CCUN 4YFUA 1VQ7N 4H0XB 1SKRA 3DXKB 4CJLA 2G8WA 4CJKA 3NH0A 2O8EB 4CFDA 5F2RA 4AHRA 1BGXT 3DWLA 3G4SN 1NGIA 4B1YB 1D4XA 1EKEA 3WNEA 3RWUA 3G71N 3C6UA 3L8BA 1G15A 2VG5A 1A5XA 5JS1A 4NCGA 1ATRA 2YNHA 1EWRA 4BDYA 3PX6A 2YHAA 4KO0A 1DEJA 2RPIA 1KVCA 5AZIA 3P1GA 2HBJA 2ZJPL 4CZHA 4I9QA 3SQ0A 3EY1A 3BY5A 5BRDA 3CC7N 4I2QA 2P9PA 1RTIA 4CK3A 4B1WB 2WOMA 2D0OA 1EO1A 5BN8A 4JN4A 2QA4N 3L2VA 3D45A 2UYTA 3FZFA 2W41A 4FO0A 3ENOA 4JLHA 4DQIA 1KAXA 4FWMA 4LF7K 5EX5A 1BUPA 4OPHA 1HKGA 1RT6A 2NLXA 2HF4A 1XWLA 2V7YA 4KV8A 4BRIA 2IS3A 2XY5A 2IAJA 4DR6K 2HNZA 4Z4HA 3DRPA 4OO1J 3BF1A 1W9HA 1R59O 3HPOA 2OPRA 1YXQA 4FLUA 2P1JA 3RTVA 4IJAA 3ASMA 4I2PA 1IKWA 1ZC6A 3NMUA 1NGFA 5J2PA 1LV5A 3VQAA 1KLNA 3CM5A 4BRHA 5AQYA 1JCEA 4DQPA 5JVHL 3NF7A 4CGFA 3PSIA 4ELVA 4OLBA 4HCBA 2KLAA 2QXLA 1QVFM 3FR0A 1WSEA 1WBDA 2QTDA 5CYQA 3A5MC 1QZ5A 4FW2A 4K43A 3UKUB 2D1KA 5C24A 1SKSA 3HL8A 3OYAA 3TAFA 5AQUA 4Z0UA 3HO1A 1NK8A 4DTUA 4CHQA 2YJFA 1B92A 3D6RA 2KFNA 4C8LA 3ID8A 1NK6A 4ID5A 3SPYA 3QERA 4O5FA 3VGLA 2F8TA 1NKCA 3NFAA 3ENBA 4MFBA 3WQTA 3OYMA 1TKDA 4O8UA 3ZX3A 4RTFD 3OS1A 4Z94A 4JS4A 3L4QA 3ZETB 3I33A 4CECA 4YOVA 2P9UA 2NUBA 1KD1O 4B9LA 4TSXA 3JS6A 2GWJA 1K73O 3B6PA 3B6OA 4CEZA 3DAWA 3JAMO 3DJCA 1HRHA 1ZBLA 2BDPA 1HYVA 4CEEA 3ZX2A 3PIPL 4Z4GA 4O4GA 1D9FA 4JD2B 4CD1A 1RT2A 3LDQA 3FFKB 1IBMK 3CQYA 1RDAA 3LDLA 3I8BA 1N6QA 1GOAA 4IOCL 4G9ZA 4KREA 1RDCA 2PAVA 1C1AA 1VQLN 1RT3A 2GBZA 4DG1A 5EVZA 2YV0X 1SV5A 4MQ3A 1QSLA 3OYCA 2HHTA 2P9SB 3V1OA 4W5QA 4F3TA 4Y1DA 2D4WA 2YHBA 3SPZA 2HF3A 1FW6A 5CR4A 4WFBL 3VQ8A 1RT1A 3G6EN 4CJFA 3RMCA 2UUCK 2A41A 2E2OA 1LWEA 3SAGA 3VEYA 5BR9A 4FPBA 1GLJO 1KAYA 1TAQA 1Q9YA 3ZX0A 4ISFA 3QEWA 4CZKA 4KPYA 4M45A 5J2MA 4FLYA 4WFAL 3SZ2A 4MLEA 5ELZA 1KC8O 4O8KA 1TK5A 4DV1K 4FJXA 2BH1A 2BTFA 3NVKA 5FRNA 1MDUB 4ZTJA 1X9JA 4JKHA 4CGIA 4FSVA 5C2FA 1LCUA 3VGKA 4IG0A 3OYJA 3TAMA 3CJ9A 4Z4EA 2YJEA 2HBKA 5HOOA 1NK4A 3SYZA 4BY9C 4RWTA 2IVNA 1NMNA 4CJ3A 2B4JA 3CJ1A 1DTTA 2ZGYA 2OPSA 3KD5E 2GWKA 4WE1A 4RCHA 2VG6A 1O13A 1U4BA 3KLEA 1U47A 3CETA 4DQSA 3QB0A 3KVGA 4EZ6A 2Z1JA 2D5RA 4KH5A 4FWQA 3UB5A 2A3ZA 4FJLA 2FBVA 1BQNA 3D2FA 3LM2A 3R1XA 3VTIA 4DR4K 4LF6K 3C0BA 4CJ5A 3PV8A 4XH1A 2XY8A 4KHQA 3NAEA 4DR1K 3T1AA 3SQ4A 1FJGK 5AQJA 4G1QA 3UIQA 4LF4K 3ZT4A 5AFUH 4GMJB 2JWKA 1XC9A 3DXKA 5BN9A 1DGKN 1TKZA 4H0TB 3WUHA 2P5GA 3PLAA 4DCHA 4CFCA 2BANA 4YDUA 4AHCA 4FK2A 2O8FA 5LJVA 3QINA 4BRFA 3O1WA 3T7ZA 3T19A 4V19S 4IKFA 3V9SA 4HTLA 4B9MA 2FBTA 3KKRA 3RMDA 5MLCQ 3VEXA 5JLHA 4J2DA 4C1NI 1RCHA 1FKPA 3QLHA 3P39A 3BDPA 1CXUA 3EZ5A 5CZ1A 1YJ9N 2QK9A 3DLBA 2W6KA 4A2AA 4CZGA 4R5PA 2YNGA 2QI2A 4DV2K 4FM2A 4BRGA 1XMQK 1YJNN 4BROA 3TWHA 2IGIA 5AQIA 3V1RA 4JS5A 4B1VA 3OYGA 1J5OA 2ITGA 1NJIO 3AVAA 4BGAA 3CPWM 3MCPA 1K6YA 4UY8O 2JLEA 4CI6A 1NMDA 4DSFA 3H46O 1JL1A 4CEAA 1C6VA 3CMEN 2R7YA 4KKOA 4I6MB 3I0RA 4M7YA 2P9KB 1KVAA 1LWCA 3EN9A 4FLVA 4KI6A 4XH4A 1CLQA 3F73A 3TSPA 4YY3K 4DWIA 4DTJA 5HRRA 1JXEA 1KAZA 4N41A 4E19A 1TVRA 4H5RA 1RBTA 1J6ZA 1EWQA 3ZSXA 4M41A 3IG1A 3HT3A 1NK7A 3O8MA 3K9JA 4DFMA 1I3AA 2HBLA 3T1HK 2VWKA 2FSNA 4H4MA 1T05A 2G8KA 2UXBK 1WOQA 3LAKA 1I94K 1RTJA 3D7EO 1Q81O 3VEVA 1KTQA 5AQRA 2IDOA 3DOKA 1NK0A 5FPDA 4FJNA 4KRFA 2CGLA 2NRHA 4LH4A 4AHTA 3IDHA 3KJVA 4ILHA 3KLHA 2O8BB 4LFCK 3JYTA 4M3UA 3T69A 5FPEA 3EYZA 4DU4A 4DU3A 1IBKK 2E8AA 3TAPA 2X6NA 4H5NA 4CEFA 4F4KA 1BI4A 1GLLO 3C7NB 4JI0K 1NWKA 4BC3A 3QETA 4JI1K 3HOTA 2Q3SA 3O6WA 3SQ2A 1CZ9A 1YT3A 3D2EB 5AQVA 3PX4A 4OJRA 2KHOA 4JI6K 5M1FA 2QEXN 3HM9A 2DFHA 3OVNA 1OVYA 2GEMA 4CHPA 1P8ZA 2LSNA 1O1WA 5KPTA 2OZMA 3SCXA 2UXCK 1NOYA 4JKFA 4E3SA 1HX1A 4B3TK 2H3GX 3GL1A 3CCRN 4DV4K 4AM7A 4DV3K 4CJ4A 2YHYA 3ZT1A 2E2QA 4GW6A 4CJTA 1TAUA 4BRPA 3J80O 5C25A 1WNSA 3AO5A 1KQSM 3S3MA 1X9WA 2ZJQL 4B9SA 1HUXA 2YHWA 3QFUA 2QWNA 3WXMB 1WAJA 2QWPA 3CMAN 4E7IA 4FLTA 3K5MA 3L4IA 1TUUA 4BQZA 4FVUA 1NKBA 3AVNA 3CC2N 3D2EA 4B1UB 1RBUA 1YTAA 4F2RA 3DLEA 4LH5A 3NVMA 2G8IA 1SL0A 3QEIA 4PWDA 3CM6A 5GINA 3MAQA 2QKBA 1LAWA 2ZD1A 3L2UA 4IG3A 1SKWA 3CCSN 1C0GA 2KFZA 4CHNA 4F2SA 3M8QA 4E7LA 4IDKA 4B9NA 1NGDA 1ASWA 4JHDA 4HUEA 3K9KA 2ETJA 1S72N 2I7NA 1NOZA 4X64K 1WSJA 2OCEA 2Q31A 4FWNA 3LALA 1GLAG 3R9PA 1CXQA 1Q8IA 2WONA 3VQ7A 4E7HA 4B1XB 3O9UA 4WQ4A 3TAGA 2FF6A 1VQ4N 2ZM6K 5AZJB 2D0AA 2E6LA 4JI8K 4B3OA 3UKRB 5KQ8A 1RNHA 4AILC 5T7BA 3CG7A 4CZLA 1C0TA 1MU2A 3QDKA 3MXMA 3SI6A 1E3MA 3HRGA 4Q5VA 3AA2A 3TANA 1ZBSA 1P90A 1NJZA 4M3TA 3R6MA 3V4IA 4BVPA 3M8SA 3OYLA 5HL7L 3SBGA 4GV6A 1K8KA 3SQ1A 2AA4A 2V7ZA 2AP1A 5KI6A 3EL2A 4NCAA 3VN5A 2XO7A 1BQMA 3N4PA 2OPQA 1XUPO 2X6SA 3HSCA 3CCJN 1SS6A 4CGDA 1HYSA 3IS9A 4C1NK 3O3HA 1T3VA 4MDBA 2JWLA 3MK6A 3SJHA 2Y1JA 1EXQA 4NXNK 4JI3K 4PQUA 3VQ5A 5CHIA 5JICA 1VQ6N 4EFHA 1UOCA 3NCIA 3IFRA 4BR4A 3O5BA 3ZYYX 3AVCA 5H1SQ 1HPZA 1BCMA 1U6ZA 1U2VA 4LC9B 5ADXA 1Z05A 3ALYA 5J2QA 1ASUA 3CJBA 3H6EA 1VSDA 3CJ7A 3AO2A 3U3YA 2BGGA 2O8FB 3O3GA 2HMPA 3TARA 1T03A 3MXIA 4B3RK 3S41A 5HBMA 4DV7K 5FPNA 1KFSA 3DYAA 4CJUA 3MXJA 3QIOA 4IEEA 4KHSA 4F8RA 4YDUC 2E2PA 3VESA 2QM1A 3QICA 2RF2A 2WC9A 3PO4A 3VTHA 5DM6L 3RRHA 1GLDG 3ZLJA 3MN6A 4CIFA 2CH6A 3WEEA 3L2QA 1H1VA 1S1WA 3AVFA 3O4WA 4Y0WA 3DXMA 4M3RA 2QWLA 3WXLA 4CZJA 4AQYK 3OY9A 4M3ZA 3ZSYA 2ITMA 1IKVA 2KZMA 2IC3A 2NRXA 3D2FB 2PZSA 4AF1A 1OH7A 1BI4B 3AO4A 1YITN 1RTHA 3ULDA 1XHXA 3ZEUA 3ZT2A 4Q0BA 4BR9A 3I56N 1FK9A 4KTWA 1LWFA 2HHVA 1JLEA 2G8VA 4IWVA 4FWLA 4JEPA 5F0XA 4FJ7A 3P5JA 4C8KA 2YHXA 4CEQA 1WSFA 3MN9A 4L8RB 3HP9A 4JI7K 1QQNA 4ICLA 4AHSA 4RW6A 1NJWA 4CJRA 1TYQB 3OYDA 4R79A 1BIUA 5AQOA 3VQCA 5E41A 1TKTA 2EX3A 4KH4A 2XHBA 3EKUA 4BG9A 5C0YA 1T44A 3KWIA 1WSHA 2O8CB 2VQEK 5AQKA 4PKIA 3HK2A 1UA0A 1VRTA 3G0ZA 3ZCMA 1E4FT 3OYKA 3QBXA 1Q82O 1D9DA 1RT7A 3H08A 4H4OA 4JKCA 1Y64A 1TK0A 1TV6A 2P9KA 2P9LA 4I6MA 3AY9A 1V4SA 3JSMA 3C94A 3NF9A 2UUBK 4HCCA 1ITGA 2OTLN 2Q0UA 1Q7YO 3RMAA 2NRTA 4MO4A 4BDZA 3MX5A 1JLBA 2VGMA 3GG4A 4JAXA 3K5OA 4DSKA 3AAPA 4EHTA 2VG7A 3I0SA 4B1ZA 4FOEA 5DMRA 4CEDA 2PY5A 4GV9A 1BDGA 4WFNL 3K57A 1RDDA 2EHGA 4CJSA 2HBMA 4FM1A 3VQDA 1HPMA 5GIOA 3BZKA 3TPQA 5LL6Z 3CXCM 2O4GA 1C1CA 1S1UA 4BRCA 4U67L 5I9EB 3M3ZA 2UU9K 5AQNA 2YKMA 5CE3A 4LF5K 4N5SA 4CGJA 3H1QA 3AVBA 1DT9A 4JRPA 5HP1A 1YVNA 2HNYA 4Z4CA 4YOXA 4DTXA 4NXMK 2XRIA 4JNEA 4FLXA 2HHXA 4X65K 3T1YK 2PBDA 3GOIA 3JXUA 3PO5A 4EZ9A 2O8DA 4GVMA 2DFFA 1IBLK 4M7XA 1LW0A 4NYNA 4LSLA 2A42A 2FLOA 5AQWA 3B8AX 4XEIA 3MEDA 5LMUK 2O4IA 4FWOA 1IKYA 4A57A 3TAQA 5M1PA 3DRRA 1NM1A 1JXBA 1YJWN 3UKRA 1X3MA 3Q7BA 3SLCA 4FJMA 3OBYA 5AZJA 3QEPA 4FLWA 1JLGA 3SUNA 1VK0A 4KI4A 4PY5A 1XQSC 5C42A 5BR8K 1GLFO 4WF9L 4DS4A 3LPUA 3VA0A 4OPAA 2F96A 3ATVA 1A5VA 1Q18A 4KHNA 2X74A 3CC4N 4L3QA 3E1YA 2KTQA 4BC2A 4OKKA 4AM6A 4H5TA 3N4QA 3AA3A 5A2QO 1RDUA 3THVA 2NRWA 3RR7A 4IFYA 5E26A 1F21A 1WLJA 2KQ2A 1LAVA 3TABA 1U04A 2GELA 2HVIA 4WQ5A 1XNRK 3A2FA 4DV6K 4WYBA 3SMPA 3MN5A 4PHTX 1WBBA 1BOTO 2YNFA 3ZEUB 4KH6A 5E84A 5AQTA 4DR5K 1GLEG 4YORA 3OYEA 1RBRA 3U4LA 3C6HA 3L3UA 3ZSQA 4CGHA 4QS8A 3M1FA 4FW1A 5ADXH 5FDLA 1SL2A 4YOTA 2E6MA 2J4RA 1M1KO 4A2BA 1JL2A 4IFVA 3KK3A 3CJAA 4JKBA 1IH7A 1X9SA 4GKKK 1ZXOA 5GADP 3NGZA 1IG9A 4FJKA 4BG8A 1ASVA 4FM0A 4BC5A 3J7ZO 4RG8A 4IFEA 3EE9A 2ZGZA 2DFEA 1L3UA 4OGEA 4I9LA 3P4IA 4X66K 3FFIA 4MLHA 4J2EA 4OKJA 2Q0RA 4PA1A 4DV0K 3LDSA 3J8AA 2GV9A 3L2WA 2P9SA 3VQPA 