4IBNA

Crystal structure of lc9-rnase h1, a type 1 rnase h with the type 2 active-site motif
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
SDIPTPLVAVYADESCLGNGREGENPGGAGVLVEYARPGGAGDIVRRDVWVSEPATTNNRMALRSVIEAFRAIGHKGTRFRVVFTTDSRYIVDGMTRWVHDWAQRGWKRKSGAIENLALWQEAVQAVNGHAVEWRWVRGHAGHAQNEYANHLAVTAAGGQTQSGGLVDSGYEEWAARVSTAASRMRLEPFPDAAAFRPSPALPVVAAGRPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease H
publication title Crystal structure of metagenome-derived LC9-RNase H1 with atypical DEDN active site motif
pubmed doi rcsb
source organism Uncultured organism
molecule tags Hydrolase
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2012-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ibnA01
3VQ5A 3SV4A 1ZBUA 2DFHA 2RKIA 1NK5A 5EU7A 1S6PA 4M3WA 3TAFA 4DF8A 1RBTA 5CY4A 2Z1JA 4KHYA 3AO4A 4AHRA 3O3HA 3SUNA 4GVMA 1T8EA 1LAWA 3OYGA 3AVLA 3SPZA 1D9DA 1W9HA 4CGGA 3SQ0A 3ITHA 3HK2A 1IKVA 3ZSXA 5J2MA 2Q3SA 4E7IA 4OKJA 4B3OA 4HCBA 4AH9A 4OVLA 2G8VA 1TKTA 4CJWA 2GBZA 4CJ3A 3HM9A 1XI1A 1BL3A 3T1AA 4FK2A 1C1CA 1A5XA 2GUIA 4CK3A 1C6VA 1QHTA 3DYAA 1S9EA 3AVHA 4KKOA 1S6QA 4CJ5A 1TKXA 4CIGA 5SZTA 3NHGA 4H4OA 1TAUA 3DI6A 3SQ4A 4KREA 2RF2A 4B08A 4B9VA 4Q5VA 1I39A 3ULDA 3HL8A 5CZ2A 1KVBA 4FJLA 1T05A 4CJEA 2Y1JA 3KD5E 3LP2A 3VQ8A 5C25A 4E7HA 5SWMA 3TAMA 3QEPA 3V81A 1QSYA 3ZSYA 3V1OA 2Z1IA 2JGUA 3RTVA 1Z26A 3PV8A 2G8FA 4ELVA 4EP4A 1HNIA 2YNGA 4BWMA 1NK7A 3L3VA 1A5WA 3DRSA 4IG0A 1SKSA 2DY4A 3SPYA 1BI4A 3PX4A 2HHXA 1U04A 4B9MA 3AVFA 2QXFA 1RDDA 1J5OA 2YKNA 4B9UA 4Z4EA 1YTAA 4CEAA 4E1NA 3NE6A 3TWHA 2R7YA 4AHTA 3THVA 1UA1A 3AV9A 1SKRA 4M3ZA 3HT3A 4Z4GA 4ZHRA 3K59A 4FZXC 4MFBA 3OYBA 3KKSA 4CF8A 4J2EA 3VQDA 3NGYA 4F3TA 1JLFA 3NH1A 3OYMA 5J2NA 3CG7A 2X6SA 1I3AA 2DTUA 3D45A 3C95A 3QEVA 4N41A 4EZ6A 3LWMA 4FVMA 3CM5A 5C24A 3L2VA 1WSGA 5J2QA 1LW2A 2Z1GA 4DQPA 4FJKA 4FZZA 3AO1A 3RRGA 4CJKA 1C0MA 4KHSA 4B8CA 4OGCA 4RW9A 4CJTA 3CFRA 4CHPA 1U47A 2XRIA 3NF7A 3NDKA 1WSJA 1S1TA 4R5PA 3V9XA 3ISNC 5DMRA 1N5YA 4KAZA 3ZSRA 2ATQA 4CGDA 1A5VA 4M3YA 3HJFA 5JS1A 1D8YA 4Z4IA 2HW3A 3CYMA 2HHQA 1NKCA 1LWFA 1EKEA 1CZ9A 3KKRA 1NJYA 3OJUA 4KHNA 3V4IA 4DQSA 2PY5A 2OPQA 1GOBA 4BWJA 3QERA 5HLFA 4FLVA 4DTRA 4W5OA 4Z4FA 1RBRA 2HHTA 4IDKA 3KK1A 1NOYA 4FJMA 1JXEA 4KPYA 3AVBA 4CEQA 1ZBLA 4CJQA 3MECA 3G10A 4F3OA 4CHQA 3QEIA 2GV9A 3MXMA 2W42A 3C94A 1J53A 4ID5A 4C8NA 3LP3A 4YNQA 3KLEA 4ELTA 4FLWA 4DU4A 4AILC 1VRTA 1DTTA 2IDOA 3ZSQA 1CLQA 3VQEA 4ICLA 3ZT4A 2ZD1A 3OS1A 3T3FA 3O3GA 4IG3A 1LV5A 1ZBFA 3I0SA 4IFYA 4N5SA 1WSFA 3ZSVA 3L2UA 4JRPA 2X74A 1QTMA 3QINA 1B9FA 1XWLA 4KO0A 1HNVA 4FK0A 1TKDA 2HVHA 3LZJA 4H4MA 1LWEA 3K5LA 4N76A 1JLCA 3O4NA 2XY8A 3K5NA 1KVAA 1S1UA 4CJLA 1JL1A 2IC3A 1UWBA 4OGEA 1SL1A 3ZSWA 3VQ7A 3I8DA 1KLNA 3U6FA 4NYFA 3NF8A 1KVCA 4B9NA 2KQ2A 4O5BA 5KGWA 4C8OA 5J1EA 2P5OA 1JLQA 4CF2A 4ZTFA 2D0BA 4DU1A 4Q0BA 1RDAA 1C1AA 2P51A 3AVMA 5HRSA 3IAYA 4YFUA 4CJUA 4FJNA 2HHUA 5J2PA 1ASVA 4B9SA 4LSLA 3L2WA 4PY5A 1UOCA 2HHSA 1VSHA 2IGIA 3IG1A 3QNNA 3SUOA 1D5AA 2LSNA 4QAGA 3ZSOA 4AHVA 4LH5A 1B92A 1IKYA 1ZBIA 3WNEA 4HCCA 1NJZA 4IKFA 3TABA 4CHNA 3NF9A 3AVCA 3P83D 3OYCA 3U3YA 3QESA 3RMBA 4CCHA 1LAVA 3VN5A 4CECA 4W5RA 4CF1A 4FW1A 3VQ4A 3ZT0A 3PX6A 2XY7A 1KSPA 3SNNA 3VQAA 3M8QA 4CEFA 1NJWA 1U49A 4O0JA 3H08A 4UQGA 1B9DA 1TAQA 4OJRA 4CF9A 2Z1HA 3EYZA 3VQCA 3TI0A 2RN2A 4CFCA 4HUGA 4FJIA 5FRNA 3LPUA 4F8RA 4KHWA 5FDLA 3CFOA 3VQBA 4CFBA 3QEXA 4DTOA 4L8RB 1KRPA 1RILA 4OPKA 3MEDA 5E41A 2ZQBA 1T03A 1U4BA 2KW4A 3K57A 1HYZA 1KFSA 4H8KA 3OY9A 1F21A 2HNYA 3DLBA 4CE9A 4FJHA 4E89A 2QK9A 1CZBA 4JS5A 3V9UA 4M3UA 1K6YA 2E4LA 1JLGA 1NK0A 2HMIA 3V6DA 4FJXA 4CK1A 5HBMA 1EETA 2XY6A 3PY8A 5FRMA 2PYJA 4HHTA 1Q9YA 2ZE2A 3V1RA 4DLGA 1U48A 4B8AB 4E1MA 4FLUA 3HP6A 3PX0A 3ASMA 3MAQA 1BI4B 1XHZA 1Y97A 2F96A 3LZIA 4FLYA 1ZBHA 3V9ZA 1WLJA 1SL2A 2VG6A 4K8ZA 4CK2A 3RMDA 4W5TA 3QNOA 3SZ2A 4DTXA 4FJ8A 3AVKA 4Z4HA 3SV3A 4DF4A 4TSXA 1QSSA 2YHBA 3P5JA 4FK4A 4N56A 1T7PA 2PZSA 4EZ9A 2KFZA 1U45A 2EHGA 2YNIA 3V9WA 4ID1A 2VWJA 4FLZA 2BANA 3UIQA 3DLRA 2FBXA 4N47A 3K5MA 1VSDA 3LANA 2FC0A 4CERA 5CYMA 1EP4A 2A1SA 1XC9A 3G0ZA 4DQRA 3K58A 3RR8A 2YNHA 1ASWA 3VA0A 3LP0A 4AHSA 3WNHA 3OYNA 1L3SA 1RDCA 3LWLA 4FM0A 3AVNA 4FM1A 1W0HA 3TANA 1TK0A 4FCYA 4BE0A 1IKXA 1BISA 5HROA 4CJVA 1QQCA 3DLGA 4IBNA 3ZT3A 4F2RA 1DTQA 5I3UA 3TR8A 4IFVA 3KLFA 3NAEA 3S3OA 3CM6A 4B9TA 1QS4A 2Y1IA 5KRSA 3SYZA 4FJ7A 2KZMA 4M3TA 1JLEA 4BACA 1WSHA 4I9LA 4FLTA 2HNDA 1VSMA 3AO5A 3BDPA 1YT3A 2OZSA 1RT1A 2KFNA 3WNFA 4MQ3A 1IO2A 3QIPA 4O4GA 1TKZA 4FJ9A 4FLXA 2DFEA 4DSJA 3V1QA 3ZCMA 3DLHA 4DSIA 3HXMA 3TAGA 4NYNA 4RW7A 3SI6A 1WN7A 3T19A 3LALA 3L2RA 4FZYA 1HRHA 4JRQA 4DU3A 1G15A 4CF0A 2P1JA 4BDZA 1UA0A 3HPHA 5C42A 4DFJA 4EP5A 4DFKA 3KTQA 2XHBA 4HVJA 4NCBA 4KTQA 4PQUA 1BHLA 1RT5A 3CFPA 4G1QA 4KI6A 4CJ4A 5HP1A 4JS4A 1NK6A 1N6QA 3A2FA 3OYEA 4HTUA 4CJRA 1RTDA 4DQIA 5K14A 3NGZA 3LP1A 2X78A 4QOZB 4KRFA 2OYQA 4O0IA 4HUFA 4BDPA 1VSKA 1HQUA 1HPZA 1HYVA 3JYTA 2BDPA 3DLKA 3NFAA 3O3FA 1BCMA 3QO9A 4FJGA 3AA4A 3ZT2A 1X9MA 4RW4A 3SUPA 1TK5A 4FXDA 2FBYA 3OVNA 3PUFA 5DK5A 4ELUA 3ALYA 2XO7A 2WONA 3OS0A 4CEDA 1J54A 4DSEA 2OA8A 1YVUA 3C6UA 3AO3A 4KB0A 3LDSA 1BIUA 1HYSA 1RCHA 3IRXA 4CGFA 3DLEA 4RW6A 2HB5A 2YKMA 3F9KA 1RTJA 1TL3A 5HRPA 4CFDA 4Z0UA 4DS5A 4DMNA 4KHQA 2QKKA 5KTQA 1QSLA 4FJ5A 2D0AA 3OJSA 1FXXA 3VQ9A 4OLAA 1EXQA 4I2QA 4DTNA 1S9GA 4DWIA 1S1WA 1S1XA 1C0UA 3VQ6A 1WSEA 4CGJA 4CGIA 2O4GA 1NJXA 4CIFA 4W5NA 1BGXT 3B6PA 1VRUA 4KTZA 4C8KA 3DRRA 1IG9A 1BCOA 3K2PA 2IS3A 4E0DA 3OYHA 1NK8A 4DS4A 1KTQA 2F8SA 3HVTA 3DMJA 1JLAA 4DLEA 3DM2A 4DTPA 3RMAA 4ZTJA 4M3XA 3NGIA 3MXIA 2OPPA 3TAPA 1NK4A 4PWDA 3SQ2A 3JSMA 1X9SA 1JL2A 1IH7A 2I5JA 3K5OA 1L5UA 4FW2A 4E7LA 1S5JA 3SUQA 4E7KA 1REVA 5D3GA 1KCFA 4KFBA 2RPIA 1BQNA 1S1VA 2XY5A 2E6LA 1O1WA 4CFAA 3L8BA 4PA1A 4O55A 2B4JA 3S3NA 4DSLA 1BIZA 5CYQA 4I9QA 1J9AA 4LH4A 4PUOA 1NKEA 1RTHA 1BQMA 1WSIA 1NK9A 3TAQA 1VK0A 1TVRA 1SL0A 4I2PA 4AHCA 1RBVA 1Q8IA 3B6OA 2HVIA 1NOZA 3MEEA 1RNHA 1YTUA 4W5QA 4JLHA 4DQQA 3U3GA 4CEOA 2BGGA 4C8MA 5CZ1A 3HSTB 4CHZA 4FM2A 4RW8A 2ITGA 3VA3A 3QETA 4FJJA 2HHVA 1HJRA 3KLHA 1RBUA 4KHUA 2G8IA 2F8TA 3TAEA 1JKHA 3QIOA 4DSKA 2D0CA 1KLMA 3LAKA 4CEBA 2AJQA 3AVIA 2KZZA 1RT7A 3AA2A 3L2QA 2P5GA 3RRHA 4C8LA 1ITGA 1KFDA 5FROA 4J2BA 1EX4A 4J2DA 4OLBA 3AO2A 1C1BA 4DTJA 5HRRA 2B6AA 1TGOA 1UAXA 2PYLA 3AA5X 3S3MA 1GOAA 3D0PA 1RT2A 1HMVA 1L3UA 3OYAA 4KB1A 3RMCA 3IS9A 3LAMA 3TARA 3AVAA 1WAJA 3BGRA 3KIOA 3L3UA 3OYLA 3OYFA 2QKBA 4LY7A 4CESA 4CHOA 2G8KA 3NCIA 2VG5A 3M8RA 2EX3A 4KI4A 4DSFA 4Z4CA 2BE2A 1FKPA 1CXUA 3HPGA 3M8SA 1LW0A 3PO4A 3V9SA 3ZT1A 1SKWA 1FKOA 3NH0A 1HQEA 4LD0A 3HPOA 4RG8A 1TV6A 1MU2A 3SJJA 3O4QA 4FYDA 2FBVA 1TK8A 4CEEA 1LWCA 1X9WA 3NBPA 4M45A 3PO5A 3HO1A 1VSIA 4OPJA 5I42A 4Y1CA 2G8HA 4OKEA 4DTSA 4KTWA 1L3VA 4XIUA 3HYFA 4DG1A 3SCXA 4B9LA 1JXBA 4GW6A 2YNFA 3MEGA 1Q9XA 2NUBA 3AVJA 3ZSZA 5JS2A 4CGHA 4E19A 4LSNA 4O44A 5KGXA 2YHAA 4M42A 2D5RA 4KV8A 1RBSA 1VSJA 3NF6A 1Z25A 4E3SA 2WOMA 1QE1A 3S9HA 2B5JA 2OPRA 4CJFA 4OKKA 3LPTA 4BE1A 1CXQA 2DFFA 5KRTA 4F2SA 1DLOA 4HUEA 4BDYA 1X1PA 4K8XA 4GMJB 4I7FA 1TL1A 4J2AA 3DOKA 4CIEA 1RT6A 2IAJA 4CJSA 2E6MA 3OS2A 1FK9A 3KK2A 1RT4A 5HRNA 1XHXA 2OPSA 4F4KA 1GOCA 4NCGA 3KJVA 1SUQA 4E7JA 1ASUA 3KLIA 1R0AA 2A1RA 5KI6A 1WNSA 3QEWA 1VSEA 3VQQA 4AHUA 3OYIA 1SV5A 3OYKA 3EZ5A 3DRPA 4BE2A 3AA3A 3HVRA 3P1GA 3SQ1A 2O4IA 2X6NA 1C0TA 3KLGA 3OYDA 1ZYQA 1L3TA 3I0RA 4DFPA 3KK3A 3RR7A 1VSLA 1RTIA 1RDBA 2G8WA 4QCLA 3DOLA 3QLHA 3HP9A 1RT3A 1VSFA 3WNGA 4M41A 3E01A 3KD1E 3AVGA 1D9FA 2HHWA 1JLBA 4NCAA 3RWUA 3F73A 4Y1DA 2FBTA 3C6TA 2ETJA 4WE1A 2G8UA 2YV0X 5T7BA 3MXJA 4CJPA 3CQ8A 2HNZA 4CEZA 2IOCA 4CHYA 3FFIA 3VQPA 3EY1A 4DTMA 2JLEA 1NKBA 2VWKA 2VG7A 3M8PA 4M3RA 2OZMA 1IKWA 4DFMA 1WAFA 2KTQA 4DTUA 3NH2A 3OYJA
chains in the Genus database with same CATH superfamily
