4IBPA

Crystal structure of a glutathione transferase family member from pseudomonas fluorescens pf-5, target efi-900011, with bound glutathione
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
205
structure length
205
Chain Sequence
b'SLTLFHNPASPYVRKVMVLLHETGQLNRVALQASQLSPVAPDAALNQDNPLGKIPALRLDNGQVLYDSRVILDYLDQQHVGNPLIPRDGSARWRRLTLAALADGIMDASVLVRYELALRAPEKHWEQWLDGQRDKIRRALAVLEAEAIAELASHFDIAAISVACALGYLDFRHPDLEWRQDHPQLAAWYFEISQRPSMLATRPPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase-like protein YibF
publication title Crystal structure of a glutathione transferase family member from Pseudomonas fluorescens Pf-5, target IFI-900011, with bound glutathione
rcsb
source organism Pseudomonas fluorescens
molecule tags Transferase
total genus 67
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2012-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4ibpA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ibpA01
1TDIA 4MZCA 1EZKA 2ZCTA 1A8YA 5DCHA 4PNGA 4WF5A 4V1Ag 5F8BA 5JCWA 1GSYA 4HEA2 2CAQA 4XS4B 4OFMA 3WT1A 3GTUB 1PGTA 3TKSE 4ECJA 2B3SA 4OWYA 2LUSA 4KUNA 2YWIA 3L78A 5FWGA 3EU4A 2HSMA 4K0GA 5EY6A 2GSRA 4NV2A 8GSSA 1WE0A 3R2QA 2CX3A 6GSVA 3CSIA 1GTAA 1JFUA 2WULA 5DJLA 3LEFA 11GSA 2YP6A 2VIMA 3QFBC 1WWJA 2MYGA 3UBKA 1GSDA 2VLVA 1BG5A 1O81A 2VLTA 2JZTA 1GSFA 2HI7A 3KH9A 3ZTLA 3TUEA 3GX0A 6GSSA 3ME8A 1EWXA 2H75A 4YQVA 5ECIB 2DSAA 3A5WA 3V1WA 2H73A 3QAGA 5ECSA 2VCXA 2C3TA 2KP1A 3GN3A 4GLTA 2FCHA 4LMVA 5G5FA 4PX1A 3WGDA 4IP6A 2E2GA 3IC8A 4EDYA 4K0NA 4IQ1A 2PBJA 2IMFA 1AAZA 3ZREA 1OE7A 1WJKA 4CW9A 1IYIA 4LMWA 5IMAA 3CTFA 3GUSA 3L9VA 2LJRA 2VCQA 3QAVA 5KEJA 3KGKA 2PMTA 4MH2A 2HSHA 1K0CA 2N5FA 3KM6A 4BWSA 4XRAA 1M9BA 2GQMA 3RBTA 4N10A 5GSTA 1FW1A 3FRCA 3FR9A 1TI3A 5DDLA 2DMMA 2FA8A 2V32A 5D9WA 3CSJA 5AGYA 4MP4A 3QD9A 2NTOA 4N0ZA 1UC7A 3D0ZA 4IKHA 2B6MA 5LNKe 3A2XA 5B7CA 4AJ6A 4WEYA 1S3AA 2YJHA 1ZYQB 1HNCA 1ERUA 1GTUA 4ZXGA 2FWFA 5J9CA 4O5RA 1W89A 4OCEA 4ECCA 3TKSA 5ECMB 1SU9A 2MMAA 4POKA 1A2LA 3E0UA 3CRTA 2AJQB 2IMKA 3L4NA 1XCCA 2YJ7A 3W6GA 5JCUA 3DKSA 4EE0A 1VRSD 3RPNA 4IJIA 4K8MA 4MABA 3D6IA 3DGQA 4HQSA 3EMXA 2UZ8A 2JL4A 4JZQA 3WD6A 3VFIA 3TOUA 2GZZA 2QC7A 1HD2A 1MTCA 4HJMA 2XPEA 3ZMLA 2M72A 1V58A 2FNOA 3GH9A 2L6CA 3MNGA 2A4VA 1G6YA 2V6OA 2XHFA 2DIYA 4TN8A 5G30A 3GSSA 1HQOA 3ZLPA 4PGTA 1YY7A 4G2EA 5DALA 1OC3A 1SK2A 2V2GA 1DE2A 1LU4A 2HXKA 5G1LA 5ENUA 3WGEA 1JZOA 4ULXA 5ECPB 2IFQA 2H8LA 1X5DA 3BCKA 5KN3A 3PH9A 4DEJA 4LL1B 5HR3A 3TJFA 1AQVA 3HZ8A 1U6TA 1YDKA 3IHQA 1GSUA 4KSMA 5G5EA 1ERWA 4YAVA 4ACSA 2LS5A 2GLRA 3EURA 5F05A 4I6XA 3TKSC 2I9HA 4WR4A 1B8XA 1YJ6A 1YEXA 1VF4A 4F82A 5CRDA 2TRCP 4NHWA 1CQHA 1PRXA 1Z7PA 4JBBA 2VLUA 4TR1B 2N5AA 4EO3A 4JR4A 3GNJA 1XWGA 4OMVA 3IE3A 4ML6A 1GNWA 2GZPA 4GWRA 1T1VA 4BVXB 1ACVA 3IAS2 2B1LA 2QGVA 2D2ZA 1XOAA 1QGVA 2CZ3A 6GSUA 2FA4A 3KIJA 2M46A 1S3CA 1OKTA 2LRCA 3MDKA 4K7NA 4PTSA 1SK0A 2JSZA 4AJ8A 4EDZA 3M3MA 3HY2A 3F6DA 2VL9A 5DAKB 1FAAA 1QMVA 4GTUA 1R7HA 3GX8A 3US3A 3FYGA 2H70A 4FH8A 2FGXA 1KTEA 3FR3A 3ZVJA 4E8HA 2OA7A 5EPFA 2WFCA 2LV3A 1F37A 4PXOA 1FVJA 1X5CA 4KAEA 3QFAC 5LCZA 2H72A 4KW6A 2H1AA 3HVSA 5ECHB 2K8VA 5B8AA 5F0GA 13GSA 2TIRA 1CQGA 2KP2A 3G7IA 1ST9A 5IOXA 2F3MA 6GSYA 3P90A 4ZBAA 5CNWA 3H93A 2H30A 4KCAA 3A3TA 2H1DA 2G2QA 3DVXA 2LNTA 5GZZB 3UOMA 4BA7A 1OC9A 3ERGA 2AB6A 4QL9A 2IWTA 5ID2A 3F4SA 1PD21 4KX4A 4GSTA 5J5NA 3MSZA 1QUWA 2HRNA 4OD7A 3RAZA 2K18A 3KMNA 4MPGA 3TJGA 4IJ3A 3HKRA 4MJAA 4KH7A 4ML1A 4YAPA 2H6YA 3GL3A 3KZQA 4KA0A 2PERA 2VD0A 4PQHA 1G6WA 2GSSA 4JEDA 1FB6A 4PUAA 5C04A 3TKPA 3I6AA 1WP0A 2H0GA 3IXRA 4GF0A 3RDWA 1X9WB 6GSXA 2AYTA 5F06A 4GSSA 2DBCA 3D22A 2IPAA 1PL1A 3FZ9A 4BPYA 1OAZA 2O87A 6GSWA 3PPUA 2I81A 3VI7A 4K1FA 1UA5A 4ILFA 4V2LA 4IN0A 4JR6A 3G7YA 3J7Yk 2C3NA 2WRTA 3FHKA 3WYWA 4ZBDA 1ZL9A 2L5LA 3L9SA 1O8XA 6GSTA 3PGTA 3EC3A 3HVVA 4OFTA 1EEJA 2H74A 2OE0A 2C0FA 2HSYA 2WB9A 2H6XA 3TJKA 3FKFA 2L4CA 3QOUA 3F3RA 4KE3A 5D8IA 4ZL7A 1Z6MA 4MH3A 2R6KA 4BL7B 1TRVA 3ZIJA 4HI7A 5JWQB 2PWJA 5J41A 3FZAA 2L6DA 3DD3A 4N0VA 1B4QA 3M9JA 5A5KA 3TJJA 3WT2A 2LRNA 1TRUA 4G9HA 4OO4A 18GSA 1Q4JA 3CSHA 4NMUA 5A4UA 4L5OA 2Z9SA 4ZILA 4MJCA 4GRFA 5H5QA 3ERFA 1MD4A 3HJOA 1EOHA 3BOAA 4HU7A 1X9MB 4BVYB 4V2NA 1NHYA 3ZL5A 4GXZA 1XVQA 1AIUA 1GSQA 2X8GA 3VWXA 2H1GA 1MDIA 1JHBA 1M0UA 1BQ7A 5DVBA 3HZ4A 3APSA 1UN2A 3CTGA 5HR0A 2PU9C 1S3DA 3IK9A 2YCDA 3A2WA 3W8SA 5IMCA 5DCGA 5JWOB 2MBSA 1Y25A 3P7XA 5KN2A 2G0FA 3KXOA 5HQPA 1YZXA 2RIIA 3IC4A 2HZEA 4L5LA 3BBYA 1BYEA 1XW6A 3C1RA 2P31A 5G1KA 1OVNA 3FY7A 2V41A 3FZ5A 3UMAA 2REMA 3C7MA 2ES7A 1J0FA 3LJRA 2YNXA 4G0KA 4XCSA 14GSA 1KBNA 5DALB 4AF2A 4IW9A 5AIXA 5AN1A 3A2VA 5FT3A 1T00A 4XS4A 2B5XA 2XC2A 3GTUA 1THXA 2B7KA 3DRNA 4RUVA 5B6NA 1AQXA 4PNFA 4QQ7A 1LBKA 1MD3A 1T7PB 2EC4A 3LG6A 2IFQB 1A2MA 5IQYA 3U6VA 3IA1A 3G7JA 1GP1A 2B7JA 1SYRA 2AHEA 3UVHA 5ECKB 2LQOA 3APOA 1TP9A 3KJYA 1J08A 4G0IA 2WCIA 2VM2A 4RI7A 1BAYA 1R26A 1J9BA 4YH2A 4TR4A 3APQA 3DMLA 1GWCA 4BWQA 2LEGA 3KP9A 2FD3A 2LTKA 1I5GA 1PKWA 3IDVA 4HQZA 1M2BA 2YV7A 3FEUA 2GDRA 1GLQA 3F9UA 2YOIA 2GS3A 1ON4A 1AXDA 2GTUA 4Q5FA 2VCZA 3IK7A 4HU9A 4OFNA 2GZYA 2GT6A 3GURA 3IRAA 2QKEA 5ECOB 1AW9A 2EIRA 3L0HA 2VD1A 4NWYA 4N30A 3GH6A 3TB2A 3DXBA 1TJDA 2CVDA 1I9DA 3LYPA 1C72A 4YQMA 1K3YA 4HZ2A 1SENA 4X0XA 4MF7A 2E7PA 3IOSA 4XS1A 4USSA 2LSTA 5L71A 5CRWA 1TU7A 1GUHA 2F51A 2GGTA 1FHEA 2J9HA 4YQUA 1ZYEA 3EINA 4KGIA 1SL0B 2KHPA 3C71A 1SL2B 5D9VA 2OACA 5DQSA 4TW5A 1ILOA 2CVKA 3M0FA 3WGXA 3W8JA 4PURA 2AUVA 3O6TA 3QDNA 4KDUA 2PPTA 3NIVA 2B5YA 3D4TA 1T8EB 4AGSA 1B48A 3VLNA 1SKRB 4TXOA 3F0IA 2VAFA 1V9WA 1EGOA 1MDKA 3FZ4A 1Q98A 4F0CA 2YV9A 1JLVA 4DSSB 1GL8A 2IMIA 5ECQB 1XBSA 5IPHA 1F6MC 2R2JA 1K3OA 2F8AA 3KTLA 5KN0A 1GTBA 4Q5NA 4IGJA 2CV4A 3E3EA 2HRFA 2OE3A 4MA9A 5COHA 5B6MA 2H0HA 3ZMKA 2BJXA 4ZBBA 4V1Ap 1USBA 2IMEA 2DLXA 4RI6A 2VCVA 1SK1A 4TKYA 1OC9B 2K8SA 2R37A 2CA8A 2H66A 1SJ6A 3CBUA 3MAKA 5ELAA 2L4QA 2B1KA 4KCEA 3TRPA 2C8UA 1TXXA 2B5EA 4G10A 3IV4A 4L0WA 2O89A 2V1MA 1URMA 3K8NA 2C0DA 5DQYA 4DVCA 1SD8A 5IM9A 1W4VA 1K0AA 4KDXA 2JSYA 3UJ1A 1T4ZA 2GSTA 1TI1A 2LRTA 1JZRA 1VF3A 2XBQA 3UARA 1THOA 1X0RA 2LNSA 1GULA 5ABRA 3HD5A 3VK9A 3M1GA 4ISDA 5D9TA 2K9FA 1G7EA 1RW1A 1VF2A 4P3YB 4KB3A 2K6VA 3BD2A 4ZB6A 2MBTA 3ZITA 1AQWA 1GUKA 3D4MA 1XZOA 3C8EA 3I9V2 2RM6A 5CREA 4IBPA 5CP1A 2C0EA 3VI5A 3QCPA 1HNBA 2IL3A 1EGRA 1WOUA 4WETA 4MJBA 1TK0B 1TKDB 1FB0A 2E2MA 5J9BA 3KTBA 3ERWA 1N2AA 2KUCA 1VGLA 3GA4A 4EXJA 2HNLA 4MK3A 3KH7A 4ECIA 5E4WA 3DEXA 3DIEA 2HRKA 1A0FA 3QAWA 1U3AA 2YZHA 1XOBA 4LL4B 1AC1A 2GQLA 3IR4A 1WPIA 4MLYA 4IELA 1H4OA 5DBQA 1YKAA 4G19A 2IMDA 3OR5A 2CAIA 5ECNB 2O8VB 3C73A 4KDYA 2HQTA 4MF5A 4TR1A 1NM3A 2X8HA 3UIWA 3L9UA 2C3QA 2NDOA 1IYHA 4HS1A 3VPTA 4KF9A 4MMMA 5J3RA 3ED3A 1SKWB 4LA1A 1YF1A 3CMIA 3Q19A 3C1SA 4J2FA 5EL8A 2QSIA 2HE3A 1ZZYA 1PKZA 2O7KA 3DYRA 2X64A 5IO0A 3GRXA 2C80A 2HSMB 1Z6NA 4MPFA 4HUAA 2CT6A 1F2EA 1PX7A 2H01A 3EWLA 2R3XA 3P2AA 1Z3EA 2F8FA 4IQAA 2I1UA 3I69A 4IP1A 3KP8A 1M9AA 3JCML 5D93A 5DAKA 2DJ1A 4ZB9A 2RUEA 1GH2A 2WDUA 1SYXA 2HRAA 5A4VA 2J23A 2FUG2 4ID0A 2OBKA 2IIYA 3GV1A 1XWBA 4K9ZA 3Q74A 2VL3A 3UEMA 4ZIJA 3Q6OA 3GKXA 2FY6A 3CYNA 3HJPA 2ZNMA 1V2AA 2VCWA 3E9JB 4NV5A 1BX9A 2VM1A 4JRRA 4IHUA 3TRQA 3O3TA 3ZZXA 2LKUA 5IOWA 4KSOA 3ZVJD 3NOFA 1QFNA 5IMDA 3TJBA 4N11A 1JZDA 