4JI2K 3FZMA 4BE2A 4CVNE 3CFOA 5J1EA 2UXDK 3K5LA 3AVGA 2CH5A 3FE1A 1WN7A 3D0PA 4DR3K 5M1KA 1VAZA 1NLVA 1RGIA 4DFKA 3CCQN 4EP4A 4OX9K 4B3SK 4ILJA 2BUPA 1VSFA 2QWQA 1E4GT 3NF8A 4IOAL 1D5AA 1VQKN 3S3OA 2GUPA 2NRRA 4E1NA 3K5NA 3CCVN 2FSKA 5C10A 1VQ9N 4ISEA 1T8EA 3VGMA 3KLFA 4RW9A 1T6CA 1Z6RA 3CERA 5KRSA 5KPZA 4DF4A 4BR5A 5HRNA 4W5RA 3ITHA 3DMJA 1B9DA 1Z25A 4IBNA 4FJHA 3AVJA 3WNHA 5FLXO 1VSEA 1L3VA 3WNGA 5J2NA 1HQUA 2HNDA 2CGKA 1HNIA 3VQQA 2NRZA 3U6FA 3NDKA 1S9EA 1NGCA 4DSEA 1VSKA 4FZZA 3O4NA 4DFPA 3KWGA 2YNIA 3OBWA 1C0UA 2HOEA 3O08A 4W5TA 3G10A 3BGRA 3O9TA 2F8SA 4WQ5C 4IOXA 4BDPA 1WUAA 2Q2RA 1KXPA 2D0PA 3V81A 3MWPA 1N33K 2NZTA 4OGCA 3AARA 4E0DA 1C0FA 1S9GA 1QHTA 4KFBA 3VENA 5KPRA 3HXMA 2EWSA 3VERA 4FWSA 3LDPA 3C65A 2OA8A 3AVIA 4WCEL 2WTUA 1LW2A 2JGUA 3O9SA 4DTPA 2ZQBA 4KHUA 5SWMA 3THXB 4LF8K 4QCLA 3LDNA 1RFQA 4FL9A 2FSJA 4EP5A 4EHUA 3THYA 3VQ6A 1L5UA 1ZBUA 2FF3B 5AQPA 2OPPA 3NHGA 1SUQA 1YF5L 1J54A 4NCBA 4NO7A 1Y97A 4DTNA 4DSJA 2KW4A 1GLCG 1X3NA 1KFDA 3QMLA 4KHWA 3FZKA 1X9MA 3LP1A 3TTCA 3V9UA 1HNVA 5IT9O 4E89A 2P5OA 2P9PB 4PL7A 3OYNA 2E2NA 3MEEA 3C6AA 3H1VX 1FKOA 1V4TA 1QQMA 2W6LA 3TTDA 3AGKA 4F3OA 4M42A 1DKGD 4CFAA 4JI5K 2E1YA 1RTDA 4CBXA 1QHAA 1JLCA 3THWB 1T7PA 1JKHA 2YI1A 1R0AA 1VQNN 1QS4A 4ID1A 3I8DA 4HUFA 2VWJA 1HNXK 4OLAA
chains in the Genus database with same CATH topology
2X78A 2I5JA 1UA1A 4CHZA 3RRHA 4B9UA 1TAQA 4OKEA 4FLZA 4C8NA 4CIFA 1Q9YA 2ZE2A 3QIPA 3QEWA 4KPYA 4DQRA 4M45A 3L2QA 4J2BA 1S1WA 3AVFA 4AHUA 5J2MA 1KSPA 4FLYA 3ZSZA 3HPGA 4FK0A 3SZ2A 4DSIA 4O0IA 4CERA 4M3RA 3TAEA 1TK5A 3NBPA 3OY9A 4M3ZA 3ZSYA 1IKVA 2KZMA 2IC3A 4FJXA 4UQGA 4CESA 5FRNA 2PZSA 5KTQA 4ZTJA 2QKKA 4CGIA 1BI4B 3AO4A 3TI0A 1TKXA 3S3NA 1RTHA 1KCFA 4QAGA 3LWLA 4N76A 3ULDA 3NH2A 1XHXA 3SUQA 4IG0A 1HQEA 3OYJA 3TAMA 3ZT2A 4Q0BA 1FK9A 4RW8A 3SJJA 4Z4EA 4KTWA 1LWFA 2HHVA 1RBSA 1JLEA 1Z26A 4DTRA 4FJ5A 4CHOA 3DLRA 2G8VA 2QKBA 2FBYA 1NK4A 5CYMA 3SYZA 3T3FA 3AVHA 4FJ7A 3P5JA 4HUGA 4C8KA 4CJ3A 4CEQA 2B4JA 4PUOA 1WSFA 3AVMA 1DTTA 5HRPA 4L8RB 1BIZA 1L3TA 3HP9A 2OPSA 4ICLA 4AHSA 3KD5E 3AA5X 4RW6A 1NJWA 4WE1A 4ELUA 4CJRA 4FJ9A 2VG6A 3OYDA 1U4BA 5FROA 3KLEA 4FYDA 1WSIA 3CFRA 1U47A 3ZT0A 1BIUA 4NYFA 3NGIA 4DQSA 3VQCA 5E41A 4OVLA 1TKTA 2EX3A 2Z1JA 2XHBA 3LZIA 1EX4A 4EZ6A 2Z1HA 1VSHA 2D5RA 3HJFA 1WSHA 4FJLA 3RRGA 2FBVA 4HTUA 1BQNA 4LY7A 4DTSA 4K8ZA 4KTQA 4CF1A 2PYLA 3NE6A 3QO9A 3HK2A 1UA0A 3VA3A 1VRTA 2A1RA 1VSIA 3VQEA 4DSLA 3G0ZA 4CJ5A 3ZCMA 3PV8A 3OYKA 1J9AA 2XY8A 1D9DA 1RT7A 3H08A 4FJIA 4KHQA 3NAEA 1KVBA 3T1AA 4H4OA 3SQ4A 3CFPA 1WSGA 3RMBA 3AO3A 1CZBA 4HVJA 4G1QA 1TK0A 1TV6A 3HVRA 2HHQA 5HRSA 3UIQA 4CF9A 3ZT4A 4GMJB 4N56A 4DFJA 3JSMA 3C94A 3MEGA 3NF9A 4HCCA 1ITGA 1XC9A 3RMAA 3PX0A 1B9FA 4BDZA 1U45A 3E01A 1TKZA 1NK9A 2P5GA 4BE1A 2ATQA 3SV4A 4CFCA 1JLBA 2BANA 4AHCA 3KK2A 4FK2A 1ZBHA 3K5OA 3KK1A 3AO1A 4DSKA 3QINA 4CIGA 2VG7A 4M3XA 3I0SA 4CEDA 4B8AB 5DMRA 2PY5A 2QXFA 1S6PA 1S5JA 3IRXA 3T19A 4CK1A 4IKFA 4CEBA 3OS2A 3V9SA 3K57A 1RDDA 1X1PA 4B9MA 2EHGA 2FBTA 4CJSA 3OYHA 2P51A 3KKRA 3RMDA 4FXDA 4FM1A 3VQDA 5I42A 3KLGA 1DTQA 4J2DA 3DOLA 2RN2A 1RCHA 1TL3A 2HHWA 4BWMA 2O4GA 1FKPA 3DRSA 4RW4A 4B9TA 4E7JA 1WAFA 1C1CA 1S1UA 3QLHA 1QQCA 1CXUA 3BDPA 1HMVA 3EZ5A 2D0BA 4CE9A 3NH1A 1DLOA 1NJXA 5CZ1A 4CJPA 2QK9A 3DLBA 2YKMA 4R5PA 2YNGA 3K58A 4N5SA 4CGJA 1ZYQA 3ZSVA 4FM2A 3AVBA 3SV3A 3AA4A 1RBVA 4JRPA 3V9XA 5HP1A 2HW3A 2HNYA 1GOBA 3QNNA 4Z4CA 2IGIA 2BE2A 5DK5A 3TWHA 3V1RA 4JS5A 3OYGA 4DTXA 1J5OA 2G8FA 4Z4FA 2ITGA 1TK8A 2XRIA 3AVAA 3NGYA 4FLXA 2HHXA 3DLHA 4QOZB 2HB5A 1K6YA 1BISA 2JLEA 1U49A 4KTZA 3WNFA 4OPJA 4DSFA 3PO5A 4EZ9A 1JL1A 1JLAA 2DFFA 4GVMA 4CEAA 3LAMA 1C6VA 1LW0A 4NYNA 3OYIA 3K2PA 4LSLA 3LP3A 1IKXA 4O55A 2R7YA 1QSSA 3MEDA 4KKOA 3LANA 2KZZA 4FK4A 2O4IA 4C8MA 4HHTA 1TGOA 3I0RA 4I7FA 1KVAA 1LWCA 1IKYA 4FLVA 3VQ9A 4KI6A 3O4QA 4DF8A 3S9HA 1RDBA 4B08A 5JS2A 1YVUA 3AV9A 3TAQA 1CLQA 3F73A 3CQ8A 3DRRA 3PY8A 4DWIA 1KLMA 1JXBA 4N47A 4DTJA 3F9KA 5HRRA 1JXEA 2Z1IA 3NF6A 3QEXA 4N41A 4KB1A 3LPTA 4E19A 2OYQA 1TVRA 4DS5A 3ZSOA 1D8YA 5D3GA 1RBTA 4FJMA 5HLFA 1S1VA 1BL3A 3ZSXA 3V6DA 4M41A 3QEPA 4FLWA 3IG1A 3HT3A 2RKIA 1JLGA 3PUFA 1VK0A 3HSTB 4CJWA 3QEVA 2XY7A 3M8PA 3K59A 1FXXA 3SUNA 4M3WA 4DFMA 4KI4A 4PY5A 1I3AA 1NK5A 5C42A 4E7KA 4AH9A 4KB0A 4DS4A 2VWKA 3LPUA 3HYFA 4H4MA 1T05A 2A1SA 4FCYA 3VA0A 4O0JA 1ZBIA 1EP4A 2F96A 3OS0A 4CF0A 1UAXA 1A5VA 2G8KA 1QE1A 2X74A 4KHNA 3KIOA 3C6TA 3LAKA 3KD1E 1RTJA 3AVKA 2KTQA 4DLEA 5HROA 1W0HA 1KTQA 4OKKA 4CEOA 1HJRA 2DY4A 1C1BA 3AA3A 1TL1A 2IDOA 3DOKA 1NK0A 5FRMA 1REVA 1Q9XA 3TR8A 3THVA 3RR7A 3LWMA 4FJNA 4KRFA 3CYMA 1VRUA 3DI6A 4FJJA 2FC0A 4IFYA 3AVLA 1F21A 4LH4A 1WLJA 1RILA 2KQ2A 4AHTA 1LAVA 3TABA 1U04A 3KJVA 3ZSRA 3KLHA 2HVIA 3JYTA 4M3UA 1HYZA 3A2FA 3EYZA 3P83D 4DU1A 4DU4A 4DU3A 2XY6A 4KAZA 5EU7A 3DLGA 3ZT3A 4FJHA 2HHUA 1BCOA 2YNFA 2Z1GA 2X6NA 3TAPA 1NKEA 3V9ZA 3IAYA 4BACA 4CEFA 1U48A 1QTMA 2HHSA 2GUIA 4F4KA 1BI4A 2HMIA 4YFUA 3QETA 1XI1A 2G8UA 3SQ2A 2Q3SA 1SKRA 1S6QA 1CZ9A 4CJLA 2G8WA 1YT3A 3OYEA 4CJKA 4BE0A 3NH0A 1RBRA 3KLIA 4CFDA 3L3UA 3L3VA 4AHRA 3PX4A 3ZSQA 1NK7A 1BGXT 4CGHA 4OJRA 4YNQA 4FW1A 4H8KA 5FDLA 2FBXA 3WNEA 1EKEA 2DFHA 3LP0A 3OVNA 3HM9A 4DQQA 1SL2A 2E6MA 1KRPA 3RWUA 3O3FA 4DTMA 5SZTA 3C6UA 1JL2A 4IFVA 4CHYA 1G15A 2VG5A 3KK3A 4CHPA 3L8BA 1A5XA 3OYBA 4B9VA 5JS1A 1IH7A 1X9SA 2LSNA 1O1WA 4NCGA 3NGZA 2OZMA 3SCXA 1C0MA 2YNHA 1IG9A 1NOYA 1RT5A 4FJKA 1ASVA 4FM0A 4E3SA 4BDYA 3PX6A 4RG8A 2YHAA 4KO0A 2DFEA 1L3UA 2PYJA 4OGEA 4CF8A 4I9LA 2RPIA 1KVCA 3FFIA 2D0CA 4J2EA 4OKJA 4CJ4A 2AJQA 3P1GA 4PA1A 3ZT1A 3LDSA 4GW6A 4CJTA 1TAUA 2GV9A 3L2WA 4CJEA 3VQPA 1VSLA 3KTQA 5C25A 4I9QA 4BE2A 3M8RA 3SQ0A 3CFOA 1WNSA 3AO5A 5J1EA 3EY1A 5K14A 3S3MA 3K5LA 3QNOA 3AVGA 1X9WA 4I2QA 4B9SA 1WN7A 1RTIA 4CK3A 3D0PA 2WOMA 4ZHRA 1WAJA 2W42A 2OZSA 4E7IA 4O44A 3L2VA 4FLTA 2Y1IA 4LSNA 3K5MA 4DFKA 3D45A 1BHLA 1NKBA 3AVNA 4EP4A 3DM2A 4JLHA 3HPHA 4DQIA 3VQ4A 1RBUA 1UWBA 1VSFA 3NF8A 1YTAA 1D5AA 4F2RA 1N5YA 3S3OA 3DLEA 1RT6A 4E1NA 4DLGA 4LH5A 3K5NA 3ZSWA 2G8IA 1XWLA 1SL0A 3QEIA 4PWDA 4LD0A 4KV8A 3CM6A 2IS3A 3MAQA 3RR8A 2XY5A 2E4LA 2IAJA 4KHYA 1LAWA 2ZD1A 2HNZA 2B6AA 1T8EA 3L2UA 4Z4HA 3KLFA 1YTUA 1EETA 4IG3A 4RW9A 1SKWA 3MECA 3DRPA 4CK2A 3SNNA 4B8CA 5CZ2A 1W9HA 5KRSA 2KFZA 3HVTA 4CHNA 4DF4A 4F2SA 5HRNA 3M8QA 4W5RA 3HPOA 2OPRA 3ITHA 4FLUA 3DMJA 1B9DA 1Z25A 2P1JA 1IO2A 3ASMA 4IBNA 4IDKA 3RTVA 3AVJA 3WNHA 4E7LA 4I2PA 4B9NA 1IKWA 1J53A 1VSEA 1ASWA 4E1MA 4HUEA 3VQAA 5J2PA 1LV5A 4JRQA 1KLNA 1L3VA 3WNGA 2ETJA 3CM5A 4FVMA 1JLQA 5J2NA 1HQUA 1NOZA 4DTOA 1SL1A 1WSJA 2HNDA 1XHZA 4DQPA 1HNIA 3VQQA 4CJQA 3NF7A 4CGFA 3LALA 3LZJA 3U6FA 1S1TA 4M3YA 4ELVA 3NDKA 4OLBA 1S9EA 1CXQA 1Q8IA 2WONA 3VQ7A 4HCBA 4E7HA 4DSEA 4C8OA 1VSKA 1VSJA 3O4NA 1WSEA 1I39A 4Y1CA 4DFPA 3TAGA 4FZZA 3V9WA 2YNIA 5CYQA 4Z4IA 2HVHA 1C0UA 2D0AA 2E6LA 4W5TA 4FW2A 3G10A 3BGRA 2F8SA 4B3OA 4BDPA 1RNHA 5C24A 4FJ8A 1SKSA 3HL8A 4AILC 3OYAA 3TAFA 5T7BA 4Z0UA 3HO1A 1NJYA 3CG7A 1NK8A 4DTUA 1C0TA 1MU2A 4CHQA 3V81A 3DLKA 5CY4A 3LP2A 1B92A 2KFNA 4CF2A 3MXMA 3PO4A 4OGCA 4C8LA 4CCHA 3SI6A 1QSYA 4XIUA 1NK6A 4K8XA 4Q5VA 3AA2A 4ID5A 3SUOA 3SPYA 1S1XA 3QERA 3SUPA 4O5BA 3TANA 4OPKA 2F8TA 4E0DA 4FZYA 1NKCA 1S9GA 2DTUA 1QHTA 3NFAA 4KFBA 4MFBA 3HXMA 1NJZA 4W5NA 1VSMA 4M3TA 3OYMA 