3VQ5A 3SV4A 4MDBA 1NK5A 5EU7A 3TAFA 2GELA 4DF8A 3A5MC 1X3NA 5C12A 3SPZA 1W9HA 3ENHA 3ITHA 4JI1K 4M7YA 2Q3SA 5AZJA 5ADXH 3H45C 1GLEG 2GBZA 4CJ3A 1LOTB 1BL3A 5AQRA 3ZEUB 3T1YK 1BUPA 4CJ5A 1S6QA 1QVFM 1YJNN 4B08A 1M90O 4Q5VA 5CZ2A 3R3LA 1T05A 1GLCG 1NGGA 5C25A 5SWMA 2WUSA 2FSKA 4ELVA 4NB4A 1Z26A 3PV8A 4EP4A 2YNGA 3A5NC 1NK7A 4IG0A 3SPYA 1BI4A 3O80A 1U04A 3J7ZO 1RDDA 4CZFA 4ISGA 1YTAA 4E1NA 2YI1A 3THVA 4M3ZA 3AV9A 3H3NO 2E2QA 5AZIB 3OYBA 3KKSA 3NGYA 3THXB 1I3AA 2FF3B 4H5TA 3C95A 2QWRA 4EZ6A 2ZGYA 4FWNA 1WSGA 1LW2A 5BRHA 3HBTA 4FZZA 4A62A 2QW9A 4OGCA 5JVHL 1ILYA 1JJ2M 3GDQA 3NF7A 3V9XA 3VTIA 4BGAA 4KAZA 5JS1A 2HW3A 3CYMA 4BREA 1CZ9A 4GKJK 5BRFA 3V4IA 4DQSA 1GOBA 1VQ8N 4FWKA 4IDKA 2BUPA 3U9DA 1ZBLA 4DKWA 1OH5A 3MXMA 3WT0A 4YNQA 3G4SN 4DU4A 1VRTA 3CCMN 2IDOA 3ZSQA 2JWKA 4FPAA 4ICLA 2YJFA 3CPEA 3I0SA 4N5SA 4NXNK 2Q97A 4DR7K 1NGAA 2X74A 1QTMA 2WC9A 2RE2A 4JD2B 1HNVA 4FK0A 1LWEA 3VTHA 1EO1A 3K5NA 1S1UA 4CJLA 2IC3A 1UWBA 3QBWA 3J7YP 3U6FA 4NYFA 3R9PA 5J1EA 1VQPN 4ZTFA 3QFUA 3UKUA 2NRWA 5HRSA 4ILGB 2CGKA 4C1NI 1NM1A 5FLXO 3IG1A 3QNNA 4FOEA 2LSNA 4JI8K 1NWKA 3ZSOA 1B92A 1YUWA 1ZBIA 3DXMB 2QM1A 5GAGP 3WNEA 4H5RA 1NJZA 4IKFA 4EFHA 3U3YA 3FZFA 3P83D 3OYCA 4CCHA 4W5RA 2V7ZA 2XY7A 1KSPA 3M8QA 1K9MO 1QHAA 3JS6A 4UQGA 1TYQB 4CF9A 1ESVA 3EYZA 4CFCA 4FJIA 5FRNA 3LPUA 3CFOA 3LDLA 4DTOA 3EL2A 2D1KA 1T03A 5KPTA 5FPNA 3K57A 1HYZA 4H8KA 3DLBA 4CZHA 1DKGD 4JS5A 3V9UA 1OH6A 2HMIA 5HBMA 1EETA 3HOSA 4BRCA 5FRMA 4EIAA 4HHTA 1U48A 4E1MA 3TTDA 3HP6A 3PX0A 1JCFA 2F4VK 4FLYA 1GLAG 4CBXA 4CK2A 2A42A 5JICA 3CCJN 1T3VA 3RMDA 3SV3A 2YHBA 3GL1A 4FK4A 1WBDA 4EZ9A 2HBKA 3CJ1A 3F9MA 5BR8K 2EHGA 2YNIA 4BR2A 2BANA 3K9KA 3OHRA 2FBXA 1VSDA 4DR2K 3DAWA 4BC5A 1EP4A 3Q7BA 2QWMA 4BRPA 2YNHA 3LP0A 5AQJA 3KK7A 3LWLA 4FM0A 5F2RA 4CJVA 3DLGA 4IBNA 3NAEA 4GV6A 3L4IA 1IJJA 3D7EO 4HTLA 4B1VA 1RT1A 3WNFA 1IO2A 3QIPA 4FJ9A 4DSJA 2YJEA 3ZCMA 5FPEA 4IOCL 3DLHA 2EWSA 3SI6A 3T19A 1I94K 3LALA 4FZYA 4IJAA 3E9PA 4JRQA 1G15A 3ATUA 2NZTA 1K73O 4KTQA 4KI6A 2O8FB 4JS4A 1NK6A 3OYEA 1RTDA 5C15A 2X78A 3VEZA 2OYQA 4O0IA 4WFAL 1HPZA 1QQOA 4ISEA 3NFAA 5DM7L 5CE3A 4GKKK 3QO9A 4AM6A 4FXDA 3SUPA 4NLBA 2HBMA 3LDQA 2XO7A 2WONA 2OA8A 4BRMA 3LDSA 4YHHK 1RCHA 4CGFA 1YI2N 3DLEA 3IDHA 4LF4K 4LF5K 1CZAN 2W41A 5KTQA 2D0AA 3NVMA 3EE9A 3OJSA 1FXXA 3VEYA 1KQSM 4OLAA 4I2QA 3WXIA 1S1XA 1K8KA 4CJ7A 1Q86O 1NJXA 5LMUK 1BGXT 3B6PA 1BCOA 3K2PA 1NK8A 1KTQA 2QWOA 4DLEA 4H0XB 3DM2A 3VEVA 1ZXOA 4YDUA 3MXIA 4PWDA 2A40A 1X9SA 3IMXA 1JL2A 4LFAK 3KHYA 1S5JA 4J8FA 4E7KA 1REVA 1BQNA 5AFUA 3ZETA 4CFAA 2NRXA 4BRAA 4I9QA 4LH4A 4M7XA 4CZGA 3LDNA 1TVRA 4BR4A 1SL0A 2QA4N 1RBVA 4XH1A 1NGJA 4JLHA 2BGGA 3U3GA 4FWMA 4RW8A 1HJRA 1FW6A 2QEXN 3D2EA 1GLLO 3IFRA 2D0CA 3AVIA 3RRHA 4BG8A 2W6KA 1C1BA 3D6RA 1YHQN 1HR0K 2W6LA 3AA5X 3VEXA 3S3MA 1WOQA 4FPBA 2P9LA 1L3UA 3OYAA 1NGIA 3IS9A 4JKEA 3AVAA 4JYAK 3KIOA 3UKRA 1QQNA 3L3UA 4BR0A 4X62K 4WF9L 2QKBA 4IO8A 4IOAL 3NCIA 2JWLA 4K41A 3TTFA 3CC4N 3E9OA 4OPAA 3V9SA 3ZT1A 3GOIA 1SKWA 4YOWA 4LD0A 3SJJA 3O4QA 4U67L 1LWCA 1X9WA 3L0QA 1U2VB 3PSFA 2G8HA 3MN5A 4KTWA 4MO4A 4DG1A 3SCXA 4B9LA 1JXBA 3A0IX 4B9QA 2E1ZA 4E19A 5JS2A 4LSNA 4O44A 5EOYA 5KGXA 2O8CB 3T7ZA 1VSJA 3MWTA 1HKBA 4PHTX 2WOMA 2B5JA 1Y64A 4WFBL 3CHWA 4CJFA 4OKKA 4OO1J 4F2SA 3Q7CA 1TL1A 5JLFA 3CCQN 4JI3K 1RT6A 4CJSA 1FK9A 3KK2A 3ID6A 1GOCA 3KJVA 1SUQA 3D2FB 4E7JA 5JVGL 1NBWA 1ASUA 3SAFA 2A1RA 1WNSA 1VSEA 5KQDA 3OYIA 2O4IA 3OYKA 3EZ5A 2X6NA 1ZYQA 1NGHA 3CQYA 1N8RO 3DOLA 3GG4A 1VSFA 4M41A 3R6MA 3KD1E 1Q18A 4KH6A 4WE1A 4CJPA 4DTMA 2IOCA 5M1QA 2F7TA 4GV9A 5AR0A 2OZMA 3G25A 1IKWA 3NH2A 3WQUA 1ZBUA 2RKIA 3FZKA 3WEEB 5CY4A 4KHYA 4BRLA 3O3HA 3SUNA 4GVMA 4CGGA 4FWRA 3HOTA 3ZSXA 4DV7K 4AH9A 3C7NA 1NNEA 1TKTA 3N4PA 1MWMA 3BZCA 1KAYA 3T1AA 4H0TB 4PKHA 1C1CA 4RWTA 3FE1A 2GUIA 1C6VA 2VQFK 2A5XA 2ZF5O 5SZTA 1TKXA 3NHGA 1ZBSA 1TAUA 3DI6A 5AQKA 4A57A 2UXBK 2Y1JA 1GLJO 3HM8A 3TAMA 1QSYA 3V1OA 3MWPA 4I6MA 3QFPA 2JGUA 1T6CA 1D4XA 1VQLN 5EX5A 3I33A 2HBLA 3L3VA 4FL9A 2YHYA 3BUZB 2P9UB 4B9MA 3P39A 3KWGA 3TSUA 2YKNA 2A41A 3E66A 2R7YA 3TWHA 1SKRA 2GX9A 4DR4K 2ZJRL 3ZX2A 1E4FT 3OYMA 2HMPA 3CG7A 2DTUA 3LWMA 3M1FA 3N4QA 5C24A 4CZKA 1GLFO 2PAVA 5E26A 3RRGA 1EWRA 4CJKA 4KHSA 2HF3A 3BEXA 1SZ2A 1NMNA 5AQXA 4R5PA 4JKGB 3THWA 1N5YA 1N34K 1A5VA 3HJFA 3OW2M 2YHWA 4Z4IA 2HHQA 1LWFA 2IVPA 2H3GX 3KKRA 3KZBA 1VQON 4KHNA 4JNEA 2DPNA 2OPQA 4FLVA 1RBRA 2V51B 2GTDA 2Q31A 3RSEA 2ASMA 4WQ5A 3MECA 3G10A 4CZIA 3LM2A 1J53A 4ELTA 3C6AA 4AILC 1DTTA 2QI2A 1CLQA 3ZT4A 3O8MA 4AF1A 3F2KA 1WSFA 3IUCA 2FLOA 4WQ4A 3QINA 3LZJA 3K5LA 4HWIA 3O4NA 1KVAA 1MDUB 5AQNA 3O9RA 1JL1A 1LCUA 4OGEA 3CCVN 4CVNE 1KVCA 4MLHA 5KGWA 3SMSA 4C8OA 1GLDG 4CF2A 2KKZA 2D0BA 3O08A 1RDAA 1C1AA 2HHUA 4LSLA 2CGLA 1ATNA 3O9SA 3SLCA 4QAGA 4AHVA 1G99A 1S72N 1IKYA 2KZMA 4CHNA 3HK2A 3VN5A 1XC3A 4FW1A 4CF1A 3VQ4A 3ZT0A 3CF5L 4JV5K 4A59A 5AZJB 1J5EK 3EE8A 3H08A 1N36K 5IWAK 3TI0A 4LC9B 3FZLA 4F8RA 5FDLA 1SS6A 4CFBA 1HKCA 3QEXA 1DT9A 1KRPA 2RHKA 2VWBA 3MEDA 3CI5A 2QK9A 4E89A 5AQQA 5KPRA 4M3UA 1K6YA 1JLGA 2P9IA 3PY8A 2PYJA 1Q9YA 1M1KO 3V1RA 4BRKA 3ASMA 3MAQA 1RDUA 1BI4B 2HHHK 4IDHA 4W5TA 4FSVA 4DTXA 4FJ8A 4Z4HA 5TKWA 1QSSA 3ZX3A 2PZSA 2KFZA 4GVEA 3UIQA 4ID1A 4BR5A 4FLZA 4FWQA 2UUCK 4CERA 5CR4A 3QDKA 2Q0UA 4O5FA 3G0ZA 4DQRA 1ATRA 3RR8A 3OYNA 3K0SA 4LF9K 3CMAN 3CXCM 2Q2RA 2O8BA 1IKXA 1EWQA 4IFVA 4B9TA 3SYZA 4M3TA 2WBNA 1J6ZA 4I9LA 5EY4A 1VSMA 3AO5A 3A5LC 3JAMO 1YT3A 4AQYK 2OZSA 4MQ3A 4XH5A 4WYBA 3UB5A 5LMNK 4FLXA 4RW7A 3DXKA 3AGRA 3T1HK 2P9PA 3TSQA 4BROA 2P1JA 4R79A 4BDZA 4DFJA 1UA0A 3KTQA 2XHBA 1QQMA 3CFPA 1RT5A 3FZMA 5HP1A 2CGJA 3A2FA 5K14A 1VSKA 3RVCA 1HYVA 3DLKA 5BN9A 5IT9O 3SAHA 1BCMA 5M1KA 2GUPA 1KD1O 4RW4A 2FBYA 4ELUA 3PLAA 3OS0A 4CEDA 1J54A 4FWSA 3C6UA 4KB0A 3AO3A 1BIUA 4DR6K 4L3QA 4RW6A 2HB5A 3F9KA 3UKUB 1Q82O 4Z0UA 1QSLA 4FJ5A 3CJAA 3BF3A 4ILHA 2ZGZA 3P31A 1S9GA 4PY5A 4CGJA 4CGIA 5EVZA 4CIFA 1VRUA 3DRRA 5JLHA 1IG8A 2F8SA 3HVTA 3DMJA 1JLAA 3RMAA 3VPZA 4ZTJA 4M3XA 3NGIA 1NK4A 3JSMA 2I5JA 3K5OA 1L5UA 4FW2A 4E7LA 1XQSC 4B3TK 2RPIA 3ZX0A 4B1WB 1S1VA 4LFCK 3DLLL 3S3NA 4O55A 5AQSA 4DSLA 1BIZA 4PUOA 1JCEA 1NGFA 2UUBK 1WSIA 1NK9A 1VK0A 4AHCA 1Q8IA 2HVIA 1R59O 2P9KA 1RNHA 4KH5A 1YTUA 4W5QA 4CEOA 5CZ1A 3VA3A 3QETA 1VHXA 4FJJA 1RBUA 4JKBA 2D0PA 3H3OB 3QIOA 4CEBA 1V4SA 4Z94A 2AJQA 4DR5K 2KZZA 2O8DA 5C2DA 3KVGA 1KFDA 1EX4A 2NLXA 5JMVA 4MDAA 2B6AA 1UAXA 1BU6O 5BR9A 4B1UB 4F9OA 1HMVA 3EZWA 4BVPA 3LAMA 3HI0A 3BGRA 3OYFA 4XH4A 4CESA 5C2FA 2EX3A 4KI4A 4Z4CA 3ULEA 3M8SA 3HPGA 1DGKN 4CI6A 1HQEA 4WCEL 4BQZA 3HPOA 4RG8A 5AFUH 1MU2A 4DV5K 3CCLN 1TK8A 4CEEA 3PO5A 4M45A 4OPJA 4OKEA 3HYFA 3THYA 3PIOL 3EEQA 4GW6A 4KBOA 4CGHA 5AQTA 4X65K 1VQKN 4M42A 4KV8A 4H5VA 4JHDA 4PKGA 1Z25A 3CCEN 1QE1A 3P4IA 3S9HA 2DFFA 5KRTA 4HUEA 1NGEA 1VQ9N 4LFBK 4CIEA 2IAJA 3OS2A 3MN6A 4H0YB 4BY9C 3OA9A 4QS9A 1WB9A 5I9EB 3KLIA 3OBWA 3DRPA 3HVRA 3P1GA 3BP8A 3KLGA 4JN4A 4QCLA 3KK3A 1VSLA 1RDBA 2G8WA 4A61A 3PIPL 5AQGA 3AVGA 1KXPA 1JLBA 1IBMK 2ETJA 3M6GA 1C0GA 3MXJA 2HNZA 3EY1A 3FFIA 3VQPA 1ATSA 1K8KB 4LF8K 5BPMA 2P9NA 3G6EN 4BRNA 3OYJA 2D4WA 2DFHA 4M3WA 1S6PA 2UU9K 3L6QA 2HF4A 3AO4A 4AHRA 3SQ0A 1IKVA 5GAEP 5J2MA 3ZETB 4OKJA 4HCBA 1EQYA 3HM9A 1XI1A 4FK2A 1A5XA 1VQ6N 4JKAA 2YX6A 1S9EA 4KKOA 4CIGA 4DQ8A 1VQ7N 3SQ4A 2RF2A 1YAGA 3NVKA 4JI7K 1I39A 2UYTA 2QXLA 3D2EB 3HL8A 5LJVA 1IBKK 2NRVA 3MK6A 4FJLA 3KD5E 1HNWK 5B8HA 3VQ8A 5F0XA 1N33K 3QEPA 3MCAB 2Q0RA 3RTVA 1Q7YO 1HNIA 2O8EA 3M3ZA 1HJOA 4BRIA 1OH7A 1A5WA 1TUYA 2AA4A 1SKSA 3PX4A 2HHXA 2P9LB 3AVFA 1NMDA 4IEIA 3UKRB 4B9UA 3QICA 4DV0K 3NE6A 4Z4EA 4Z4GA 3CQXA 3HT3A 4ZHRA 3K59A 1SQKA 2VCPA 4FZXC 4K25A 4F3TA 1JLFA 3NH1A 2X6SA 3D45A 3QEVA 4N41A 5AQLA 4FVMA 4RTFD 5BPLA 4DQPA 4H0VB 3KWIA 1C0MA 1XMQK 4B8CA 4BRGA 3VEOA 4X66K 1S1TA 5AQPA 5DMRA 4M3YA 3HRGA 3ZSRA 2ATQA 1D8YA 4JKDA 4JK7A 4YOXA 2NRZA 3VGLA 1NJYA 4WFNL 2PY5A 2HHTA 4DTRA 3ID8A 4QS7A 3KK1A 3C0BA 1KAZA 3VMFB 4O8UA 4CJQA 3TTCA 3QEIA 1OKJA 4CZEA 2PBDA 3KLEA 1FJGK 4FLWA 1BDGA 3OS1A 1NLVA 2ZD1A 4GY2B 1ZBFA 3A5OC 3LM9A 5F1XA 1W2BM 3AAQA 3HZ6A 4JRPA 5A2QO 1TKDA 3CC2N 2HVHA 4H4MA 2XY8A 1SL1A 3ZSWA 3VQ7A 3I8DA 4BVOA 3EKUA 3NF8A 4B3RK 1JLQA 4DU1A 4Q0BA 3OBYA 3AVMA 3O9QA 3ENOA 4C1NK 4FJNA 3HTVA 4CZJA 5J2PA 4B9SA 3L2WA 4DV1K 2HHSA 4QS8A 1D5AA 4LH5A 4HCCA 3TABA 3EO3A 3QESA 2FSJA 1U6ZA 2WFBA 2ZJPL 3PX6A 4DTUA 3SNNA 3VF6A 3VQAA 1NJWA 1U49A 3C7NB 3FGUA 3SMPA 1NGBA 2Z1HA 3FR0A 3SAGA 4IZ9A 4L8RB 1Z6RA 2P9SA 4OPKA 3J7AP 3ATVA 5EXWA 3J81O 1U4BA 3C6HA 3CD6N 4AM7A 4Y0WA 1KFSA 4FOIA 4FJHA 4CE9A 1CZBA 1VQ5N 3V6DA 4CK1A 1WBBA 2E2OA 2E2PA 4I6MB 4B8AB 1XHZA 3LZIA 1SL2A 4H03B 3A8YA 4K8ZA 3AVKA 4DF4A 4U7BA 3VENA 4N56A 2IVNA 2VWJA 1HKGA 4N47A 3LANA 4IO9L 2FC0A 3WXLA 2A1SA 1XC9A 3K58A 2I7PA 3VERA 4JKCA 4AHSA 3VA0A 3WNHA 1HNZK 3U9ZA 4FVUA 3AVNA 1IBLK 5HROA 1QQCA 3ZT3A 2AP1A 2J4RA 4F2RA 1W97L 5I3UA 3TR8A 3KLFA 3CM6A 2QWNA 2Y1IA 5KRSA 1YVNA 3EN9A 5TKYA 3AARA 4BACA 3THWB 3R1XA 4BRFA 4KHPK 4E1JA 4DB3A 2KFNA 1V4TA 4O4GA 1OH8A 1TKZA 3CETA 5BRDA 3V1QA 4B1XB 1W7AA 3HXMA 4JEPA 4NYNA 3RSEB 4CF0A 3O9UA 3HPHA 5C42A 4EP5A 4JK8A 4CZLA 4NCBA 5AQMA 1BHLA 4UY8O 4G1QA 4MLEA 4CJ4A 1N6QA 3BZKA 4EAHD 4HTUA 4CJRA 3JXUA 3NGZA 5AQIA 3O3FA 3ENBA 1X9JA 4FJGA 1RDWX 4A2AA 4K42A 5DK5A 3PUFA 3O6WA 4DSEA 4A5AA 4A2BA 1NGCA 5HRPA 2CH6A 5GAHP 4DV6K 2YHXA 2OTLN 3VQ9A 3QB0A 3CCUN 1C0UA 1XMOK 4YOVA 2KLAA 4E0DA 4KTZA 4C8KA 4V19S 5ELZA 4B3MK 4BC3A 2IS3A 3OYHA 4DS4A 4YDUC 2NRTA 4DTPA 2OPPA 3TAPA 4JI2K 3SQ2A 3LDOA 1IH7A 3MDQA 5HOOA 5D3GA 1KCFA 4KFBA 2CH5A 2XY5A 4XEIA 1O1WA 1OVQA 3WUHA 4PA1A 4BGBA 2B4JA 1BOTO 3MN7A 1J9AA 1NKEA 1RTHA 2NNWA 1BQMA 3ZEUA 3DJCA 4NLCA 3TAQA 1YF5L 4I2PA 2D0OA 3FFKB 3B6OA 3MEEA 4DQQA 2PFUA 4C8MA 4CHZA 3HSTB 2ITGA 1XNRK 2HHVA 2P9IB 2G8IA 5FPDA 4LF6K 2F8TA 4ISFA 3CERA 2W40A 1RT7A 3CJCA 2UUAK 1ITGA 2A3ZA 2IIRA 3W0LA 5M1PA 4J2BA 4OLBA 3AO2A 4DTJA 5HRRA 3E9LA 1TGOA 1H1VA 4IWVA 3O1BA 1GOAA 1YXQA 2VQEK 3RMCA 5AQYA 3TARA 5BN8A 3OYLA 4LY7A 4CHOA 5AZIA 2BE2A 1FKPA 1BG3A 3THXA 1FKOA 3NH0A 2O8BB 1TV6A 1BA1A 4FYDA 1KAXA 3HO1A 2HSTA 1L3VA 