3F6FA 1M2DA 4F9ZA 3PR8A 2YWNA 1A24A 3O76A 3F4TA 3FW2A 3GHAA 1GLPA 4FIWA 2HZEB 2RLIA 1ZMAA 4Q5RA 2H1BA 3TKRA 1SL1B 3KCMA 3H4KA 3U5RE 10GSA 4J56E 4DSQA 2L57A 1R5AA 4HDEA 3RHBA 2DC5A 1TK5B 5EVOA 3IPZA 2MMOA 3LXZA 2RUFA 1TU8A 2RM5A 2FWHA 3GYKA 1DE1A 1K0OA 4QL7A 5IPGA 2ON5A 3ZFBA 1Z9HA 4TRXA 1ML6A 2PUKC 1E2YA 2WGRA 4O92A 4HJ2A 4EL1A 5GAND 1G7OA 3TRXA 4XS6A 2TRXA 3DWVA 3TDGA 2DJ3A 1RK4A 3G9BA 4ECBA 2IJYA 1Y6EA 1ZOFA 2AAWA 1EP7A 4CHSA 4D73A 3UAPA 2CX4A 2VL2A 2VOCA 3BCIA 4CDOA 2YANA 4WBJA 5FHIA 1B9YC 1YF0A 1O6JA 5AISA 1F9MA 3H79A 1YKCA 3ZYWA 1H75A 1B4PA 1O8WA 1O7UA 4Q5QA 3LQ7A 19GSA 3GSTA 4TVEA 4K2DA 2ALBA 2H6ZA 1A8LA 2YN1A 4G0LA 1GTIA 2VO4A 1N8JA 3HVXA 1SKSB 2HYXA 4FYBA 2X99A 1WMJA 1Z7RA 4WR5A 5JWRB 2FHEA 3VWUA 3KD0A 3LYKA 3EYTA 1OC8A 1EP8A 1JLWA 4H86A 4MZBA 1GRXA 3LFLA 2HLSA 3UBLA 1TRSA 1K0DA 1GSSA 1NW2A 2HSNB 4BL7A 3FK8A 2ON7A 4F03A 2ZUPA 2JZSA 3IBHA 3H1NA 4F2IA 3LXTA 2NVLA 1R4WA 2LQQA 1MDJA 5G31A 1ZGNA 4EKZA 2L59A 4MCUA 5D73A 3GMFA 1HNAA 1KNGA 1JZWA 2VL2C 1EEMA 2MMNA 3AY8A 5A4WA 3CRUA 1DSBA 1WRYA 4TXOB 1EV9A 5HFGA 3I43A 4BVYA 1U87A 1M7TA 5IMZA 5IO2A 5CRHA 4FYCA 3HA9A 1FO5A 2LJAA 5CYYA 2FWGA 1DUGA 1QK8A 5HFIA 2P0GA 3HCZA 2JZRA 4FYUA 4OO5A 1DBYA 2VCTA 4NHZA 2DJKA 4I2UA 7GSSA 1HYUA 2GVPA 1EV4A 3ZFLA 3ZRDA 1F3BA 3KEBA 5INYA 5F07A 3VURA 2CQ9A 2NBSA 4ZL8A 4I97A 2NPBA 4V2MA 2HT9A 1T3BA 1TRWA 1U88A 2CVBA 1TW9A 5H5SA 2GSQA 4TXVA 1KEBA 3EMPA 1XWKA 1PA3A 4XHMA 2MZCA 5H5RA 5C00A 1O73A 4WKWA 2A2SA 4Z7XA 1QQ2A 17GSA 1OE8A 3FR6A 1SJIA 2MMZA 2L5OA 3EU3A 3H8QA 5ECLB 2JACA 5DJMA 2P5QA 3LWAA 5HR2A 3F4RA 4I8BA 2OJLA 2PN8A 2C0GA 2PGTA 3D5JA 5B8BA 1SJZA 5KN1A 2EIOA 2VUPA 3QMXA 2M80A 4O32A 2WJUA 1K0BA 1XWCA 4I5QA 4XIHA 3GKNA 4FO5A 5J4UA 3RPPA 2OE1A 4GSNA 1GSEA 3UL3A 4JE1A 1UVZA 2PVOC 3ME7A 5D9XA 2XPDA 4MZWA 1OYJA 1XW9A 1RQMA 3MWHA 1ABAA 1O85A 1Z5YE 9GSSA 3LGCA 3J7Yb 4PUFC 1ERTA 1ZCPA 2I4AA 3F3QA 4KNDA 3F8UA 2HRKB 2R4VA 5D96A 5IIZA 1A23A 3R3EA 4MF6A 2LJKA 2P5RA 3NZNA 3F63A 3RHCA 4RQXA 3M8NA 2H19A 2X8CA 2EIQA 2GT5A 3UVTA 4POMA 3LORA 2JU5A 4K6XA 4IVFA 3SWLA 2HFDA 5ID2B 1G0TA 4J57E 4TR3A 1K3LA 4HZ4A 3EE2A 2C1YA 1A2JA 5G2ZA 2JADA 1GNEA 1M2AA 2XBIA 2E0QA 2FWEA 4L8EA 1AUCA 4AJ7A 1X9SB 2YWMA 4IS0A 2YWOA 1SD9A 1PQNA 3ZIVA 4HOJA 22GSA 1BJXA 1XVWA 4WF4A 2DJ2A 2YZUA 5AIVA 3LSZA 5JCGA 1VF1A 3DVWA 3HJMA 3BJ5A 5HFKA 2BMXA 4GQCA 4NPBA 3VWVA 3N9JA 3M9KA 1YEPA 4PQIA 3QR6A 5HR1A 1PSQA 3HXSA 4RQRA 2R5GA 4TOPA 1PN9A 4OCFA 3HDCA 4POBA 3VWWA 4MJEA 2O85A 4DSSA 1ERVA 4WXTA 4XRDA 5LD0A 4E8EA 2WS2A 3ISOA 2AV4A 2OBIA 4K7OA 3TGZA 4GQFA 2N5BA 4K7IA 1XW5A 5IMFA 1MEKA 1K0MA 4ZL9A 4X43A 2KLXA 1GUMA 1U3IA 16GSA 4F0BA 1EOGA 2OADA 4NAXA 1F3AA 4POLA 3D21A 5IMVA 1TTZA 2H71A 3VPQA 4FQUA 4BVXA 2I3YA 1FG4A 2DMLA 1R5PA 1YQ1A 3QPMA 4EC0A 1PL2A 4PQ1A 4ZB8A 2OKAA 1X5EA 1XFLA 2BTOT 1OKDA 2CZ2A 1BEDA 2FLSA 4JU5A 2H0IA 3CXGA 4LLRA 1WIKA 1PX6A 5ECRB 2A2RA 3GKKA 4D73B 2PVQA 1XIYA 4DSRA 1XWAA 4NXIA 1K0NA 1QXHA 4L0UA 4X1UA 3S9FA 1B9XC 1T4YA 1NSWA 5E59A 2IN3A 2DJJA 2C4JA 1XXUA 1FOVA 4O7HA 1TOFA 2HZFA 3SBCA 2H76A 2YPMA 1V57A 2DIZA 3TCOA 5CAXA 5BMUA 5CRGA 1NHOA 3TKQA 3HYPA 4GCIA 1V98A 1PMTA 2WZ9A 5GAPD 4XTSA 2F9SA 12GSA 3HHVA 3Q18A 5GSSA 4EF0A 1V40A 1E6BA 2DJ0A 4EUYA 3TOTA 1M99A 5CO3A 20GSA 2GQKA 5ELGA 3N5OA 1FVKA 3GFKA 2KOKA 3EVIA 3P8WA 1XPVA 4TR0A 4I2TA 1TK8B 4WBRD 4EVMA 4MDCA 2V6KA 1LJRA 3KMOA 1A0RP 3GL5A 3IAM2 3PINA 3GKMA 3GIXA
chains in the Genus database with same CATH superfamily
1TDIA 4MZCA 1EZKA 2ZCTA 1A8YA 5DCHA 4PNGA 4WF5A 4V1Ag 5F8BA 3MIXA 5JCWA 1GSYA 4HEA2 2CAQA 4XS4B 4OFMA 3WT1A 3GTUB 1PGTA 3TKSE 4ECJA 2B3SA 4OWYA 2LUSA 4KUNA 5A5HA 2YWIA 3L78A 5FWGA 1YVLA 3EU4A 2HSMA 4K0GA 5EY6A 2GSRA 5KOWA 4NV2A 8GSSA 1WE0A 3R2QA 2CX3A 6GSVA 3CSIA 1GTAA 1JFUA 2WULA 5DJLA 3LEFA 11GSA 2YP6A 2VIMA 3QFBC 1WWJA 2MYGA 3UBKA 1GSDA 2VLVA 1BF5A 4K5SA 1BG5A 1O81A 2VLTA 2JZTA 1GSFA 2HI7A 3KH9A 3ZTLA 3TUEA 3GX0A 6GSSA 3ME8A 1EWXA 2H75A 4YQVA 5ECIB 2DSAA 3A5WA 3V1WA 2H73A 3QAGA 5ECSA 2EFCA 2VCXA 2C3TA 5BRTA 2KP1A 3GN3A 4GLTA 2FCHA 4LMVA 5G5FA 4PX1A 3WGDA 4IP6A 2E2GA 3IC8A 4EDYA 4K0NA 4IQ1A 4K2XA 2PBJA 3CWGA 2IMFA 1AAZA 3ZREA 1OE7A 1WJKA 4CW9A 1IYIA 1M3IA 4LMWA 5IMAA 4PI0C 3CTFA 3GUSA 3L9VA 2LJRA 2VCQA 3QAVA 5KEJA 3KGKA 2PMTA 4MH2A 2HSHA 1K0CA 2N5FA 4PHZC 3KM6A 4BWSA 4K5RA 4XRAA 1M9BA 2GQMA 3RBTA 4N10A 5GSTA 1FW1A 4E68A 3FRCA 3FR9A 1TI3A 5DDLA 2DMMA 2FA8A 2V32A 5D9WA 3CSJA 5AGYA 4MP4A 3QD9A 2NTOA 4N0ZA 1UC7A 2UV8G 3D0ZA 4IKHA 2B6MA 5LNKe 3A2XA 5B7CA 4AJ6A 4WEYA 1S3AA 2YJHA 1ZYQB 1HNCA 1ERUA 1GTUA 4ZXGA 2FWFA 5J9CA 4O5RA 1W89A 4OCEA 4ECCA 3TKSA 5ECMB 1SU9A 2MMAA 4POKA 1A2LA 3E0UA 3CRTA 2AJQB 1SVLA 2IMKA 3L4NA 1XCCA 2YJ7A 3W6GA 5JCUA 3DKSA 4EE0A 1VRSD 3RPNA 4IJIA 4K8MA 4MABA 3D6IA 3DGQA 4HQSA 3EMXA 2UZ8A 2JL4A 4JZQA 3WD6A 3VFIA 3TOUA 2GZZA 2QC7A 1HD2A 1MTCA 4HJMA 2XPEA 3FMWA 3ZMLA 2M72A 1V58A 2FNOA 3GH9A 2L6CA 3MNGA 2A4VA 1G6YA 2V6OA 2XHFA 2DIYA 4TN8A 5G30A 3GSSA 1HQOA 3ZLPA 4PGTA 1YY7A 4G2EA 5DALA 1OC3A 2WVXB 1SK2A 2V2GA 1DE2A 1LU4A 2HXKA 5G1LA 5ENUA 3WGEA 5A1NB 1JZOA 4ULXA 5ECPB 2IFQA 2H8LA 1X5DA 3BCKA 5KN3A 3PH9A 4DEJA 4LL1B 5HR3A 3TJFA 4QMKA 1AQVA 3HZ8A 1U6TA 1YDKA 3IHQA 1GSUA 4KSMA 5G5EA 1ERWA 4YAVA 4ACSA 4AKIA 2LS5A 2GLRA 3EURA 5F05A 4I6XA 3TKSC 2I9HA 4WR4A 2WW0A 1B8XA 3IHGA 1YJ6A 1YEXA 1VF4A 4F82A 5CRDA 2TRCP 4NHWA 1CQHA 1PRXA 1Z7PA 4JBBA 2VLUA 4TR1B 2N5AA 4EO3A 4JR4A 3GNJA 1XWGA 4OMVA 3IE3A 4ML6A 1GNWA 2GZPA 4GWRA 1T1VA 4BVXB 1ACVA 3IAS2 2B1LA 2QGVA 2D2ZA 1XOAA 1QGVA 2CZ3A 6GSUA 1M3JA 2FA4A 3KIJA 2M46A 1S3CA 1OKTA 2LRCA 3MDKA 4K7NA 4PTSA 1SK0A 2X4AA 2JSZA 4AJ8A 4EDZA 3M3MA 3HY2A 3F6DA 2VL9A 5DAKB 1FAAA 1QMVA 4GTUA 4AKHA 1R7HA 3GX8A 3US3A 2WVYA 3FYGA 2H70A 4FH8A 2FGXA 1KTEA 3FR3A 3ZVJA 4E8HA 2OA7A 5EPFA 2WFCA 2LV3A 1F37A 4PXOA 1FVJA 1X5CA 4KAEA 3QFAC 5LCZA 2H72A 4KW6A 2H1AA 3HVSA 5ECHB 2K8VA 5B8AA 5F0GA 13GSA 2TIRA 1CQGA 2KP2A 3G7IA 1ST9A 5A34B 5IOXA 2F3MA 6GSYA 3P90A 4ZBAA 5CNWA 3H93A 2H30A 4KCAA 3A3TA 2H1DA 2G2QA 3DVXA 2LNTA 5GZZB 3UOMA 4BA7A 1OC9A 2R0PA 3ERGA 2AB6A 4X4JA 4QL9A 2IWTA 5ID2A 3F4SA 1PD21 4KX4A 4GSTA 5J5NA 3MSZA 1Y1UA 1QUWA 2HRNA 4OD7A 3RAZA 2K18A 3KMNA 4MPGA 3TJGA 4IJ3A 2WW1A 3HKRA 4MJAA 4KH7A 4ML1A 5J4YA 4YAPA 2H6YA 3GL3A 3KZQA 4KA0A 2PERA 2VD0A 4PQHA 5A5HB 1G6WA 2GSSA 4JEDA 1FB6A 4PUAA 5C04A 3TKPA 3I6AA 1WP0A 2H0GA 3IXRA 4GF0A 3RDWA 1X9WB 6GSXA 2AYTA 5F06A 4GSSA 2R0GA 2DBCA 3D22A 2IPAA 3LW9A 1PL1A 3FZ9A 4BPYA 1OAZA 2O87A 6GSWA 3PPUA 2I81A 3VI7A 4K1FA 1UA5A 4ILFA 4V2LA 4IN0A 4JR6A 3G7YA 3J7Yk 2C3NA 2WRTA 3FHKA 3WYWA 4ZBDA 1ZL9A 2L5LA 3L9SA 1O8XA 6GSTA 3PGTA 3EC3A 3HVVA 4Z2RA 4OFTA 1EEJA 2H74A 2OE0A 2C0FA 2HSYA 2WB9A 2H6XA 3TJKA 3FKFA 2L4CA 3QOUA 3F3RA 4KE3A 5D8IA 4ZL7A 1Z6MA 4MH3A 2R6KA 4BL7B 1TRVA 3ZIJA 4HI7A 2WZSA 5JWQB 2PWJA 5J41A 3FZAA 2L6DA 3DD3A 4N0VA 1B4QA 3M9JA 5A5KA 3TJJA 3WT2A 2LRNA 1TRUA 4G9HA 4OO4A 18GSA 1Q4JA 3CSHA 4NMUA 5A4UA 4L5OA 2Z9SA 4ZILA 4HSCX 4MJCA 4YKGA 4GRFA 5H5QA 3ERFA 1MD4A 3HJOA 1EOHA 3BOAA 5KOXA 4HU7A 1X9MB 4BVYB 4V2NA 1NHYA 3ZL5A 4GXZA 1XVQA 3RGBC 1AIUA 1GSQA 2X8GA 3VWXA 2H1GA 1MDIA 1JHBA 1M0UA 1BQ7A 5DVBA 3HZ4A 3APSA 1UN2A 3CTGA 5HR0A 4YKFA 2PU9C 1S3DA 3IK9A 2YCDA 3A2WA 3W8SA 5IMCA 5DCGA 5JWOB 2MBSA 3RFRC 1Y25A 3P7XA 5KN2A 2G0FA 2QA1A 3KXOA 5HQPA 1YZXA 2RIIA 3IC4A 2HZEA 4L5LA 3BBYA 1BYEA 1XW6A 3C1RA 2P31A 5G1KA 1OVNA 2X49A 3FY7A 