3V4IA 3M8SA 1TKDA 3OYLA 4DMNA 2OA8A 2IOCA 3AVIA 3OS1A 4FZXC 1LW2A 2JGUA 4JS4A 3OYFA 4DTPA 2ZQBA 3SQ1A 5SWMA 1L3SA 4CECA 4KHUA 4QCLA 2NUBA 4B9LA 5KI6A 4TSXA 4NCAA 3L2RA 3VN5A 2XO7A 1BQMA 2OPQA 4EP5A 3KKSA 4AHVA 3VQ6A 2X6SA 3B6PA 3B6OA 4CEZA 1L5UA 1ZBUA 3ISNC 4CGDA 1HYSA 3IS9A 2B5JA 1HRHA 2YKNA 2OPPA 3NHGA 1SUQA 1ZBLA 1HYVA 4CEEA 2BDPA 1J54A 4RW7A 2G8HA 4NCBA 3O3HA 1GOCA 4Z4GA 1Y97A 5KGWA 4CIEA 4O4GA 4DTNA 4CFBA 1D9FA 2Y1JA 2KW4A 4DSJA 1KFDA 5I3UA 1EXQA 1RT2A 4KHWA 1X9MA 3LP1A 4PQUA 1RDAA 3V9UA 3VQ5A 1HNVA 3C95A 3OJSA 1N6QA 4E89A 1GOAA 1UOCA 3NCIA 4ELTA 4KREA 1RDCA 2P5OA 1C1AA 3AVCA 3V1QA 1RT3A 2GBZA 4DG1A 1HPZA 2YV0X 1BCMA 3OYNA 3QESA 1SV5A 4MQ3A 3ALYA 1JLFA 1QSLA 4J2AA 3OYCA 2HHTA 5J2QA 1ASUA 1ZBFA 3V1OA 3MEEA 5KGXA 4W5QA 4F3TA 1FKOA 4Y1DA 4BWJA 4CGGA 1VSDA 4FJGA 1RT4A 3AO2A 3U3YA 2BGGA 3HP6A 2YHBA 4F3OA 3SPZA 3O3GA 4M42A 3TARA 4CFAA 1T03A 3MXIA 1RTDA 5HBMA 1KFSA 5KRTA 3DYAA 3U3GA 3VQ8A 3VQBA 3MXJA 1JLCA 4CJUA 1RT1A 3QIOA 4W5OA 1T7PA 4KHSA 4F8RA 4CJFA 3RMCA 1JKHA 1A5WA 3OJUA 4ZTFA 1R0AA 1QS4A 1LWEA 2RF2A 4ID1A 4CJVA 3I8DA 4HUFA 2VWJA 4OLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X78 A;  2I5J A;  1UA1 A;  4CHZ A;  3RRH A;  4B9U A;  1TAQ A;  4OKE A;  4FLZ A;  4C8N A;  4CIF A;  1Q9Y A;  2ZE2 A;  3QIP A;  3QEW A;  4KPY A;  4DQR A;  4M45 A;  3L2Q A;  4J2B A;  1S1W A;  3AVF A;  4AHU A;  5J2M A;  1KSP A;  4FLY A;  3ZSZ A;  3HPG A;  4FK0 A;  3SZ2 A;  4DSI A;  4O0I A;  4CER A;  4M3R A;  3TAE A;  1TK5 A;  3NBP A;  3OY9 A;  4M3Z A;  3ZSY A;  1IKV A;  2KZM A;  2IC3 A;  4FJX A;  4UQG A;  4CES A;  5FRN A;  2PZS A;  5KTQ A;  4ZTJ A;  2QKK A;  4CGI A;  1BI4 B;  3AO4 A;  3TI0 A;  1TKX A;  3S3N A;  1RTH A;  1KCF A;  4QAG A;  3LWL A;  4N76 A;  3ULD A;  3NH2 A;  1XHX A;  3SUQ A;  4IG0 A;  1HQE A;  3OYJ A;  3TAM A;  3ZT2 A;  4Q0B A;  1FK9 A;  4RW8 A;  3SJJ A;  4Z4E A;  4KTW A;  1LWF A;  2HHV A;  1RBS A;  1JLE A;  1Z26 A;  4DTR A;  4FJ5 A;  4CHO A;  3DLR A;  2G8V A;  2QKB A;  2FBY A;  1NK4 A;  5CYM A;  3SYZ A;  3T3F A;  3AVH A;  4FJ7 A;  3P5J A;  4HUG A;  4C8K A;  4CJ3 A;  4CEQ A;  2B4J A;  4PUO A;  1WSF A;  3AVM A;  1DTT A;  5HRP A;  4L8R B;  1BIZ A;  1L3T A;  3HP9 A;  2OPS A;  4ICL A;  4AHS A;  3KD5 E;  3AA5 X;  4RW6 A;  1NJW A;  4WE1 A;  4ELU A;  4CJR A;  4FJ9 A;  2VG6 A;  3OYD A;  1U4B A;  5FRO A;  3KLE A;  4FYD A;  1WSI A;  3CFR A;  1U47 A;  3ZT0 A;  1BIU A;  4NYF A;  3NGI A;  4DQS A;  3VQC A;  5E41 A;  4OVL A;  1TKT A;  2EX3 A;  2Z1J A;  2XHB A;  3LZI A;  1EX4 A;  4EZ6 A;  2Z1H A;  1VSH A;  2D5R A;  3HJF A;  1WSH A;  4FJL A;  3RRG A;  2FBV A;  4HTU A;  1BQN A;  4LY7 A;  4DTS A;  4K8Z A;  4KTQ A;  4CF1 A;  2PYL A;  3NE6 A;  3QO9 A;  3HK2 A;  1UA0 A;  3VA3 A;  1VRT A;  2A1R A;  1VSI A;  3VQE A;  4DSL A;  3G0Z A;  4CJ5 A;  3ZCM A;  3PV8 A;  3OYK A;  1J9A A;  2XY8 A;  1D9D A;  1RT7 A;  3H08 A;  4FJI A;  4KHQ A;  3NAE A;  1KVB A;  3T1A A;  4H4O A;  3SQ4 A;  3CFP A;  1WSG A;  3RMB A;  3AO3 A;  1CZB A;  4HVJ A;  4G1Q A;  1TK0 A;  1TV6 A;  3HVR A;  2HHQ A;  5HRS A;  3UIQ A;  4CF9 A;  3ZT4 A;  4GMJ B;  4N56 A;  4DFJ A;  3JSM A;  3C94 A;  3MEG A;  3NF9 A;  4HCC A;  1ITG A;  1XC9 A;  3RMA A;  3PX0 A;  1B9F A;  4BDZ A;  1U45 A;  3E01 A;  1TKZ A;  1NK9 A;  2P5G A;  4BE1 A;  2ATQ A;  3SV4 A;  4CFC A;  1JLB A;  2BAN A;  4AHC A;  3KK2 A;  4FK2 A;  1ZBH A;  3K5O A;  3KK1 A;  3AO1 A;  4DSK A;  3QIN A;  4CIG A;  2VG7 A;  4M3X A;  3I0S A;  4CED A;  4B8A B;  5DMR A;  2PY5 A;  2QXF A;  1S6P A;  1S5J A;  3IRX A;  3T19 A;  4CK1 A;  4IKF A;  4CEB A;  3OS2 A;  3V9S A;  3K57 A;  1RDD A;  1X1P A;  4B9M A;  2EHG A;  2FBT A;  4CJS A;  3OYH A;  2P51 A;  3KKR A;  3RMD A;  4FXD A;  4FM1 A;  3VQD A;  5I42 A;  3KLG A;  1DTQ A;  4J2D A;  3DOL A;  2RN2 A;  1RCH A;  1TL3 A;  2HHW A;  4BWM A;  2O4G A;  1FKP A;  3DRS A;  4RW4 A;  4B9T A;  4E7J A;  1WAF A;  1C1C A;  1S1U A;  3QLH A;  1QQC A;  1CXU A;  3BDP A;  1HMV A;  3EZ5 A;  2D0B A;  4CE9 A;  3NH1 A;  1DLO A;  1NJX A;  5CZ1 A;  4CJP A;  2QK9 A;  3DLB A;  2YKM A;  4R5P A;  2YNG A;  3K58 A;  4N5S A;  4CGJ A;  1ZYQ A;  3ZSV A;  4FM2 A;  3AVB A;  3SV3 A;  3AA4 A;  1RBV A;  4JRP A;  3V9X A;  5HP1 A;  2HW3 A;  2HNY A;  1GOB A;  3QNN A;  4Z4C A;  2IGI A;  2BE2 A;  5DK5 A;  3TWH A;  3V1R A;  4JS5 A;  3OYG A;  4DTX A;  1J5O A;  2G8F A;  4Z4F A;  2ITG A;  1TK8 A;  2XRI A;  3AVA A;  3NGY A;  4FLX A;  2HHX A;  3DLH A;  4QOZ B;  2HB5 A;  1K6Y A;  1BIS A;  2JLE A;  1U49 A;  4KTZ A;  3WNF A;  4OPJ A;  4DSF A;  3PO5 A;  4EZ9 A;  1JL1 A;  1JLA A;  2DFF A;  4GVM A;  4CEA A;  3LAM A;  1C6V A;  1LW0 A;  4NYN A;  3OYI A;  3K2P A;  4LSL A;  3LP3 A;  1IKX A;  4O55 A;  2R7Y A;  1QSS A;  3MED A;  4KKO A;  3LAN A;  2KZZ A;  4FK4 A;  2O4I A;  4C8M A;  4HHT A;  1TGO A;  3I0R A;  4I7F A;  1KVA A;  1LWC A;  1IKY A;  4FLV A;  3VQ9 A;  4KI6 A;  3O4Q A;  4DF8 A;  3S9H A;  1RDB A;  4B08 A;  5JS2 A;  1YVU A;  3AV9 A;  3TAQ A;  1CLQ A;  3F73 A;  3CQ8 A;  3DRR A;  3PY8 A;  4DWI A;  1KLM A;  1JXB A;  4N47 A;  4DTJ A;  3F9K A;  5HRR A;  1JXE A;  2Z1I A;  3NF6 A;  3QEX A;  4N41 A;  4KB1 A;  3LPT A;  4E19 A;  2OYQ A;  1TVR A;  4DS5 A;  3ZSO A;  1D8Y A;  5D3G A;  1RBT A;  4FJM A;  5HLF A;  1S1V A;  1BL3 A;  3ZSX A;  3V6D A;  4M41 A;  3QEP A;  4FLW A;  3IG1 A;  3HT3 A;  2RKI A;  1JLG A;  3PUF A;  1VK0 A;  3HST B;  4CJW A;  3QEV A;  2XY7 A;  3M8P A;  3K59 A;  1FXX A;  3SUN A;  4M3W A;  4DFM A;  4KI4 A;  4PY5 A;  1I3A A;  1NK5 A;  5C42 A;  4E7K A;  4AH9 A;  4KB0 A;  4DS4 A;  2VWK A;  3LPU A;  3HYF A;  4H4M A;  1T05 A;  2A1S A;  4FCY A;  3VA0 A;  4O0J A;  1ZBI A;  1EP4 A;  2F96 A;  3OS0 A;  4CF0 A;  1UAX A;  1A5V A;  2G8K A;  1QE1 A;  2X74 A;  4KHN A;  3KIO A;  3C6T A;  3LAK A;  3KD1 E;  1RTJ A;  3AVK A;  2KTQ A;  4DLE A;  5HRO A;  1W0H A;  1KTQ A;  4OKK A;  4CEO A;  1HJR A;  2DY4 A;  1C1B A;  3AA3 A;  1TL1 A;  2IDO A;  3DOK A;  1NK0 A;  5FRM A;  1REV A;  1Q9X A;  3TR8 A;  3THV A;  3RR7 A;  3LWM A;  4FJN A;  4KRF A;  3CYM A;  1VRU A;  3DI6 A;  4FJJ A;  2FC0 A;  4IFY A;  3AVL A;  1F21 A;  4LH4 A;  1WLJ A;  1RIL A;  2KQ2 A;  4AHT A;  1LAV A;  3TAB A;  1U04 A;  3KJV A;  3ZSR A;  3KLH A;  2HVI A;  3JYT A;  4M3U A;  1HYZ A;  3A2F A;  3EYZ A;  3P83 D;  4DU1 A;  4DU4 A;  4DU3 A;  2XY6 A;  4KAZ A;  5EU7 A;  3DLG A;  3ZT3 A;  4FJH A;  2HHU A;  1BCO A;  2YNF A;  2Z1G A;  2X6N A;  3TAP A;  1NKE A;  3V9Z A;  3IAY A;  4BAC A;  4CEF A;  1U48 A;  1QTM A;  2HHS A;  2GUI A;  4F4K A;  1BI4 A;  2HMI A;  4YFU A;  3QET A;  1XI1 A;  2G8U A;  3SQ2 A;  2Q3S A;  1SKR A;  1S6Q A;  1CZ9 A;  4CJL A;  2G8W A;  1YT3 A;  3OYE A;  4CJK A;  4BE0 A;  3NH0 A;  1RBR A;  3KLI A;  4CFD A;  3L3U A;  3L3V A;  4AHR A;  3PX4 A;  3ZSQ A;  1NK7 A;  1BGX T;  4CGH A;  4OJR A;  4YNQ A;  4FW1 A;  4H8K A;  5FDL A;  2FBX A;  3WNE A;  1EKE A;  2DFH A;  3LP0 A;  3OVN A;  3HM9 A;  4DQQ A;  1SL2 A;  2E6M A;  1KRP A;  3RWU A;  3O3F A;  4DTM A;  5SZT A;  3C6U A;  1JL2 A;  4IFV A;  4CHY A;  1G15 A;  2VG5 A;  3KK3 A;  4CHP A;  3L8B A;  1A5X A;  3OYB A;  4B9V A;  5JS1 A;  1IH7 A;  1X9S A;  2LSN A;  1O1W A;  4NCG A;  3NGZ A;  2OZM A;  3SCX A;  1C0M A;  2YNH A;  1IG9 A;  1NOY A;  1RT5 A;  4FJK A;  1ASV A;  4FM0 A;  4E3S A;  