4XIUA 3LL3A 2ZJQL 1GLBG 2YNFA 1JCGA 3MEGA 2NUBA 3AVJA 2QWPA 1RBSA 1RFQA 3DXKB 4E3SA 1T6DA 2P9PB 4BR7A 3S41A 5AQHA 3VESA 3LPTA 5KQ8A 1CXQA 1DLOA 5ADXA 4GMJB 4I7FA 3VOVA 4J2AA 3I8BA 5HRNA 1XHXA 4F4KA 4NCGA 3WXJA 1NJIO 4PL7A 3TU5A 4BG9A 5KI6A 1XNQK 3F5TA 4AHUA 3QMLA 2E2NA 3SQ1A 3SBGA 1C0TA 4JD2A 1L3TA 3I0RA 4PL8A 5GIOA 1RTIA 3O1WA 3J80O 3H6EA 3QLHA 3HP9A 4CW7B 3WNGA 3E01A 1YITN 4H0PA 4BR9A 3F73A 2FBTA 2YV0X 3M5RA 4CEZA 4CHYA 2VG7A 3M8PA 4M3RA 3MN9A 1HUXA 3DWLA 3HSCA 2KTQA 3O9TA 3AGKA 1RBTA 2Z1JA 4CD1A 3AAPA 3DXMA 1HNXK 4DHYA 3H1VX 1LAWA 3OYGA 3AVLA 1T8EA 1D9DA 3FLCO 4E7IA 3CCRN 4B3OA 4YY3K 4OVLA 2G8VA 2QTDA 1TYQA 4CJWA 5GADP 1NU0A 4CK3A 1QHTA 3DYAA 3AVHA 2P9KB 2NRHA 3VGMA 3I56N 1HPMA 4H4OA 4DUYK 1MWKA 1XUPO 5C0YA 4KREA 4K0KK 4B9VA 1IV0A 3ULDA 2Q36A 1KVBA 4CJEA 3LP2A 4E7HA 3V81A 3ZSYA 2O8DB 5DM6L 2Z1IA 2G8FA 3EKSA 4BWMA 3DRSA 2DY4A 4C23A 1OVYA 2QXFA 1J5OA 4CEAA 1RGIA 1UA1A 3VEWA 4AHTA 2ASPA 4MFBA 1VAZA 3MX2A 4CF8A 3ULEB 4J2EA 2ZM6K 3VQDA 3SJHA 2NRRA 5J2NA 4K43A 4G9ZA 4EHUA 4CZMA 5GINA 3CM5A 3L2VA 2FF6A 5J2QA 3L4QA 1VQMN 2Z1GA 4FJKA 4OPHA 3AO1A 4NO7A 4RW9A 4CJTA 3CFRA 4BRHA 4CHPA 4YOTA 1U47A 2F9TA 3THYB 2XRIA 3NDKA 3CIPA 2I7NA 1WSJA 2E8AA 3ISNC 2VGMA 4CGDA 5FPMA 4JHDB 1NKCA 3OTOK 1EKEA 3OJUA 2HOEA 2YCHA 4LF7K 4BWJA 3QERA 2V52B 5HLFA 4Z4FA 4W5OA 4WQ5C 4DV4K 4DR3K 1MA9B 1NOYA 4FJMA 1JXEA 4KPYA 3AVBA 4CEQA 4F3OA 4FWPA 4CHQA 5H1SQ 1VQ4N 2GV9A 2W42A 3C94A 4ID5A 4C8NA 3U4LA 3LP3A 2O8FA 5HL7L 3H1QA 4IXCA 3VQEA 3T3FA 3O3GA 4IG3A 1LV5A 4WQ4C 4IFYA 3ZSVA 3L2UA 4IEEA 1X3MA 4BRQA 4B1ZA 4JKFA 2FXUA 1B9FA 4X64K 1XWLA 4KO0A 5KPZA 3IKMA 2BTFA 4N76A 1KC8O 1JLCA 5LJWA 1KLNA 4B9NA 1BWFO 2KQ2A 4O5BA 5LL6Z 2P5OA 2QWQA 2P51A 2P9NB 2V7YA 4YFUA 1T44A 3IAYA 4IFEA 4CJUA 2BH1A 1YJ9N 1ASVA 1UOCA 1VSHA 2IGIA 3SUOA 4FO0A 3WQTA 3UE5A 4KRFA 3RMBA 3NF9A 3AVCA 3R8EA 1LAVA 4CECA 3MCPA 1K8AO 4B3SK 4CEFA 5AQOA 5BREA 4DV3K 4O0JA 1B9DA 1TAQA 4OJRA 4NXMK 3VQCA 3QBXA 2RN2A 4HUGA 5AQUA 5C10A 1P90A 1C0FA 3TPQA 4KHWA 5E84A 3VQBA 1RILA 5E41A 2ZQBA 2KW4A 5AJ3K 5GIPA 3ZLJA 3OY9A 1F21A 2HNYA 1Q81O 1DEJA 2E4LA 2OTJN 1NK0A 4FJXA 2XY6A 1S3XA 4IOXA 2ZE2A 4DLGA 2O8EB 4FLUA 2QWLA 4PKIA 1Y97A 2F96A 3ZYYX 1ZBHA 3E1YA 1WLJA 3V9ZA 3CPWM 2VG6A 3CJ7A 3QNOA 3SZ2A 4TSXA 3P5JA 1T7PA 3LDPA 3SK3A 1U45A 3V9WA 3DLRA 3K5MA 1HX1A 4CBUA 2GWJA 4OX9K 5CYMA 1WUAA 1ASWA 1L3SA 1RDCA 4FM1A 4JI4K 3TANA 1W0HA 1TK0A 4FCYA 1NGDA 1ZC6A 4BE0A 1BISA 5LY3A 4MO5A 1DTQA 3S3OA 1QS4A 3MX5A 4FJ7A 4JAXA 1JLEA 1WSHA 2GEMA 1U2VA 4FLTA 2HNDA 3BDPA 3P38A 3B8AX 2DFEA 4DSIA 2VYPA 3MMVA 3O5BA 3TAGA 2O8CA 1WN7A 1E3MA 3L2RA 1HRHA 4DU3A 3U8XA 4DFKA 4PQUA 3H46O 4HVJA 2ASOA 4BQLA 4DQIA 3LP1A 4QOZB 4ILJA 1O13A 4HUFA 4BDPA 1HQUA 3JYTA 2BDPA 3CCSN 3D2FA 4JI6K 4KH4A 3O4WA 2E88A 3AA4A 3WXMB 3ZT2A 3VF4A 2OCEA 4DCHA 3I55N 1X9MA 1TK5A 3CMEN 3OVNA 4JK9A 3ALYA 2E5LK 5AQZA 4CD3A 1YVUA 1HYSA 3IRXA 4YOUA 4JI0K 2GWKA 2YKMA 1RTJA 1TL3A 1TUUA 4CFDA 4DS5A 2A6AA 4DMNA 4KHQA 2QKKA 3PSIA 1EXQA 2UXDK 4DTNA 4RCHA 4DWIA 1S1WA 3VQ6A 3C65A 1WSEA 2O4GA 1QZ6A 4H5WA 4W5NA 1BO5O 2ZWHA 4GNIA 1IG9A 5AQFA 3K9JA 3TSPA 3WEEA 2OANA 3SUQA 2E6LA 3G71N 1QVGM 3L8BA 1HLUA 2UXCK 5CYQA 2P9SB 3CJBA 3T69A 3VETA 1NOZA 1E4GT 4FM2A 3CC7N 2Q1NA 5M1OA 2VGNA 3KLHA 4KHUA 1YIJN 3GE1A 3TAEA 1JKHA 4DSKA 2FSNA 3LAKA 1KLMA 1VQNN 3AA2A 3L2QA 2P5GA 4C8LA 3WXKA 5FROA 5BPNA 4J2DA 2HBJA 2PYLA 3GBTA 2P9UA 1YJWN 4DV2K 3D0PA 1RT2A 4JKHA 4KB1A 1WAJA 1N32K 4O8KA 2G8KA 4M63C 2VG5A 3M8RA 3VGKA 4DSFA 4BRDA 1CXUA 1LW0A 3PO4A 4FWLA 3SBTA 4A5BA 2FBVA 3BF1A 3AY9A 3NBPA 1NG9A 1VSIA 5I42A 4Y1CA 5M1FA 2E1YA 4DTSA 3BY5A 5MLCQ 2F9WA 4JKGA 1Q9XA 3ZSZA 3CJ9A 5CHIA 2YHAA 1P8ZA 2D5RA 4EHTA 3NF6A 2WTUA 4DR1K 4CBWA 2OPRA 4BE1A 4IJNA 4K8XA 4BDYA 1X1PA 4DUZK 1Z05A 3DOKA 1BA0A 4JI5K 3J8AA 2E6MA 3NMUA 1RT4A 2OPSA 5AQVA 2ITMA 3W3DA 2KHOA 1QZ5A 4GV3A 2IVOA 1R0AA 3FZHA 3QEWA 3VQQA 1S22A 4H0OA 4BC4A 1SV5A 4BE2A 3AA3A 1SAZA 4YORA 3OYDA 2E20A 4DFPA 3RR7A 4FWOA 4H5NA 1RT3A 5AQWA 1D9FA 2HHWA 4BC2A 4NCAA 3RWUA 4Y1DA 3C6TA 2G8UA 3CQ8A 5T7BA 5M1NA 1NKBA 2JLEA 2VWKA 4B1YB 4DFMA 1WAFA 3VF2A 4YOYA
chains in the Genus database with same CATH topology
3VQ5A 3SV4A 1ZBUA 2DFHA 2RKIA 1NK5A 5EU7A 1S6PA 4M3WA 3TAFA 4DF8A 1RBTA 5CY4A 2Z1JA 4KHYA 3AO4A 4AHRA 3O3HA 3SUNA 4GVMA 1T8EA 1LAWA 3OYGA 3AVLA 3SPZA 1D9DA 1W9HA 4CGGA 3SQ0A 3ITHA 3HK2A 1IKVA 3ZSXA 5J2MA 2Q3SA 4E7IA 4OKJA 4B3OA 4HCBA 4AH9A 4OVLA 2G8VA 1TKTA 4CJWA 2GBZA 4CJ3A 3HM9A 1XI1A 1BL3A 3T1AA 4FK2A 1C1CA 1A5XA 2GUIA 4CK3A 1C6VA 1QHTA 3DYAA 1S9EA 3AVHA 4KKOA 1S6QA 4CJ5A 1TKXA 4CIGA 5SZTA 3NHGA 4H4OA 1TAUA 3DI6A 3SQ4A 4KREA 2RF2A 4B08A 4B9VA 4Q5VA 1I39A 3ULDA 3HL8A 5CZ2A 1KVBA 4FJLA 1T05A 4CJEA 2Y1JA 3KD5E 3LP2A 3VQ8A 5C25A 4E7HA 5SWMA 3TAMA 3QEPA 3V81A 1QSYA 3ZSYA 3V1OA 2Z1IA 2JGUA 3RTVA 1Z26A 3PV8A 2G8FA 4ELVA 4EP4A 1HNIA 2YNGA 4BWMA 1NK7A 3L3VA 1A5WA 3DRSA 4IG0A 1SKSA 2DY4A 3SPYA 1BI4A 3PX4A 2HHXA 1U04A 4B9MA 3AVFA 2QXFA 1RDDA 1J5OA 2YKNA 4B9UA 4Z4EA 1YTAA 4CEAA 4E1NA 3NE6A 3TWHA 2R7YA 4AHTA 3THVA 1UA1A 3AV9A 1SKRA 4M3ZA 3HT3A 4Z4GA 4ZHRA 3K59A 4FZXC 4MFBA 3OYBA 3KKSA 4CF8A 4J2EA 3VQDA 3NGYA 4F3TA 1JLFA 3NH1A 3OYMA 5J2NA 3CG7A 2X6SA 1I3AA 2DTUA 3D45A 3C95A 3QEVA 4N41A 4EZ6A 3LWMA 4FVMA 3CM5A 5C24A 3L2VA 1WSGA 5J2QA 1LW2A 2Z1GA 4DQPA 4FJKA 4FZZA 3AO1A 3RRGA 4CJKA 1C0MA 4KHSA 4B8CA 4OGCA 4RW9A 4CJTA 3CFRA 4CHPA 1U47A 2XRIA 3NF7A 3NDKA 1WSJA 1S1TA 4R5PA 3V9XA 3ISNC 5DMRA 1N5YA 4KAZA 3ZSRA 2ATQA 4CGDA 1A5VA 4M3YA 3HJFA 5JS1A 1D8YA 4Z4IA 2HW3A 3CYMA 2HHQA 1NKCA 1LWFA 1EKEA 1CZ9A 3KKRA 1NJYA 3OJUA 4KHNA 3V4IA 4DQSA 2PY5A 2OPQA 1GOBA 4BWJA 3QERA 5HLFA 4FLVA 4DTRA 4W5OA 4Z4FA 1RBRA 2HHTA 4IDKA 3KK1A 1NOYA 4FJMA 1JXEA 4KPYA 3AVBA 4CEQA 1ZBLA 4CJQA 3MECA 3G10A 4F3OA 4CHQA 3QEIA 2GV9A 3MXMA 2W42A 3C94A 1J53A 4ID5A 4C8NA 3LP3A 4YNQA 3KLEA 4ELTA 4FLWA 4DU4A 4AILC 1VRTA 1DTTA 2IDOA 3ZSQA 1CLQA 3VQEA 4ICLA 3ZT4A 2ZD1A 3OS1A 3T3FA 3O3GA 4IG3A 1LV5A 1ZBFA 3I0SA 4IFYA 4N5SA 1WSFA 3ZSVA 3L2UA 4JRPA 2X74A 1QTMA 3QINA 1B9FA 1XWLA 4KO0A 1HNVA 4FK0A 1TKDA 2HVHA 3LZJA 4H4MA 1LWEA 3K5LA 4N76A 1JLCA 3O4NA 2XY8A 3K5NA 1KVAA 1S1UA 4CJLA 1JL1A 2IC3A 1UWBA 4OGEA 1SL1A 3ZSWA 3VQ7A 3I8DA 1KLNA 3U6FA 4NYFA 3NF8A 1KVCA 4B9NA 2KQ2A 4O5BA 5KGWA 4C8OA 5J1EA 2P5OA 1JLQA 4CF2A 4ZTFA 2D0BA 4DU1A 4Q0BA 1RDAA 1C1AA 2P51A 3AVMA 5HRSA 3IAYA 4YFUA 4CJUA 4FJNA 2HHUA 5J2PA 1ASVA 4B9SA 4LSLA 3L2WA 4PY5A 1UOCA 2HHSA 1VSHA 2IGIA 3IG1A 3QNNA 3SUOA 1D5AA 2LSNA 4QAGA 3ZSOA 4AHVA 4LH5A 1B92A 1IKYA 1ZBIA 3WNEA 4HCCA 1NJZA 4IKFA 3TABA 4CHNA 3NF9A 3AVCA 3P83D 3OYCA 3U3YA 3QESA 3RMBA 4CCHA 1LAVA 3VN5A 4CECA 4W5RA 4CF1A 4FW1A 3VQ4A 3ZT0A 3PX6A 2XY7A 1KSPA 3SNNA 3VQAA 3M8QA 4CEFA 1NJWA 1U49A 4O0JA 3H08A 4UQGA 1B9DA 1TAQA 4OJRA 4CF9A 2Z1HA 3EYZA 3VQCA 3TI0A 2RN2A 4CFCA 4HUGA 4FJIA 5FRNA 3LPUA 4F8RA 4KHWA 5FDLA 3CFOA 3VQBA 4CFBA 3QEXA 4DTOA 4L8RB 1KRPA 1RILA 4OPKA 3MEDA 5E41A 2ZQBA 1T03A 1U4BA 2KW4A 3K57A 1HYZA 1KFSA 4H8KA 3OY9A 1F21A 2HNYA 3DLBA 4CE9A 4FJHA 4E89A 2QK9A 1CZBA 4JS5A 3V9UA 4M3UA 1K6YA 2E4LA 1JLGA 1NK0A 2HMIA 3V6DA 4FJXA 4CK1A 5HBMA 1EETA 2XY6A 3PY8A 5FRMA 2PYJA 4HHTA 1Q9YA 2ZE2A 3V1RA 4DLGA 1U48A 4B8AB 4E1MA 4FLUA 3HP6A 3PX0A 3ASMA 3MAQA 1BI4B 1XHZA 1Y97A 2F96A 3LZIA 4FLYA 1ZBHA 3V9ZA 1WLJA 1SL2A 2VG6A 4K8ZA 4CK2A 3RMDA 4W5TA 3QNOA 3SZ2A 4DTXA 4FJ8A 3AVKA 4Z4HA 3SV3A 4DF4A 4TSXA 1QSSA 2YHBA 3P5JA 4FK4A 4N56A 1T7PA 2PZSA 4EZ9A 2KFZA 1U45A 2EHGA 2YNIA 3V9WA 4ID1A 2VWJA 4FLZA 2BANA 3UIQA 3DLRA 2FBXA 4N47A 3K5MA 1VSDA 3LANA 2FC0A 4CERA 5CYMA 1EP4A 2A1SA 1XC9A 3G0ZA 4DQRA 3K58A 3RR8A 2YNHA 1ASWA 3VA0A 3LP0A 4AHSA 3WNHA 3OYNA 1L3SA 1RDCA 3LWLA 4FM0A 3AVNA 4FM1A 1W0HA 3TANA 1TK0A 4FCYA 4BE0A 1IKXA 1BISA 5HROA 4CJVA 1QQCA 3DLGA 4IBNA 3ZT3A 4F2RA 1DTQA 5I3UA 3TR8A 4IFVA 3KLFA 3NAEA 3S3OA 3CM6A 4B9TA 1QS4A 2Y1IA 5KRSA 3SYZA 4FJ7A 2KZMA 4M3TA 1JLEA 4BACA 1WSHA 4I9LA 4FLTA 2HNDA 1VSMA 3AO5A 3BDPA 1YT3A 2OZSA 1RT1A 2KFNA 3WNFA 4MQ3A 1IO2A 3QIPA 4O4GA 1TKZA 4FJ9A 4FLXA 2DFEA 4DSJA 3V1QA 3ZCMA 3DLHA 4DSIA 3HXMA 3TAGA 4NYNA 4RW7A 3SI6A 1WN7A 3T19A 3LALA 3L2RA 4FZYA 1HRHA 4JRQA 4DU3A 1G15A 4CF0A 2P1JA 4BDZA 1UA0A 3HPHA 5C42A 4DFJA 4EP5A 4DFKA 3KTQA 2XHBA 4HVJA 4NCBA 4KTQA 4PQUA 1BHLA 1RT5A 3CFPA 4G1QA 4KI6A 4CJ4A 5HP1A 4JS4A 1NK6A 1N6QA 3A2FA 3OYEA 4HTUA 4CJRA 1RTDA 4DQIA 5K14A 3NGZA 3LP1A 2X78A 4QOZB 4KRFA 2OYQA 4O0IA 4HUFA 4BDPA 1VSKA 1HQUA 1HPZA 1HYVA 3JYTA 2BDPA 3DLKA 3NFAA 3O3FA 1BCMA 3QO9A 4FJGA 3AA4A 3ZT2A 1X9MA 4RW4A 3SUPA 1TK5A 4FXDA 2FBYA 3OVNA 3PUFA 5DK5A 4ELUA 3ALYA 2XO7A 2WONA 3OS0A 4CEDA 1J54A 4DSEA 2OA8A 1YVUA 3C6UA 3AO3A 4KB0A 3LDSA 1BIUA 1HYSA 1RCHA 3IRXA 4CGFA 3DLEA 4RW6A 2HB5A 2YKMA 3F9KA 1RTJA 1TL3A 5HRPA 4CFDA 4Z0UA 4DS5A 4DMNA 4KHQA 2QKKA 5KTQA 1QSLA 4FJ5A 2D0AA 3OJSA 1FXXA 3VQ9A 4OLAA 1EXQA 4I2QA 4DTNA 1S9GA 4DWIA 1S1WA 1S1XA 1C0UA 3VQ6A 1WSEA 4CGJA 4CGIA 2O4GA 1NJXA 4CIFA 4W5NA 1BGXT 3B6PA 1VRUA 4KTZA 4C8KA 3DRRA 1IG9A 1BCOA 3K2PA 2IS3A 4E0DA 3OYHA 1NK8A 4DS4A 1KTQA 2F8SA 