2V41A 3FZ5A 3UMAA 2REMA 3C7MA 2ES7A 1J0FA 3LJRA 2YNXA 4G0KA 4XCSA 14GSA 1KBNA 5DALB 4AF2A 4IW9A 5AIXA 5AN1A 3A2VA 5FT3A 1T00A 4XS4A 2B5XA 2XC2A 3GTUA 1THXA 2B7KA 3DRNA 4RUVA 5B6NA 1AQXA 4PNFA 4QQ7A 1LBKA 1MD3A 1T7PB 2EC4A 3LG6A 2IFQB 1A2MA 5IQYA 3U6VA 5J40A 3IA1A 3G7JA 1GP1A 2B7JA 2EFHA 4BIKA 3CQFA 1SYRA 2AHEA 3UVHA 5ECKB 2LQOA 3APOA 1TP9A 3KJYA 1J08A 4G0IA 2WCIA 2VM2A 4RI7A 1BAYA 1R26A 1J9BA 4YH2A 4TR4A 3APQA 3DMLA 1GWCA 4BWQA 2LEGA 4FXYP 2FD3A 3KP9A 2LTKA 1I5GA 1PKWA 3IDVA 4HQZA 1M2BA 2YV7A 3FEUA 2GDRA 1GLQA 3F9UA 2YOIA 2GS3A 1ON4A 1AXDA 2GTUA 4Q5FA 4AKXB 2VCZA 3IK7A 4HU9A 4OFNA 2GZYA 2GT6A 3GURA 3IRAA 2QKEA 5ECOB 1SVOA 1AW9A 2EIRA 3L0HA 2VD1A 4NWYA 4N30A 3GH6A 3TB2A 3DXBA 1TJDA 2CVDA 1I9DA 3LYPA 1C72A 4YQMA 1K3YA 4HZ2A 1SENA 4X0XA 4MF7A 2E7PA 3IOSA 4XS1A 4USSA 2LSTA 5L71A 2HSNA 5CRWA 1TU7A 1GUHA 2F51A 2GGTA 1FHEA 2J9HA 4YQUA 4GDFA 1ZYEA 3EINA 1I1IP 4KGIA 1SL0B 2KHPA 3C71A 1SL2B 3HMJG 5D9VA 2OACA 5DQSA 4TW5A 1ILOA 2CVKA 3M0FA 3WGXA 3W8JA 4PURA 2AUVA 3O6TA 4A5PA 3QDNA 4KDUA 2PPTA 3NIVA 2B5YA 3D4TA 1T8EB 4AGSA 1B48A 3VLNA 1SKRB 4TXOA 3F0IA 2VAFA 1V9WA 1EGOA 1MDKA 3FZ4A 1Q98A 4F0CA 2YV9A 1JLVA 4DSSB 1GL8A 2IMIA 5ECQB 1XBSA 5IPHA 1F6MC 2R2JA 1K3OA 2F8AA 3TU3B 3KTLA 5KN0A 1GTBA 4Q5NA 4IGJA 2CV4A 3E3EA 2HRFA 2OE3A 4MA9A 5COHA 5B6MA 2H0HA 3ZMKA 2BJXA 4ZBBA 4V1Ap 1USBA 4Z2TA 2IMEA 2DLXA 4RI6A 4CY6A 2VCVA 1SK1A 4TKYA 1OC9B 2K8SA 2R37A 2CA8A 4N3ZA 2H66A 1SJ6A 3CBUA 4CY8A 3MAKA 5ELAA 2L4QA 2B1KA 4KCEA 3TRPA 2C8UA 1TXXA 2B5EA 4G10A 3IV4A 4L0WA 2O89A 2V1MA 1URMA 3K8NA 2C0DA 5DQYA 4DVCA 1SD8A 5IM9A 1W4VA 1K0AA 4KDXA 2JSYA 3UJ1A 1T4ZA 2GSTA 1TI1A 2LRTA 1JZRA 1VF3A 2XBQA 3UARA 1THOA 1X0RA 2LNSA 1GULA 5J47A 5ABRA 3HD5A 3VK9A 1BG1A 3M1GA 4ISDA 5D9TA 2K9FA 1G7EA 1RW1A 1VF2A 4P3YB 2WVXA 4KB3A 2K6VA 3BD2A 4ZB6A 2MBTA 3ZITA 1AQWA 1GUKA 5A1NA 3D4MA 1XZOA 3C8EA 3I9V2 2RM6A 5CREA 4IBPA 5CP1A 5BMUB 2C0EA 3VI5A 3QCPA 1HNBA 2IL3A 1EGRA 1WOUA 2A4HA 4WETA 4MJBA 1TK0B 1TKDB 1FB0A 2E2MA 5J9BA 3KTBA 3ERWA 1N2AA 2KUCA 1VGLA 3GA4A 4EXJA 2HNLA 4MK3A 3KH7A 4ECIA 5E4WA 3DEXA 3DIEA 2HRKA 1A0FA 3QAWA 1U3AA 2YZHA 1XOBA 4LL4B 1AC1A 2GQLA 3IR4A 1WPIA 4MLYA 4IELA 1H4OA 5DBQA 1YKAA 4G19A 2IMDA 3OR5A 2CAIA 5ECNB 2O8VB 3C73A 4KDYA 2HQTA 4MF5A 4TR1A 1NM3A 2X8HA 3UIWA 3L9UA 2C3QA 2NDOA 1IYHA 4HS1A 3VPTA 4KF9A 4MMMA 5J3RA 3ED3A 1SKWB 4LA1A 1YF1A 3CMIA 3Q19A 3C1SA 4J2FA 5EL8A 2QSIA 2HE3A 1ZZYA 1PKZA 2O7KA 3DYRA 2X64A 5IO0A 3GRXA 2C80A 2HSMB 1Z6NA 4MPFA 4HUAA 2CT6A 1F2EA 1PX7A 2H01A 3EWLA 2R3XA 3MYDA 3P2AA 1Z3EA 2F8FA 4IQAA 2I1UA 3I69A 4IP1A 3KP8A 1M9AA 3JCML 5D93A 5DAKA 2DJ1A 4ZB9A 2RUEA 1GH2A 1S3RA 2WDUA 1SYXA 2HRAA 5A4VA 2J23A 2FUG2 4ID0A 2OBKA 2IIYA 3GV1A 1XWBA 4K9ZA 3Q74A 2VL3A 3UEMA 4ZIJA 3Q6OA 3GKXA 2FY6A 3CYNA 3HJPA 2ZNMA 1V2AA 2VCWA 3E9JB 4NV5A 1BX9A 2VM1A 4JRRA 2DKHA 4IHUA 3TRQA 3O3TA 3ZZXA 2LKUA 5IOWA 4KSOA 3ZVJD 3NOFA 1QFNA 5IMDA 3TJBA 4N11A 1JZDA 3F6FA 1M2DA 4F9ZA 3PR8A 2YWNA 1A24A 3O76A 3F4TA 3FW2A 3GHAA 1GLPA 4FIWA 2HZEB 2RLIA 1ZMAA 4Q5RA 2H1BA 3TKRA 1SL1B 3KCMA 3H4KA 3U5RE 10GSA 4J56E 4DSQA 2L57A 3EPTA 1R5AA 4HDEA 3RHBA 2DC5A 1TK5B 5EVOA 3IPZA 2MMOA 1XG8A 3LXZA 2RUFA 1TU8A 2RM5A 2FWHA 3GYKA 1DE1A 1K0OA 4QL7A 5IPGA 2ON5A 3ZFBA 1Z9HA 4TRXA 1ML6A 2PUKC 1E2YA 2WGRA 4O92A 4HJ2A 4EL1A 5GAND 1G7OA 3TRXA 4XS6A 2TRXA 3DWVA 3TDGA 2DJ3A 1RK4A 3G9BA 4ECBA 2IJYA 1Y6EA 1ZOFA 2AAWA 1EP7A 4CHSA 4D73A 3UAPA 2CX4A 4MNNA 2VL2A 2WVZA 2VOCA 3BCIA 4CDOA 2YANA 4WBJA 5FHIA 1B9YC 1YF0A 1O6JA 5AISA 1F9MA 3H79A 1ZYPA 1YKCA 3ZYWA 1H75A 1B4PA 1O8WA 1O7UA 4Q5QA 3LQ7A 19GSA 3GSTA 4TVEA 4K2DA 2ALBA 2H6ZA 1A8LA 2A2PA 2YN1A 4G0LA 1GTIA 2VO4A 1N8JA 3HVXA 1SKSB 2HYXA 4FYBA 2X99A 1WMJA 1Z7RA 4O5UA 4WR5A 5JWRB 2FHEA 3VWUA 3KD0A 3LYKA 2WW2A 3EYTA 1OC8A 1EP8A 1JLWA 4H86A 4MZBA 1GRXA 3LFLA 2HLSA 3UBLA 1TRSA 1K0DA 2H1LA 1GSSA 1NW2A 2HSNB 4BL7A 3FK8A 2ON7A 4F03A 2ZUPA 2JZSA 3IBHA 3H1NA 4F2IA 3LXTA 2NVLA 1R4WA 4AI6A 2LQQA 1MDJA 5G31A 1ZGNA 4EKZA 2L59A 4MCUA 5D73A 3GMFA 2EFEA 1HNAA 1KNGA 1JZWA 2VL2C 2QA2A 1EEMA 2MMNA 3AY8A 5A4WA 3CRUA 1DSBA 1WRYA 2WW3A 4TXOB 1EV9A 5HFGA 3I43A 4BVYA 1U87A 4ZB7A 1M7TA 5IMZA 5IO2A 5CRHA 4FYCA 3HA9A 1FO5A 2LJAA 5CYYA 2FWGA 1DUGA 1QK8A 5HFIA 2P0GA 3HCZA 2JZRA 4FYUA 2EFDA 4OO5A 1DBYA 2VCTA 4EIPA 4NHZA 2DJKA 4I2UA 7GSSA 1HYUA 2GVPA 1EV4A 3ZFLA 3ZRDA 1F3BA 3KEBA 5INYA 5F07A 3VURA 2CQ9A 2NBSA 4ZL8A 4I97A 2NPBA 1N25A 2HT9A 4V2MA 1T3BA 1TRWA 1U88A 2CVBA 1SVMA 1TW9A 5H5SA 2GSQA 4TXVA 1KEBA 3EMPA 4AKGA 1XWKA 1PA3A 4XHMA 2MZCA 5H5RA 5C00A 1YEWC 1O73A 4WKWA 2A2SA 4Z7XA 2O5VA 3CHXC 1QQ2A 17GSA 1OE8A 3FR6A 1SJIA 2MMZA 4W66A 2L5OA 3EU3A 3H8QA 5ECLB 2JACA 5DJMA 2P5QA 3LWAA 5HR2A 1FOHA 3F4RA 4I8BA 2OJLA 2PN8A 2C0GA 2PGTA 3D5JA 5B8BA 1SJZA 5KN1A 2EIOA 2VUPA 3QMXA 2M80A 4O32A 2WJUA 1K0BA 1XWCA 4I5QA 4XIHA 3GKNA 4FO5A 5J4UA 3RPPA 2OE1A 4GSNA 1GSEA 3UL3A 4JE1A 1UVZA 2PVOC 3ME7A 5D9XA 2XPDA 4MZWA 1OYJA 1XW9A 1RQMA 2VKZG 3MWHA 1ABAA 1O85A 1Z5YE 9GSSA 3LGCA 3J7Yb 1ZYNA 4PUFC 1ERTA 1ZCPA 2I4AA 3F3QA 4KNDA 3F8UA 2HRKB 2R4VA 5D96A 5IIZA 1A23A 3R3EA 4MF6A 2LJKA 2DKIA 2P5RA 3NZNA 3F63A 3RHCA 4RQXA 3M8NA 2H19A 2X8CA 2EIQA 2GT5A 3UVTA 4POMA 3LORA 2JU5A 4K6XA 4IVFA 3SWLA 3HVNA 2HFDA 5ID2B 1G0TA 4J57E 4TR3A 1K3LA 1TXUA 4HZ4A 4PI2C 3EE2A 4Z2UA 2C1YA 1A2JA 5G2ZA 2JADA 1GNEA 1M2AA 2XBIA 2E0QA 2FWEA 4L8EA 1AUCA 4AJ7A 1X9SB 2YWMA 4IS0A 2YWOA 1SD9A 4G01A 1PQNA 3ZIVA 4HOJA 22GSA 1BJXA 1XVWA 4WF4A 2DJ2A 2YZUA 5AIVA 3LSZA 5JCGA 1VF1A 3DVWA 3HJMA 3BJ5A 2R0CA 5HFKA 2BMXA 4GQCA 4NPBA 3VWVA 3N9JA 3M9KA 1YEPA 4PQIA 3QR6A 5HR1A 1PSQA 3HXSA 4RQRA 2R5GA 4TOPA 1PN9A 4OCFA 3HDCA 4POBA 3VWWA 4MJEA 2O85A 4DSSA 1ERVA 4WXTA 4XRDA 5LD0A 4E8EA 2WS2A 3ISOA 2AV4A 2OBIA 4K7OA 3TGZA 4GQFA 2N5BA 4K7IA 1XW5A 5IMFA 1MEKA 1K0MA 4ZL9A 4X43A 2KLXA 1GUMA 1U3IA 16GSA 4F0BA 1EOGA 2OADA 4NAXA 1F3AA 4POLA 3D21A 5IMVA 1TTZA 2H71A 3VPQA 4FQUA 4BVXA 2I3YA 1PFOA 1FG4A 2DMLA 1R5PA 1YQ1A 3QPMA 4EC0A 1PL2A 4PQ1A 4ZB8A 2OKAA 1X5EA 1XFLA 2BTOT 1OKDA 2CZ2A 1BEDA 2FLSA 1PN0A 4JU5A 2H0IA 3CXGA 4LLRA 1WIKA 1PX6A 5ECRB 2A2RA 3GKKA 4D73B 2PVQA 1XIYA 4DSRA 1XWAA 4NXIA 1K0NA 1QXHA 2O3EA 4L0UA 4X1UA 3S9FA 4EIQA 1B9XC 1T4YA 1NSWA 5E59A 2IN3A 4O5QA 2DJJA 2C4JA 1XXUA 1FOVA 4O7HA 2O36A 1TOFA 2HZFA 3SBCA 2H76A 2YPMA 1V57A 2DIZA 3TCOA 5CAXA 5BMUA 5CRGA 1NHOA 3TKQA 3HYPA 4GCIA 1V98A 1PMTA 2WZ9A 5GAPD 4XTSA 2F9SA 12GSA 3HHVA 3Q18A 5GSSA 4EF0A 1V40A 2OT3A 1E6BA 2DJ0A 3A5IA 4EUYA 1S4BP 3TOTA 1M99A 5CO3A 20GSA 2GQKA 5ELGA 3N5OA 1FVKA 3GFKA 2KOKA 3EVIA 3P8WA 5A34A 4ICYA 1XPVA 4TR0A 4I2TA 1TK8B 5J4VA 4WBRD 4EVMA 4MDCA 2V6KA 1LJRA 3KMOA 1A0RP 3GL5A 3IAM2 3PINA 3GKMA 3GIXA
chains in the Genus database with same CATH topology