4BDY A;  3PX6 A;  4RG8 A;  2YHA A;  4KO0 A;  2DFE A;  1L3U A;  2PYJ A;  4OGE A;  4CF8 A;  4I9L A;  2RPI A;  1KVC A;  3FFI A;  2D0C A;  4J2E A;  4OKJ A;  4CJ4 A;  2AJQ A;  3P1G A;  4PA1 A;  3ZT1 A;  3LDS A;  4GW6 A;  4CJT A;  1TAU A;  2GV9 A;  3L2W A;  4CJE A;  3VQP A;  1VSL A;  3KTQ A;  5C25 A;  4I9Q A;  4BE2 A;  3M8R A;  3SQ0 A;  3CFO A;  1WNS A;  3AO5 A;  5J1E A;  3EY1 A;  5K14 A;  3S3M A;  3K5L A;  3QNO A;  3AVG A;  1X9W A;  4I2Q A;  4B9S A;  1WN7 A;  1RTI A;  4CK3 A;  3D0P A;  2WOM A;  4ZHR A;  1WAJ A;  2W42 A;  2OZS A;  4E7I A;  4O44 A;  3L2V A;  4FLT A;  2Y1I A;  4LSN A;  3K5M A;  4DFK A;  3D45 A;  1BHL A;  1NKB A;  3AVN A;  4EP4 A;  3DM2 A;  4JLH A;  3HPH A;  4DQI A;  3VQ4 A;  1RBU A;  1UWB A;  1VSF A;  3NF8 A;  1YTA A;  1D5A A;  4F2R A;  1N5Y A;  3S3O A;  3DLE A;  1RT6 A;  4E1N A;  4DLG A;  4LH5 A;  3K5N A;  3ZSW A;  2G8I A;  1XWL A;  1SL0 A;  3QEI A;  4PWD A;  4LD0 A;  4KV8 A;  3CM6 A;  2IS3 A;  3MAQ A;  3RR8 A;  2XY5 A;  2E4L A;  2IAJ A;  4KHY A;  1LAW A;  2ZD1 A;  2HNZ A;  2B6A A;  1T8E A;  3L2U A;  4Z4H A;  3KLF A;  1YTU A;  1EET A;  4IG3 A;  4RW9 A;  1SKW A;  3MEC A;  3DRP A;  4CK2 A;  3SNN A;  4B8C A;  5CZ2 A;  1W9H A;  5KRS A;  2KFZ A;  3HVT A;  4CHN A;  4DF4 A;  4F2S A;  5HRN A;  3M8Q A;  4W5R A;  3HPO A;  2OPR A;  3ITH A;  4FLU A;  3DMJ A;  1B9D A;  1Z25 A;  2P1J A;  1IO2 A;  3ASM A;  4IBN A;  4IDK A;  3RTV A;  3AVJ A;  3WNH A;  4E7L A;  4I2P A;  4B9N A;  1IKW A;  1J53 A;  1VSE A;  1ASW A;  4E1M A;  4HUE A;  3VQA A;  5J2P A;  1LV5 A;  4JRQ A;  1KLN A;  1L3V A;  3WNG A;  2ETJ A;  3CM5 A;  4FVM A;  1JLQ A;  5J2N A;  1HQU A;  1NOZ A;  4DTO A;  1SL1 A;  1WSJ A;  2HND A;  1XHZ A;  4DQP A;  1HNI A;  3VQQ A;  4CJQ A;  3NF7 A;  4CGF A;  3LAL A;  3LZJ A;  3U6F A;  1S1T A;  4M3Y A;  4ELV A;  3NDK A;  4OLB A;  1S9E A;  1CXQ A;  1Q8I A;  2WON A;  3VQ7 A;  4HCB A;  4E7H A;  4DSE A;  4C8O A;  1VSK A;  1VSJ A;  3O4N A;  1WSE A;  1I39 A;  4Y1C A;  4DFP A;  3TAG A;  4FZZ A;  3V9W A;  2YNI A;  5CYQ A;  4Z4I A;  2HVH A;  1C0U A;  2D0A A;  2E6L A;  4W5T A;  4FW2 A;  3G10 A;  3BGR A;  2F8S A;  4B3O A;  4BDP A;  1RNH A;  5C24 A;  4FJ8 A;  1SKS A;  3HL8 A;  4AIL C;  3OYA A;  3TAF A;  5T7B A;  4Z0U A;  3HO1 A;  1NJY A;  3CG7 A;  1NK8 A;  4DTU A;  1C0T A;  1MU2 A;  4CHQ A;  3V81 A;  3DLK A;  5CY4 A;  3LP2 A;  1B92 A;  2KFN A;  4CF2 A;  3MXM A;  3PO4 A;  4OGC A;  4C8L A;  4CCH A;  3SI6 A;  1QSY A;  4XIU A;  1NK6 A;  4K8X A;  4Q5V A;  3AA2 A;  4ID5 A;  3SUO A;  3SPY A;  1S1X A;  3QER A;  3SUP A;  4O5B A;  3TAN A;  4OPK A;  2F8T A;  4E0D A;  4FZY A;  1NKC A;  1S9G A;  2DTU A;  1QHT A;  3NFA A;  4KFB A;  4MFB A;  3HXM A;  1NJZ A;  4W5N A;  1VSM A;  4M3T A;  3OYM A;  3V4I A;  3M8S A;  1TKD A;  3OYL A;  4DMN A;  2OA8 A;  2IOC A;  3AVI A;  3OS1 A;  4FZX C;  1LW2 A;  2JGU A;  4JS4 A;  3OYF A;  4DTP A;  2ZQB A;  3SQ1 A;  5SWM A;  1L3S A;  4CEC A;  4KHU A;  4QCL A;  2NUB A;  4B9L A;  5KI6 A;  4TSX A;  4NCA A;  3L2R A;  3VN5 A;  2XO7 A;  1BQM A;  2OPQ A;  4EP5 A;  3KKS A;  4AHV A;  3VQ6 A;  2X6S A;  3B6P A;  3B6O A;  4CEZ A;  1L5U A;  1ZBU A;  3ISN C;  4CGD A;  1HYS A;  3IS9 A;  2B5J A;  1HRH A;  2YKN A;  2OPP A;  3NHG A;  1SUQ A;  1ZBL A;  1HYV A;  4CEE A;  2BDP A;  1J54 A;  4RW7 A;  2G8H A;  4NCB A;  3O3H A;  1GOC A;  4Z4G A;  1Y97 A;  5KGW A;  4CIE A;  4O4G A;  4DTN A;  4CFB A;  1D9F A;  2Y1J A;  2KW4 A;  4DSJ A;  1KFD A;  5I3U A;  1EXQ A;  1RT2 A;  4KHW A;  1X9M A;  3LP1 A;  4PQU A;  1RDA A;  3V9U A;  3VQ5 A;  1HNV A;  3C95 A;  3OJS A;  1N6Q A;  4E89 A;  1GOA A;  1UOC A;  3NCI A;  4ELT A;  4KRE A;  1RDC A;  2P5O A;  1C1A A;  3AVC A;  3V1Q A;  1RT3 A;  2GBZ A;  4DG1 A;  1HPZ A;  2YV0 X;  1BCM A;  3OYN A;  3QES A;  1SV5 A;  4MQ3 A;  3ALY A;  1JLF A;  1QSL A;  4J2A A;  3OYC A;  2HHT A;  5J2Q A;  1ASU A;  1ZBF A;  3V1O A;  3MEE A;  5KGX A;  4W5Q A;  4F3T A;  1FKO A;  4Y1D A;  4BWJ A;  4CGG A;  1VSD A;  4FJG A;  1RT4 A;  3AO2 A;  3U3Y A;  2BGG A;  3HP6 A;  2YHB A;  4F3O A;  3SPZ A;  3O3G A;  4M42 A;  3TAR A;  4CFA A;  1T03 A;  3MXI A;  1RTD A;  5HBM A;  1KFS A;  5KRT A;  3DYA A;  3U3G A;  3VQ8 A;  3VQB A;  3MXJ A;  1JLC A;  4CJU A;  1RT1 A;  3QIO A;  4W5O A;  1T7P A;  4KHS A;  4F8R A;  4CJF A;  3RMC A;  1JKH A;  1A5W A;  3OJU A;  4ZTF A;  1R0A A;  1QS4 A;  1LWE A;  2RF2 A;  4ID1 A;  4CJV A;  3I8D A;  4HUF A;  2VWJ A;  4OLA A; 
#chains in the Genus database with same CATH topology
 2X78 A;  4BR7 A;  3R3L A;  3HBT A;  4B9U A;  3L6Q A;  4CW7 B;  1HNW K;  3QIP A;  1XC3 A;  1WB9 A;  4J2B A;  5GIP A;  1ILY A;  4FK0 A;  3HPG A;  3MWT A;  4DSI A;  1NGG A;  2ZJR L;  3NBP A;  3BF3 A;  2Q97 A;  1S3X A;  4C23 A;  4K0K K;  5KTQ A;  2QKK A;  3C7N A;  5LY3 A;  4QAG A;  1KCF A;  2E88 A;  1N8R O;  3QBW A;  2RHK A;  3SJJ A;  2I7P A;  1IG8 A;  1RBS A;  1Z26 A;  4DTR A;  3WXK A;  3DLR A;  4K41 A;  3DXM B;  1YUW A;  3VEO A;  5CYM A;  3AVH A;  3WEE B;  4JK8 A;  5AQX A;  5EOY A;  4MDA A;  5HRP A;  1BIZ A;  5C12 A;  4H0P A;  1Q86 O;  4FJ9 A;  3CCM N;  4CBU A;  4FYD A;  1NU0 A;  2P9N A;  3ZT0 A;  4NYF A;  3NGI A;  4OVL A;  5M1Q A;  1XNQ K;  1VSH A;  3HJF A;  3RRG A;  2Q36 A;  5BRH A;  4DTS A;  5AQH A;  1MWM A;  3M5R A;  2PYL A;  4KTQ A;  2V52 B;  3U9D A;  3KK7 A;  2A1R A;  1VSI A;  1IV0 A;  5AQF A;  4DSL A;  4BRK A;  1ESV A;  1KVB A;  1G99 A;  4H0O A;  3RMB A;  1W7A A;  1NGH A;  3AO3 A;  1CZB A;  5JMV A;  5HRS A;  4DR7 K;  4CF9 A;  3HTV A;  1CZA N;  3VF6 A;  4N56 A;  4DFJ A;  3ID6 A;  3MEG A;  5TKY A;  4YOW A;  3PX0 A;  1U45 A;  3E01 A;  1MA9 B;  1VQP N;  3L0Q A;  4BE1 A;  2ATQ A;  3K0S A;  5M1N A;  1NNE A;  1LOT B;  1ZBH A;  3U8X A;  3KK1 A;  3AO1 A;  4M3X A;  1TUY A;  1VQO N;  2QXF A;  1W2B M;  3IRX A;  1QQO A;  3THX A;  1K8K B;  3OS2 A;  3P31 A;  2P51 A;  1MWK A;  1IJJ A;  4CZE A;  5I42 A;  3O1B A;  4DV5 K;  2RN2 A;  1TL3 A;  3DRS A;  4RW4 A;  4B9T A;  1WAF A;  1QQC A;  2D0B A;  4CE9 A;  4JD2 A;  3VMF B;  4FPA A;  3K58 A;  5AQL A;  3ZSV A;  3GE1 A;  2IVO A;  2HW3 A;  4A62 A;  2PFU A;  3E9L A;  5DK5 A;  4Z4F A;  2G8F A;  1N32 K;  4FOI A;  3DLH A;  4QOZ B;  2HB5 A;  1U49 A;  3OTO K;  3WNF A;  2YCH A;  4OPJ A;  3CHW A;  4PL8 A;  4KHP K;  3O80 A;  4JKD A;  4O55 A;  1QSS A;  1NGA A;  1VQ5 N;  4C8M A;  3A5O C;  3VEW A;  4I7F A;  3VQ9 A;  3O4Q A;  1RDB A;  4B08 A;  1YVU A;  2YX6 A;  1QZ6 A;  3CQ8 A;  1ATS A;  1L3S A;  3EKS A;  4N47 A;  3QEX A;  2UUA K;  1EQY A;  2Z1I A;  4KB1 A;  3LPT A;  2OYQ A;  4LFB K;  5D3G A;  1S1V A;  1BL3 A;  4BRM A;  3PUF A;  4CJW A;  3QEV A;  3M8P A;  4M3W A;  1FXX A;  4NLC A;  5AJ3 K;  1NK5 A;  3HYF A;  3EO3 A;  4JKE A;  5BRF A;  4YHH K;  3SK3 A;  4FCY A;  1HLU A;  3BZC A;  1EP4 A;  3CCL N;  4CF0 A;  1QE1 A;  3H45 C;  2W40 A;  3KIO A;  4CD3 A;  3C6T A;  3ULE A;  4DLE A;  5HRO A;  1W0H A;  5FRM A;  3DLL L;  1REV A;  3TR8 A;  3LM9 A;  3DI6 A;  4FJJ A;  4HWI A;  2FC0 A;  2VGN A;  4BGB A;  4QS9 A;  1RIL A;  3ZSR A;  2E1Z A;  1HKB A;  4BC4 A;  1HYZ A;  4B3M K;  4GY2 B;  4DU1 A;  4KAZ A;  3LL3 A;  3ZT3 A;  4DB3 A;  2Z1G A;  1NKE A;  3IAY A;  3V9Z A;  4BAC A;  1NGE A;  1U48 A;  2HMI A;  3CQX A;  1XI1 A;  2G8U A;  3A0I X;  1S6Q A;  3Q7C A;  1W97 L;  4BE0 A;  