3HVTA 3DMJA 1JLAA 4DLEA 3DM2A 4DTPA 3RMAA 4ZTJA 4M3XA 3NGIA 3MXIA 2OPPA 3TAPA 1NK4A 4PWDA 3SQ2A 3JSMA 1X9SA 1JL2A 1IH7A 2I5JA 3K5OA 1L5UA 4FW2A 4E7LA 1S5JA 3SUQA 4E7KA 1REVA 5D3GA 1KCFA 4KFBA 2RPIA 1BQNA 1S1VA 2XY5A 2E6LA 1O1WA 4CFAA 3L8BA 4PA1A 4O55A 2B4JA 3S3NA 4DSLA 1BIZA 5CYQA 4I9QA 1J9AA 4LH4A 4PUOA 1NKEA 1RTHA 1BQMA 1WSIA 1NK9A 3TAQA 1VK0A 1TVRA 1SL0A 4I2PA 4AHCA 1RBVA 1Q8IA 3B6OA 2HVIA 1NOZA 3MEEA 1RNHA 1YTUA 4W5QA 4JLHA 4DQQA 3U3GA 4CEOA 2BGGA 4C8MA 5CZ1A 3HSTB 4CHZA 4FM2A 4RW8A 2ITGA 3VA3A 3QETA 4FJJA 2HHVA 1HJRA 3KLHA 1RBUA 4KHUA 2G8IA 2F8TA 3TAEA 1JKHA 3QIOA 4DSKA 2D0CA 1KLMA 3LAKA 4CEBA 2AJQA 3AVIA 2KZZA 1RT7A 3AA2A 3L2QA 2P5GA 3RRHA 4C8LA 1ITGA 1KFDA 5FROA 4J2BA 1EX4A 4J2DA 4OLBA 3AO2A 1C1BA 4DTJA 5HRRA 2B6AA 1TGOA 1UAXA 2PYLA 3AA5X 3S3MA 1GOAA 3D0PA 1RT2A 1HMVA 1L3UA 3OYAA 4KB1A 3RMCA 3IS9A 3LAMA 3TARA 3AVAA 1WAJA 3BGRA 3KIOA 3L3UA 3OYLA 3OYFA 2QKBA 4LY7A 4CESA 4CHOA 2G8KA 3NCIA 2VG5A 3M8RA 2EX3A 4KI4A 4DSFA 4Z4CA 2BE2A 1FKPA 1CXUA 3HPGA 3M8SA 1LW0A 3PO4A 3V9SA 3ZT1A 1SKWA 1FKOA 3NH0A 1HQEA 4LD0A 3HPOA 4RG8A 1TV6A 1MU2A 3SJJA 3O4QA 4FYDA 2FBVA 1TK8A 4CEEA 1LWCA 1X9WA 3NBPA 4M45A 3PO5A 3HO1A 1VSIA 4OPJA 5I42A 4Y1CA 2G8HA 4OKEA 4DTSA 4KTWA 1L3VA 4XIUA 3HYFA 4DG1A 3SCXA 4B9LA 1JXBA 4GW6A 2YNFA 3MEGA 1Q9XA 2NUBA 3AVJA 3ZSZA 5JS2A 4CGHA 4E19A 4LSNA 4O44A 5KGXA 2YHAA 4M42A 2D5RA 4KV8A 1RBSA 1VSJA 3NF6A 1Z25A 4E3SA 2WOMA 1QE1A 3S9HA 2B5JA 2OPRA 4CJFA 4OKKA 3LPTA 4BE1A 1CXQA 2DFFA 5KRTA 4F2SA 1DLOA 4HUEA 4BDYA 1X1PA 4K8XA 4GMJB 4I7FA 1TL1A 4J2AA 3DOKA 4CIEA 1RT6A 2IAJA 4CJSA 2E6MA 3OS2A 1FK9A 3KK2A 1RT4A 5HRNA 1XHXA 2OPSA 4F4KA 1GOCA 4NCGA 3KJVA 1SUQA 4E7JA 1ASUA 3KLIA 1R0AA 2A1RA 5KI6A 1WNSA 3QEWA 1VSEA 3VQQA 4AHUA 3OYIA 1SV5A 3OYKA 3EZ5A 3DRPA 4BE2A 3AA3A 3HVRA 3P1GA 3SQ1A 2O4IA 2X6NA 1C0TA 3KLGA 3OYDA 1ZYQA 1L3TA 3I0RA 4DFPA 3KK3A 3RR7A 1VSLA 1RTIA 1RDBA 2G8WA 4QCLA 3DOLA 3QLHA 3HP9A 1RT3A 1VSFA 3WNGA 4M41A 3E01A 3KD1E 3AVGA 1D9FA 2HHWA 1JLBA 4NCAA 3RWUA 3F73A 4Y1DA 2FBTA 3C6TA 2ETJA 4WE1A 2G8UA 2YV0X 5T7BA 3MXJA 4CJPA 3CQ8A 2HNZA 4CEZA 2IOCA 4CHYA 3FFIA 3VQPA 3EY1A 4DTMA 2JLEA 1NKBA 2VWKA 2VG7A 3M8PA 4M3RA 2OZMA 1IKWA 4DFMA 1WAFA 2KTQA 4DTUA 3NH2A 3OYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VQ5 A;  3SV4 A;  1ZBU A;  2DFH A;  2RKI A;  1NK5 A;  5EU7 A;  1S6P A;  4M3W A;  3TAF A;  4DF8 A;  1RBT A;  5CY4 A;  2Z1J A;  4KHY A;  3AO4 A;  4AHR A;  3O3H A;  3SUN A;  4GVM A;  1T8E A;  1LAW A;  3OYG A;  3AVL A;  3SPZ A;  1D9D A;  1W9H A;  4CGG A;  3SQ0 A;  3ITH A;  3HK2 A;  1IKV A;  3ZSX A;  5J2M A;  2Q3S A;  4E7I A;  4OKJ A;  4B3O A;  4HCB A;  4AH9 A;  4OVL A;  2G8V A;  1TKT A;  4CJW A;  2GBZ A;  4CJ3 A;  3HM9 A;  1XI1 A;  1BL3 A;  3T1A A;  4FK2 A;  1C1C A;  1A5X A;  2GUI A;  4CK3 A;  1C6V A;  1QHT A;  3DYA A;  1S9E A;  3AVH A;  4KKO A;  1S6Q A;  4CJ5 A;  1TKX A;  4CIG A;  5SZT A;  3NHG A;  4H4O A;  1TAU A;  3DI6 A;  3SQ4 A;  4KRE A;  2RF2 A;  4B08 A;  4B9V A;  4Q5V A;  1I39 A;  3ULD A;  3HL8 A;  5CZ2 A;  1KVB A;  4FJL A;  1T05 A;  4CJE A;  2Y1J A;  3KD5 E;  3LP2 A;  3VQ8 A;  5C25 A;  4E7H A;  5SWM A;  3TAM A;  3QEP A;  3V81 A;  1QSY A;  3ZSY A;  3V1O A;  2Z1I A;  2JGU A;  3RTV A;  1Z26 A;  3PV8 A;  2G8F A;  4ELV A;  4EP4 A;  1HNI A;  2YNG A;  4BWM A;  1NK7 A;  3L3V A;  1A5W A;  3DRS A;  4IG0 A;  1SKS A;  2DY4 A;  3SPY A;  1BI4 A;  3PX4 A;  2HHX A;  1U04 A;  4B9M A;  3AVF A;  2QXF A;  1RDD A;  1J5O A;  2YKN A;  4B9U A;  4Z4E A;  1YTA A;  4CEA A;  4E1N A;  3NE6 A;  3TWH A;  2R7Y A;  4AHT A;  3THV A;  1UA1 A;  3AV9 A;  1SKR A;  4M3Z A;  3HT3 A;  4Z4G A;  4ZHR A;  3K59 A;  4FZX C;  4MFB A;  3OYB A;  3KKS A;  4CF8 A;  4J2E A;  3VQD A;  3NGY A;  4F3T A;  1JLF A;  3NH1 A;  3OYM A;  5J2N A;  3CG7 A;  2X6S A;  1I3A A;  2DTU A;  3D45 A;  3C95 A;  3QEV A;  4N41 A;  4EZ6 A;  3LWM A;  4FVM A;  3CM5 A;  5C24 A;  3L2V A;  1WSG A;  5J2Q A;  1LW2 A;  2Z1G A;  4DQP A;  4FJK A;  4FZZ A;  3AO1 A;  3RRG A;  4CJK A;  1C0M A;  4KHS A;  4B8C A;  4OGC A;  4RW9 A;  4CJT A;  3CFR A;  4CHP A;  1U47 A;  2XRI A;  3NF7 A;  3NDK A;  1WSJ A;  1S1T A;  4R5P A;  3V9X A;  3ISN C;  5DMR A;  1N5Y A;  4KAZ A;  3ZSR A;  2ATQ A;  4CGD A;  1A5V A;  4M3Y A;  3HJF A;  5JS1 A;  1D8Y A;  4Z4I A;  2HW3 A;  3CYM A;  2HHQ A;  1NKC A;  1LWF A;  1EKE A;  1CZ9 A;  3KKR A;  1NJY A;  3OJU A;  4KHN A;  3V4I A;  4DQS A;  2PY5 A;  2OPQ A;  1GOB A;  4BWJ A;  3QER A;  5HLF A;  4FLV A;  4DTR A;  4W5O A;  4Z4F A;  1RBR A;  2HHT A;  4IDK A;  3KK1 A;  1NOY A;  4FJM A;  1JXE A;  4KPY A;  3AVB A;  4CEQ A;  1ZBL A;  4CJQ A;  3MEC A;  3G10 A;  4F3O A;  4CHQ A;  3QEI A;  2GV9 A;  3MXM A;  2W42 A;  3C94 A;  1J53 A;  4ID5 A;  4C8N A;  3LP3 A;  4YNQ A;  3KLE A;  4ELT A;  4FLW A;  4DU4 A;  4AIL C;  1VRT A;  1DTT A;  2IDO A;  3ZSQ A;  1CLQ A;  3VQE A;  4ICL A;  3ZT4 A;  2ZD1 A;  3OS1 A;  3T3F A;  3O3G A;  4IG3 A;  1LV5 A;  1ZBF A;  3I0S A;  4IFY A;  4N5S A;  1WSF A;  3ZSV A;  3L2U A;  4JRP A;  2X74 A;  1QTM A;  3QIN A;  1B9F A;  1XWL A;  4KO0 A;  1HNV A;  4FK0 A;  1TKD A;  2HVH A;  3LZJ A;  4H4M A;  1LWE A;  3K5L A;  4N76 A;  1JLC A;  3O4N A;  2XY8 A;  3K5N A;  1KVA A;  1S1U A;  4CJL A;  1JL1 A;  2IC3 A;  1UWB A;  4OGE A;  1SL1 A;  3ZSW A;  3VQ7 A;  3I8D A;  1KLN A;  3U6F A;  4NYF A;  3NF8 A;  1KVC A;  4B9N A;  2KQ2 A;  4O5B A;  5KGW A;  4C8O A;  5J1E A;  2P5O A;  1JLQ A;  4CF2 A;  4ZTF A;  2D0B A;  4DU1 A;  4Q0B A;  1RDA A;  1C1A A;  2P51 A;  3AVM A;  5HRS A;  3IAY A;  4YFU A;  4CJU A;  4FJN A;  2HHU A;  5J2P A;  1ASV A;  4B9S A;  4LSL A;  3L2W A;  4PY5 A;  1UOC A;  2HHS A;  1VSH A;  2IGI A;  3IG1 A;  3QNN A;  3SUO A;  1D5A A;  2LSN A;  4QAG A;  3ZSO A;  4AHV A;  4LH5 A;  1B92 A;  1IKY A;  1ZBI A;  3WNE A;  4HCC A;  1NJZ A;  4IKF A;  3TAB A;  4CHN A;  3NF9 A;  3AVC A;  3P83 D;  3OYC A;  3U3Y A;  3QES A;  3RMB A;  4CCH A;  1LAV A;  3VN5 A;  4CEC A;  4W5R A;  4CF1 A;  4FW1 A;  3VQ4 A;  3ZT0 A;  3PX6 A;  2XY7 A;  1KSP A;  3SNN A;  3VQA A;  3M8Q A;  4CEF A;  1NJW A;  1U49 A;  4O0J A;  3H08 A;  4UQG A;  1B9D A;  1TAQ A;  4OJR A;  4CF9 A;  2Z1H A;  3EYZ A;  3VQC A;  3TI0 A;  2RN2 A;  4CFC A;  4HUG A;  4FJI A;  5FRN A;  3LPU A;  4F8R A;  4KHW A;  5FDL A;  3CFO A;  3VQB A;  4CFB A;  3QEX A;  4DTO A;  4L8R B;  1KRP A;  1RIL A;  4OPK A;  3MED A;  5E41 A;  2ZQB A;  1T03 A;  1U4B A;  2KW4 A;  3K57 A;  1HYZ A;  1KFS A;  4H8K A;  3OY9 A;  1F21 A;  2HNY A;  3DLB A;  4CE9 A;  4FJH A;  4E89 A;  2QK9 A;  1CZB A;  4JS5 A;  3V9U A;  4M3U A;  1K6Y A;  2E4L A;  1JLG A;  1NK0 A;  2HMI A;  3V6D A;  4FJX A;  4CK1 A;  5HBM A;  1EET A;  2XY6 A;  3PY8 A;  5FRM A;  2PYJ A;  4HHT A;  1Q9Y A;  2ZE2 A;  3V1R A;  4DLG A;  1U48 A;  4B8A B;  4E1M A;  4FLU A;  3HP6 A;  3PX0 A;  3ASM A;  3MAQ A;  1BI4 B;  1XHZ A;  1Y97 A;  2F96 A;  3LZI A;  4FLY A;  1ZBH A;  3V9Z A;  1WLJ A;  1SL2 A;  2VG6 A;  4K8Z A;  4CK2 A;  3RMD A;  4W5T A;  3QNO A;  3SZ2 A;  4DTX A;  4FJ8 A;  3AVK A;  4Z4H A;  3SV3 A;  4DF4 A;  4TSX A;  1QSS A;  2YHB A;  3P5J A;  4FK4 A;  4N56 A;  1T7P A;  2PZS A;  4EZ9 A;  2KFZ A;  1U45 A;  2EHG A;  2YNI A;  3V9W A;  4ID1 A;  2VWJ A;  4FLZ A;  2BAN A;  3UIQ A;  3DLR A;  2FBX A;  4N47 A;  3K5M A;  1VSD A;  3LAN A;  2FC0 A;  4CER A;  5CYM A;  1EP4 A;  2A1S A;  1XC9 A;  3G0Z A;  4DQR A;  3K58 A;  3RR8 A;  2YNH A;  1ASW A;  3VA0 A;  3LP0 A;  4AHS A;  3WNH A;  3OYN A;  1L3S A;  1RDC A;  3LWL A;  4FM0 A;  3AVN A;  4FM1 A;  1W0H A;  3TAN A;  1TK0 A;  4FCY A;  4BE0 A;  1IKX A;  1BIS A;  5HRO A;  4CJV A;  1QQC A;  3DLG A;  4IBN A;  3ZT3 A;  4F2R A;  1DTQ A;  5I3U A;  3TR8 A;  4IFV A;  3KLF A;  3NAE A;  3S3O A;  3CM6 A;  4B9T A;  1QS4 A;  2Y1I A;  5KRS A;  3SYZ A;  4FJ7 A;  2KZM A;  4M3T A;  1JLE A;  4BAC A;  1WSH A;  4I9L A;  4FLT A;  2HND A;  1VSM A;  3AO5 A;  3BDP A;  1YT3 A;  2OZS A;  1RT1 A;  2KFN A;  3WNF A;  4MQ3 A;  1IO2 A;  3QIP A;  4O4G A;  1TKZ A;  4FJ9 A;  4FLX A;  2DFE A;  4DSJ A;  3V1Q A;  3ZCM A;  3DLH A;  4DSI A;  3HXM A;  3TAG A;  4NYN A;  4RW7 A;  3SI6 A;  1WN7 A;  3T19 A;  3LAL A;  3L2R A;  4FZY A;  1HRH A;  4JRQ A;  4DU3 A;  1G15 A;  4CF0 A;  2P1J A;  4BDZ A;  1UA0 A;  3HPH A;  5C42 A;  4DFJ A;  4EP5 A;  4DFK A;  3KTQ A;  2XHB A;  4HVJ A;  4NCB A;  4KTQ A;  4PQU A;  1BHL A;  1RT5 A;  3CFP A;  4G1Q A;  4KI6 A;  4CJ4 A;  5HP1 A;  4JS4 A;  1NK6 A;  1N6Q A;  3A2F A;  3OYE A;  4HTU A;  4CJR A;  1RTD A;  4DQI A;  5K14 A;  3NGZ A;  3LP1 A;  2X78 A;  4QOZ B;  4KRF A;  2OYQ A;  4O0I A;  4HUF A;  4BDP A;  1VSK A;  1HQU A;  1HPZ A;  1HYV A;  3JYT A;  2BDP A;  3DLK A;  3NFA A;  3O3F A;  1BCM A;  3QO9 A;  4FJG A;  3AA4 A;  3ZT2 A;  1X9M A;  4RW4 A;  3SUP A;  1TK5 A;  4FXD A;  2FBY A;  3OVN A;  3PUF A;  5DK5 A;  4ELU A;  3ALY A;  2XO7 A;  2WON A;  3OS0 A;  4CED A;  1J54 A;  4DSE A;  2OA8 A;  1YVU A;  3C6U A;  3AO3 A;  4KB0 A;  3LDS A;  1BIU A;  1HYS A;  1RCH A;  3IRX A;  