1TDIA 4MZCA 1EZKA 2ZCTA 1A8YA 5DCHA 4PNGA 4WF5A 4V1Ag 5F8BA 3MIXA 5JCWA 1GSYA 4HEA2 2CAQA 4XS4B 4OFMA 3WT1A 3GTUB 1PGTA 3TKSE 4ECJA 2B3SA 4OWYA 2LUSA 4KUNA 5A5HA 2YWIA 3L78A 5FWGA 1YVLA 3EU4A 2HSMA 4K0GA 5EY6A 2GSRA 5KOWA 4NV2A 8GSSA 1WE0A 3R2QA 2CX3A 6GSVA 3CSIA 1GTAA 1JFUA 2WULA 5DJLA 3LEFA 11GSA 2YP6A 2VIMA 3QFBC 1WWJA 2MYGA 3UBKA 1GSDA 2VLVA 1BF5A 4K5SA 1BG5A 1O81A 2VLTA 2JZTA 1GSFA 2HI7A 3KH9A 3ZTLA 3TUEA 3GX0A 6GSSA 3ME8A 1EWXA 2H75A 4YQVA 5ECIB 2DSAA 3A5WA 3V1WA 2H73A 3QAGA 5ECSA 2EFCA 2VCXA 2C3TA 5BRTA 2KP1A 3GN3A 4GLTA 2FCHA 4LMVA 5G5FA 4PX1A 3WGDA 4IP6A 2E2GA 3IC8A 4EDYA 4K0NA 4IQ1A 4K2XA 2PBJA 3CWGA 2IMFA 1AAZA 3ZREA 1OE7A 1WJKA 4CW9A 1IYIA 4LMWA 5IMAA 3CTFA 3GUSA 3L9VA 2LJRA 2VCQA 3QAVA 5KEJA 3KGKA 2PMTA 4MH2A 2HSHA 1K0CA 2N5FA 3KM6A 4BWSA 4K5RA 4XRAA 1M9BA 2GQMA 3RBTA 4N10A 5GSTA 1FW1A 4E68A 3FRCA 3FR9A 1TI3A 5DDLA 2DMMA 2FA8A 2V32A 5D9WA 3CSJA 5AGYA 4MP4A 3QD9A 2NTOA 4N0ZA 1UC7A 2UV8G 3D0ZA 4IKHA 2B6MA 5LNKe 3A2XA 5B7CA 4AJ6A 4WEYA 1S3AA 2YJHA 1ZYQB 1HNCA 1ERUA 1GTUA 4ZXGA 2FWFA 5J9CA 4O5RA 1W89A 4OCEA 4ECCA 3TKSA 5ECMB 1SU9A 2MMAA 4POKA 1A2LA 3E0UA 3CRTA 2AJQB 1SVLA 2IMKA 3L4NA 1XCCA 2YJ7A 3W6GA 5JCUA 3DKSA 4EE0A 1VRSD 3RPNA 4IJIA 4K8MA 4MABA 3D6IA 3DGQA 4HQSA 3EMXA 2UZ8A 2JL4A 4JZQA 3WD6A 3VFIA 3TOUA 2GZZA 2QC7A 1HD2A 1MTCA 4HJMA 2XPEA 3FMWA 3ZMLA 2M72A 1V58A 2FNOA 3GH9A 2L6CA 3MNGA 2A4VA 1G6YA 2V6OA 2XHFA 2DIYA 4TN8A 5G30A 3GSSA 1HQOA 3ZLPA 4PGTA 1YY7A 4G2EA 5DALA 1OC3A 1SK2A 2V2GA 1DE2A 1LU4A 2HXKA 5G1LA 5ENUA 3WGEA 5A1NB 1JZOA 4ULXA 5ECPB 2IFQA 2H8LA 1X5DA 3BCKA 5KN3A 3PH9A 4DEJA 4LL1B 5HR3A 3TJFA 4QMKA 1AQVA 3HZ8A 1U6TA 1YDKA 3IHQA 1GSUA 4KSMA 5G5EA 1ERWA 4YAVA 4ACSA 4AKIA 2LS5A 2GLRA 3EURA 5F05A 4I6XA 3TKSC 2I9HA 4WR4A 1B8XA 3IHGA 1YJ6A 1YEXA 1VF4A 4F82A 5CRDA 2TRCP 4NHWA 1CQHA 1PRXA 1Z7PA 4JBBA 2VLUA 4TR1B 2N5AA 4EO3A 4JR4A 3GNJA 1XWGA 4OMVA 3IE3A 4ML6A 1GNWA 2GZPA 4GWRA 1T1VA 4BVXB 1ACVA 3IAS2 2B1LA 2QGVA 2D2ZA 1XOAA 1QGVA 2CZ3A 6GSUA 2FA4A 3KIJA 2M46A 1S3CA 1OKTA 2LRCA 3MDKA 4K7NA 4PTSA 1SK0A 2X4AA 2JSZA 4AJ8A 4EDZA 3M3MA 3HY2A 3F6DA 2VL9A 5DAKB 1FAAA 1QMVA 4GTUA 4AKHA 1R7HA 3GX8A 3US3A 3FYGA 2H70A 4FH8A 2FGXA 1KTEA 3FR3A 3ZVJA 4E8HA 2OA7A 5EPFA 2WFCA 2LV3A 1F37A 4PXOA 1FVJA 1X5CA 4KAEA 3QFAC 5LCZA 2H72A 4KW6A 2H1AA 3HVSA 5ECHB 2K8VA 5B8AA 5F0GA 13GSA 2TIRA 1CQGA 2KP2A 3G7IA 1ST9A 5A34B 5IOXA 2F3MA 6GSYA 3P90A 4ZBAA 5CNWA 3H93A 2H30A 4KCAA 3A3TA 2H1DA 2G2QA 3DVXA 2LNTA 5GZZB 3UOMA 4BA7A 1OC9A 2R0PA 3ERGA 2AB6A 4X4JA 4QL9A 2IWTA 5ID2A 3F4SA 1PD21 4KX4A 4GSTA 5J5NA 3MSZA 1Y1UA 1QUWA 2HRNA 4OD7A 3RAZA 2K18A 3KMNA 4MPGA 3TJGA 4IJ3A 3HKRA 4MJAA 4KH7A 4ML1A 5J4YA 4YAPA 2H6YA 3GL3A 3KZQA 4KA0A 2PERA 2VD0A 4PQHA 5A5HB 1G6WA 2GSSA 4JEDA 1FB6A 4PUAA 5C04A 3TKPA 3I6AA 1WP0A 2H0GA 3IXRA 4GF0A 3RDWA 1X9WB 6GSXA 2AYTA 5F06A 4GSSA 2R0GA 2DBCA 3D22A 2IPAA 3LW9A 1PL1A 3FZ9A 4BPYA 1OAZA 2O87A 6GSWA 3PPUA 2I81A 3VI7A 4K1FA 1UA5A 4ILFA 4V2LA 4IN0A 4JR6A 3G7YA 3J7Yk 2C3NA 2WRTA 3FHKA 3WYWA 4ZBDA 1ZL9A 2L5LA 3L9SA 1O8XA 6GSTA 3PGTA 3EC3A 3HVVA 4Z2RA 4OFTA 1EEJA 2H74A 2OE0A 2C0FA 2HSYA 2WB9A 2H6XA 3TJKA 3FKFA 2L4CA 3QOUA 3F3RA 4KE3A 5D8IA 4ZL7A 1Z6MA 4MH3A 2R6KA 4BL7B 1TRVA 3ZIJA 4HI7A 5JWQB 2PWJA 5J41A 3FZAA 2L6DA 3DD3A 4N0VA 1B4QA 3M9JA 5A5KA 3TJJA 3WT2A 2LRNA 1TRUA 4G9HA 4OO4A 18GSA 1Q4JA 3CSHA 4NMUA 5A4UA 4L5OA 2Z9SA 4ZILA 4MJCA 4YKGA 4GRFA 5H5QA 3ERFA 1MD4A 3HJOA 1EOHA 3BOAA 5KOXA 4HU7A 1X9MB 4BVYB 4V2NA 1NHYA 3ZL5A 4GXZA 1XVQA 1AIUA 1GSQA 2X8GA 3VWXA 2H1GA 1MDIA 1JHBA 1M0UA 1BQ7A 5DVBA 3HZ4A 3APSA 1UN2A 3CTGA 5HR0A 4YKFA 2PU9C 1S3DA 3IK9A 2YCDA 3A2WA 3W8SA 5IMCA 5DCGA 5JWOB 2MBSA 1Y25A 3P7XA 5KN2A 2G0FA 2QA1A 3KXOA 5HQPA 1YZXA 2RIIA 3IC4A 2HZEA 4L5LA 3BBYA 1BYEA 1XW6A 3C1RA 2P31A 5G1KA 1OVNA 2X49A 3FY7A 2V41A 3FZ5A 3UMAA 2REMA 3C7MA 2ES7A 1J0FA 3LJRA 2YNXA 4G0KA 4XCSA 14GSA 1KBNA 5DALB 4AF2A 4IW9A 5AIXA 5AN1A 3A2VA 5FT3A 1T00A 4XS4A 2B5XA 2XC2A 3GTUA 1THXA 2B7KA 3DRNA 4RUVA 5B6NA 1AQXA 4PNFA 4QQ7A 1LBKA 1MD3A 1T7PB 2EC4A 3LG6A 2IFQB 1A2MA 5IQYA 3U6VA 5J40A 3IA1A 3G7JA 1GP1A 2B7JA 2EFHA 1SYRA 2AHEA 3UVHA 5ECKB 2LQOA 3APOA 1TP9A 3KJYA 1J08A 4G0IA 2WCIA 2VM2A 4RI7A 1BAYA 1R26A 1J9BA 4YH2A 4TR4A 3APQA 3DMLA 1GWCA 4BWQA 2LEGA 3KP9A 2FD3A 2LTKA 1I5GA 1PKWA 3IDVA 4HQZA 1M2BA 2YV7A 3FEUA 2GDRA 1GLQA 3F9UA 2YOIA 2GS3A 1ON4A 1AXDA 2GTUA 4Q5FA 4AKXB 2VCZA 3IK7A 4HU9A 4OFNA 2GZYA 2GT6A 3GURA 3IRAA 2QKEA 5ECOB 1SVOA 1AW9A 2EIRA 3L0HA 2VD1A 4NWYA 4N30A 3GH6A 3TB2A 3DXBA 1TJDA 2CVDA 1I9DA 3LYPA 1C72A 4YQMA 1K3YA 4HZ2A 1SENA 4X0XA 4MF7A 2E7PA 3IOSA 4XS1A 4USSA 2LSTA 5L71A 2HSNA 5CRWA 1TU7A 1GUHA 2F51A 2GGTA 1FHEA 2J9HA 4YQUA 4GDFA 1ZYEA 3EINA 4KGIA 1SL0B 2KHPA 3C71A 1SL2B 3HMJG 5D9VA 2OACA 5DQSA 4TW5A 1ILOA 2CVKA 3M0FA 3WGXA 3W8JA 4PURA 2AUVA 3O6TA 4A5PA 3QDNA 4KDUA 2PPTA 3NIVA 2B5YA 3D4TA 1T8EB 4AGSA 1B48A 3VLNA 1SKRB 4TXOA 3F0IA 2VAFA 1V9WA 1EGOA 1MDKA 3FZ4A 1Q98A 4F0CA 2YV9A 1JLVA 4DSSB 1GL8A 2IMIA 5ECQB 1XBSA 5IPHA 1F6MC 2R2JA 1K3OA 2F8AA 3TU3B 3KTLA 5KN0A 1GTBA 4Q5NA 4IGJA 2CV4A 3E3EA 2HRFA 2OE3A 4MA9A 5COHA 5B6MA 2H0HA 3ZMKA 2BJXA 4ZBBA 4V1Ap 1USBA 4Z2TA 2IMEA 2DLXA 4RI6A 4CY6A 2VCVA 1SK1A 4TKYA 1OC9B 2K8SA 2R37A 2CA8A 4N3ZA 2H66A 1SJ6A 3CBUA 4CY8A 3MAKA 5ELAA 2L4QA 2B1KA 4KCEA 3TRPA 2C8UA 1TXXA 2B5EA 4G10A 3IV4A 4L0WA 2O89A 2V1MA 1URMA 3K8NA 2C0DA 5DQYA 4DVCA 1SD8A 5IM9A 1W4VA 1K0AA 4KDXA 2JSYA 3UJ1A 1T4ZA 2GSTA 1TI1A 2LRTA 1JZRA 1VF3A 2XBQA 3UARA 1THOA 1X0RA 2LNSA 1GULA 5J47A 5ABRA 3HD5A 3VK9A 1BG1A 3M1GA 4ISDA 5D9TA 2K9FA 1G7EA 1RW1A 1VF2A 4P3YB 4KB3A 2K6VA 3BD2A 4ZB6A 2MBTA 3ZITA 1AQWA 1GUKA 5A1NA 3D4MA 1XZOA 3C8EA 3I9V2 2RM6A 5CREA 4IBPA 5CP1A 5BMUB 2C0EA 3VI5A 3QCPA 1HNBA 2IL3A 1EGRA 1WOUA 2A4HA 4WETA 4MJBA 1TK0B 1TKDB 1FB0A 2E2MA 5J9BA 3KTBA 3ERWA 1N2AA 2KUCA 1VGLA 3GA4A 4EXJA 2HNLA 4MK3A 3KH7A 4ECIA 5E4WA 3DEXA 3DIEA 2HRKA 1A0FA 3QAWA 1U3AA 2YZHA 1XOBA 4LL4B 1AC1A 2GQLA 3IR4A 1WPIA 4MLYA 4IELA 1H4OA 5DBQA 1YKAA 4G19A 2IMDA 3OR5A 2CAIA 5ECNB 2O8VB 3C73A 4KDYA 2HQTA 4MF5A 4TR1A 1NM3A 2X8HA 3UIWA 3L9UA 2C3QA 2NDOA 1IYHA 4HS1A 3VPTA 4KF9A 4MMMA 5J3RA 3ED3A 1SKWB 4LA1A 1YF1A 3CMIA 3Q19A 3C1SA 4J2FA 5EL8A 2QSIA 2HE3A 1ZZYA 1PKZA 2O7KA 3DYRA 2X64A 5IO0A 3GRXA 2C80A 2HSMB 1Z6NA 4MPFA 4HUAA 2CT6A 1F2EA 1PX7A 2H01A 3EWLA 2R3XA 3MYDA 3P2AA 1Z3EA 2F8FA 4IQAA 2I1UA 3I69A 4IP1A 3KP8A 1M9AA 3JCML 5D93A 5DAKA 2DJ1A 4ZB9A 2RUEA 1GH2A 2WDUA 1SYXA 2HRAA 5A4VA 2J23A 2FUG2 4ID0A 2OBKA 2IIYA 3GV1A 1XWBA 4K9ZA 3Q74A 2VL3A 3UEMA 4ZIJA 3Q6OA 3GKXA 2FY6A 3CYNA 3HJPA 2ZNMA 1V2AA 2VCWA 3E9JB 4NV5A 1BX9A 2VM1A 4JRRA 2DKHA 4IHUA 3TRQA 3O3TA 3ZZXA 2LKUA 5IOWA 4KSOA 3ZVJD 3NOFA 1QFNA 5IMDA 3TJBA 4N11A 1JZDA 3F6FA 1M2DA 4F9ZA 3PR8A 2YWNA 1A24A 3O76A 3F4TA 3FW2A 3GHAA 1GLPA 4FIWA 2HZEB 2RLIA 1ZMAA 4Q5RA 2H1BA 3TKRA 1SL1B 3KCMA 3H4KA 3U5RE 10GSA 4J56E 4DSQA 2L57A 3EPTA 1R5AA 4HDEA 3RHBA 2DC5A 1TK5B 5EVOA 3IPZA 2MMOA 3LXZA 2RUFA 1TU8A 2RM5A 2FWHA 3GYKA 1DE1A 1K0OA 4QL7A 5IPGA 2ON5A 3ZFBA 1Z9HA 4TRXA 1ML6A 2PUKC 1E2YA 2WGRA 4O92A 4HJ2A 4EL1A 5GAND 1G7OA 3TRXA 4XS6A 2TRXA 3DWVA 3TDGA 2DJ3A 1RK4A 3G9BA 4ECBA 2IJYA 1Y6EA 1ZOFA 2AAWA 1EP7A 4CHSA 4D73A 3UAPA 2CX4A 4MNNA 2VL2A 2VOCA 3BCIA 4CDOA 2YANA 4WBJA 5FHIA 1B9YC 1YF0A 1O6JA 5AISA 1F9MA 3H79A 1ZYPA 1YKCA 3ZYWA 1H75A 1B4PA 1O8WA 1O7UA 4Q5QA 3LQ7A 19GSA 3GSTA 4TVEA 4K2DA 2ALBA 2H6ZA 1A8LA 2A2PA 2YN1A 4G0LA 1GTIA 2VO4A 1N8JA 3HVXA 1SKSB 2HYXA 4FYBA 2X99A 1WMJA 1Z7RA 4O5UA 4WR5A 5JWRB 2FHEA 3VWUA 3KD0A 3LYKA 3EYTA 1OC8A 1EP8A 1JLWA 4H86A 4MZBA 1GRXA 3LFLA 2HLSA 3UBLA 1TRSA 1K0DA 2H1LA 1GSSA 1NW2A 2HSNB 4BL7A 3FK8A 2ON7A 4F03A 2ZUPA 2JZSA 3IBHA 3H1NA 4F2IA 3LXTA 2NVLA 1R4WA 4AI6A 2LQQA 1MDJA 5G31A 1ZGNA 4EKZA 2L59A 4MCUA 5D73A 3GMFA 2EFEA 1HNAA 1KNGA 1JZWA 2VL2C 2QA2A 1EEMA 2MMNA 3AY8A 5A4WA 3CRUA 1DSBA 1WRYA 4TXOB 1EV9A 5HFGA 3I43A 4BVYA 1U87A 4ZB7A 1M7TA 5IMZA 5IO2A 5CRHA 4FYCA 3HA9A 1FO5A 2LJAA 5CYYA 2FWGA 1DUGA 1QK8A 5HFIA 2P0GA 3HCZA 2JZRA 4FYUA 2EFDA 4OO5A 1DBYA 2VCTA 