3MX2 A;  3KLI A;  3P38 A;  2E5L K;  4BRL A;  4K25 A;  3L3V A;  2P9L B;  1YHQ N;  4YNQ A;  4H8K A;  4IZ9 A;  2FBX A;  4DQQ A;  1KRP A;  3LP0 A;  1HJO A;  4CJ7 A;  3O3F A;  4DTM A;  5SZT A;  4CHY A;  4B9V A;  3OYB A;  2GTD A;  4PKH A;  2OTJ N;  4BR2 A;  1C0M A;  1RT5 A;  2QWO A;  2ZWH A;  3OA9 A;  2O8C A;  3AAQ A;  1YAG A;  2PYJ A;  4DUZ K;  4CF8 A;  3TTF A;  2D0C A;  2KKZ A;  2CGJ A;  1VHX A;  2AJQ A;  5AQS A;  2OAN A;  5AFU A;  4CJE A;  1TYQ A;  1VSL A;  3KTQ A;  3M8R A;  5BRE A;  5K14 A;  3QNO A;  4JKG A;  4PKG A;  4ZHR A;  4LF9 K;  4CZI A;  2W42 A;  2OZS A;  4IJN A;  4O44 A;  2Y1I A;  4LSN A;  2WFB A;  5FPM A;  4NB4 A;  3CF5 L;  1BHL A;  5TKW A;  3DM2 A;  3HPH A;  3VQ4 A;  3BP8 A;  1UWB A;  2V51 B;  5BPM A;  1N5Y A;  4DLG A;  3ZSW A;  4LD0 A;  1NGJ A;  3RR8 A;  2RE2 A;  2E4L A;  1GLB G;  4KHY A;  1YTU A;  2B6A A;  1EET A;  3HM8 A;  3MEC A;  2QWR A;  4CK2 A;  3SNN A;  4B8C A;  4DQ8 A;  5CZ2 A;  4BR0 A;  3HVT A;  1HR0 K;  4H0V B;  1IO2 A;  2ASO A;  4ILG B;  3QFP A;  2NNW A;  1J53 A;  4GNI A;  4E1M A;  4JRQ A;  4JV5 K;  4XH5 A;  4FVM A;  1JLQ A;  3SAF A;  2NRV A;  4DTO A;  1SL1 A;  3H3N O;  1XHZ A;  4H5V A;  4CJQ A;  3SBT A;  5AQZ A;  3I55 N;  3LZJ A;  1S1T A;  4M3Y A;  3SAH A;  1QVG M;  2O8D B;  1NBW A;  3PIO L;  4C8O A;  4JI4 K;  1VSJ A;  1OH5 A;  1I39 A;  4FWK A;  4Y1C A;  3AGR A;  3TU5 A;  3V9W A;  2VQF K;  4Z4I A;  2HVH A;  3OW2 M;  3VEZ A;  4EIA A;  3R8E A;  4GKJ K;  2VCP A;  4FJ8 A;  4BRA A;  1NJY A;  1J5E K;  3PSF A;  4FWP A;  3DLK A;  5CY4 A;  3LP2 A;  4CF2 A;  4CCH A;  3F2K A;  1QSY A;  5JLF A;  4FWR A;  4XIU A;  4K8X A;  3SUO A;  1S1X A;  3SUP A;  4O5B A;  4OPK A;  4FZY A;  3IKM A;  2DTU A;  4W5N A;  2QWM A;  1VSM A;  3MDQ A;  3VOV A;  4DMN A;  2IOC A;  4FZX C;  3OYF A;  4K42 A;  2VWB A;  4JK9 A;  3GBT A;  4B9Q A;  1VQM N;  2P9U B;  3L2R A;  2DPN A;  3A5L C;  3KKS A;  4BVO A;  4AHV A;  3ZET A;  3IUC A;  2HHH K;  3ISN C;  3A8Y A;  2B5J A;  3H3O B;  2YKN A;  4RW7 A;  2G8H A;  1GOC A;  1M90 O;  5KGW A;  4CIE A;  4CFB A;  5I3U A;  3OJS A;  3C95 A;  4A5B A;  1BO5 O;  3A5N C;  4ELT A;  4JYA K;  4JKG B;  3UE5 A;  3MCA B;  5C2D A;  3V1Q A;  1BWF O;  3QES A;  3CIP A;  1JLF A;  4J2A A;  3BEX A;  1ZBF A;  1JCG A;  5KGX A;  4LFA K;  4CGG A;  4BWJ A;  3W3D A;  3F5T A;  4FJG A;  1RT4 A;  4H0Y B;  3HP6 A;  3TSU A;  1HKC A;  1ATN A;  3FZH A;  4BRN A;  1BU6 O;  5KRT A;  2A40 A;  3U3G A;  3VQB A;  4W5O A;  1A5W A;  3OJU A;  5F1X A;  4ZTF A;  5EXW A;  3MN7 A;  5BPL A;  4CJV A;  2I5J A;  1UA1 A;  3HZ6 A;  4CHZ A;  3CCE N;  4CZM A;  4OKE A;  4FLZ A;  4C8N A;  2ZE2 A;  4DQR A;  1OH8 A;  1KSP A;  4AHU A;  2ZF5 O;  3ZSZ A;  4O0I A;  4CER A;  5M1O A;  2F9W A;  3TAE A;  4DUY K;  3VET A;  4DKW A;  5EY4 A;  4UQG A;  2A6A A;  4CES A;  4JKA A;  3OHR A;  4ISG A;  1SQK A;  3TI0 A;  1TKX A;  5AR0 A;  3S3N A;  4N76 A;  3LWL A;  3NH2 A;  3SUQ A;  1BG3 A;  1HQE A;  2P9I B;  1BA1 A;  4RW8 A;  3FGU A;  4YOY A;  3CPE A;  4FJ5 A;  4CHO A;  2FBY A;  1RDW X;  4H03 B;  3T3F A;  1K8A O;  4HUG A;  4PUO A;  4E1J A;  3AVM A;  4U7B A;  1L3T A;  3HI0 A;  4M63 C;  5DM7 L;  3AA5 X;  4ELU A;  2GX9 A;  2F4V K;  2ASM A;  3ULE B;  1YIJ N;  5FRO A;  2P9I A;  1WSI A;  3CFR A;  5IWA K;  1VQ8 N;  5AZI B;  3EEQ A;  1NGB A;  3LZI A;  1EX4 A;  2Z1H A;  3SMS A;  3CJC A;  4IEI A;  3WXJ A;  4HTU A;  4BQL A;  4LY7 A;  4K8Z A;  4CF1 A;  3ATU A;  3NE6 A;  3QO9 A;  5JVG L;  3VA3 A;  3WQU A;  3VQE A;  4IO9 L;  2HST A;  4BRQ A;  1J9A A;  2WUS A;  2A5X A;  1U2V B;  4FJI A;  3HOS A;  3CFP A;  1WSG A;  2Q1N A;  4HVJ A;  2HHQ A;  3HVR A;  4EAH D;  1OH6 A;  4JK7 A;  4QS7 A;  2O8E A;  1B9F A;  3FZL A;  3THW A;  1NK9 A;  3BUZ B;  3SV4 A;  3KK2 A;  4CIG A;  1XMO K;  5AQQ A;  2WBN A;  4B8A B;  2F7T A;  5AQM A;  1S6P A;  3LDO A;  3W0L A;  4DHY A;  1S5J A;  1JJ2 M;  2O8B A;  4CK1 A;  1YI2 N;  4H5W A;  3VF2 A;  4CEB A;  3E9O A;  4YOU A;  1X1P A;  4X62 K;  1NG9 A;  2FXU A;  2QW9 A;  3TSQ A;  3OYH A;  4FXD A;  3KLG A;  1DTQ A;  4GV3 A;  3DOL A;  2HHW A;  4BWM A;  2E20 A;  3RSE B;  4E7J A;  5KQD A;  1HMV A;  3NH1 A;  1DLO A;  1JCF A;  1NJX A;  3GDQ A;  3RSE A;  4CJP A;  1N36 K;  4DR2 K;  3EE8 A;  1ZYQ A;  1OKJ A;  4GVE A;  4IO8 A;  3SV3 A;  2IIR A;  3AA4 A;  1RBV A;  2F9T A;  3V9X A;  3THY B;  2IVP A;  3U9Z A;  4WQ4 C;  3UKU A;  1GOB A;  3QNN A;  2BE2 A;  3ENH A;  1TK8 A;  2VYP A;  3NGY A;  3G25 A;  4A61 A;  1BIS A;  3J81 O;  4NLB A;  4KTZ A;  1JLA A;  3FLC O;  3LAM A;  3RVC A;  1S22 A;  3OYI A;  3EZW A;  3K2P A;  3LP3 A;  1IKX A;  1N34 K;  3LAN A;  4BRE A;  2KZZ A;  4FK4 A;  3CI5 A;  4HHT A;  1TGO A;  3IMX A;  3KHY A;  4A5A A;  4DF8 A;  3WT0 A;  3S9H A;  5JS2 A;  3AV9 A;  4JHD B;  4CZF A;  3PY8 A;  1HNZ K;  1KLM A;  3F9K A;  3NF6 A;  4KBO A;  3ZSO A;  4CBW A;  4DS5 A;  1D8Y A;  5AQG A;  3V6D A;  5HLF A;  5GAG P;  3F9M A;  4BRD A;  2RKI A;  3HST B;  2XY7 A;  3K59 A;  5GAH P;  3VF4 A;  4KB0 A;  4E7K A;  5GAE P;  4AH9 A;  3E66 A;  3CD6 N;  2A1S A;  4O0J A;  1ZBI A;  3OS0 A;  3WXI A;  4J8F A;  1UAX A;  3E9P A;  2P9N B;  3O9R A;  5B8H A;  3KZB A;  4MO5 A;  5LJW A;  3KD1 E;  3AVK A;  1BA0 A;  4IXC A;  4CEO A;  3O9Q A;  1HJR A;  2DY4 A;  1C1B A;  3VPZ A;  3MMV A;  5C15 A;  1TL1 A;  3J7A P;  1Q9X A;  4F9O A;  1OVQ A;  3LWM A;  3M6G A;  3J7Y P;  3CYM A;  1VRU A;  5BPN A;  1SZ2 A;  1T6D A;  3AVL A;  1SAZ A;  3P83 D;  1K9M O;  2XY6 A;  5EU7 A;  3DLG A;  4A59 A;  2HHU A;  5LMN K;  1BCO A;  2ASP A;  4IDH A;  1QTM A;  2HHS A;  2GUI A;  3CCU N;  4YFU A;  1VQ7 N;  4H0X B;  1SKR A;  3DXK B;  4CJL A;  2G8W A;  4CJK A;  3NH0 A;  2O8E B;  4CFD A;  5F2R A;  4AHR A;  1BGX T;  3DWL A;  3G4S N;  1NGI A;  4B1Y B;  1D4X A;  1EKE A;  3WNE A;  3RWU A;  3G71 N;  3C6U A;  3L8B A;  1G15 A;  2VG5 A;  1A5X A;  5JS1 A;  4NCG A;  1ATR A;  2YNH A;  1EWR A;  4BDY A;  3PX6 A;  2YHA A;  4KO0 A;  1DEJ A;  2RPI A;  1KVC A;  5AZI A;  3P1G A;  2HBJ A;  2ZJP L;  4CZH A;  4I9Q A;  3SQ0 A;  3EY1 A;  3BY5 A;  5BRD A;  3CC7 N;  4I2Q A;  2P9P A;  1RTI A;  4CK3 A;  4B1W B;  2WOM A;  2D0O A;  1EO1 A;  5BN8 A;  4JN4 A;  2QA4 N;  3L2V A;  3D45 A;  2UYT A;  3FZF A;  2W41 A;  4FO0 A;  3ENO A;  4JLH A;  4DQI A;  1KAX A;  4FWM A;  4LF7 K;  5EX5 A;  1BUP A;  4OPH A;  1HKG A;  1RT6 A;  2NLX A;  2HF4 A;  1XWL A;  2V7Y A;  4KV8 A;  4BRI A;  2IS3 A;  2XY5 A;  2IAJ A;  4DR6 K;  2HNZ A;  4Z4H A;  3DRP A;  4OO1 J;  3BF1 A;  1W9H A;  1R59 O;  3HPO A;  2OPR A;  1YXQ A;  4FLU A;  2P1J A;  3RTV A;  4IJA A;  3ASM A;  4I2P A;  1IKW A;  1ZC6 A;  3NMU A;  1NGF A;  5J2P A;  1LV5 A;  3VQA A;  1KLN A;  3CM5 A;  4BRH A;  5AQY A;  1JCE A;  4DQP A;  5JVH L;  3NF7 A;  4CGF A;  3PSI A;  4ELV A;  4OLB A;  4HCB A;  2KLA A;  2QXL A;  1QVF M;  3FR0 A;  1WSE A;  1WBD A;  2QTD A;  5CYQ A;  3A5M C;  1QZ5 A;  4FW2 A;  4K43 A;  3UKU B;  2D1K A;  5C24 A;  1SKS A;  3HL8 A;  3OYA A;  3TAF A;  5AQU A;  4Z0U A;  3HO1 A;  1NK8 A;  4DTU A;  4CHQ A;  2YJF A;  1B92 A;  3D6R A;  2KFN A;  4C8L A;  3ID8 A;  1NK6 A;  4ID5 A;  3SPY A;  3QER A;  4O5F A;  3VGL A;  2F8T A;  1NKC A;  3NFA A;  3ENB A;  4MFB A;  3WQT A;  3OYM A;  1TKD A;  4O8U A;  3ZX3 A;  4RTF D;  3OS1 A;  4Z94 A;  4JS4 A;  3L4Q A;  3ZET B;  3I33 