4CGF A;  3DLE A;  4RW6 A;  2HB5 A;  2YKM A;  3F9K A;  1RTJ A;  1TL3 A;  5HRP A;  4CFD A;  4Z0U A;  4DS5 A;  4DMN A;  4KHQ A;  2QKK A;  5KTQ A;  1QSL A;  4FJ5 A;  2D0A A;  3OJS A;  1FXX A;  3VQ9 A;  4OLA A;  1EXQ A;  4I2Q A;  4DTN A;  1S9G A;  4DWI A;  1S1W A;  1S1X A;  1C0U A;  3VQ6 A;  1WSE A;  4CGJ A;  4CGI A;  2O4G A;  1NJX A;  4CIF A;  4W5N A;  1BGX T;  3B6P A;  1VRU A;  4KTZ A;  4C8K A;  3DRR A;  1IG9 A;  1BCO A;  3K2P A;  2IS3 A;  4E0D A;  3OYH A;  1NK8 A;  4DS4 A;  1KTQ A;  2F8S A;  3HVT A;  3DMJ A;  1JLA A;  4DLE A;  3DM2 A;  4DTP A;  3RMA A;  4ZTJ A;  4M3X A;  3NGI A;  3MXI A;  2OPP A;  3TAP A;  1NK4 A;  4PWD A;  3SQ2 A;  3JSM A;  1X9S A;  1JL2 A;  1IH7 A;  2I5J A;  3K5O A;  1L5U A;  4FW2 A;  4E7L A;  1S5J A;  3SUQ A;  4E7K A;  1REV A;  5D3G A;  1KCF A;  4KFB A;  2RPI A;  1BQN A;  1S1V A;  2XY5 A;  2E6L A;  1O1W A;  4CFA A;  3L8B A;  4PA1 A;  4O55 A;  2B4J A;  3S3N A;  4DSL A;  1BIZ A;  5CYQ A;  4I9Q A;  1J9A A;  4LH4 A;  4PUO A;  1NKE A;  1RTH A;  1BQM A;  1WSI A;  1NK9 A;  3TAQ A;  1VK0 A;  1TVR A;  1SL0 A;  4I2P A;  4AHC A;  1RBV A;  1Q8I A;  3B6O A;  2HVI A;  1NOZ A;  3MEE A;  1RNH A;  1YTU A;  4W5Q A;  4JLH A;  4DQQ A;  3U3G A;  4CEO A;  2BGG A;  4C8M A;  5CZ1 A;  3HST B;  4CHZ A;  4FM2 A;  4RW8 A;  2ITG A;  3VA3 A;  3QET A;  4FJJ A;  2HHV A;  1HJR A;  3KLH A;  1RBU A;  4KHU A;  2G8I A;  2F8T A;  3TAE A;  1JKH A;  3QIO A;  4DSK A;  2D0C A;  1KLM A;  3LAK A;  4CEB A;  2AJQ A;  3AVI A;  2KZZ A;  1RT7 A;  3AA2 A;  3L2Q A;  2P5G A;  3RRH A;  4C8L A;  1ITG A;  1KFD A;  5FRO A;  4J2B A;  1EX4 A;  4J2D A;  4OLB A;  3AO2 A;  1C1B A;  4DTJ A;  5HRR A;  2B6A A;  1TGO A;  1UAX A;  2PYL A;  3AA5 X;  3S3M A;  1GOA A;  3D0P A;  1RT2 A;  1HMV A;  1L3U A;  3OYA A;  4KB1 A;  3RMC A;  3IS9 A;  3LAM A;  3TAR A;  3AVA A;  1WAJ A;  3BGR A;  3KIO A;  3L3U A;  3OYL A;  3OYF A;  2QKB A;  4LY7 A;  4CES A;  4CHO A;  2G8K A;  3NCI A;  2VG5 A;  3M8R A;  2EX3 A;  4KI4 A;  4DSF A;  4Z4C A;  2BE2 A;  1FKP A;  1CXU A;  3HPG A;  3M8S A;  1LW0 A;  3PO4 A;  3V9S A;  3ZT1 A;  1SKW A;  1FKO A;  3NH0 A;  1HQE A;  4LD0 A;  3HPO A;  4RG8 A;  1TV6 A;  1MU2 A;  3SJJ A;  3O4Q A;  4FYD A;  2FBV A;  1TK8 A;  4CEE A;  1LWC A;  1X9W A;  3NBP A;  4M45 A;  3PO5 A;  3HO1 A;  1VSI A;  4OPJ A;  5I42 A;  4Y1C A;  2G8H A;  4OKE A;  4DTS A;  4KTW A;  1L3V A;  4XIU A;  3HYF A;  4DG1 A;  3SCX A;  4B9L A;  1JXB A;  4GW6 A;  2YNF A;  3MEG A;  1Q9X A;  2NUB A;  3AVJ A;  3ZSZ A;  5JS2 A;  4CGH A;  4E19 A;  4LSN A;  4O44 A;  5KGX A;  2YHA A;  4M42 A;  2D5R A;  4KV8 A;  1RBS A;  1VSJ A;  3NF6 A;  1Z25 A;  4E3S A;  2WOM A;  1QE1 A;  3S9H A;  2B5J A;  2OPR A;  4CJF A;  4OKK A;  3LPT A;  4BE1 A;  1CXQ A;  2DFF A;  5KRT A;  4F2S A;  1DLO A;  4HUE A;  4BDY A;  1X1P A;  4K8X A;  4GMJ B;  4I7F A;  1TL1 A;  4J2A A;  3DOK A;  4CIE A;  1RT6 A;  2IAJ A;  4CJS A;  2E6M A;  3OS2 A;  1FK9 A;  3KK2 A;  1RT4 A;  5HRN A;  1XHX A;  2OPS A;  4F4K A;  1GOC A;  4NCG A;  3KJV A;  1SUQ A;  4E7J A;  1ASU A;  3KLI A;  1R0A A;  2A1R A;  5KI6 A;  1WNS A;  3QEW A;  1VSE A;  3VQQ A;  4AHU A;  3OYI A;  1SV5 A;  3OYK A;  3EZ5 A;  3DRP A;  4BE2 A;  3AA3 A;  3HVR A;  3P1G A;  3SQ1 A;  2O4I A;  2X6N A;  1C0T A;  3KLG A;  3OYD A;  1ZYQ A;  1L3T A;  3I0R A;  4DFP A;  3KK3 A;  3RR7 A;  1VSL A;  1RTI A;  1RDB A;  2G8W A;  4QCL A;  3DOL A;  3QLH A;  3HP9 A;  1RT3 A;  1VSF A;  3WNG A;  4M41 A;  3E01 A;  3KD1 E;  3AVG A;  1D9F A;  2HHW A;  1JLB A;  4NCA A;  3RWU A;  3F73 A;  4Y1D A;  2FBT A;  3C6T A;  2ETJ A;  4WE1 A;  2G8U A;  2YV0 X;  5T7B A;  3MXJ A;  4CJP A;  3CQ8 A;  2HNZ A;  4CEZ A;  2IOC A;  4CHY A;  3FFI A;  3VQP A;  3EY1 A;  4DTM A;  2JLE A;  1NKB A;  2VWK A;  2VG7 A;  3M8P A;  4M3R A;  2OZM A;  1IKW A;  4DFM A;  1WAF A;  2KTQ A;  4DTU A;  3NH2 A;  3OYJ A; 
#chains in the Genus database with same CATH topology
 3VQ5 A;  3SV4 A;  4MDB A;  1NK5 A;  5EU7 A;  3TAF A;  2GEL A;  4DF8 A;  3A5M C;  1X3N A;  5C12 A;  3SPZ A;  1W9H A;  3ENH A;  3ITH A;  4JI1 K;  4M7Y A;  2Q3S A;  5AZJ A;  5ADX H;  3H45 C;  1GLE G;  2GBZ A;  4CJ3 A;  1LOT B;  1BL3 A;  5AQR A;  3ZEU B;  3T1Y K;  1BUP A;  4CJ5 A;  1S6Q A;  1QVF M;  1YJN N;  4B08 A;  1M90 O;  4Q5V A;  5CZ2 A;  3R3L A;  1T05 A;  1GLC G;  1NGG A;  5C25 A;  5SWM A;  2WUS A;  2FSK A;  4ELV A;  4NB4 A;  1Z26 A;  3PV8 A;  4EP4 A;  2YNG A;  3A5N C;  1NK7 A;  4IG0 A;  3SPY A;  1BI4 A;  3O80 A;  1U04 A;  3J7Z O;  1RDD A;  4CZF A;  4ISG A;  1YTA A;  4E1N A;  2YI1 A;  3THV A;  4M3Z A;  3AV9 A;  3H3N O;  2E2Q A;  5AZI B;  3OYB A;  3KKS A;  3NGY A;  3THX B;  1I3A A;  2FF3 B;  4H5T A;  3C95 A;  2QWR A;  4EZ6 A;  2ZGY A;  4FWN A;  1WSG A;  1LW2 A;  5BRH A;  3HBT A;  4FZZ A;  4A62 A;  2QW9 A;  4OGC A;  5JVH L;  1ILY A;  1JJ2 M;  3GDQ A;  3NF7 A;  3V9X A;  3VTI A;  4BGA A;  4KAZ A;  5JS1 A;  2HW3 A;  3CYM A;  4BRE A;  1CZ9 A;  4GKJ K;  5BRF A;  3V4I A;  4DQS A;  1GOB A;  1VQ8 N;  4FWK A;  4IDK A;  2BUP A;  3U9D A;  1ZBL A;  4DKW A;  1OH5 A;  3MXM A;  3WT0 A;  4YNQ A;  3G4S N;  4DU4 A;  1VRT A;  3CCM N;  2IDO A;  3ZSQ A;  2JWK A;  4FPA A;  4ICL A;  2YJF A;  3CPE A;  3I0S A;  4N5S A;  4NXN K;  2Q97 A;  4DR7 K;  1NGA A;  2X74 A;  1QTM A;  2WC9 A;  2RE2 A;  4JD2 B;  1HNV A;  4FK0 A;  1LWE A;  3VTH A;  1EO1 A;  3K5N A;  1S1U A;  4CJL A;  2IC3 A;  1UWB A;  3QBW A;  3J7Y P;  3U6F A;  4NYF A;  3R9P A;  5J1E A;  1VQP N;  4ZTF A;  3QFU A;  3UKU A;  2NRW A;  5HRS A;  4ILG B;  2CGK A;  4C1N I;  1NM1 A;  5FLX O;  3IG1 A;  3QNN A;  4FOE A;  2LSN A;  4JI8 K;  1NWK A;  3ZSO A;  1B92 A;  1YUW A;  1ZBI A;  3DXM B;  2QM1 A;  5GAG P;  3WNE A;  4H5R A;  1NJZ A;  4IKF A;  4EFH A;  3U3Y A;  3FZF A;  3P83 D;  3OYC A;  4CCH A;  4W5R A;  2V7Z A;  2XY7 A;  1KSP A;  3M8Q A;  1K9M O;  1QHA A;  3JS6 A;  4UQG A;  1TYQ B;  4CF9 A;  1ESV A;  3EYZ A;  4CFC A;  4FJI A;  5FRN A;  3LPU A;  3CFO A;  3LDL A;  4DTO A;  3EL2 A;  2D1K A;  1T03 A;  5KPT A;  5FPN A;  3K57 A;  1HYZ A;  4H8K A;  3DLB A;  4CZH A;  1DKG D;  4JS5 A;  3V9U A;  1OH6 A;  2HMI A;  5HBM A;  1EET A;  3HOS A;  4BRC A;  5FRM A;  4EIA A;  4HHT A;  1U48 A;  4E1M A;  3TTD A;  3HP6 A;  3PX0 A;  1JCF A;  2F4V K;  4FLY A;  1GLA G;  4CBX A;  4CK2 A;  2A42 A;  5JIC A;  3CCJ N;  1T3V A;  3RMD A;  3SV3 A;  2YHB A;  3GL1 A;  4FK4 A;  1WBD A;  4EZ9 A;  2HBK A;  3CJ1 A;  3F9M A;  5BR8 K;  2EHG A;  2YNI A;  4BR2 A;  2BAN A;  3K9K A;  3OHR A;  2FBX A;  1VSD A;  4DR2 K;  3DAW A;  4BC5 A;  1EP4 A;  3Q7B A;  2QWM A;  4BRP A;  2YNH A;  3LP0 A;  5AQJ A;  3KK7 A;  3LWL A;  4FM0 A;  5F2R A;  4CJV A;  3DLG A;  4IBN A;  3NAE A;  4GV6 A;  3L4I A;  1IJJ A;  3D7E O;  4HTL A;  4B1V A;  1RT1 A;  3WNF A;  1IO2 A;  3QIP A;  4FJ9 A;  4DSJ A;  2YJE A;  3ZCM A;  5FPE A;  4IOC L;  3DLH A;  2EWS A;  3SI6 A;  3T19 A;  1I94 K;  3LAL A;  4FZY A;  4IJA A;  3E9P A;  4JRQ A;  1G15 A;  3ATU A;  2NZT A;  1K73 O;  4KTQ A;  4KI6 A;  2O8F B;  4JS4 A;  1NK6 A;  3OYE A;  1RTD A;  5C15 A;  2X78 A;  3VEZ A;  2OYQ A;  4O0I A;  4WFA L;  1HPZ A;  1QQO A;  4ISE A;  3NFA A;  5DM7 L;  5CE3 A;  4GKK K;  3QO9 A;  4AM6 A;  4FXD A;  3SUP A;  4NLB A;  2HBM A;  3LDQ A;  2XO7 A;  2WON A;  2OA8 A;  4BRM A;  3LDS A;  4YHH K;  1RCH A;  4CGF A;  1YI2 N;  3DLE A;  3IDH A;  4LF4 K;  4LF5 K;  1CZA N;  2W41 A;  5KTQ A;  2D0A A;  3NVM A;  3EE9 A;  3OJS A;  1FXX A;  3VEY A;  1KQS M;  4OLA A;  4I2Q A;  3WXI A;  1S1X A;  1K8K A;  4CJ7 A;  1Q86 O;  1NJX A;  5LMU K;  1BGX T;  3B6P A;  1BCO A;  3K2P A;  1NK8 A;  1KTQ A;  2QWO A;  4DLE A;  4H0X B;  3DM2 A;  3VEV A;  1ZXO A;  4YDU A;  3MXI A;  4PWD A;  2A40 A;  1X9S A;  3IMX A;  1JL2 A;  4LFA K;  3KHY A;  1S5J A;  4J8F A;  4E7K A;  1REV A;  1BQN A;  5AFU A;  3ZET A;  4CFA A;  2NRX A;  4BRA A;  4I9Q A;  4LH4 A;  4M7X A;  4CZG A;  3LDN A;  1TVR A;  4BR4 A;  1SL0 A;  2QA4 N;  1RBV A;  4XH1 A;  1NGJ A;  4JLH A;  2BGG A;  3U3G A;  4FWM A;  4RW8 A;  1HJR A;  1FW6 A;  2QEX N;  3D2E A;  1GLL O;  3IFR A;  2D0C A;  3AVI A;  3RRH A;  4BG8 A;  2W6K A;  1C1B A;  3D6R A;  1YHQ N;  1HR0 K;  2W6L A;  3AA5 X;  3VEX A;  3S3M A;  1WOQ A;  4FPB A;  2P9L A;  1L3U A;  3OYA A;  1NGI A;  3IS9 A;  4JKE A;  3AVA A;  4JYA K;  3KIO A;  3UKR A;  1QQN A;  3L3U A;  4BR0 A;  4X62 K;  4WF9 L;  2QKB A;  4IO8 A;  4IOA L;  3NCI A;  2JWL A;  4K41 A;  3TTF A;  3CC4 N;  3E9O A;  4OPA A;  3V9S A;  3ZT1 A;  3GOI A;  1SKW A;  4YOW A;  4LD0 A;  3SJJ A;  3O4Q A;  4U67 L;  1LWC A;  1X9W A;  3L0Q A;  1U2V B;  3PSF A;  2G8H A;  3MN5 A;  4KTW A;  4MO4 A;  4DG1 A;  3SCX A;  4B9L A;  1JXB A;  3A0I X;  4B9Q A;  2E1Z A;  4E19 A;  5JS2 A;  4LSN A;  4O44 A;  5EOY A;  5KGX A;  2O8C B;  3T7Z A;  1VSJ A;  3MWT A;  1HKB A;  4PHT X;  2WOM A;  2B5J A;  1Y64 A;  4WFB L;  3CHW A;  4CJF A;  4OKK A;  4OO1 J;  4F2S A;  3Q7C A;  1TL1 A;  5JLF A;  3CCQ N;  4JI3 K;  1RT6 A;  4CJS A;  1FK9 A;  3KK2 A;  3ID6 