4EIPA 4NHZA 2DJKA 4I2UA 7GSSA 1HYUA 2GVPA 1EV4A 3ZFLA 3ZRDA 1F3BA 3KEBA 5INYA 5F07A 3VURA 2CQ9A 2NBSA 4ZL8A 4I97A 2NPBA 1N25A 2HT9A 4V2MA 1T3BA 1TRWA 1U88A 2CVBA 1SVMA 1TW9A 5H5SA 2GSQA 4TXVA 1KEBA 3EMPA 4AKGA 1XWKA 1PA3A 4XHMA 2MZCA 5H5RA 5C00A 1O73A 4WKWA 2A2SA 4Z7XA 2O5VA 1QQ2A 17GSA 1OE8A 3FR6A 1SJIA 2MMZA 4W66A 2L5OA 3EU3A 3H8QA 5ECLB 2JACA 5DJMA 2P5QA 3LWAA 5HR2A 1FOHA 3F4RA 4I8BA 2OJLA 2PN8A 2C0GA 2PGTA 3D5JA 5B8BA 1SJZA 5KN1A 2EIOA 2VUPA 3QMXA 2M80A 4O32A 2WJUA 1K0BA 1XWCA 4I5QA 4XIHA 3GKNA 4FO5A 5J4UA 3RPPA 2OE1A 4GSNA 1GSEA 3UL3A 4JE1A 1UVZA 2PVOC 3ME7A 5D9XA 2XPDA 4MZWA 1OYJA 1XW9A 1RQMA 2VKZG 3MWHA 1ABAA 1O85A 1Z5YE 9GSSA 3LGCA 3J7Yb 1ZYNA 4PUFC 1ERTA 1ZCPA 2I4AA 3F3QA 4KNDA 3F8UA 2HRKB 2R4VA 5D96A 5IIZA 1A23A 3R3EA 4MF6A 2LJKA 2DKIA 2P5RA 3NZNA 3F63A 3RHCA 4RQXA 3M8NA 2H19A 2X8CA 2EIQA 2GT5A 3UVTA 4POMA 3LORA 2JU5A 4K6XA 4IVFA 3SWLA 2HFDA 5ID2B 1G0TA 4J57E 4TR3A 1K3LA 1TXUA 4HZ4A 3EE2A 4Z2UA 2C1YA 1A2JA 5G2ZA 2JADA 1GNEA 1M2AA 2XBIA 2E0QA 2FWEA 4L8EA 1AUCA 4AJ7A 1X9SB 2YWMA 4IS0A 2YWOA 1SD9A 4G01A 1PQNA 3ZIVA 4HOJA 22GSA 1BJXA 1XVWA 4WF4A 2DJ2A 2YZUA 5AIVA 3LSZA 5JCGA 1VF1A 3DVWA 3HJMA 3BJ5A 2R0CA 5HFKA 2BMXA 4GQCA 4NPBA 3VWVA 3N9JA 3M9KA 1YEPA 4PQIA 3QR6A 5HR1A 1PSQA 3HXSA 4RQRA 2R5GA 4TOPA 1PN9A 4OCFA 3HDCA 4POBA 3VWWA 4MJEA 2O85A 4DSSA 1ERVA 4WXTA 4XRDA 5LD0A 4E8EA 2WS2A 3ISOA 2AV4A 2OBIA 4K7OA 3TGZA 4GQFA 2N5BA 4K7IA 1XW5A 5IMFA 1MEKA 1K0MA 4ZL9A 4X43A 2KLXA 1GUMA 1U3IA 16GSA 4F0BA 1EOGA 2OADA 4NAXA 1F3AA 4POLA 3D21A 5IMVA 1TTZA 2H71A 3VPQA 4FQUA 4BVXA 2I3YA 1FG4A 2DMLA 1R5PA 1YQ1A 3QPMA 4EC0A 1PL2A 4PQ1A 4ZB8A 2OKAA 1X5EA 1XFLA 2BTOT 1OKDA 2CZ2A 1BEDA 2FLSA 1PN0A 4JU5A 2H0IA 3CXGA 4LLRA 1WIKA 1PX6A 5ECRB 2A2RA 3GKKA 4D73B 2PVQA 1XIYA 4DSRA 1XWAA 4NXIA 1K0NA 1QXHA 4L0UA 4X1UA 3S9FA 4EIQA 1B9XC 1T4YA 1NSWA 5E59A 2IN3A 4O5QA 2DJJA 2C4JA 1XXUA 1FOVA 4O7HA 1TOFA 2HZFA 3SBCA 2H76A 2YPMA 1V57A 2DIZA 3TCOA 5CAXA 5BMUA 5CRGA 1NHOA 3TKQA 3HYPA 4GCIA 1V98A 1PMTA 2WZ9A 5GAPD 4XTSA 2F9SA 12GSA 3HHVA 3Q18A 5GSSA 4EF0A 1V40A 2OT3A 1E6BA 2DJ0A 3A5IA 4EUYA 3TOTA 1M99A 5CO3A 20GSA 2GQKA 5ELGA 3N5OA 1FVKA 3GFKA 2KOKA 3EVIA 3P8WA 5A34A 4ICYA 1XPVA 4TR0A 4I2TA 1TK8B 5J4VA 4WBRD 4EVMA 4MDCA 2V6KA 1LJRA 3KMOA 1A0RP 3GL5A 3IAM2 3PINA 3GKMA 3GIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TDI A;  4MZC A;  1EZK A;  2ZCT A;  1A8Y A;  5DCH A;  4PNG A;  4WF5 A;  4V1A g;  5F8B A;  5JCW A;  1GSY A;  4HEA 2;  2CAQ A;  4XS4 B;  4OFM A;  3WT1 A;  3GTU B;  1PGT A;  3TKS E;  4ECJ A;  2B3S A;  4OWY A;  2LUS A;  4KUN A;  2YWI A;  3L78 A;  5FWG A;  3EU4 A;  2HSM A;  4K0G A;  5EY6 A;  2GSR A;  4NV2 A;  8GSS A;  1WE0 A;  3R2Q A;  2CX3 A;  6GSV A;  3CSI A;  1GTA A;  1JFU A;  2WUL A;  5DJL A;  3LEF A;  11GS A;  2YP6 A;  2VIM A;  3QFB C;  1WWJ A;  2MYG A;  3UBK A;  1GSD A;  2VLV A;  1BG5 A;  1O81 A;  2VLT A;  2JZT A;  1GSF A;  2HI7 A;  3KH9 A;  3ZTL A;  3TUE A;  3GX0 A;  6GSS A;  3ME8 A;  1EWX A;  2H75 A;  4YQV A;  5ECI B;  2DSA A;  3A5W A;  3V1W A;  2H73 A;  3QAG A;  5ECS A;  2VCX A;  2C3T A;  2KP1 A;  3GN3 A;  4GLT A;  2FCH A;  4LMV A;  5G5F A;  4PX1 A;  3WGD A;  4IP6 A;  2E2G A;  3IC8 A;  4EDY A;  4K0N A;  4IQ1 A;  2PBJ A;  2IMF A;  1AAZ A;  3ZRE A;  1OE7 A;  1WJK A;  4CW9 A;  1IYI A;  4LMW A;  5IMA A;  3CTF A;  3GUS A;  3L9V A;  2LJR A;  2VCQ A;  3QAV A;  5KEJ A;  3KGK A;  2PMT A;  4MH2 A;  2HSH A;  1K0C A;  2N5F A;  3KM6 A;  4BWS A;  4XRA A;  1M9B A;  2GQM A;  3RBT A;  4N10 A;  5GST A;  1FW1 A;  3FRC A;  3FR9 A;  1TI3 A;  5DDL A;  2DMM A;  2FA8 A;  2V32 A;  5D9W A;  3CSJ A;  5AGY A;  4MP4 A;  3QD9 A;  2NTO A;  4N0Z A;  1UC7 A;  3D0Z A;  4IKH A;  2B6M A;  5LNK e;  3A2X A;  5B7C A;  4AJ6 A;  4WEY A;  1S3A A;  2YJH A;  1ZYQ B;  1HNC A;  1ERU A;  1GTU A;  4ZXG A;  2FWF A;  5J9C A;  4O5R A;  1W89 A;  4OCE A;  4ECC A;  3TKS A;  5ECM B;  1SU9 A;  2MMA A;  4POK A;  1A2L A;  3E0U A;  3CRT A;  2AJQ B;  2IMK A;  3L4N A;  1XCC A;  2YJ7 A;  3W6G A;  5JCU A;  3DKS A;  4EE0 A;  1VRS D;  3RPN A;  4IJI A;  4K8M A;  4MAB A;  3D6I A;  3DGQ A;  4HQS A;  3EMX A;  2UZ8 A;  2JL4 A;  4JZQ A;  3WD6 A;  3VFI A;  3TOU A;  2GZZ A;  2QC7 A;  1HD2 A;  1MTC A;  4HJM A;  2XPE A;  3ZML A;  2M72 A;  1V58 A;  2FNO A;  3GH9 A;  2L6C A;  3MNG A;  2A4V A;  1G6Y A;  2V6O A;  2XHF A;  2DIY A;  4TN8 A;  5G30 A;  3GSS A;  1HQO A;  3ZLP A;  4PGT A;  1YY7 A;  4G2E A;  5DAL A;  1OC3 A;  1SK2 A;  2V2G A;  1DE2 A;  1LU4 A;  2HXK A;  5G1L A;  5ENU A;  3WGE A;  1JZO A;  4ULX A;  5ECP B;  2IFQ A;  2H8L A;  1X5D A;  3BCK A;  5KN3 A;  3PH9 A;  4DEJ A;  4LL1 B;  5HR3 A;  3TJF A;  1AQV A;  3HZ8 A;  1U6T A;  1YDK A;  3IHQ A;  1GSU A;  4KSM A;  5G5E A;  1ERW A;  4YAV A;  4ACS A;  2LS5 A;  2GLR A;  3EUR A;  5F05 A;  4I6X A;  3TKS C;  2I9H A;  4WR4 A;  1B8X A;  1YJ6 A;  1YEX A;  1VF4 A;  4F82 A;  5CRD A;  2TRC P;  4NHW A;  1CQH A;  1PRX A;  1Z7P A;  4JBB A;  2VLU A;  4TR1 B;  2N5A A;  4EO3 A;  4JR4 A;  3GNJ A;  1XWG A;  4OMV A;  3IE3 A;  4ML6 A;  1GNW A;  2GZP A;  4GWR A;  1T1V A;  4BVX B;  1ACV A;  3IAS 2;  2B1L A;  2QGV A;  2D2Z A;  1XOA A;  1QGV A;  2CZ3 A;  6GSU A;  2FA4 A;  3KIJ A;  2M46 A;  1S3C A;  1OKT A;  2LRC A;  3MDK A;  4K7N A;  4PTS A;  1SK0 A;  2JSZ A;  4AJ8 A;  4EDZ A;  3M3M A;  3HY2 A;  3F6D A;  2VL9 A;  5DAK B;  1FAA A;  1QMV A;  4GTU A;  1R7H A;  3GX8 A;  3US3 A;  3FYG A;  2H70 A;  4FH8 A;  2FGX A;  1KTE A;  3FR3 A;  3ZVJ A;  4E8H A;  2OA7 A;  5EPF A;  2WFC A;  2LV3 A;  1F37 A;  4PXO A;  1FVJ A;  1X5C A;  4KAE A;  3QFA C;  5LCZ A;  2H72 A;  4KW6 A;  2H1A A;  3HVS A;  5ECH B;  2K8V A;  5B8A A;  5F0G A;  13GS A;  2TIR A;  1CQG A;  2KP2 A;  3G7I A;  1ST9 A;  5IOX A;  2F3M A;  6GSY A;  3P90 A;  4ZBA A;  5CNW A;  3H93 A;  2H30 A;  4KCA A;  3A3T A;  2H1D A;  2G2Q A;  3DVX A;  2LNT A;  5GZZ B;  3UOM A;  4BA7 A;  1OC9 A;  3ERG A;  2AB6 A;  4QL9 A;  2IWT A;  5ID2 A;  3F4S A;  1PD2 1;  4KX4 A;  4GST A;  5J5N A;  3MSZ A;  1QUW A;  2HRN A;  4OD7 A;  3RAZ A;  2K18 A;  3KMN A;  4MPG A;  3TJG A;  4IJ3 A;  3HKR A;  4MJA A;  4KH7 A;  4ML1 A;  4YAP A;  2H6Y A;  3GL3 A;  3KZQ A;  4KA0 A;  2PER A;  2VD0 A;  4PQH A;  1G6W A;  2GSS A;  4JED A;  1FB6 A;  4PUA A;  5C04 A;  3TKP A;  3I6A A;  1WP0 A;  2H0G A;  3IXR A;  4GF0 A;  3RDW A;  1X9W B;  6GSX A;  2AYT A;  5F06 A;  4GSS A;  2DBC A;  3D22 A;  2IPA A;  1PL1 A;  3FZ9 A;  4BPY A;  1OAZ A;  2O87 A;  6GSW A;  3PPU A;  2I81 A;  3VI7 A;  4K1F A;  1UA5 A;  4ILF A;  4V2L A;  4IN0 A;  4JR6 A;  3G7Y A;  3J7Y k;  2C3N A;  2WRT A;  3FHK A;  3WYW A;  4ZBD A;  1ZL9 A;  2L5L A;  3L9S A;  1O8X A;  6GST A;  3PGT A;  3EC3 A;  3HVV A;  4OFT A;  1EEJ A;  2H74 A;  2OE0 A;  2C0F A;  2HSY A;  2WB9 A;  2H6X A;  3TJK A;  3FKF A;  2L4C A;  3QOU A;  3F3R A;  4KE3 A;  5D8I A;  4ZL7 A;  1Z6M A;  4MH3 A;  2R6K A;  4BL7 B;  1TRV A;  3ZIJ A;  4HI7 A;  5JWQ B;  2PWJ A;  5J41 A;  3FZA A;  2L6D A;  3DD3 A;  4N0V A;  1B4Q A;  3M9J A;  5A5K A;  3TJJ A;  3WT2 A;  2LRN A;  1TRU A;  4G9H A;  4OO4 A;  18GS A;  1Q4J A;  3CSH A;  4NMU A;  5A4U A;  4L5O A;  2Z9S A;  4ZIL A;  4MJC A;  4GRF A;  5H5Q A;  3ERF A;  1MD4 A;  3HJO A;  1EOH A;  3BOA A;  4HU7 A;  1X9M B;  4BVY B;  4V2N A;  1NHY A;  3ZL5 A;  4GXZ A;  1XVQ A;  1AIU A;  1GSQ A;  2X8G A;  