A;  4CEC A;  4YOV A;  2P9U A;  2NUB A;  1KD1 O;  4B9L A;  4TSX A;  3JS6 A;  2GWJ A;  1K73 O;  3B6P A;  3B6O A;  4CEZ A;  3DAW A;  3JAM O;  3DJC A;  1HRH A;  1ZBL A;  2BDP A;  1HYV A;  4CEE A;  3ZX2 A;  3PIP L;  4Z4G A;  4O4G A;  1D9F A;  4JD2 B;  4CD1 A;  1RT2 A;  3LDQ A;  3FFK B;  1IBM K;  3CQY A;  1RDA A;  3LDL A;  3I8B A;  1N6Q A;  1GOA A;  4IOC L;  4G9Z A;  4KRE A;  1RDC A;  2PAV A;  1C1A A;  1VQL N;  1RT3 A;  2GBZ A;  4DG1 A;  5EVZ A;  2YV0 X;  1SV5 A;  4MQ3 A;  1QSL A;  3OYC A;  2HHT A;  2P9S B;  3V1O A;  4W5Q A;  4F3T A;  4Y1D A;  2D4W A;  2YHB A;  3SPZ A;  2HF3 A;  1FW6 A;  5CR4 A;  4WFB L;  3VQ8 A;  1RT1 A;  3G6E N;  4CJF A;  3RMC A;  2UUC K;  2A41 A;  2E2O A;  1LWE A;  3SAG A;  3VEY A;  5BR9 A;  4FPB A;  1GLJ O;  1KAY A;  1TAQ A;  1Q9Y A;  3ZX0 A;  4ISF A;  3QEW A;  4CZK A;  4KPY A;  4M45 A;  5J2M A;  4FLY A;  4WFA L;  3SZ2 A;  4MLE A;  5ELZ A;  1KC8 O;  4O8K A;  1TK5 A;  4DV1 K;  4FJX A;  2BH1 A;  2BTF A;  3NVK A;  5FRN A;  1MDU B;  4ZTJ A;  1X9J A;  4JKH A;  4CGI A;  4FSV A;  5C2F A;  1LCU A;  3VGK A;  4IG0 A;  3OYJ A;  3TAM A;  3CJ9 A;  4Z4E A;  2YJE A;  2HBK A;  5HOO A;  1NK4 A;  3SYZ A;  4BY9 C;  4RWT A;  2IVN A;  1NMN A;  4CJ3 A;  2B4J A;  3CJ1 A;  1DTT A;  2ZGY A;  2OPS A;  3KD5 E;  2GWK A;  4WE1 A;  4RCH A;  2VG6 A;  1O13 A;  1U4B A;  3KLE A;  1U47 A;  3CET A;  4DQS A;  3QB0 A;  3KVG A;  4EZ6 A;  2Z1J A;  2D5R A;  4KH5 A;  4FWQ A;  3UB5 A;  2A3Z A;  4FJL A;  2FBV A;  1BQN A;  3D2F A;  3LM2 A;  3R1X A;  3VTI A;  4DR4 K;  4LF6 K;  3C0B A;  4CJ5 A;  3PV8 A;  4XH1 A;  2XY8 A;  4KHQ A;  3NAE A;  4DR1 K;  3T1A A;  3SQ4 A;  1FJG K;  5AQJ A;  4G1Q A;  3UIQ A;  4LF4 K;  3ZT4 A;  5AFU H;  4GMJ B;  2JWK A;  1XC9 A;  3DXK A;  5BN9 A;  1DGK N;  1TKZ A;  4H0T B;  3WUH A;  2P5G A;  3PLA A;  4DCH A;  4CFC A;  2BAN A;  4YDU A;  4AHC A;  4FK2 A;  2O8F A;  5LJV A;  3QIN A;  4BRF A;  3O1W A;  3T7Z A;  3T19 A;  4V19 S;  4IKF A;  3V9S A;  4HTL A;  4B9M A;  2FBT A;  3KKR A;  3RMD A;  5MLC Q;  3VEX A;  5JLH A;  4J2D A;  4C1N I;  1RCH A;  1FKP A;  3QLH A;  3P39 A;  3BDP A;  1CXU A;  3EZ5 A;  5CZ1 A;  1YJ9 N;  2QK9 A;  3DLB A;  2W6K A;  4A2A A;  4CZG A;  4R5P A;  2YNG A;  2QI2 A;  4DV2 K;  4FM2 A;  4BRG A;  1XMQ K;  1YJN N;  4BRO A;  3TWH A;  2IGI A;  5AQI A;  3V1R A;  4JS5 A;  4B1V A;  3OYG A;  1J5O A;  2ITG A;  1NJI O;  3AVA A;  4BGA A;  3CPW M;  3MCP A;  1K6Y A;  4UY8 O;  2JLE A;  4CI6 A;  1NMD A;  4DSF A;  3H46 O;  1JL1 A;  4CEA A;  1C6V A;  3CME N;  2R7Y A;  4KKO A;  4I6M B;  3I0R A;  4M7Y A;  2P9K B;  1KVA A;  1LWC A;  3EN9 A;  4FLV A;  4KI6 A;  4XH4 A;  1CLQ A;  3F73 A;  3TSP A;  4YY3 K;  4DWI A;  4DTJ A;  5HRR A;  1JXE A;  1KAZ A;  4N41 A;  4E19 A;  1TVR A;  4H5R A;  1RBT A;  1J6Z A;  1EWQ A;  3ZSX A;  4M41 A;  3IG1 A;  3HT3 A;  1NK7 A;  3O8M A;  3K9J A;  4DFM A;  1I3A A;  2HBL A;  3T1H K;  2VWK A;  2FSN A;  4H4M A;  1T05 A;  2G8K A;  2UXB K;  1WOQ A;  3LAK A;  1I94 K;  1RTJ A;  3D7E O;  1Q81 O;  3VEV A;  1KTQ A;  5AQR A;  2IDO A;  3DOK A;  1NK0 A;  5FPD A;  4FJN A;  4KRF A;  2CGL A;  2NRH A;  4LH4 A;  4AHT A;  3IDH A;  3KJV A;  4ILH A;  3KLH A;  2O8B B;  4LFC K;  3JYT A;  4M3U A;  3T69 A;  5FPE A;  3EYZ A;  4DU4 A;  4DU3 A;  1IBK K;  2E8A A;  3TAP A;  2X6N A;  4H5N A;  4CEF A;  4F4K A;  1BI4 A;  1GLL O;  3C7N B;  4JI0 K;  1NWK A;  4BC3 A;  3QET A;  4JI1 K;  3HOT A;  2Q3S A;  3O6W A;  3SQ2 A;  1CZ9 A;  1YT3 A;  3D2E B;  5AQV A;  3PX4 A;  4OJR A;  2KHO A;  4JI6 K;  5M1F A;  2QEX N;  3HM9 A;  2DFH A;  3OVN A;  1OVY A;  2GEM A;  4CHP A;  1P8Z A;  2LSN A;  1O1W A;  5KPT A;  2OZM A;  3SCX A;  2UXC K;  1NOY A;  4JKF A;  4E3S A;  1HX1 A;  4B3T K;  2H3G X;  3GL1 A;  3CCR N;  4DV4 K;  4AM7 A;  4DV3 K;  4CJ4 A;  2YHY A;  3ZT1 A;  2E2Q A;  4GW6 A;  4CJT A;  1TAU A;  4BRP A;  3J80 O;  5C25 A;  1WNS A;  3AO5 A;  1KQS M;  3S3M A;  1X9W A;  2ZJQ L;  4B9S A;  1HUX A;  2YHW A;  3QFU A;  2QWN A;  3WXM B;  1WAJ A;  2QWP A;  3CMA N;  4E7I A;  4FLT A;  3K5M A;  3L4I A;  1TUU A;  4BQZ A;  4FVU A;  1NKB A;  3AVN A;  3CC2 N;  3D2E A;  4B1U B;  1RBU A;  1YTA A;  4F2R A;  3DLE A;  4LH5 A;  3NVM A;  2G8I A;  1SL0 A;  3QEI A;  4PWD A;  3CM6 A;  5GIN A;  3MAQ A;  2QKB A;  1LAW A;  2ZD1 A;  3L2U A;  4IG3 A;  1SKW A;  3CCS N;  1C0G A;  2KFZ A;  4CHN A;  4F2S A;  3M8Q A;  4E7L A;  4IDK A;  4B9N A;  1NGD A;  1ASW A;  4JHD A;  4HUE A;  3K9K A;  2ETJ A;  1S72 N;  2I7N A;  1NOZ A;  4X64 K;  1WSJ A;  2OCE A;  2Q31 A;  4FWN A;  3LAL A;  1GLA G;  3R9P A;  1CXQ A;  1Q8I A;  2WON A;  3VQ7 A;  4E7H A;  4B1X B;  3O9U A;  4WQ4 A;  3TAG A;  2FF6 A;  1VQ4 N;  2ZM6 K;  5AZJ B;  2D0A A;  2E6L A;  4JI8 K;  4B3O A;  3UKR B;  5KQ8 A;  1RNH A;  4AIL C;  5T7B A;  3CG7 A;  4CZL A;  1C0T A;  1MU2 A;  3QDK A;  3MXM A;  3SI6 A;  1E3M A;  3HRG A;  4Q5V A;  3AA2 A;  3TAN A;  1ZBS A;  1P90 A;  1NJZ A;  4M3T A;  3R6M A;  3V4I A;  4BVP A;  3M8S A;  3OYL A;  5HL7 L;  3SBG A;  4GV6 A;  1K8K A;  3SQ1 A;  2AA4 A;  2V7Z A;  2AP1 A;  5KI6 A;  3EL2 A;  4NCA A;  3VN5 A;  2XO7 A;  1BQM A;  3N4P A;  2OPQ A;  1XUP O;  2X6S A;  3HSC A;  3CCJ N;  1SS6 A;  4CGD A;  1HYS A;  3IS9 A;  4C1N K;  3O3H A;  1T3V A;  4MDB A;  2JWL A;  3MK6 A;  3SJH A;  2Y1J A;  1EXQ A;  4NXN K;  4JI3 K;  4PQU A;  3VQ5 A;  5CHI A;  5JIC A;  1VQ6 N;  4EFH A;  1UOC A;  3NCI A;  3IFR A;  4BR4 A;  3O5B A;  3ZYY X;  3AVC A;  5H1S Q;  1HPZ A;  1BCM A;  1U6Z A;  1U2V A;  4LC9 B;  5ADX A;  1Z05 A;  3ALY A;  5J2Q A;  1ASU A;  3CJB A;  3H6E A;  1VSD A;  3CJ7 A;  3AO2 A;  3U3Y A;  2BGG A;  2O8F B;  3O3G A;  2HMP A;  3TAR A;  1T03 A;  3MXI A;  4B3R K;  3S41 A;  5HBM A;  4DV7 K;  5FPN A;  1KFS A;  3DYA A;  4CJU A;  3MXJ A;  3QIO A;  4IEE A;  4KHS A;  4F8R A;  4YDU C;  2E2P A;  3VES A;  2QM1 A;  3QIC A;  2RF2 A;  2WC9 A;  3PO4 A;  3VTH A;  5DM6 L;  3RRH A;  1GLD G;  3ZLJ A;  3MN6 A;  4CIF A;  2CH6 A;  3WEE A;  3L2Q A;  1H1V A;  1S1W A;  3AVF A;  3O4W A;  4Y0W A;  3DXM A;  4M3R A;  2QWL A;  3WXL A;  4CZJ A;  4AQY K;  3OY9 A;  4M3Z A;  3ZSY A;  2ITM A;  1IKV A;  2KZM A;  2IC3 A;  2NRX A;  3D2F B;  2PZS A;  4AF1 A;  1OH7 A;  1BI4 B;  3AO4 A;  1YIT N;  1RTH A;  3ULD A;  1XHX A;  3ZEU A;  3ZT2 A;  4Q0B A;  4BR9 A;  3I56 N;  1FK9 A;  4KTW A;  1LWF A;  2HHV A;  1JLE A;  2G8V A;  4IWV A;  4FWL A;  4JEP A;  5F0X A;  4FJ7 A;  3P5J A;  4C8K A;  2YHX A;  4CEQ A;  1WSF A;  3MN9 A;  4L8R B;  3HP9 A;  4JI7 K;  1QQN A;  4ICL A;  4AHS A;  4RW6 A;  1NJW A;  4CJR A;  1TYQ B;  3OYD A;  4R79 A;  1BIU A;  5AQO A;  3VQC A;  5E41 A;  1TKT A;  2EX3 A;  4KH4 A;  2XHB A;  3EKU A;  4BG9 A;  5C0Y A;  1T44 A;  3KWI A;  1WSH A;  2O8C B;  2VQE K;  5AQK A;  4PKI A;  3HK2 A;  1UA0 A;  1VRT A;  3G0Z A;  3ZCM A;  1E4F T;  3OYK A;  3QBX A;  1Q82 O;  1D9D A;  1RT7 A;  3H08 A;  4H4O A;  4JKC A;  1Y64 A;  1TK0 A;  1TV6 A;  2P9K A;  2P9L A;  4I6M A;  3AY9 A;  1V4S A;  3JSM A;  3C94 A;  3NF9 A;  2UUB K;  4HCC A;  1ITG A;  2OTL N;  2Q0U A;  1Q7Y O;  3RMA A;  2NRT A;  4MO4 A;  4BDZ A;  3MX5 A;  1JLB A;  2VGM A;  3GG4 A;  4JAX A;  3K5O A;  4DSK A;  3AAP A;  4EHT A;  2VG7 A;  3I0S A;  4B1Z A;  4FOE A;  5DMR A;  4CED A;  2PY5 A;  4GV9 A;  1BDG A;  4WFN L;  3K57 A;  1RDD A;  2EHG A;  4CJS