A;  1GOC A;  3KJV A;  1SUQ A;  3D2F B;  4E7J A;  5JVG L;  1NBW A;  1ASU A;  3SAF A;  2A1R A;  1WNS A;  1VSE A;  5KQD A;  3OYI A;  2O4I A;  3OYK A;  3EZ5 A;  2X6N A;  1ZYQ A;  1NGH A;  3CQY A;  1N8R O;  3DOL A;  3GG4 A;  1VSF A;  4M41 A;  3R6M A;  3KD1 E;  1Q18 A;  4KH6 A;  4WE1 A;  4CJP A;  4DTM A;  2IOC A;  5M1Q A;  2F7T A;  4GV9 A;  5AR0 A;  2OZM A;  3G25 A;  1IKW A;  3NH2 A;  3WQU A;  1ZBU A;  2RKI A;  3FZK A;  3WEE B;  5CY4 A;  4KHY A;  4BRL A;  3O3H A;  3SUN A;  4GVM A;  4CGG A;  4FWR A;  3HOT A;  3ZSX A;  4DV7 K;  4AH9 A;  3C7N A;  1NNE A;  1TKT A;  3N4P A;  1MWM A;  3BZC A;  1KAY A;  3T1A A;  4H0T B;  4PKH A;  1C1C A;  4RWT A;  3FE1 A;  2GUI A;  1C6V A;  2VQF K;  2A5X A;  2ZF5 O;  5SZT A;  1TKX A;  3NHG A;  1ZBS A;  1TAU A;  3DI6 A;  5AQK A;  4A57 A;  2UXB K;  2Y1J A;  1GLJ O;  3HM8 A;  3TAM A;  1QSY A;  3V1O A;  3MWP A;  4I6M A;  3QFP A;  2JGU A;  1T6C A;  1D4X A;  1VQL N;  5EX5 A;  3I33 A;  2HBL A;  3L3V A;  4FL9 A;  2YHY A;  3BUZ B;  2P9U B;  4B9M A;  3P39 A;  3KWG A;  3TSU A;  2YKN A;  2A41 A;  3E66 A;  2R7Y A;  3TWH A;  1SKR A;  2GX9 A;  4DR4 K;  2ZJR L;  3ZX2 A;  1E4F T;  3OYM A;  2HMP A;  3CG7 A;  2DTU A;  3LWM A;  3M1F A;  3N4Q A;  5C24 A;  4CZK A;  1GLF O;  2PAV A;  5E26 A;  3RRG A;  1EWR A;  4CJK A;  4KHS A;  2HF3 A;  3BEX A;  1SZ2 A;  1NMN A;  5AQX A;  4R5P A;  4JKG B;  3THW A;  1N5Y A;  1N34 K;  1A5V A;  3HJF A;  3OW2 M;  2YHW A;  4Z4I A;  2HHQ A;  1LWF A;  2IVP A;  2H3G X;  3KKR A;  3KZB A;  1VQO N;  4KHN A;  4JNE A;  2DPN A;  2OPQ A;  4FLV A;  1RBR A;  2V51 B;  2GTD A;  2Q31 A;  3RSE A;  2ASM A;  4WQ5 A;  3MEC A;  3G10 A;  4CZI A;  3LM2 A;  1J53 A;  4ELT A;  3C6A A;  4AIL C;  1DTT A;  2QI2 A;  1CLQ A;  3ZT4 A;  3O8M A;  4AF1 A;  3F2K A;  1WSF A;  3IUC A;  2FLO A;  4WQ4 A;  3QIN A;  3LZJ A;  3K5L A;  4HWI A;  3O4N A;  1KVA A;  1MDU B;  5AQN A;  3O9R A;  1JL1 A;  1LCU A;  4OGE A;  3CCV N;  4CVN E;  1KVC A;  4MLH A;  5KGW A;  3SMS A;  4C8O A;  1GLD G;  4CF2 A;  2KKZ A;  2D0B A;  3O08 A;  1RDA A;  1C1A A;  2HHU A;  4LSL A;  2CGL A;  1ATN A;  3O9S A;  3SLC A;  4QAG A;  4AHV A;  1G99 A;  1S72 N;  1IKY A;  2KZM A;  4CHN A;  3HK2 A;  3VN5 A;  1XC3 A;  4FW1 A;  4CF1 A;  3VQ4 A;  3ZT0 A;  3CF5 L;  4JV5 K;  4A59 A;  5AZJ B;  1J5E K;  3EE8 A;  3H08 A;  1N36 K;  5IWA K;  3TI0 A;  4LC9 B;  3FZL A;  4F8R A;  5FDL A;  1SS6 A;  4CFB A;  1HKC A;  3QEX A;  1DT9 A;  1KRP A;  2RHK A;  2VWB A;  3MED A;  3CI5 A;  2QK9 A;  4E89 A;  5AQQ A;  5KPR A;  4M3U A;  1K6Y A;  1JLG A;  2P9I A;  3PY8 A;  2PYJ A;  1Q9Y A;  1M1K O;  3V1R A;  4BRK A;  3ASM A;  3MAQ A;  1RDU A;  1BI4 B;  2HHH K;  4IDH A;  4W5T A;  4FSV A;  4DTX A;  4FJ8 A;  4Z4H A;  5TKW A;  1QSS A;  3ZX3 A;  2PZS A;  2KFZ A;  4GVE A;  3UIQ A;  4ID1 A;  4BR5 A;  4FLZ A;  4FWQ A;  2UUC K;  4CER A;  5CR4 A;  3QDK A;  2Q0U A;  4O5F A;  3G0Z A;  4DQR A;  1ATR A;  3RR8 A;  3OYN A;  3K0S A;  4LF9 K;  3CMA N;  3CXC M;  2Q2R A;  2O8B A;  1IKX A;  1EWQ A;  4IFV A;  4B9T A;  3SYZ A;  4M3T A;  2WBN A;  1J6Z A;  4I9L A;  5EY4 A;  1VSM A;  3AO5 A;  3A5L C;  3JAM O;  1YT3 A;  4AQY K;  2OZS A;  4MQ3 A;  4XH5 A;  4WYB A;  3UB5 A;  5LMN K;  4FLX A;  4RW7 A;  3DXK A;  3AGR A;  3T1H K;  2P9P A;  3TSQ A;  4BRO A;  2P1J A;  4R79 A;  4BDZ A;  4DFJ A;  1UA0 A;  3KTQ A;  2XHB A;  1QQM A;  3CFP A;  1RT5 A;  3FZM A;  5HP1 A;  2CGJ A;  3A2F A;  5K14 A;  1VSK A;  3RVC A;  1HYV A;  3DLK A;  5BN9 A;  5IT9 O;  3SAH A;  1BCM A;  5M1K A;  2GUP A;  1KD1 O;  4RW4 A;  2FBY A;  4ELU A;  3PLA A;  3OS0 A;  4CED A;  1J54 A;  4FWS A;  3C6U A;  4KB0 A;  3AO3 A;  1BIU A;  4DR6 K;  4L3Q A;  4RW6 A;  2HB5 A;  3F9K A;  3UKU B;  1Q82 O;  4Z0U A;  1QSL A;  4FJ5 A;  3CJA A;  3BF3 A;  4ILH A;  2ZGZ A;  3P31 A;  1S9G A;  4PY5 A;  4CGJ A;  4CGI A;  5EVZ A;  4CIF A;  1VRU A;  3DRR A;  5JLH A;  1IG8 A;  2F8S A;  3HVT A;  3DMJ A;  1JLA A;  3RMA A;  3VPZ A;  4ZTJ A;  4M3X A;  3NGI A;  1NK4 A;  3JSM A;  2I5J A;  3K5O A;  1L5U A;  4FW2 A;  4E7L A;  1XQS C;  4B3T K;  2RPI A;  3ZX0 A;  4B1W B;  1S1V A;  4LFC K;  3DLL L;  3S3N A;  4O55 A;  5AQS A;  4DSL A;  1BIZ A;  4PUO A;  1JCE A;  1NGF A;  2UUB K;  1WSI A;  1NK9 A;  1VK0 A;  4AHC A;  1Q8I A;  2HVI A;  1R59 O;  2P9K A;  1RNH A;  4KH5 A;  1YTU A;  4W5Q A;  4CEO A;  5CZ1 A;  3VA3 A;  3QET A;  1VHX A;  4FJJ A;  1RBU A;  4JKB A;  2D0P A;  3H3O B;  3QIO A;  4CEB A;  1V4S A;  4Z94 A;  2AJQ A;  4DR5 K;  2KZZ A;  2O8D A;  5C2D A;  3KVG A;  1KFD A;  1EX4 A;  2NLX A;  5JMV A;  4MDA A;  2B6A A;  1UAX A;  1BU6 O;  5BR9 A;  4B1U B;  4F9O A;  1HMV A;  3EZW A;  4BVP A;  3LAM A;  3HI0 A;  3BGR A;  3OYF A;  4XH4 A;  4CES A;  5C2F A;  2EX3 A;  4KI4 A;  4Z4C A;  3ULE A;  3M8S A;  3HPG A;  1DGK N;  4CI6 A;  1HQE A;  4WCE L;  4BQZ A;  3HPO A;  4RG8 A;  5AFU H;  1MU2 A;  4DV5 K;  3CCL N;  1TK8 A;  4CEE A;  3PO5 A;  4M45 A;  4OPJ A;  4OKE A;  3HYF A;  3THY A;  3PIO L;  3EEQ A;  4GW6 A;  4KBO A;  4CGH A;  5AQT A;  4X65 K;  1VQK N;  4M42 A;  4KV8 A;  4H5V A;  4JHD A;  4PKG A;  1Z25 A;  3CCE N;  1QE1 A;  3P4I A;  3S9H A;  2DFF A;  5KRT A;  4HUE A;  1NGE A;  1VQ9 N;  4LFB K;  4CIE A;  2IAJ A;  3OS2 A;  3MN6 A;  4H0Y B;  4BY9 C;  3OA9 A;  4QS9 A;  1WB9 A;  5I9E B;  3KLI A;  3OBW A;  3DRP A;  3HVR A;  3P1G A;  3BP8 A;  3KLG A;  4JN4 A;  4QCL A;  3KK3 A;  1VSL A;  1RDB A;  2G8W A;  4A61 A;  3PIP L;  5AQG A;  3AVG A;  1KXP A;  1JLB A;  1IBM K;  2ETJ A;  3M6G A;  1C0G A;  3MXJ A;  2HNZ A;  3EY1 A;  3FFI A;  3VQP A;  1ATS A;  1K8K B;  4LF8 K;  5BPM A;  2P9N A;  3G6E N;  4BRN A;  3OYJ A;  2D4W A;  2DFH A;  4M3W A;  1S6P A;  2UU9 K;  3L6Q A;  2HF4 A;  3AO4 A;  4AHR A;  3SQ0 A;  1IKV A;  5GAE P;  5J2M A;  3ZET B;  4OKJ A;  4HCB A;  1EQY A;  3HM9 A;  1XI1 A;  4FK2 A;  1A5X A;  1VQ6 N;  4JKA A;  2YX6 A;  1S9E A;  4KKO A;  4CIG A;  4DQ8 A;  1VQ7 N;  3SQ4 A;  2RF2 A;  1YAG A;  3NVK A;  4JI7 K;  1I39 A;  2UYT A;  2QXL A;  3D2E B;  3HL8 A;  5LJV A;  1IBK K;  2NRV A;  3MK6 A;  4FJL A;  3KD5 E;  1HNW K;  5B8H A;  3VQ8 A;  5F0X A;  1N33 K;  3QEP A;  3MCA B;  2Q0R A;  3RTV A;  1Q7Y O;  1HNI A;  2O8E A;  3M3Z A;  1HJO A;  4BRI A;  1OH7 A;  1A5W A;  1TUY A;  2AA4 A;  1SKS A;  3PX4 A;  2HHX A;  2P9L B;  3AVF A;  1NMD A;  4IEI A;  3UKR B;  4B9U A;  3QIC A;  4DV0 K;  3NE6 A;  4Z4E A;  4Z4G A;  3CQX A;  3HT3 A;  4ZHR A;  3K59 A;  1SQK A;  2VCP A;  4FZX C;  4K25 A;  4F3T A;  1JLF A;  3NH1 A;  2X6S A;  3D45 A;  3QEV A;  4N41 A;  5AQL A;  4FVM A;  4RTF D;  5BPL A;  4DQP A;  4H0V B;  3KWI A;  1C0M A;  1XMQ K;  4B8C A;  4BRG A;  3VEO A;  4X66 K;  1S1T A;  5AQP A;  5DMR A;  4M3Y A;  3HRG A;  3ZSR A;  2ATQ A;  1D8Y A;  4JKD A;  4JK7 A;  4YOX A;  2NRZ A;  3VGL A;  1NJY A;  4WFN L;  2PY5 A;  2HHT A;  4DTR A;  3ID8 A;  4QS7 A;  3KK1 A;  3C0B A;  1KAZ A;  3VMF B;  4O8U A;  4CJQ A;  3TTC A;  3QEI A;  1OKJ A;  4CZE A;  2PBD A;  3KLE A;  1FJG K;  4FLW A;  1BDG A;  3OS1 A;  1NLV A;  2ZD1 A;  4GY2 B;  1ZBF A;  3A5O C;  3LM9 A;  5F1X A;  1W2B M;  3AAQ A;  3HZ6 A;  4JRP A;  5A2Q O;  1TKD A;  3CC2 N;  2HVH A;  4H4M A;  2XY8 A;  1SL1 A;  3ZSW A;  3VQ7 A;  3I8D A;  4BVO A;  3EKU A;  3NF8 A;  4B3R K;  1JLQ A;  4DU1 A;  4Q0B A;  3OBY A;  3AVM A;  3O9Q A;  3ENO A;  4C1N K;  4FJN A;  3HTV A;  4CZJ A;  5J2P A;  4B9S A;  3L2W A;  4DV1 K;  2HHS A;  4QS8 A;  1D5A A;  4LH5 A;  4HCC A;  3TAB A;  3EO3 A;  3QES A;  2FSJ A;  1U6Z A;  2WFB A;  2ZJP L;  3PX6 A;  4DTU A;  3SNN A;  3VF6 A;  3VQA A;  1NJW A;  1U49 A;  3C7N B;  3FGU A;  3SMP A;  1NGB A;  2Z1H A;  3FR0 A;  3SAG A;  4IZ9 A;  4L8R B;  1Z6R A;  2P9S A;  4OPK A;  3J7A P;  3ATV A;  5EXW A;  3J81 O;  1U4B A;  3C6H A;  3CD6 N;  4AM7 A;  4Y0W A;  1KFS A;  4FOI A;  4FJH A;  4CE9 A;  1CZB A;  1VQ5 N;  3V6D A;  4CK1 A;  1WBB A;  2E2O A;  2E2P A;  4I6M B;  4B8A B;  1XHZ A;  3LZI A;  1SL2 A;  4H03 B;  3A8Y A;  4K8Z A;  3AVK A;  4DF4 A;  4U7B A;  3VEN A;  4N56 A;  2IVN A;  2VWJ A;  1HKG A;  4N47 A;  3LAN A;  4IO9 L;  2FC0 A;  3WXL A;  2A1S A;  1XC9 A;  3K58 A;  2I7P A;  3VER A;  4JKC A;  4AHS A;  3VA0 A;  3WNH A;  1HNZ K;  3U9Z A;  4FVU A;  3AVN A;  1IBL K;  5HRO A;  1QQC A;  3ZT3 A;  2AP1 A;  2J4R A;  4F2R A;  1W97 L;  5I3U A;  3TR8 A;  3KLF A;  3CM6 A;  2QWN A;  2Y1I A;  5KRS A;  1YVN A;  3EN9 A;  5TKY A;  3AAR A;  4BAC A;  3THW B;  3R1X A;  4BRF A;  4KHP K;  4E1J A;  4DB3 A;  2KFN A;  1V4T A;  4O4G A;  1OH8 A;  1TKZ A;  3CET A;  5BRD A;  3V1Q A;  4B1X B;  1W7A A;  3HXM A;  4JEP A;  4NYN A;  3RSE B;  4CF0 A;  3O9U A;  3HPH A;  5C42 A;  4EP5 A;  4JK8 A;  4CZL A;  4NCB A;  5AQM A;  1BHL A;  4UY8 O;  4G1Q A;  4MLE A;  4CJ4 A;  1N6Q A;  3BZK A;  4EAH D;  4HTU A;  4CJR A;  3JXU A;  3NGZ A;  5AQI A;  3O3F A;  3ENB A;  1X9J A;  4FJG A;  1RDW X;  4A2A A;  4K42 A;  5DK5 A;  3PUF A;  3O6W A;  4DSE A;  4A5A A;  4A2B A;  1NGC A;  5HRP A;  2CH6 A;  5GAH P;  4DV6 K;  2YHX A;  2OTL N;  