3VWX A;  2H1G A;  1MDI A;  1JHB A;  1M0U A;  1BQ7 A;  5DVB A;  3HZ4 A;  3APS A;  1UN2 A;  3CTG A;  5HR0 A;  2PU9 C;  1S3D A;  3IK9 A;  2YCD A;  3A2W A;  3W8S A;  5IMC A;  5DCG A;  5JWO B;  2MBS A;  1Y25 A;  3P7X A;  5KN2 A;  2G0F A;  3KXO A;  5HQP A;  1YZX A;  2RII A;  3IC4 A;  2HZE A;  4L5L A;  3BBY A;  1BYE A;  1XW6 A;  3C1R A;  2P31 A;  5G1K A;  1OVN A;  3FY7 A;  2V41 A;  3FZ5 A;  3UMA A;  2REM A;  3C7M A;  2ES7 A;  1J0F A;  3LJR A;  2YNX A;  4G0K A;  4XCS A;  14GS A;  1KBN A;  5DAL B;  4AF2 A;  4IW9 A;  5AIX A;  5AN1 A;  3A2V A;  5FT3 A;  1T00 A;  4XS4 A;  2B5X A;  2XC2 A;  3GTU A;  1THX A;  2B7K A;  3DRN A;  4RUV A;  5B6N A;  1AQX A;  4PNF A;  4QQ7 A;  1LBK A;  1MD3 A;  1T7P B;  2EC4 A;  3LG6 A;  2IFQ B;  1A2M A;  5IQY A;  3U6V A;  3IA1 A;  3G7J A;  1GP1 A;  2B7J A;  1SYR A;  2AHE A;  3UVH A;  5ECK B;  2LQO A;  3APO A;  1TP9 A;  3KJY A;  1J08 A;  4G0I A;  2WCI A;  2VM2 A;  4RI7 A;  1BAY A;  1R26 A;  1J9B A;  4YH2 A;  4TR4 A;  3APQ A;  3DML A;  1GWC A;  4BWQ A;  2LEG A;  3KP9 A;  2FD3 A;  2LTK A;  1I5G A;  1PKW A;  3IDV A;  4HQZ A;  1M2B A;  2YV7 A;  3FEU A;  2GDR A;  1GLQ A;  3F9U A;  2YOI A;  2GS3 A;  1ON4 A;  1AXD A;  2GTU A;  4Q5F A;  2VCZ A;  3IK7 A;  4HU9 A;  4OFN A;  2GZY A;  2GT6 A;  3GUR A;  3IRA A;  2QKE A;  5ECO B;  1AW9 A;  2EIR A;  3L0H A;  2VD1 A;  4NWY A;  4N30 A;  3GH6 A;  3TB2 A;  3DXB A;  1TJD A;  2CVD A;  1I9D A;  3LYP A;  1C72 A;  4YQM A;  1K3Y A;  4HZ2 A;  1SEN A;  4X0X A;  4MF7 A;  2E7P A;  3IOS A;  4XS1 A;  4USS A;  2LST A;  5L71 A;  5CRW A;  1TU7 A;  1GUH A;  2F51 A;  2GGT A;  1FHE A;  2J9H A;  4YQU A;  1ZYE A;  3EIN A;  4KGI A;  1SL0 B;  2KHP A;  3C71 A;  1SL2 B;  5D9V A;  2OAC A;  5DQS A;  4TW5 A;  1ILO A;  2CVK A;  3M0F A;  3WGX A;  3W8J A;  4PUR A;  2AUV A;  3O6T A;  3QDN A;  4KDU A;  2PPT A;  3NIV A;  2B5Y A;  3D4T A;  1T8E B;  4AGS A;  1B48 A;  3VLN A;  1SKR B;  4TXO A;  3F0I A;  2VAF A;  1V9W A;  1EGO A;  1MDK A;  3FZ4 A;  1Q98 A;  4F0C A;  2YV9 A;  1JLV A;  4DSS B;  1GL8 A;  2IMI A;  5ECQ B;  1XBS A;  5IPH A;  1F6M C;  2R2J A;  1K3O A;  2F8A A;  3KTL A;  5KN0 A;  1GTB A;  4Q5N A;  4IGJ A;  2CV4 A;  3E3E A;  2HRF A;  2OE3 A;  4MA9 A;  5COH A;  5B6M A;  2H0H A;  3ZMK A;  2BJX A;  4ZBB A;  4V1A p;  1USB A;  2IME A;  2DLX A;  4RI6 A;  2VCV A;  1SK1 A;  4TKY A;  1OC9 B;  2K8S A;  2R37 A;  2CA8 A;  2H66 A;  1SJ6 A;  3CBU A;  3MAK A;  5ELA A;  2L4Q A;  2B1K A;  4KCE A;  3TRP A;  2C8U A;  1TXX A;  2B5E A;  4G10 A;  3IV4 A;  4L0W A;  2O89 A;  2V1M A;  1URM A;  3K8N A;  2C0D A;  5DQY A;  4DVC A;  1SD8 A;  5IM9 A;  1W4V A;  1K0A A;  4KDX A;  2JSY A;  3UJ1 A;  1T4Z A;  2GST A;  1TI1 A;  2LRT A;  1JZR A;  1VF3 A;  2XBQ A;  3UAR A;  1THO A;  1X0R A;  2LNS A;  1GUL A;  5ABR A;  3HD5 A;  3VK9 A;  3M1G A;  4ISD A;  5D9T A;  2K9F A;  1G7E A;  1RW1 A;  1VF2 A;  4P3Y B;  4KB3 A;  2K6V A;  3BD2 A;  4ZB6 A;  2MBT A;  3ZIT A;  1AQW A;  1GUK A;  3D4M A;  1XZO A;  3C8E A;  3I9V 2;  2RM6 A;  5CRE A;  4IBP A;  5CP1 A;  2C0E A;  3VI5 A;  3QCP A;  1HNB A;  2IL3 A;  1EGR A;  1WOU A;  4WET A;  4MJB A;  1TK0 B;  1TKD B;  1FB0 A;  2E2M A;  5J9B A;  3KTB A;  3ERW A;  1N2A A;  2KUC A;  1VGL A;  3GA4 A;  4EXJ A;  2HNL A;  4MK3 A;  3KH7 A;  4ECI A;  5E4W A;  3DEX A;  3DIE A;  2HRK A;  1A0F A;  3QAW A;  1U3A A;  2YZH A;  1XOB A;  4LL4 B;  1AC1 A;  2GQL A;  3IR4 A;  1WPI A;  4MLY A;  4IEL A;  1H4O A;  5DBQ A;  1YKA A;  4G19 A;  2IMD A;  3OR5 A;  2CAI A;  5ECN B;  2O8V B;  3C73 A;  4KDY A;  2HQT A;  4MF5 A;  4TR1 A;  1NM3 A;  2X8H A;  3UIW A;  3L9U A;  2C3Q A;  2NDO A;  1IYH A;  4HS1 A;  3VPT A;  4KF9 A;  4MMM A;  5J3R A;  3ED3 A;  1SKW B;  4LA1 A;  1YF1 A;  3CMI A;  3Q19 A;  3C1S A;  4J2F A;  5EL8 A;  2QSI A;  2HE3 A;  1ZZY A;  1PKZ A;  2O7K A;  3DYR A;  2X64 A;  5IO0 A;  3GRX A;  2C80 A;  2HSM B;  1Z6N A;  4MPF A;  4HUA A;  2CT6 A;  1F2E A;  1PX7 A;  2H01 A;  3EWL A;  2R3X A;  3P2A A;  1Z3E A;  2F8F A;  4IQA A;  2I1U A;  3I69 A;  4IP1 A;  3KP8 A;  1M9A A;  3JCM L;  5D93 A;  5DAK A;  2DJ1 A;  4ZB9 A;  2RUE A;  1GH2 A;  2WDU A;  1SYX A;  2HRA A;  5A4V A;  2J23 A;  2FUG 2;  4ID0 A;  2OBK A;  2IIY A;  3GV1 A;  1XWB A;  4K9Z A;  3Q74 A;  2VL3 A;  3UEM A;  4ZIJ A;  3Q6O A;  3GKX A;  2FY6 A;  3CYN A;  3HJP A;  2ZNM A;  1V2A A;  2VCW A;  3E9J B;  4NV5 A;  1BX9 A;  2VM1 A;  4JRR A;  4IHU A;  3TRQ A;  3O3T A;  3ZZX A;  2LKU A;  5IOW A;  4KSO A;  3ZVJ D;  3NOF A;  1QFN A;  5IMD A;  3TJB A;  4N11 A;  1JZD A;  3F6F A;  1M2D A;  4F9Z A;  3PR8 A;  2YWN A;  1A24 A;  3O76 A;  3F4T A;  3FW2 A;  3GHA A;  1GLP A;  4FIW A;  2HZE B;  2RLI A;  1ZMA A;  4Q5R A;  2H1B A;  3TKR A;  1SL1 B;  3KCM A;  3H4K A;  3U5R E;  10GS A;  4J56 E;  4DSQ A;  2L57 A;  1R5A A;  4HDE A;  3RHB A;  2DC5 A;  1TK5 B;  5EVO A;  3IPZ A;  2MMO A;  3LXZ A;  2RUF A;  1TU8 A;  2RM5 A;  2FWH A;  3GYK A;  1DE1 A;  1K0O A;  4QL7 A;  5IPG A;  2ON5 A;  3ZFB A;  1Z9H A;  4TRX A;  1ML6 A;  2PUK C;  1E2Y A;  2WGR A;  4O92 A;  4HJ2 A;  4EL1 A;  5GAN D;  1G7O A;  3TRX A;  4XS6 A;  2TRX A;  3DWV A;  3TDG A;  2DJ3 A;  1RK4 A;  3G9B A;  4ECB A;  2IJY A;  1Y6E A;  1ZOF A;  2AAW A;  1EP7 A;  4CHS A;  4D73 A;  3UAP A;  2CX4 A;  2VL2 A;  2VOC A;  3BCI A;  4CDO A;  2YAN A;  4WBJ A;  5FHI A;  1B9Y C;  1YF0 A;  1O6J A;  5AIS A;  1F9M A;  3H79 A;  1YKC A;  3ZYW A;  1H75 A;  1B4P A;  1O8W A;  1O7U A;  4Q5Q A;  3LQ7 A;  19GS A;  3GST A;  4TVE A;  4K2D A;  2ALB A;  2H6Z A;  1A8L A;  2YN1 A;  4G0L A;  1GTI A;  2VO4 A;  1N8J A;  3HVX A;  1SKS B;  2HYX A;  4FYB A;  2X99 A;  1WMJ A;  1Z7R A;  4WR5 A;  5JWR B;  2FHE A;  3VWU A;  3KD0 A;  3LYK A;  3EYT A;  1OC8 A;  1EP8 A;  1JLW A;  4H86 A;  4MZB A;  1GRX A;  3LFL A;  2HLS A;  3UBL A;  1TRS A;  1K0D A;  1GSS A;  1NW2 A;  2HSN B;  4BL7 A;  3FK8 A;  2ON7 A;  4F03 A;  2ZUP A;  2JZS A;  3IBH A;  3H1N A;  4F2I A;  3LXT A;  2NVL A;  1R4W A;  2LQQ A;  1MDJ A;  5G31 A;  1ZGN A;  4EKZ A;  2L59 A;  4MCU A;  5D73 A;  3GMF A;  1HNA A;  1KNG A;  1JZW A;  2VL2 C;  1EEM A;  2MMN A;  3AY8 A;  5A4W A;  3CRU A;  1DSB A;  1WRY A;  4TXO B;  1EV9 A;  5HFG A;  3I43 A;  4BVY A;  1U87 A;  1M7T A;  5IMZ A;  5IO2 A;  5CRH A;  4FYC A;  3HA9 A;  1FO5 A;  2LJA A;  5CYY A;  2FWG A;  1DUG A;  1QK8 A;  5HFI A;  2P0G A;  3HCZ A;  2JZR A;  4FYU A;  4OO5 A;  1DBY A;  2VCT A;  4NHZ A;  2DJK A;  4I2U A;  7GSS A;  1HYU A;  2GVP A;  1EV4 A;  3ZFL A;  3ZRD A;  1F3B A;  3KEB A;  5INY A;  5F07 A;  3VUR A;  2CQ9 A;  2NBS A;  4ZL8 A;  4I97 A;  2NPB A;  4V2M A;  2HT9 A;  1T3B A;  1TRW A;  1U88 A;  2CVB A;  1TW9 A;  5H5S A;  2GSQ A;  4TXV A;  1KEB A;  3EMP A;  1XWK A;  1PA3 A;  4XHM A;  2MZC A;  5H5R A;  5C00 A;  1O73 A;  4WKW A;  2A2S A;  4Z7X A;  1QQ2 A;  17GS A;  1OE8 A;  3FR6 A;  1SJI A;  2MMZ A;  2L5O A;  3EU3 A;  3H8Q A;  5ECL B;  2JAC A;  5DJM A;  2P5Q A;  3LWA A;  5HR2 A;  3F4R A;  4I8B A;  2OJL A;  2PN8 A;  2C0G A;  2PGT A;  3D5J A;  5B8B A;  1SJZ A;  5KN1 A;  2EIO A;  2VUP A;  3QMX A;  2M80 A;  4O32 A;  2WJU A;  1K0B A;  1XWC A;  4I5Q A;  4XIH A;  3GKN A;  4FO5 A;  5J4U A;  3RPP A;  2OE1 A;  4GSN A;  1GSE A;  3UL3 A;  4JE1 A;  1UVZ A;  2PVO C;  3ME7 A;  5D9X A;  2XPD A;  4MZW A;  1OYJ A;  1XW9 A;  1RQM A;  3MWH A;  1ABA A;  1O85 A;  1Z5Y E;  9GSS A;  