A;  2HBM A;  4FM1 A;  3VQD A;  1HPM A;  5GIO A;  3BZK A;  3TPQ A;  5LL6 Z;  3CXC M;  2O4G A;  1C1C A;  1S1U A;  4BRC A;  4U67 L;  5I9E B;  3M3Z A;  2UU9 K;  5AQN A;  2YKM A;  5CE3 A;  4LF5 K;  4N5S A;  4CGJ A;  3H1Q A;  3AVB A;  1DT9 A;  4JRP A;  5HP1 A;  1YVN A;  2HNY A;  4Z4C A;  4YOX A;  4DTX A;  4NXM K;  2XRI A;  4JNE A;  4FLX A;  2HHX A;  4X65 K;  3T1Y K;  2PBD A;  3GOI A;  3JXU A;  3PO5 A;  4EZ9 A;  2O8D A;  4GVM A;  2DFF A;  1IBL K;  4M7X A;  1LW0 A;  4NYN A;  4LSL A;  2A42 A;  2FLO A;  5AQW A;  3B8A X;  4XEI A;  3MED A;  5LMU K;  2O4I A;  4FWO A;  1IKY A;  4A57 A;  3TAQ A;  5M1P A;  3DRR A;  1NM1 A;  1JXB A;  1YJW N;  3UKR A;  1X3M A;  3Q7B A;  3SLC A;  4FJM A;  3OBY A;  5AZJ A;  3QEP A;  4FLW A;  1JLG A;  3SUN A;  1VK0 A;  4KI4 A;  4PY5 A;  1XQS C;  5C42 A;  5BR8 K;  1GLF O;  4WF9 L;  4DS4 A;  3LPU A;  3VA0 A;  4OPA A;  2F96 A;  3ATV A;  1A5V A;  1Q18 A;  4KHN A;  2X74 A;  3CC4 N;  4L3Q A;  3E1Y A;  2KTQ A;  4BC2 A;  4OKK A;  4AM6 A;  4H5T A;  3N4Q A;  3AA3 A;  5A2Q O;  1RDU A;  3THV A;  2NRW A;  3RR7 A;  4IFY A;  5E26 A;  1F21 A;  1WLJ A;  2KQ2 A;  1LAV A;  3TAB A;  1U04 A;  2GEL A;  2HVI A;  4WQ5 A;  1XNR K;  3A2F A;  4DV6 K;  4WYB A;  3SMP A;  3MN5 A;  4PHT X;  1WBB A;  1BOT O;  2YNF A;  3ZEU B;  4KH6 A;  5E84 A;  5AQT A;  4DR5 K;  1GLE G;  4YOR A;  3OYE A;  1RBR A;  3U4L A;  3C6H A;  3L3U A;  3ZSQ A;  4CGH A;  4QS8 A;  3M1F A;  4FW1 A;  5ADX H;  5FDL A;  1SL2 A;  4YOT A;  2E6M A;  2J4R A;  1M1K O;  4A2B A;  1JL2 A;  4IFV A;  3KK3 A;  3CJA A;  4JKB A;  1IH7 A;  1X9S A;  4GKK K;  1ZXO A;  5GAD P;  3NGZ A;  1IG9 A;  4FJK A;  4BG8 A;  1ASV A;  4FM0 A;  4BC5 A;  3J7Z O;  4RG8 A;  4IFE A;  3EE9 A;  2ZGZ A;  2DFE A;  1L3U A;  4OGE A;  4I9L A;  3P4I A;  4X66 K;  3FFI A;  4MLH A;  4J2E A;  4OKJ A;  2Q0R A;  4PA1 A;  4DV0 K;  3LDS A;  3J8A A;  2GV9 A;  3L2W A;  2P9S A;  3VQP A;  4JI2 K;  3FZM A;  4BE2 A;  4CVN E;  3CFO A;  5J1E A;  2UXD K;  3K5L A;  3AVG A;  2CH5 A;  3FE1 A;  1WN7 A;  3D0P A;  4DR3 K;  5M1K A;  1VAZ A;  1NLV A;  1RGI A;  4DFK A;  3CCQ N;  4EP4 A;  4OX9 K;  4B3S K;  4ILJ A;  2BUP A;  1VSF A;  2QWQ A;  1E4G T;  3NF8 A;  4IOA L;  1D5A A;  1VQK N;  3S3O A;  2GUP A;  2NRR A;  4E1N A;  3K5N A;  3CCV N;  2FSK A;  5C10 A;  1VQ9 N;  4ISE A;  1T8E A;  3VGM A;  3KLF A;  4RW9 A;  1T6C A;  1Z6R A;  3CER A;  5KRS A;  5KPZ A;  4DF4 A;  4BR5 A;  5HRN A;  4W5R A;  3ITH A;  3DMJ A;  1B9D A;  1Z25 A;  4IBN A;  4FJH A;  3AVJ A;  3WNH A;  5FLX O;  1VSE A;  1L3V A;  3WNG A;  5J2N A;  1HQU A;  2HND A;  2CGK A;  1HNI A;  3VQQ A;  2NRZ A;  3U6F A;  3NDK A;  1S9E A;  1NGC A;  4DSE A;  1VSK A;  4FZZ A;  3O4N A;  4DFP A;  3KWG A;  2YNI A;  3OBW A;  1C0U A;  2HOE A;  3O08 A;  4W5T A;  3G10 A;  3BGR A;  3O9T A;  2F8S A;  4WQ5 C;  4IOX A;  4BDP A;  1WUA A;  2Q2R A;  1KXP A;  2D0P A;  3V81 A;  3MWP A;  1N33 K;  2NZT A;  4OGC A;  3AAR A;  4E0D A;  1C0F A;  1S9G A;  1QHT A;  4KFB A;  3VEN A;  5KPR A;  3HXM A;  2EWS A;  3VER A;  4FWS A;  3LDP A;  3C65 A;  2OA8 A;  3AVI A;  4WCE L;  2WTU A;  1LW2 A;  2JGU A;  3O9S A;  4DTP A;  2ZQB A;  4KHU A;  5SWM A;  3THX B;  4LF8 K;  4QCL A;  3LDN A;  1RFQ A;  4FL9 A;  2FSJ A;  4EP5 A;  4EHU A;  3THY A;  3VQ6 A;  1L5U A;  1ZBU A;  2FF3 B;  5AQP A;  2OPP A;  3NHG A;  1SUQ A;  1YF5 L;  1J54 A;  4NCB A;  4NO7 A;  1Y97 A;  4DTN A;  4DSJ A;  2KW4 A;  1GLC G;  1X3N A;  1KFD A;  3QML A;  4KHW A;  3FZK A;  1X9M A;  3LP1 A;  3TTC A;  3V9U A;  1HNV A;  5IT9 O;  4E89 A;  2P5O A;  2P9P B;  4PL7 A;  3OYN A;  2E2N A;  3MEE A;  3C6A A;  3H1V X;  1FKO A;  1V4T A;  1QQM A;  2W6L A;  3TTD A;  3AGK A;  4F3O A;  4M42 A;  1DKG D;  4CFA A;  4JI5 K;  2E1Y A;  1RTD A;  4CBX A;  1QHA A;  1JLC A;  3THW B;  1T7P A;  1JKH A;  2YI1 A;  1R0A A;  1VQN N;  1QS4 A;  4ID1 A;  3I8D A;  4HUF A;  2VWJ A;  1HNX K;  4OLA A; 
#chains in the Genus database with same CATH homology
 2X78 A;  2I5J A;  1UA1 A;  4CHZ A;  3RRH A;  4B9U A;  1TAQ A;  4OKE A;  4FLZ A;  4C8N A;  4CIF A;  1Q9Y A;  2ZE2 A;  3QIP A;  3QEW A;  4KPY A;  4DQR A;  4M45 A;  3L2Q A;  4J2B A;  1S1W A;  3AVF A;  4AHU A;  5J2M A;  1KSP A;  4FLY A;  3ZSZ A;  3HPG A;  4FK0 A;  3SZ2 A;  4DSI A;  4O0I A;  4CER A;  4M3R A;  3TAE A;  1TK5 A;  3NBP A;  3OY9 A;  4M3Z A;  3ZSY A;  1IKV A;  2KZM A;  2IC3 A;  4FJX A;  4UQG A;  4CES A;  5FRN A;  2PZS A;  5KTQ A;  4ZTJ A;  2QKK A;  4CGI A;  1BI4 B;  3AO4 A;  3TI0 A;  1TKX A;  3S3N A;  1RTH A;  1KCF A;  4QAG A;  3LWL A;  4N76 A;  3ULD A;  3NH2 A;  1XHX A;  3SUQ A;  4IG0 A;  1HQE A;  3OYJ A;  3TAM A;  3ZT2 A;  4Q0B A;  1FK9 A;  4RW8 A;  3SJJ A;  4Z4E A;  4KTW A;  1LWF A;  2HHV A;  1RBS A;  1JLE A;  1Z26 A;  4DTR A;  4FJ5 A;  4CHO A;  3DLR A;  2G8V A;  2QKB A;  2FBY A;  1NK4 A;  5CYM A;  3SYZ A;  3T3F A;  3AVH A;  4FJ7 A;  3P5J A;  4HUG A;  4C8K A;  4CJ3 A;  4CEQ A;  2B4J A;  4PUO A;  1WSF A;  3AVM A;  1DTT A;  5HRP A;  4L8R B;  1BIZ A;  1L3T A;  3HP9 A;  2OPS A;  4ICL A;  4AHS A;  3KD5 E;  3AA5 X;  4RW6 A;  1NJW A;  4WE1 A;  4ELU A;  4CJR A;  4FJ9 A;  2VG6 A;  3OYD A;  1U4B A;  5FRO A;  3KLE A;  4FYD A;  1WSI A;  3CFR A;  1U47 A;  3ZT0 A;  1BIU A;  4NYF A;  3NGI A;  4DQS A;  3VQC A;  5E41 A;  4OVL A;  1TKT A;  2EX3 A;  2Z1J A;  2XHB A;  3LZI A;  1EX4 A;  4EZ6 A;  2Z1H A;  1VSH A;  2D5R A;  3HJF A;  1WSH A;  4FJL A;  3RRG A;  2FBV A;  4HTU A;  1BQN A;  4LY7 A;  4DTS A;  4K8Z A;  4KTQ A;  4CF1 A;  2PYL A;  3NE6 A;  3QO9 A;  3HK2 A;  1UA0 A;  3VA3 A;  1VRT A;  2A1R A;  1VSI A;  3VQE A;  4DSL A;  3G0Z A;  4CJ5 A;  3ZCM A;  3PV8 A;  3OYK A;  1J9A A;  2XY8 A;  1D9D A;  1RT7 A;  3H08 A;  4FJI A;  4KHQ A;  3NAE A;  1KVB A;  3T1A A;  4H4O A;  3SQ4 A;  3CFP A;  1WSG A;  3RMB A;  3AO3 A;  1CZB A;  4HVJ A;  4G1Q A;  1TK0 A;  1TV6 A;  3HVR A;  2HHQ A;  5HRS A;  3UIQ A;  4CF9 A;  3ZT4 A;  4GMJ B;  4N56 A;  4DFJ A;  3JSM A;  3C94 A;  3MEG A;  3NF9 A;  4HCC A;  1ITG A;  1XC9 A;  3RMA A;  3PX0 A;  1B9F A;  4BDZ A;  1U45 A;  3E01 A;  1TKZ A;  1NK9 A;  2P5G A;  4BE1 A;  2ATQ A;  3SV4 A;  4CFC A;  1JLB A;  2BAN A;  4AHC A;  3KK2 A;  4FK2 A;  1ZBH A;  3K5O A;  3KK1 A;  3AO1 A;  4DSK A;  3QIN A;  4CIG A;  2VG7 A;  4M3X A;  3I0S A;  4CED A;  4B8A B;  5DMR A;  2PY5 A;  2QXF A;  1S6P A;  1S5J A;  3IRX A;  3T19 A;  4CK1 A;  4IKF A;  4CEB A;  3OS2 A;  3V9S A;  3K57 A;  1RDD A;  1X1P A;  4B9M A;  2EHG A;  2FBT A;  4CJS A;  3OYH A;  2P51 A;  3KKR A;  3RMD A;  4FXD A;  4FM1 A;  3VQD A;  5I42 A;  3KLG A;  1DTQ A;  4J2D A;  3DOL A;  2RN2 A;  1RCH A;  1TL3 A;  2HHW A;  4BWM A;  2O4G A;  1FKP A;  3DRS A;  4RW4 A;  4B9T A;  4E7J A;  1WAF A;  1C1C A;  1S1U A;  3QLH A;  1QQC A;  1CXU A;  3BDP A;  1HMV A;  3EZ5 A;  2D0B A;  4CE9 A;  3NH1 A;  1DLO A;  1NJX A;  5CZ1 A;  4CJP A;  2QK9 A;  3DLB A;  2YKM A;  4R5P A;  2YNG A;  3K58 A;  4N5S A;  4CGJ A;  1ZYQ A;  3ZSV A;  4FM2 A;  3AVB A;  3SV3 A;  3AA4 A;  1RBV A;  4JRP A;  3V9X A;  5HP1 A;  2HW3 A;  2HNY A;  1GOB A;  3QNN A;  4Z4C A;  2IGI A;  2BE2 A;  5DK5 A;  3TWH A;  3V1R A;  4JS5 A;  3OYG A;  4DTX A;  1J5O A;  2G8F A;  4Z4F A;  2ITG A;  1TK8 A;  2XRI A;  3AVA A;  3NGY A;  4FLX A;  2HHX A;  3DLH A;  4QOZ B;  2HB5 A;  1K6Y A;  1BIS A;  2JLE