3VQ9 A;  3QB0 A;  3CCU N;  1C0U A;  1XMO K;  4YOV A;  2KLA A;  4E0D A;  4KTZ A;  4C8K A;  4V19 S;  5ELZ A;  4B3M K;  4BC3 A;  2IS3 A;  3OYH A;  4DS4 A;  4YDU C;  2NRT A;  4DTP A;  2OPP A;  3TAP A;  4JI2 K;  3SQ2 A;  3LDO A;  1IH7 A;  3MDQ A;  5HOO A;  5D3G A;  1KCF A;  4KFB A;  2CH5 A;  2XY5 A;  4XEI A;  1O1W A;  1OVQ A;  3WUH A;  4PA1 A;  4BGB A;  2B4J A;  1BOT O;  3MN7 A;  1J9A A;  1NKE A;  1RTH A;  2NNW A;  1BQM A;  3ZEU A;  3DJC A;  4NLC A;  3TAQ A;  1YF5 L;  4I2P A;  2D0O A;  3FFK B;  3B6O A;  3MEE A;  4DQQ A;  2PFU A;  4C8M A;  4CHZ A;  3HST B;  2ITG A;  1XNR K;  2HHV A;  2P9I B;  2G8I A;  5FPD A;  4LF6 K;  2F8T A;  4ISF A;  3CER A;  2W40 A;  1RT7 A;  3CJC A;  2UUA K;  1ITG A;  2A3Z A;  2IIR A;  3W0L A;  5M1P A;  4J2B A;  4OLB A;  3AO2 A;  4DTJ A;  5HRR A;  3E9L A;  1TGO A;  1H1V A;  4IWV A;  3O1B A;  1GOA A;  1YXQ A;  2VQE K;  3RMC A;  5AQY A;  3TAR A;  5BN8 A;  3OYL A;  4LY7 A;  4CHO A;  5AZI A;  2BE2 A;  1FKP A;  1BG3 A;  3THX A;  1FKO A;  3NH0 A;  2O8B B;  1TV6 A;  1BA1 A;  4FYD A;  1KAX A;  3HO1 A;  2HST A;  1L3V A;  4XIU A;  3LL3 A;  2ZJQ L;  1GLB G;  2YNF A;  1JCG A;  3MEG A;  2NUB A;  3AVJ A;  2QWP A;  1RBS A;  1RFQ A;  3DXK B;  4E3S A;  1T6D A;  2P9P B;  4BR7 A;  3S41 A;  5AQH A;  3VES A;  3LPT A;  5KQ8 A;  1CXQ A;  1DLO A;  5ADX A;  4GMJ B;  4I7F A;  3VOV A;  4J2A A;  3I8B A;  5HRN A;  1XHX A;  4F4K A;  4NCG A;  3WXJ A;  1NJI O;  4PL7 A;  3TU5 A;  4BG9 A;  5KI6 A;  1XNQ K;  3F5T A;  4AHU A;  3QML A;  2E2N A;  3SQ1 A;  3SBG A;  1C0T A;  4JD2 A;  1L3T A;  3I0R A;  4PL8 A;  5GIO A;  1RTI A;  3O1W A;  3J80 O;  3H6E A;  3QLH A;  3HP9 A;  4CW7 B;  3WNG A;  3E01 A;  1YIT N;  4H0P A;  4BR9 A;  3F73 A;  2FBT A;  2YV0 X;  3M5R A;  4CEZ A;  4CHY A;  2VG7 A;  3M8P A;  4M3R A;  3MN9 A;  1HUX A;  3DWL A;  3HSC A;  2KTQ A;  3O9T A;  3AGK A;  1RBT A;  2Z1J A;  4CD1 A;  3AAP A;  3DXM A;  1HNX K;  4DHY A;  3H1V X;  1LAW A;  3OYG A;  3AVL A;  1T8E A;  1D9D A;  3FLC O;  4E7I A;  3CCR N;  4B3O A;  4YY3 K;  4OVL A;  2G8V A;  2QTD A;  1TYQ A;  4CJW A;  5GAD P;  1NU0 A;  4CK3 A;  1QHT A;  3DYA A;  3AVH A;  2P9K B;  2NRH A;  3VGM A;  3I56 N;  1HPM A;  4H4O A;  4DUY K;  1MWK A;  1XUP O;  5C0Y A;  4KRE A;  4K0K K;  4B9V A;  1IV0 A;  3ULD A;  2Q36 A;  1KVB A;  4CJE A;  3LP2 A;  4E7H A;  3V81 A;  3ZSY A;  2O8D B;  5DM6 L;  2Z1I A;  2G8F A;  3EKS A;  4BWM A;  3DRS A;  2DY4 A;  4C23 A;  1OVY A;  2QXF A;  1J5O A;  4CEA A;  1RGI A;  1UA1 A;  3VEW A;  4AHT A;  2ASP A;  4MFB A;  1VAZ A;  3MX2 A;  4CF8 A;  3ULE B;  4J2E A;  2ZM6 K;  3VQD A;  3SJH A;  2NRR A;  5J2N A;  4K43 A;  4G9Z A;  4EHU A;  4CZM A;  5GIN A;  3CM5 A;  3L2V A;  2FF6 A;  5J2Q A;  3L4Q A;  1VQM N;  2Z1G A;  4FJK A;  4OPH A;  3AO1 A;  4NO7 A;  4RW9 A;  4CJT A;  3CFR A;  4BRH A;  4CHP A;  4YOT A;  1U47 A;  2F9T A;  3THY B;  2XRI A;  3NDK A;  3CIP A;  2I7N A;  1WSJ A;  2E8A A;  3ISN C;  2VGM A;  4CGD A;  5FPM A;  4JHD B;  1NKC A;  3OTO K;  1EKE A;  3OJU A;  2HOE A;  2YCH A;  4LF7 K;  4BWJ A;  3QER A;  2V52 B;  5HLF A;  4Z4F A;  4W5O A;  4WQ5 C;  4DV4 K;  4DR3 K;  1MA9 B;  1NOY A;  4FJM A;  1JXE A;  4KPY A;  3AVB A;  4CEQ A;  4F3O A;  4FWP A;  4CHQ A;  5H1S Q;  1VQ4 N;  2GV9 A;  2W42 A;  3C94 A;  4ID5 A;  4C8N A;  3U4L A;  3LP3 A;  2O8F A;  5HL7 L;  3H1Q A;  4IXC A;  3VQE A;  3T3F A;  3O3G A;  4IG3 A;  1LV5 A;  4WQ4 C;  4IFY A;  3ZSV A;  3L2U A;  4IEE A;  1X3M A;  4BRQ A;  4B1Z A;  4JKF A;  2FXU A;  1B9F A;  4X64 K;  1XWL A;  4KO0 A;  5KPZ A;  3IKM A;  2BTF A;  4N76 A;  1KC8 O;  1JLC A;  5LJW A;  1KLN A;  4B9N A;  1BWF O;  2KQ2 A;  4O5B A;  5LL6 Z;  2P5O A;  2QWQ A;  2P51 A;  2P9N B;  2V7Y A;  4YFU A;  1T44 A;  3IAY A;  4IFE A;  4CJU A;  2BH1 A;  1YJ9 N;  1ASV A;  1UOC A;  1VSH A;  2IGI A;  3SUO A;  4FO0 A;  3WQT A;  3UE5 A;  4KRF A;  3RMB A;  3NF9 A;  3AVC A;  3R8E A;  1LAV A;  4CEC A;  3MCP A;  1K8A O;  4B3S K;  4CEF A;  5AQO A;  5BRE A;  4DV3 K;  4O0J A;  1B9D A;  1TAQ A;  4OJR A;  4NXM K;  3VQC A;  3QBX A;  2RN2 A;  4HUG A;  5AQU A;  5C10 A;  1P90 A;  1C0F A;  3TPQ A;  4KHW A;  5E84 A;  3VQB A;  1RIL A;  5E41 A;  2ZQB A;  2KW4 A;  5AJ3 K;  5GIP A;  3ZLJ A;  3OY9 A;  1F21 A;  2HNY A;  1Q81 O;  1DEJ A;  2E4L A;  2OTJ N;  1NK0 A;  4FJX A;  2XY6 A;  1S3X A;  4IOX A;  2ZE2 A;  4DLG A;  2O8E B;  4FLU A;  2QWL A;  4PKI A;  1Y97 A;  2F96 A;  3ZYY X;  1ZBH A;  3E1Y A;  1WLJ A;  3V9Z A;  3CPW M;  2VG6 A;  3CJ7 A;  3QNO A;  3SZ2 A;  4TSX A;  3P5J A;  1T7P A;  3LDP A;  3SK3 A;  1U45 A;  3V9W A;  3DLR A;  3K5M A;  1HX1 A;  4CBU A;  2GWJ A;  4OX9 K;  5CYM A;  1WUA A;  1ASW A;  1L3S A;  1RDC A;  4FM1 A;  4JI4 K;  3TAN A;  1W0H A;  1TK0 A;  4FCY A;  1NGD A;  1ZC6 A;  4BE0 A;  1BIS A;  5LY3 A;  4MO5 A;  1DTQ A;  3S3O A;  1QS4 A;  3MX5 A;  4FJ7 A;  4JAX A;  1JLE A;  1WSH A;  2GEM A;  1U2V A;  4FLT A;  2HND A;  3BDP A;  3P38 A;  3B8A X;  2DFE A;  4DSI A;  2VYP A;  3MMV A;  3O5B A;  3TAG A;  2O8C A;  1WN7 A;  1E3M A;  3L2R A;  1HRH A;  4DU3 A;  3U8X A;  4DFK A;  4PQU A;  3H46 O;  4HVJ A;  2ASO A;  4BQL A;  4DQI A;  3LP1 A;  4QOZ B;  4ILJ A;  1O13 A;  4HUF A;  4BDP A;  1HQU A;  3JYT A;  2BDP A;  3CCS N;  3D2F A;  4JI6 K;  4KH4 A;  3O4W A;  2E88 A;  3AA4 A;  3WXM B;  3ZT2 A;  3VF4 A;  2OCE A;  4DCH A;  3I55 N;  1X9M A;  1TK5 A;  3CME N;  3OVN A;  4JK9 A;  3ALY A;  2E5L K;  5AQZ A;  4CD3 A;  1YVU A;  1HYS A;  3IRX A;  4YOU A;  4JI0 K;  2GWK A;  2YKM A;  1RTJ A;  1TL3 A;  1TUU A;  4CFD A;  4DS5 A;  2A6A A;  4DMN A;  4KHQ A;  2QKK A;  3PSI A;  1EXQ A;  2UXD K;  4DTN A;  4RCH A;  4DWI A;  1S1W A;  3VQ6 A;  3C65 A;  1WSE A;  2O4G A;  1QZ6 A;  4H5W A;  4W5N A;  1BO5 O;  2ZWH A;  4GNI A;  1IG9 A;  5AQF A;  3K9J A;  3TSP A;  3WEE A;  2OAN A;  3SUQ A;  2E6L A;  3G71 N;  1QVG M;  3L8B A;  1HLU A;  2UXC K;  5CYQ A;  2P9S B;  3CJB A;  3T69 A;  3VET A;  1NOZ A;  1E4G T;  4FM2 A;  3CC7 N;  2Q1N A;  5M1O A;  2VGN A;  3KLH A;  4KHU A;  1YIJ N;  3GE1 A;  3TAE A;  1JKH A;  4DSK A;  2FSN A;  3LAK A;  1KLM A;  1VQN N;  3AA2 A;  3L2Q A;  2P5G A;  4C8L A;  3WXK A;  5FRO A;  5BPN A;  4J2D A;  2HBJ A;  2PYL A;  3GBT A;  2P9U A;  1YJW N;  4DV2 K;  3D0P A;  1RT2 A;  4JKH A;  4KB1 A;  1WAJ A;  1N32 K;  4O8K A;  2G8K A;  4M63 C;  2VG5 A;  3M8R A;  3VGK A;  4DSF A;  4BRD A;  1CXU A;  1LW0 A;  3PO4 A;  4FWL A;  3SBT A;  4A5B A;  2FBV A;  3BF1 A;  3AY9 A;  3NBP A;  1NG9 A;  1VSI A;  5I42 A;  4Y1C A;  5M1F A;  2E1Y A;  4DTS A;  3BY5 A;  5MLC Q;  2F9W A;  4JKG A;  1Q9X A;  3ZSZ A;  3CJ9 A;  5CHI A;  2YHA A;  1P8Z A;  2D5R A;  4EHT A;  3NF6 A;  2WTU A;  4DR1 K;  4CBW A;  2OPR A;  4BE1 A;  4IJN A;  4K8X A;  4BDY A;  1X1P A;  4DUZ K;  1Z05 A;  3DOK A;  1BA0 A;  4JI5 K;  3J8A A;  2E6M A;  3NMU A;  1RT4 A;  2OPS A;  5AQV A;  2ITM A;  3W3D A;  2KHO A;  1QZ5 A;  4GV3 A;  2IVO A;  1R0A A;  3FZH A;  3QEW A;  3VQQ A;  1S22 A;  4H0O A;  4BC4 A;  1SV5 A;  4BE2 A;  3AA3 A;  1SAZ A;  4YOR A;  3OYD A;  2E20 A;  4DFP A;  3RR7 A;  4FWO A;  4H5N A;  1RT3 A;  5AQW A;  1D9F A;  2HHW A;  4BC2 A;  4NCA A;  3RWU A;  4Y1D A;  3C6T A;  2G8U A;  3CQ8 A;  5T7B A;  5M1N A;  1NKB A;  2JLE A;  2VWK A;  4B1Y B;  4DFM A;  1WAF A;  3VF2 A;  4YOY A; 
#chains in the Genus database with same CATH homology
 3VQ5 A;  3SV4 A;  1ZBU A;  2DFH A;  2RKI A;  1NK5 A;  5EU7 A;  1S6P A;  4M3W A;  3TAF A;  4DF8 A;  1RBT A;  5CY4 A;  2Z1J A;  4KHY A;  3AO4 A;  4AHR A;  3O3H A;  3SUN A;  4GVM A;  1T8E A;  1LAW A;  3OYG A;  3AVL A;  3SPZ A;  1D9D A;  1W9H A;  4CGG A;  3SQ0 A;  3ITH A;  3HK2 A;  1IKV A;  3ZSX A;  5J2M A;  2Q3S A;  4E7I A;  4OKJ A;  4B3O A;  4HCB A;  4AH9 A;  4OVL A;  2G8V A;  1TKT A;  4CJW A;  2GBZ A;  4CJ3 A;  3HM9 A;  1XI1 A;  1BL3 A;  3T1A A;  4FK2 A;  1C1C A;  1A5X A;  2GUI A;  4CK3 A;  1C6V A;  1QHT A;  3DYA A;  1S9E A;  3AVH A;  4KKO A;  1S6Q A;  4CJ5 A;  1TKX A;  4CIG A;  5SZT A;  3NHG A;  4H4O A;  1TAU A;  3DI6 A;  3SQ4 A;  4KRE A;  2RF2 A;  4B08 A;  4B9V A;  4Q5V A;  1I39 A;  3ULD A;  3HL8 A;  5CZ2 A;  1KVB A;  4FJL A;  1T05 A;  4CJE A;  2Y1J A;  3KD5 E;  3LP2 A;  3VQ8 A;  5C25 A;  4E7H A;  5SWM A;  3TAM A;  3QEP A;  3V81 A;  1QSY A;  3ZSY A;  3V1O A;  2Z1I A;  2JGU A;  3RTV A;  1Z26 A;  3PV8 A;  2G8F A;  4ELV A;  4EP4 A;  1HNI A;  2YNG A;  4BWM A;  1NK7 A;  3L3V A;  1A5W A;  3DRS A;  4IG0 A;  1SKS A;  2DY4 A;  3SPY A;  1BI4 A;  3PX4 A;  2HHX A;  1U04 A;  4B9M A;  3AVF A;  2QXF A;  1RDD A;  1J5O A;  2YKN A;  4B9U A;  4Z4E A;  1YTA A;  4CEA A;  4E1N A;  3NE6 A;  3TWH A;  2R7Y A;  4AHT A;  3THV A;  1UA1 A;  3AV9 A;  1SKR A;  4M3Z A;  3HT3 A;  4Z4G A;  4ZHR A;  3K59 A;  4FZX C;  4MFB A;  3OYB A;  3KKS A;  4CF8 A;  4J2E A;  3VQD A;  3NGY A;  4F3T A;  1JLF A;  3NH1 A;  3OYM A;  5J2N A;  3CG7 A;  2X6S A;  1I3A A;  2DTU A;  3D45 A;  3C95 A;  3QEV A;  4N41 A;  4EZ6 A;  3LWM A;  4FVM A;  3CM5 A;  5C24 A;  3L2V A;  1WSG A;  