3LGC A;  3J7Y b;  4PUF C;  1ERT A;  1ZCP A;  2I4A A;  3F3Q A;  4KND A;  3F8U A;  2HRK B;  2R4V A;  5D96 A;  5IIZ A;  1A23 A;  3R3E A;  4MF6 A;  2LJK A;  2P5R A;  3NZN A;  3F63 A;  3RHC A;  4RQX A;  3M8N A;  2H19 A;  2X8C A;  2EIQ A;  2GT5 A;  3UVT A;  4POM A;  3LOR A;  2JU5 A;  4K6X A;  4IVF A;  3SWL A;  2HFD A;  5ID2 B;  1G0T A;  4J57 E;  4TR3 A;  1K3L A;  4HZ4 A;  3EE2 A;  2C1Y A;  1A2J A;  5G2Z A;  2JAD A;  1GNE A;  1M2A A;  2XBI A;  2E0Q A;  2FWE A;  4L8E A;  1AUC A;  4AJ7 A;  1X9S B;  2YWM A;  4IS0 A;  2YWO A;  1SD9 A;  1PQN A;  3ZIV A;  4HOJ A;  22GS A;  1BJX A;  1XVW A;  4WF4 A;  2DJ2 A;  2YZU A;  5AIV A;  3LSZ A;  5JCG A;  1VF1 A;  3DVW A;  3HJM A;  3BJ5 A;  5HFK A;  2BMX A;  4GQC A;  4NPB A;  3VWV A;  3N9J A;  3M9K A;  1YEP A;  4PQI A;  3QR6 A;  5HR1 A;  1PSQ A;  3HXS A;  4RQR A;  2R5G A;  4TOP A;  1PN9 A;  4OCF A;  3HDC A;  4POB A;  3VWW A;  4MJE A;  2O85 A;  4DSS A;  1ERV A;  4WXT A;  4XRD A;  5LD0 A;  4E8E A;  2WS2 A;  3ISO A;  2AV4 A;  2OBI A;  4K7O A;  3TGZ A;  4GQF A;  2N5B A;  4K7I A;  1XW5 A;  5IMF A;  1MEK A;  1K0M A;  4ZL9 A;  4X43 A;  2KLX A;  1GUM A;  1U3I A;  16GS A;  4F0B A;  1EOG A;  2OAD A;  4NAX A;  1F3A A;  4POL A;  3D21 A;  5IMV A;  1TTZ A;  2H71 A;  3VPQ A;  4FQU A;  4BVX A;  2I3Y A;  1FG4 A;  2DML A;  1R5P A;  1YQ1 A;  3QPM A;  4EC0 A;  1PL2 A;  4PQ1 A;  4ZB8 A;  2OKA A;  1X5E A;  1XFL A;  2BTO T;  1OKD A;  2CZ2 A;  1BED A;  2FLS A;  4JU5 A;  2H0I A;  3CXG A;  4LLR A;  1WIK A;  1PX6 A;  5ECR B;  2A2R A;  3GKK A;  4D73 B;  2PVQ A;  1XIY A;  4DSR A;  1XWA A;  4NXI A;  1K0N A;  1QXH A;  4L0U A;  4X1U A;  3S9F A;  1B9X C;  1T4Y A;  1NSW A;  5E59 A;  2IN3 A;  2DJJ A;  2C4J A;  1XXU A;  1FOV A;  4O7H A;  1TOF A;  2HZF A;  3SBC A;  2H76 A;  2YPM A;  1V57 A;  2DIZ A;  3TCO A;  5CAX A;  5BMU A;  5CRG A;  1NHO A;  3TKQ A;  3HYP A;  4GCI A;  1V98 A;  1PMT A;  2WZ9 A;  5GAP D;  4XTS A;  2F9S A;  12GS A;  3HHV A;  3Q18 A;  5GSS A;  4EF0 A;  1V40 A;  1E6B A;  2DJ0 A;  4EUY A;  3TOT A;  1M99 A;  5CO3 A;  20GS A;  2GQK A;  5ELG A;  3N5O A;  1FVK A;  3GFK A;  2KOK A;  3EVI A;  3P8W A;  1XPV A;  4TR0 A;  4I2T A;  1TK8 B;  4WBR D;  4EVM A;  4MDC A;  2V6K A;  1LJR A;  3KMO A;  1A0R P;  3GL5 A;  3IAM 2;  3PIN A;  3GKM A;  3GIX A; 
#chains in the Genus database with same CATH topology
 1TDI A;  4MZC A;  1EZK A;  2ZCT A;  1A8Y A;  5DCH A;  4PNG A;  4WF5 A;  4V1A g;  5F8B A;  3MIX A;  5JCW A;  1GSY A;  4HEA 2;  2CAQ A;  4XS4 B;  4OFM A;  3WT1 A;  3GTU B;  1PGT A;  3TKS E;  4ECJ A;  2B3S A;  4OWY A;  2LUS A;  4KUN A;  5A5H A;  2YWI A;  3L78 A;  5FWG A;  1YVL A;  3EU4 A;  2HSM A;  4K0G A;  5EY6 A;  2GSR A;  5KOW A;  4NV2 A;  8GSS A;  1WE0 A;  3R2Q A;  2CX3 A;  6GSV A;  3CSI A;  1GTA A;  1JFU A;  2WUL A;  5DJL A;  3LEF A;  11GS A;  2YP6 A;  2VIM A;  3QFB C;  1WWJ A;  2MYG A;  3UBK A;  1GSD A;  2VLV A;  1BF5 A;  4K5S A;  1BG5 A;  1O81 A;  2VLT A;  2JZT A;  1GSF A;  2HI7 A;  3KH9 A;  3ZTL A;  3TUE A;  3GX0 A;  6GSS A;  3ME8 A;  1EWX A;  2H75 A;  4YQV A;  5ECI B;  2DSA A;  3A5W A;  3V1W A;  2H73 A;  3QAG A;  5ECS A;  2EFC A;  2VCX A;  2C3T A;  5BRT A;  2KP1 A;  3GN3 A;  4GLT A;  2FCH A;  4LMV A;  5G5F A;  4PX1 A;  3WGD A;  4IP6 A;  2E2G A;  3IC8 A;  4EDY A;  4K0N A;  4IQ1 A;  4K2X A;  2PBJ A;  3CWG A;  2IMF A;  1AAZ A;  3ZRE A;  1OE7 A;  1WJK A;  4CW9 A;  1IYI A;  1M3I A;  4LMW A;  5IMA A;  4PI0 C;  3CTF A;  3GUS A;  3L9V A;  2LJR A;  2VCQ A;  3QAV A;  5KEJ A;  3KGK A;  2PMT A;  4MH2 A;  2HSH A;  1K0C A;  2N5F A;  4PHZ C;  3KM6 A;  4BWS A;  4K5R A;  4XRA A;  1M9B A;  2GQM A;  3RBT A;  4N10 A;  5GST A;  1FW1 A;  4E68 A;  3FRC A;  3FR9 A;  1TI3 A;  5DDL A;  2DMM A;  2FA8 A;  2V32 A;  5D9W A;  3CSJ A;  5AGY A;  4MP4 A;  3QD9 A;  2NTO A;  4N0Z A;  1UC7 A;  2UV8 G;  3D0Z A;  4IKH A;  2B6M A;  5LNK e;  3A2X A;  5B7C A;  4AJ6 A;  4WEY A;  1S3A A;  2YJH A;  1ZYQ B;  1HNC A;  1ERU A;  1GTU A;  4ZXG A;  2FWF A;  5J9C A;  4O5R A;  1W89 A;  4OCE A;  4ECC A;  3TKS A;  5ECM B;  1SU9 A;  2MMA A;  4POK A;  1A2L A;  3E0U A;  3CRT A;  2AJQ B;  1SVL A;  2IMK A;  3L4N A;  1XCC A;  2YJ7 A;  3W6G A;  5JCU A;  3DKS A;  4EE0 A;  1VRS D;  3RPN A;  4IJI A;  4K8M A;  4MAB A;  3D6I A;  3DGQ A;  4HQS A;  3EMX A;  2UZ8 A;  2JL4 A;  4JZQ A;  3WD6 A;  3VFI A;  3TOU A;  2GZZ A;  2QC7 A;  1HD2 A;  1MTC A;  4HJM A;  2XPE A;  3FMW A;  3ZML A;  2M72 A;  1V58 A;  2FNO A;  3GH9 A;  2L6C A;  3MNG A;  2A4V A;  1G6Y A;  2V6O A;  2XHF A;  2DIY A;  4TN8 A;  5G30 A;  3GSS A;  1HQO A;  3ZLP A;  4PGT A;  1YY7 A;  4G2E A;  5DAL A;  1OC3 A;  2WVX B;  1SK2 A;  2V2G A;  1DE2 A;  1LU4 A;  2HXK A;  5G1L A;  5ENU A;  3WGE A;  5A1N B;  1JZO A;  4ULX A;  5ECP B;  2IFQ A;  2H8L A;  1X5D A;  3BCK A;  5KN3 A;  3PH9 A;  4DEJ A;  4LL1 B;  5HR3 A;  3TJF A;  4QMK A;  1AQV A;  3HZ8 A;  1U6T A;  1YDK A;  3IHQ A;  1GSU A;  4KSM A;  5G5E A;  1ERW A;  4YAV A;  4ACS A;  4AKI A;  2LS5 A;  2GLR A;  3EUR A;  5F05 A;  4I6X A;  3TKS C;  2I9H A;  4WR4 A;  2WW0 A;  1B8X A;  3IHG A;  1YJ6 A;  1YEX A;  1VF4 A;  4F82 A;  5CRD A;  2TRC P;  4NHW A;  1CQH A;  1PRX A;  1Z7P A;  4JBB A;  2VLU A;  4TR1 B;  2N5A A;  4EO3 A;  4JR4 A;  3GNJ A;  1XWG A;  4OMV A;  3IE3 A;  4ML6 A;  1GNW A;  2GZP A;  4GWR A;  1T1V A;  4BVX B;  1ACV A;  3IAS 2;  2B1L A;  2QGV A;  2D2Z A;  1XOA A;  1QGV A;  2CZ3 A;  6GSU A;  1M3J A;  2FA4 A;  3KIJ A;  2M46 A;  1S3C A;  1OKT A;  2LRC A;  3MDK A;  4K7N A;  4PTS A;  1SK0 A;  2X4A A;  2JSZ A;  4AJ8 A;  4EDZ A;  3M3M A;  3HY2 A;  3F6D A;  2VL9 A;  5DAK B;  1FAA A;  1QMV A;  4GTU A;  4AKH A;  1R7H A;  3GX8 A;  3US3 A;  2WVY A;  3FYG A;  2H70 A;  4FH8 A;  2FGX A;  1KTE A;  3FR3 A;  3ZVJ A;  4E8H A;  2OA7 A;  5EPF A;  2WFC A;  2LV3 A;  1F37 A;  4PXO A;  1FVJ A;  1X5C A;  4KAE A;  3QFA C;  5LCZ A;  2H72 A;  4KW6 A;  2H1A A;  3HVS A;  5ECH B;  2K8V A;  5B8A A;  5F0G A;  13GS A;  2TIR A;  1CQG A;  2KP2 A;  3G7I A;  1ST9 A;  5A34 B;  5IOX A;  2F3M A;  6GSY A;  3P90 A;  4ZBA A;  5CNW A;  3H93 A;  2H30 A;  4KCA A;  3A3T A;  2H1D A;  2G2Q A;  3DVX A;  2LNT A;  5GZZ B;  3UOM A;  4BA7 A;  1OC9 A;  2R0P A;  3ERG A;  2AB6 A;  4X4J A;  4QL9 A;  2IWT A;  5ID2 A;  3F4S A;  1PD2 1;  4KX4 A;  4GST A;  5J5N A;  3MSZ A;  1Y1U A;  1QUW A;  2HRN A;  4OD7 A;  3RAZ A;  2K18 A;  3KMN A;  4MPG A;  3TJG A;  4IJ3 A;  2WW1 A;  3HKR A;  4MJA A;  4KH7 A;  4ML1 A;  5J4Y A;  4YAP A;  2H6Y A;  3GL3 A;  3KZQ A;  4KA0 A;  2PER A;  2VD0 A;  4PQH A;  5A5H B;  1G6W A;  2GSS A;  4JED A;  1FB6 A;  4PUA A;  5C04 A;  3TKP A;  3I6A A;  1WP0 A;  2H0G A;  3IXR A;  4GF0 A;  3RDW A;  1X9W B;  6GSX A;  2AYT A;  5F06 A;  4GSS A;  2R0G A;  2DBC A;  3D22 A;  2IPA A;  3LW9 A;  1PL1 A;  3FZ9 A;  4BPY A;  1OAZ A;  2O87 A;  6GSW A;  3PPU A;  2I81 A;  3VI7 A;  4K1F A;  1UA5 A;  4ILF A;  4V2L A;  4IN0 A;  4JR6 A;  3G7Y A;  3J7Y k;  2C3N A;  2WRT A;  3FHK A;  3WYW A;  4ZBD A;  1ZL9 A;  2L5L A;  3L9S A;  1O8X A;  6GST A;  3PGT A;  3EC3 A;  3HVV A;  4Z2R A;  4OFT A;  1EEJ A;  2H74 A;  2OE0 A;  2C0F A;  2HSY A;  2WB9 A;  2H6X A;  3TJK A;  3FKF A;  2L4C A;  3QOU A;  3F3R A;  4KE3 A;  5D8I A;  4ZL7 A;  1Z6M A;  4MH3 A;  2R6K A;  4BL7 B;  1TRV A;  3ZIJ A;  4HI7 A;  2WZS A;  5JWQ B;  2PWJ A;  5J41 A;  3FZA A;  