A;  1U49 A;  4KTZ A;  3WNF A;  4OPJ A;  4DSF A;  3PO5 A;  4EZ9 A;  1JL1 A;  1JLA A;  2DFF A;  4GVM A;  4CEA A;  3LAM A;  1C6V A;  1LW0 A;  4NYN A;  3OYI A;  3K2P A;  4LSL A;  3LP3 A;  1IKX A;  4O55 A;  2R7Y A;  1QSS A;  3MED A;  4KKO A;  3LAN A;  2KZZ A;  4FK4 A;  2O4I A;  4C8M A;  4HHT A;  1TGO A;  3I0R A;  4I7F A;  1KVA A;  1LWC A;  1IKY A;  4FLV A;  3VQ9 A;  4KI6 A;  3O4Q A;  4DF8 A;  3S9H A;  1RDB A;  4B08 A;  5JS2 A;  1YVU A;  3AV9 A;  3TAQ A;  1CLQ A;  3F73 A;  3CQ8 A;  3DRR A;  3PY8 A;  4DWI A;  1KLM A;  1JXB A;  4N47 A;  4DTJ A;  3F9K A;  5HRR A;  1JXE A;  2Z1I A;  3NF6 A;  3QEX A;  4N41 A;  4KB1 A;  3LPT A;  4E19 A;  2OYQ A;  1TVR A;  4DS5 A;  3ZSO A;  1D8Y A;  5D3G A;  1RBT A;  4FJM A;  5HLF A;  1S1V A;  1BL3 A;  3ZSX A;  3V6D A;  4M41 A;  3QEP A;  4FLW A;  3IG1 A;  3HT3 A;  2RKI A;  1JLG A;  3PUF A;  1VK0 A;  3HST B;  4CJW A;  3QEV A;  2XY7 A;  3M8P A;  3K59 A;  1FXX A;  3SUN A;  4M3W A;  4DFM A;  4KI4 A;  4PY5 A;  1I3A A;  1NK5 A;  5C42 A;  4E7K A;  4AH9 A;  4KB0 A;  4DS4 A;  2VWK A;  3LPU A;  3HYF A;  4H4M A;  1T05 A;  2A1S A;  4FCY A;  3VA0 A;  4O0J A;  1ZBI A;  1EP4 A;  2F96 A;  3OS0 A;  4CF0 A;  1UAX A;  1A5V A;  2G8K A;  1QE1 A;  2X74 A;  4KHN A;  3KIO A;  3C6T A;  3LAK A;  3KD1 E;  1RTJ A;  3AVK A;  2KTQ A;  4DLE A;  5HRO A;  1W0H A;  1KTQ A;  4OKK A;  4CEO A;  1HJR A;  2DY4 A;  1C1B A;  3AA3 A;  1TL1 A;  2IDO A;  3DOK A;  1NK0 A;  5FRM A;  1REV A;  1Q9X A;  3TR8 A;  3THV A;  3RR7 A;  3LWM A;  4FJN A;  4KRF A;  3CYM A;  1VRU A;  3DI6 A;  4FJJ A;  2FC0 A;  4IFY A;  3AVL A;  1F21 A;  4LH4 A;  1WLJ A;  1RIL A;  2KQ2 A;  4AHT A;  1LAV A;  3TAB A;  1U04 A;  3KJV A;  3ZSR A;  3KLH A;  2HVI A;  3JYT A;  4M3U A;  1HYZ A;  3A2F A;  3EYZ A;  3P83 D;  4DU1 A;  4DU4 A;  4DU3 A;  2XY6 A;  4KAZ A;  5EU7 A;  3DLG A;  3ZT3 A;  4FJH A;  2HHU A;  1BCO A;  2YNF A;  2Z1G A;  2X6N A;  3TAP A;  1NKE A;  3V9Z A;  3IAY A;  4BAC A;  4CEF A;  1U48 A;  1QTM A;  2HHS A;  2GUI A;  4F4K A;  1BI4 A;  2HMI A;  4YFU A;  3QET A;  1XI1 A;  2G8U A;  3SQ2 A;  2Q3S A;  1SKR A;  1S6Q A;  1CZ9 A;  4CJL A;  2G8W A;  1YT3 A;  3OYE A;  4CJK A;  4BE0 A;  3NH0 A;  1RBR A;  3KLI A;  4CFD A;  3L3U A;  3L3V A;  4AHR A;  3PX4 A;  3ZSQ A;  1NK7 A;  1BGX T;  4CGH A;  4OJR A;  4YNQ A;  4FW1 A;  4H8K A;  5FDL A;  2FBX A;  3WNE A;  1EKE A;  2DFH A;  3LP0 A;  3OVN A;  3HM9 A;  4DQQ A;  1SL2 A;  2E6M A;  1KRP A;  3RWU A;  3O3F A;  4DTM A;  5SZT A;  3C6U A;  1JL2 A;  4IFV A;  4CHY A;  1G15 A;  2VG5 A;  3KK3 A;  4CHP A;  3L8B A;  1A5X A;  3OYB A;  4B9V A;  5JS1 A;  1IH7 A;  1X9S A;  2LSN A;  1O1W A;  4NCG A;  3NGZ A;  2OZM A;  3SCX A;  1C0M A;  2YNH A;  1IG9 A;  1NOY A;  1RT5 A;  4FJK A;  1ASV A;  4FM0 A;  4E3S A;  4BDY A;  3PX6 A;  4RG8 A;  2YHA A;  4KO0 A;  2DFE A;  1L3U A;  2PYJ A;  4OGE A;  4CF8 A;  4I9L A;  2RPI A;  1KVC A;  3FFI A;  2D0C A;  4J2E A;  4OKJ A;  4CJ4 A;  2AJQ A;  3P1G A;  4PA1 A;  3ZT1 A;  3LDS A;  4GW6 A;  4CJT A;  1TAU A;  2GV9 A;  3L2W A;  4CJE A;  3VQP A;  1VSL A;  3KTQ A;  5C25 A;  4I9Q A;  4BE2 A;  3M8R A;  3SQ0 A;  3CFO A;  1WNS A;  3AO5 A;  5J1E A;  3EY1 A;  5K14 A;  3S3M A;  3K5L A;  3QNO A;  3AVG A;  1X9W A;  4I2Q A;  4B9S A;  1WN7 A;  1RTI A;  4CK3 A;  3D0P A;  2WOM A;  4ZHR A;  1WAJ A;  2W42 A;  2OZS A;  4E7I A;  4O44 A;  3L2V A;  4FLT A;  2Y1I A;  4LSN A;  3K5M A;  4DFK A;  3D45 A;  1BHL A;  1NKB A;  3AVN A;  4EP4 A;  3DM2 A;  4JLH A;  3HPH A;  4DQI A;  3VQ4 A;  1RBU A;  1UWB A;  1VSF A;  3NF8 A;  1YTA A;  1D5A A;  4F2R A;  1N5Y A;  3S3O A;  3DLE A;  1RT6 A;  4E1N A;  4DLG A;  4LH5 A;  3K5N A;  3ZSW A;  2G8I A;  1XWL A;  1SL0 A;  3QEI A;  4PWD A;  4LD0 A;  4KV8 A;  3CM6 A;  2IS3 A;  3MAQ A;  3RR8 A;  2XY5 A;  2E4L A;  2IAJ A;  4KHY A;  1LAW A;  2ZD1 A;  2HNZ A;  2B6A A;  1T8E A;  3L2U A;  4Z4H A;  3KLF A;  1YTU A;  1EET A;  4IG3 A;  4RW9 A;  1SKW A;  3MEC A;  3DRP A;  4CK2 A;  3SNN A;  4B8C A;  5CZ2 A;  1W9H A;  5KRS A;  2KFZ A;  3HVT A;  4CHN A;  4DF4 A;  4F2S A;  5HRN A;  3M8Q A;  4W5R A;  3HPO A;  2OPR A;  3ITH A;  4FLU A;  3DMJ A;  1B9D A;  1Z25 A;  2P1J A;  1IO2 A;  3ASM A;  4IBN A;  4IDK A;  3RTV A;  3AVJ A;  3WNH A;  4E7L A;  4I2P A;  4B9N A;  1IKW A;  1J53 A;  1VSE A;  1ASW A;  4E1M A;  4HUE A;  3VQA A;  5J2P A;  1LV5 A;  4JRQ A;  1KLN A;  1L3V A;  3WNG A;  2ETJ A;  3CM5 A;  4FVM A;  1JLQ A;  5J2N A;  1HQU A;  1NOZ A;  4DTO A;  1SL1 A;  1WSJ A;  2HND A;  1XHZ A;  4DQP A;  1HNI A;  3VQQ A;  4CJQ A;  3NF7 A;  4CGF A;  3LAL A;  3LZJ A;  3U6F A;  1S1T A;  4M3Y A;  4ELV A;  3NDK A;  4OLB A;  1S9E A;  1CXQ A;  1Q8I A;  2WON A;  3VQ7 A;  4HCB A;  4E7H A;  4DSE A;  4C8O A;  1VSK A;  1VSJ A;  3O4N A;  1WSE A;  1I39 A;  4Y1C A;  4DFP A;  3TAG A;  4FZZ A;  3V9W A;  2YNI A;  5CYQ A;  4Z4I A;  2HVH A;  1C0U A;  2D0A A;  2E6L A;  4W5T A;  4FW2 A;  3G10 A;  3BGR A;  2F8S A;  4B3O A;  4BDP A;  1RNH A;  5C24 A;  4FJ8 A;  1SKS A;  3HL8 A;  4AIL C;  3OYA A;  3TAF A;  5T7B A;  4Z0U A;  3HO1 A;  1NJY A;  3CG7 A;  1NK8 A;  4DTU A;  1C0T A;  1MU2 A;  4CHQ A;  3V81 A;  3DLK A;  5CY4 A;  3LP2 A;  1B92 A;  2KFN A;  4CF2 A;  3MXM A;  3PO4 A;  4OGC A;  4C8L A;  4CCH A;  3SI6 A;  1QSY A;  4XIU A;  1NK6 A;  4K8X A;  4Q5V A;  3AA2 A;  4ID5 A;  3SUO A;  3SPY A;  1S1X A;  3QER A;  3SUP A;  4O5B A;  3TAN A;  4OPK A;  2F8T A;  4E0D A;  4FZY A;  1NKC A;  1S9G A;  2DTU A;  1QHT A;  3NFA A;  4KFB A;  4MFB A;  3HXM A;  1NJZ A;  4W5N A;  1VSM A;  4M3T A;  3OYM A;  3V4I A;  3M8S A;  1TKD A;  3OYL A;  4DMN A;  2OA8 A;  2IOC A;  3AVI A;  3OS1 A;  4FZX C;  1LW2 A;  2JGU A;  4JS4 A;  3OYF A;  4DTP A;  2ZQB A;  3SQ1 A;  5SWM A;  1L3S A;  4CEC A;  4KHU A;  4QCL A;  2NUB A;  4B9L A;  5KI6 A;  4TSX A;  4NCA A;  3L2R A;  3VN5 A;  2XO7 A;  1BQM A;  2OPQ A;  4EP5 A;  3KKS A;  4AHV A;  3VQ6 A;  2X6S A;  3B6P A;  3B6O A;  4CEZ A;  1L5U A;  1ZBU A;  3ISN C;  4CGD A;  1HYS A;  3IS9 A;  2B5J A;  1HRH A;  2YKN A;  2OPP A;  3NHG A;  1SUQ A;  1ZBL A;  1HYV A;  4CEE A;  2BDP A;  1J54 A;  4RW7 A;  2G8H A;  4NCB A;  3O3H A;  1GOC A;  4Z4G A;  1Y97 A;  5KGW A;  4CIE A;  4O4G A;  4DTN A;  4CFB A;  1D9F A;  2Y1J A;  2KW4 A;  4DSJ A;  1KFD A;  5I3U A;  1EXQ A;  1RT2 A;  4KHW A;  1X9M A;  3LP1 A;  4PQU A;  1RDA A;  3V9U A;  3VQ5 A;  1HNV A;  3C95 A;  3OJS A;  1N6Q A;  4E89 A;  1GOA A;  1UOC A;  3NCI A;  4ELT A;  4KRE A;  1RDC A;  2P5O A;  1C1A A;  3AVC A;  3V1Q A;  1RT3 A;  2GBZ A;  4DG1 A;  1HPZ A;  2YV0 X;  1BCM A;  3OYN A;  3QES A;  1SV5 A;  4MQ3 A;  3ALY A;  1JLF A;  1QSL A;  4J2A A;  3OYC A;  2HHT A;  5J2Q A;  1ASU A;  1ZBF A;  3V1O A;  3MEE A;  5KGX A;  4W5Q A;  4F3T A;  1FKO A;  4Y1D A;  4BWJ A;  4CGG A;  1VSD A;  4FJG A;  1RT4 A;  3AO2 A;  3U3Y A;  2BGG A;  3HP6 A;  2YHB A;  4F3O A;  3SPZ A;  3O3G A;  4M42 A;  3TAR A;  4CFA A;  1T03 A;  3MXI A;  1RTD A;  5HBM A;  1KFS A;  5KRT A;  3DYA A;  3U3G A;  3VQ8 A;  3VQB A;  3MXJ A;  1JLC A;  4CJU A;  1RT1 A;  3QIO A;  4W5O A;  1T7P A;  4KHS A;  4F8R A;  4CJF A;  3RMC A;  1JKH A;  1A5W A;  3OJU A;  4ZTF A;  1R0A A;  1QS4 A;  1LWE A;  2RF2 A;  4ID1 A;  4CJV A;  3I8D A;  4HUF A;  2VWJ A;  4OLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...