5J2Q A;  1LW2 A;  2Z1G A;  4DQP A;  4FJK A;  4FZZ A;  3AO1 A;  3RRG A;  4CJK A;  1C0M A;  4KHS A;  4B8C A;  4OGC A;  4RW9 A;  4CJT A;  3CFR A;  4CHP A;  1U47 A;  2XRI A;  3NF7 A;  3NDK A;  1WSJ A;  1S1T A;  4R5P A;  3V9X A;  3ISN C;  5DMR A;  1N5Y A;  4KAZ A;  3ZSR A;  2ATQ A;  4CGD A;  1A5V A;  4M3Y A;  3HJF A;  5JS1 A;  1D8Y A;  4Z4I A;  2HW3 A;  3CYM A;  2HHQ A;  1NKC A;  1LWF A;  1EKE A;  1CZ9 A;  3KKR A;  1NJY A;  3OJU A;  4KHN A;  3V4I A;  4DQS A;  2PY5 A;  2OPQ A;  1GOB A;  4BWJ A;  3QER A;  5HLF A;  4FLV A;  4DTR A;  4W5O A;  4Z4F A;  1RBR A;  2HHT A;  4IDK A;  3KK1 A;  1NOY A;  4FJM A;  1JXE A;  4KPY A;  3AVB A;  4CEQ A;  1ZBL A;  4CJQ A;  3MEC A;  3G10 A;  4F3O A;  4CHQ A;  3QEI A;  2GV9 A;  3MXM A;  2W42 A;  3C94 A;  1J53 A;  4ID5 A;  4C8N A;  3LP3 A;  4YNQ A;  3KLE A;  4ELT A;  4FLW A;  4DU4 A;  4AIL C;  1VRT A;  1DTT A;  2IDO A;  3ZSQ A;  1CLQ A;  3VQE A;  4ICL A;  3ZT4 A;  2ZD1 A;  3OS1 A;  3T3F A;  3O3G A;  4IG3 A;  1LV5 A;  1ZBF A;  3I0S A;  4IFY A;  4N5S A;  1WSF A;  3ZSV A;  3L2U A;  4JRP A;  2X74 A;  1QTM A;  3QIN A;  1B9F A;  1XWL A;  4KO0 A;  1HNV A;  4FK0 A;  1TKD A;  2HVH A;  3LZJ A;  4H4M A;  1LWE A;  3K5L A;  4N76 A;  1JLC A;  3O4N A;  2XY8 A;  3K5N A;  1KVA A;  1S1U A;  4CJL A;  1JL1 A;  2IC3 A;  1UWB A;  4OGE A;  1SL1 A;  3ZSW A;  3VQ7 A;  3I8D A;  1KLN A;  3U6F A;  4NYF A;  3NF8 A;  1KVC A;  4B9N A;  2KQ2 A;  4O5B A;  5KGW A;  4C8O A;  5J1E A;  2P5O A;  1JLQ A;  4CF2 A;  4ZTF A;  2D0B A;  4DU1 A;  4Q0B A;  1RDA A;  1C1A A;  2P51 A;  3AVM A;  5HRS A;  3IAY A;  4YFU A;  4CJU A;  4FJN A;  2HHU A;  5J2P A;  1ASV A;  4B9S A;  4LSL A;  3L2W A;  4PY5 A;  1UOC A;  2HHS A;  1VSH A;  2IGI A;  3IG1 A;  3QNN A;  3SUO A;  1D5A A;  2LSN A;  4QAG A;  3ZSO A;  4AHV A;  4LH5 A;  1B92 A;  1IKY A;  1ZBI A;  3WNE A;  4HCC A;  1NJZ A;  4IKF A;  3TAB A;  4CHN A;  3NF9 A;  3AVC A;  3P83 D;  3OYC A;  3U3Y A;  3QES A;  3RMB A;  4CCH A;  1LAV A;  3VN5 A;  4CEC A;  4W5R A;  4CF1 A;  4FW1 A;  3VQ4 A;  3ZT0 A;  3PX6 A;  2XY7 A;  1KSP A;  3SNN A;  3VQA A;  3M8Q A;  4CEF A;  1NJW A;  1U49 A;  4O0J A;  3H08 A;  4UQG A;  1B9D A;  1TAQ A;  4OJR A;  4CF9 A;  2Z1H A;  3EYZ A;  3VQC A;  3TI0 A;  2RN2 A;  4CFC A;  4HUG A;  4FJI A;  5FRN A;  3LPU A;  4F8R A;  4KHW A;  5FDL A;  3CFO A;  3VQB A;  4CFB A;  3QEX A;  4DTO A;  4L8R B;  1KRP A;  1RIL A;  4OPK A;  3MED A;  5E41 A;  2ZQB A;  1T03 A;  1U4B A;  2KW4 A;  3K57 A;  1HYZ A;  1KFS A;  4H8K A;  3OY9 A;  1F21 A;  2HNY A;  3DLB A;  4CE9 A;  4FJH A;  4E89 A;  2QK9 A;  1CZB A;  4JS5 A;  3V9U A;  4M3U A;  1K6Y A;  2E4L A;  1JLG A;  1NK0 A;  2HMI A;  3V6D A;  4FJX A;  4CK1 A;  5HBM A;  1EET A;  2XY6 A;  3PY8 A;  5FRM A;  2PYJ A;  4HHT A;  1Q9Y A;  2ZE2 A;  3V1R A;  4DLG A;  1U48 A;  4B8A B;  4E1M A;  4FLU A;  3HP6 A;  3PX0 A;  3ASM A;  3MAQ A;  1BI4 B;  1XHZ A;  1Y97 A;  2F96 A;  3LZI A;  4FLY A;  1ZBH A;  3V9Z A;  1WLJ A;  1SL2 A;  2VG6 A;  4K8Z A;  4CK2 A;  3RMD A;  4W5T A;  3QNO A;  3SZ2 A;  4DTX A;  4FJ8 A;  3AVK A;  4Z4H A;  3SV3 A;  4DF4 A;  4TSX A;  1QSS A;  2YHB A;  3P5J A;  4FK4 A;  4N56 A;  1T7P A;  2PZS A;  4EZ9 A;  2KFZ A;  1U45 A;  2EHG A;  2YNI A;  3V9W A;  4ID1 A;  2VWJ A;  4FLZ A;  2BAN A;  3UIQ A;  3DLR A;  2FBX A;  4N47 A;  3K5M A;  1VSD A;  3LAN A;  2FC0 A;  4CER A;  5CYM A;  1EP4 A;  2A1S A;  1XC9 A;  3G0Z A;  4DQR A;  3K58 A;  3RR8 A;  2YNH A;  1ASW A;  3VA0 A;  3LP0 A;  4AHS A;  3WNH A;  3OYN A;  1L3S A;  1RDC A;  3LWL A;  4FM0 A;  3AVN A;  4FM1 A;  1W0H A;  3TAN A;  1TK0 A;  4FCY A;  4BE0 A;  1IKX A;  1BIS A;  5HRO A;  4CJV A;  1QQC A;  3DLG A;  4IBN A;  3ZT3 A;  4F2R A;  1DTQ A;  5I3U A;  3TR8 A;  4IFV A;  3KLF A;  3NAE A;  3S3O A;  3CM6 A;  4B9T A;  1QS4 A;  2Y1I A;  5KRS A;  3SYZ A;  4FJ7 A;  2KZM A;  4M3T A;  1JLE A;  4BAC A;  1WSH A;  4I9L A;  4FLT A;  2HND A;  1VSM A;  3AO5 A;  3BDP A;  1YT3 A;  2OZS A;  1RT1 A;  2KFN A;  3WNF A;  4MQ3 A;  1IO2 A;  3QIP A;  4O4G A;  1TKZ A;  4FJ9 A;  4FLX A;  2DFE A;  4DSJ A;  3V1Q A;  3ZCM A;  3DLH A;  4DSI A;  3HXM A;  3TAG A;  4NYN A;  4RW7 A;  3SI6 A;  1WN7 A;  3T19 A;  3LAL A;  3L2R A;  4FZY A;  1HRH A;  4JRQ A;  4DU3 A;  1G15 A;  4CF0 A;  2P1J A;  4BDZ A;  1UA0 A;  3HPH A;  5C42 A;  4DFJ A;  4EP5 A;  4DFK A;  3KTQ A;  2XHB A;  4HVJ A;  4NCB A;  4KTQ A;  4PQU A;  1BHL A;  1RT5 A;  3CFP A;  4G1Q A;  4KI6 A;  4CJ4 A;  5HP1 A;  4JS4 A;  1NK6 A;  1N6Q A;  3A2F A;  3OYE A;  4HTU A;  4CJR A;  1RTD A;  4DQI A;  5K14 A;  3NGZ A;  3LP1 A;  2X78 A;  4QOZ B;  4KRF A;  2OYQ A;  4O0I A;  4HUF A;  4BDP A;  1VSK A;  1HQU A;  1HPZ A;  1HYV A;  3JYT A;  2BDP A;  3DLK A;  3NFA A;  3O3F A;  1BCM A;  3QO9 A;  4FJG A;  3AA4 A;  3ZT2 A;  1X9M A;  4RW4 A;  3SUP A;  1TK5 A;  4FXD A;  2FBY A;  3OVN A;  3PUF A;  5DK5 A;  4ELU A;  3ALY A;  2XO7 A;  2WON A;  3OS0 A;  4CED A;  1J54 A;  4DSE A;  2OA8 A;  1YVU A;  3C6U A;  3AO3 A;  4KB0 A;  3LDS A;  1BIU A;  1HYS A;  1RCH A;  3IRX A;  4CGF A;  3DLE A;  4RW6 A;  2HB5 A;  2YKM A;  3F9K A;  1RTJ A;  1TL3 A;  5HRP A;  4CFD A;  4Z0U A;  4DS5 A;  4DMN A;  4KHQ A;  2QKK A;  5KTQ A;  1QSL A;  4FJ5 A;  2D0A A;  3OJS A;  1FXX A;  3VQ9 A;  4OLA A;  1EXQ A;  4I2Q A;  4DTN A;  1S9G A;  4DWI A;  1S1W A;  1S1X A;  1C0U A;  3VQ6 A;  1WSE A;  4CGJ A;  4CGI A;  2O4G A;  1NJX A;  4CIF A;  4W5N A;  1BGX T;  3B6P A;  1VRU A;  4KTZ A;  4C8K A;  3DRR A;  1IG9 A;  1BCO A;  3K2P A;  2IS3 A;  4E0D A;  3OYH A;  1NK8 A;  4DS4 A;  1KTQ A;  2F8S A;  3HVT A;  3DMJ A;  1JLA A;  4DLE A;  3DM2 A;  4DTP A;  3RMA A;  4ZTJ A;  4M3X A;  3NGI A;  3MXI A;  2OPP A;  3TAP A;  1NK4 A;  4PWD A;  3SQ2 A;  3JSM A;  1X9S A;  1JL2 A;  1IH7 A;  2I5J A;  3K5O A;  1L5U A;  4FW2 A;  4E7L A;  1S5J A;  3SUQ A;  4E7K A;  1REV A;  5D3G A;  1KCF A;  4KFB A;  2RPI A;  1BQN A;  1S1V A;  2XY5 A;  2E6L A;  1O1W A;  4CFA A;  3L8B A;  4PA1 A;  4O55 A;  2B4J A;  3S3N A;  4DSL A;  1BIZ A;  5CYQ A;  4I9Q A;  1J9A A;  4LH4 A;  4PUO A;  1NKE A;  1RTH A;  1BQM A;  1WSI A;  1NK9 A;  3TAQ A;  1VK0 A;  1TVR A;  1SL0 A;  4I2P A;  4AHC A;  1RBV A;  1Q8I A;  3B6O A;  2HVI A;  1NOZ A;  3MEE A;  1RNH A;  1YTU A;  4W5Q A;  4JLH A;  4DQQ A;  3U3G A;  4CEO A;  2BGG A;  4C8M A;  5CZ1 A;  3HST B;  4CHZ A;  4FM2 A;  4RW8 A;  2ITG A;  3VA3 A;  3QET A;  4FJJ A;  2HHV A;  1HJR A;  3KLH A;  1RBU A;  4KHU A;  2G8I A;  2F8T A;  3TAE A;  1JKH A;  3QIO A;  4DSK A;  2D0C A;  1KLM A;  3LAK A;  4CEB A;  2AJQ A;  3AVI A;  2KZZ A;  1RT7 A;  3AA2 A;  3L2Q A;  2P5G A;  3RRH A;  4C8L A;  1ITG A;  1KFD A;  5FRO A;  4J2B A;  1EX4 A;  4J2D A;  4OLB A;  3AO2 A;  1C1B A;  4DTJ A;  5HRR A;  2B6A A;  1TGO A;  1UAX A;  2PYL A;  3AA5 X;  3S3M A;  1GOA A;  3D0P A;  1RT2 A;  1HMV A;  1L3U A;  3OYA A;  4KB1 A;  3RMC A;  3IS9 A;  3LAM A;  3TAR A;  3AVA A;  1WAJ A;  3BGR A;  3KIO A;  3L3U A;  3OYL A;  3OYF A;  2QKB A;  4LY7 A;  4CES A;  4CHO A;  2G8K A;  3NCI A;  2VG5 A;  3M8R A;  2EX3 A;  4KI4 A;  4DSF A;  4Z4C A;  2BE2 A;  1FKP A;  1CXU A;  3HPG A;  3M8S A;  1LW0 A;  3PO4 A;  3V9S A;  3ZT1 A;  1SKW A;  1FKO A;  3NH0 A;  1HQE A;  4LD0 A;  3HPO A;  4RG8 A;  1TV6 A;  1MU2 A;  3SJJ A;  3O4Q A;  4FYD A;  2FBV A;  1TK8 A;  4CEE A;  1LWC A;  1X9W A;  3NBP A;  4M45 A;  3PO5 A;  3HO1 A;  1VSI A;  4OPJ A;  5I42 A;  4Y1C A;  2G8H A;  4OKE A;  4DTS A;  4KTW A;  1L3V A;  4XIU A;  3HYF A;  4DG1 A;  3SCX A;  4B9L A;  1JXB A;  4GW6 A;  2YNF A;  3MEG A;  1Q9X A;  2NUB A;  3AVJ A;  3ZSZ A;  5JS2 A;  4CGH A;  4E19 A;  4LSN A;  4O44 A;  5KGX A;  2YHA A;  4M42 A;  2D5R A;  4KV8 A;  1RBS A;  1VSJ A;  3NF6 A;  1Z25 A;  4E3S A;  2WOM A;  1QE1 A;  3S9H A;  2B5J A;  2OPR A;  4CJF A;  4OKK A;  3LPT A;  4BE1 A;  1CXQ A;  2DFF A;  5KRT A;  4F2S A;  1DLO A;  4HUE A;  4BDY A;  1X1P A;  4K8X A;  4GMJ B;  4I7F A;  1TL1 A;  4J2A A;  3DOK A;  4CIE A;  1RT6 A;  2IAJ A;  4CJS A;  2E6M A;  3OS2 A;  1FK9 A;  3KK2 A;  1RT4 A;  5HRN A;  1XHX A;  2OPS A;  4F4K A;  1GOC A;  4NCG A;  3KJV A;  1SUQ A;  4E7J A;  1ASU A;  3KLI A;  1R0A A;  2A1R A;  5KI6 A;  1WNS A;  3QEW A;  1VSE A;  3VQQ A;  4AHU A;  3OYI A;  1SV5 A;  3OYK A;  3EZ5 A;  3DRP A;  4BE2 A;  3AA3 A;  3HVR A;  3P1G A;  3SQ1 A;  2O4I A;  2X6N A;  1C0T A;  3KLG A;  3OYD A;  1ZYQ A;  1L3T A;  3I0R A;  4DFP A;  3KK3 A;  3RR7 A;  1VSL A;  1RTI A;  1RDB A;  2G8W A;  4QCL A;  3DOL A;  3QLH A;  3HP9 A;  1RT3 A;  1VSF A;  3WNG A;  4M41 A;  3E01 A;  3KD1 E;  3AVG A;  1D9F A;  2HHW A;  1JLB A;  4NCA A;  3RWU A;  3F73 A;  4Y1D A;  2FBT A;  3C6T A;  2ETJ A;  4WE1 A;  2G8U A;  2YV0 X;  5T7B A;  3MXJ A;  4CJP A;  3CQ8 A;  2HNZ A;  4CEZ A;  2IOC A;  4CHY A;  3FFI A;  3VQP A;  3EY1 A;  4DTM A;  2JLE A;  1NKB A;  2VWK A;  2VG7 A;  3M8P A;  4M3R A;  2OZM A;  1IKW A;  4DFM A;  1WAF A;  2KTQ A;  4DTU A;  3NH2 A;  3OYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...