2L6D A;  3DD3 A;  4N0V A;  1B4Q A;  3M9J A;  5A5K A;  3TJJ A;  3WT2 A;  2LRN A;  1TRU A;  4G9H A;  4OO4 A;  18GS A;  1Q4J A;  3CSH A;  4NMU A;  5A4U A;  4L5O A;  2Z9S A;  4ZIL A;  4HSC X;  4MJC A;  4YKG A;  4GRF A;  5H5Q A;  3ERF A;  1MD4 A;  3HJO A;  1EOH A;  3BOA A;  5KOX A;  4HU7 A;  1X9M B;  4BVY B;  4V2N A;  1NHY A;  3ZL5 A;  4GXZ A;  1XVQ A;  3RGB C;  1AIU A;  1GSQ A;  2X8G A;  3VWX A;  2H1G A;  1MDI A;  1JHB A;  1M0U A;  1BQ7 A;  5DVB A;  3HZ4 A;  3APS A;  1UN2 A;  3CTG A;  5HR0 A;  4YKF A;  2PU9 C;  1S3D A;  3IK9 A;  2YCD A;  3A2W A;  3W8S A;  5IMC A;  5DCG A;  5JWO B;  2MBS A;  3RFR C;  1Y25 A;  3P7X A;  5KN2 A;  2G0F A;  2QA1 A;  3KXO A;  5HQP A;  1YZX A;  2RII A;  3IC4 A;  2HZE A;  4L5L A;  3BBY A;  1BYE A;  1XW6 A;  3C1R A;  2P31 A;  5G1K A;  1OVN A;  2X49 A;  3FY7 A;  2V41 A;  3FZ5 A;  3UMA A;  2REM A;  3C7M A;  2ES7 A;  1J0F A;  3LJR A;  2YNX A;  4G0K A;  4XCS A;  14GS A;  1KBN A;  5DAL B;  4AF2 A;  4IW9 A;  5AIX A;  5AN1 A;  3A2V A;  5FT3 A;  1T00 A;  4XS4 A;  2B5X A;  2XC2 A;  3GTU A;  1THX A;  2B7K A;  3DRN A;  4RUV A;  5B6N A;  1AQX A;  4PNF A;  4QQ7 A;  1LBK A;  1MD3 A;  1T7P B;  2EC4 A;  3LG6 A;  2IFQ B;  1A2M A;  5IQY A;  3U6V A;  5J40 A;  3IA1 A;  3G7J A;  1GP1 A;  2B7J A;  2EFH A;  4BIK A;  3CQF A;  1SYR A;  2AHE A;  3UVH A;  5ECK B;  2LQO A;  3APO A;  1TP9 A;  3KJY A;  1J08 A;  4G0I A;  2WCI A;  2VM2 A;  4RI7 A;  1BAY A;  1R26 A;  1J9B A;  4YH2 A;  4TR4 A;  3APQ A;  3DML A;  1GWC A;  4BWQ A;  2LEG A;  4FXY P;  2FD3 A;  3KP9 A;  2LTK A;  1I5G A;  1PKW A;  3IDV A;  4HQZ A;  1M2B A;  2YV7 A;  3FEU A;  2GDR A;  1GLQ A;  3F9U A;  2YOI A;  2GS3 A;  1ON4 A;  1AXD A;  2GTU A;  4Q5F A;  4AKX B;  2VCZ A;  3IK7 A;  4HU9 A;  4OFN A;  2GZY A;  2GT6 A;  3GUR A;  3IRA A;  2QKE A;  5ECO B;  1SVO A;  1AW9 A;  2EIR A;  3L0H A;  2VD1 A;  4NWY A;  4N30 A;  3GH6 A;  3TB2 A;  3DXB A;  1TJD A;  2CVD A;  1I9D A;  3LYP A;  1C72 A;  4YQM A;  1K3Y A;  4HZ2 A;  1SEN A;  4X0X A;  4MF7 A;  2E7P A;  3IOS A;  4XS1 A;  4USS A;  2LST A;  5L71 A;  2HSN A;  5CRW A;  1TU7 A;  1GUH A;  2F51 A;  2GGT A;  1FHE A;  2J9H A;  4YQU A;  4GDF A;  1ZYE A;  3EIN A;  1I1I P;  4KGI A;  1SL0 B;  2KHP A;  3C71 A;  1SL2 B;  3HMJ G;  5D9V A;  2OAC A;  5DQS A;  4TW5 A;  1ILO A;  2CVK A;  3M0F A;  3WGX A;  3W8J A;  4PUR A;  2AUV A;  3O6T A;  4A5P A;  3QDN A;  4KDU A;  2PPT A;  3NIV A;  2B5Y A;  3D4T A;  1T8E B;  4AGS A;  1B48 A;  3VLN A;  1SKR B;  4TXO A;  3F0I A;  2VAF A;  1V9W A;  1EGO A;  1MDK A;  3FZ4 A;  1Q98 A;  4F0C A;  2YV9 A;  1JLV A;  4DSS B;  1GL8 A;  2IMI A;  5ECQ B;  1XBS A;  5IPH A;  1F6M C;  2R2J A;  1K3O A;  2F8A A;  3TU3 B;  3KTL A;  5KN0 A;  1GTB A;  4Q5N A;  4IGJ A;  2CV4 A;  3E3E A;  2HRF A;  2OE3 A;  4MA9 A;  5COH A;  5B6M A;  2H0H A;  3ZMK A;  2BJX A;  4ZBB A;  4V1A p;  1USB A;  4Z2T A;  2IME A;  2DLX A;  4RI6 A;  4CY6 A;  2VCV A;  1SK1 A;  4TKY A;  1OC9 B;  2K8S A;  2R37 A;  2CA8 A;  4N3Z A;  2H66 A;  1SJ6 A;  3CBU A;  4CY8 A;  3MAK A;  5ELA A;  2L4Q A;  2B1K A;  4KCE A;  3TRP A;  2C8U A;  1TXX A;  2B5E A;  4G10 A;  3IV4 A;  4L0W A;  2O89 A;  2V1M A;  1URM A;  3K8N A;  2C0D A;  5DQY A;  4DVC A;  1SD8 A;  5IM9 A;  1W4V A;  1K0A A;  4KDX A;  2JSY A;  3UJ1 A;  1T4Z A;  2GST A;  1TI1 A;  2LRT A;  1JZR A;  1VF3 A;  2XBQ A;  3UAR A;  1THO A;  1X0R A;  2LNS A;  1GUL A;  5J47 A;  5ABR A;  3HD5 A;  3VK9 A;  1BG1 A;  3M1G A;  4ISD A;  5D9T A;  2K9F A;  1G7E A;  1RW1 A;  1VF2 A;  4P3Y B;  2WVX A;  4KB3 A;  2K6V A;  3BD2 A;  4ZB6 A;  2MBT A;  3ZIT A;  1AQW A;  1GUK A;  5A1N A;  3D4M A;  1XZO A;  3C8E A;  3I9V 2;  2RM6 A;  5CRE A;  4IBP A;  5CP1 A;  5BMU B;  2C0E A;  3VI5 A;  3QCP A;  1HNB A;  2IL3 A;  1EGR A;  1WOU A;  2A4H A;  4WET A;  4MJB A;  1TK0 B;  1TKD B;  1FB0 A;  2E2M A;  5J9B A;  3KTB A;  3ERW A;  1N2A A;  2KUC A;  1VGL A;  3GA4 A;  4EXJ A;  2HNL A;  4MK3 A;  3KH7 A;  4ECI A;  5E4W A;  3DEX A;  3DIE A;  2HRK A;  1A0F A;  3QAW A;  1U3A A;  2YZH A;  1XOB A;  4LL4 B;  1AC1 A;  2GQL A;  3IR4 A;  1WPI A;  4MLY A;  4IEL A;  1H4O A;  5DBQ A;  1YKA A;  4G19 A;  2IMD A;  3OR5 A;  2CAI A;  5ECN B;  2O8V B;  3C73 A;  4KDY A;  2HQT A;  4MF5 A;  4TR1 A;  1NM3 A;  2X8H A;  3UIW A;  3L9U A;  2C3Q A;  2NDO A;  1IYH A;  4HS1 A;  3VPT A;  4KF9 A;  4MMM A;  5J3R A;  3ED3 A;  1SKW B;  4LA1 A;  1YF1 A;  3CMI A;  3Q19 A;  3C1S A;  4J2F A;  5EL8 A;  2QSI A;  2HE3 A;  1ZZY A;  1PKZ A;  2O7K A;  3DYR A;  2X64 A;  5IO0 A;  3GRX A;  2C80 A;  2HSM B;  1Z6N A;  4MPF A;  4HUA A;  2CT6 A;  1F2E A;  1PX7 A;  2H01 A;  3EWL A;  2R3X A;  3MYD A;  3P2A A;  1Z3E A;  2F8F A;  4IQA A;  2I1U A;  3I69 A;  4IP1 A;  3KP8 A;  1M9A A;  3JCM L;  5D93 A;  5DAK A;  2DJ1 A;  4ZB9 A;  2RUE A;  1GH2 A;  1S3R A;  2WDU A;  1SYX A;  2HRA A;  5A4V A;  2J23 A;  2FUG 2;  4ID0 A;  2OBK A;  2IIY A;  3GV1 A;  1XWB A;  4K9Z A;  3Q74 A;  2VL3 A;  3UEM A;  4ZIJ A;  3Q6O A;  3GKX A;  2FY6 A;  3CYN A;  3HJP A;  2ZNM A;  1V2A A;  2VCW A;  3E9J B;  4NV5 A;  1BX9 A;  2VM1 A;  4JRR A;  2DKH A;  4IHU A;  3TRQ A;  3O3T A;  3ZZX A;  2LKU A;  5IOW A;  4KSO A;  3ZVJ D;  3NOF A;  1QFN A;  5IMD A;  3TJB A;  4N11 A;  1JZD A;  3F6F A;  1M2D A;  4F9Z A;  3PR8 A;  2YWN A;  1A24 A;  3O76 A;  3F4T A;  3FW2 A;  3GHA A;  1GLP A;  4FIW A;  2HZE B;  2RLI A;  1ZMA A;  4Q5R A;  2H1B A;  3TKR A;  1SL1 B;  3KCM A;  3H4K A;  3U5R E;  10GS A;  4J56 E;  4DSQ A;  2L57 A;  3EPT A;  1R5A A;  4HDE A;  3RHB A;  2DC5 A;  1TK5 B;  5EVO A;  3IPZ A;  2MMO A;  1XG8 A;  3LXZ A;  2RUF A;  1TU8 A;  2RM5 A;  2FWH A;  3GYK A;  1DE1 A;  1K0O A;  4QL7 A;  5IPG A;  2ON5 A;  3ZFB A;  1Z9H A;  4TRX A;  1ML6 A;  2PUK C;  1E2Y A;  2WGR A;  4O92 A;  4HJ2 A;  4EL1 A;  5GAN D;  1G7O A;  3TRX A;  4XS6 A;  2TRX A;  3DWV A;  3TDG A;  2DJ3 A;  1RK4 A;  3G9B A;  4ECB A;  2IJY A;  1Y6E A;  1ZOF A;  2AAW A;  1EP7 A;  4CHS A;  4D73 A;  3UAP A;  2CX4 A;  4MNN A;  2VL2 A;  2WVZ A;  2VOC A;  3BCI A;  4CDO A;  2YAN A;  4WBJ A;  5FHI A;  1B9Y C;  1YF0 A;  1O6J A;  5AIS A;  1F9M A;  3H79 A;  1ZYP A;  1YKC A;  3ZYW A;  1H75 A;  1B4P A;  1O8W A;  1O7U A;  4Q5Q A;  3LQ7 A;  19GS A;  3GST A;  4TVE A;  4K2D A;  2ALB A;  2H6Z A;  1A8L A;  2A2P A;  2YN1 A;  4G0L A;  1GTI A;  2VO4 A;  1N8J A;  3HVX A;  1SKS B;  2HYX A;  4FYB A;  2X99 A;  1WMJ A;  1Z7R A;  4O5U A;  4WR5 A;  5JWR B;  2FHE A;  3VWU A;  3KD0 A;  3LYK A;  2WW2 A;  3EYT A;  1OC8 A;  1EP8 A;  1JLW A;  4H86 A;  4MZB A;  1GRX A;  3LFL A;  2HLS A;  3UBL A;  1TRS A;  1K0D A;  2H1L A;  1GSS A;  1NW2 A;  2HSN B;  4BL7 A;  3FK8 A;  2ON7 A;  4F03 A;  2ZUP A;  2JZS A;  3IBH A;  3H1N A;  4F2I A;  3LXT A;  2NVL A;  1R4W A;  4AI6 A;  2LQQ A;  1MDJ A;  5G31 A;  1ZGN A;  4EKZ A;  2L59 A;  4MCU A;  5D73 A;  3GMF A;  2EFE A;  1HNA A;  1KNG A;  1JZW A;  2VL2 C;  2QA2 A;  1EEM A;  2MMN A;  3AY8 A;  5A4W A;  3CRU A;  1DSB A;  1WRY A;  2WW3 A;  4TXO B;  1EV9 A;  5HFG A;  3I43 A;  4BVY A;  1U87 A;  4ZB7 A;  1M7T A;  5IMZ A;  5IO2 A;  5CRH A;  4FYC A;  3HA9 A;  1FO5 A;  2LJA A;  5CYY A;  2FWG A;  1DUG A;  1QK8 A;  5HFI A;  2P0G A;  3HCZ A;  2JZR A;  4FYU A;  2EFD A;  4OO5 A;  1DBY A;  2VCT A;  4EIP A;  4NHZ A;  2DJK A;  4I2U A;  7GSS A;  1HYU A;  2GVP A;  1EV4 A;  3ZFL A;  3ZRD A;  1F3B A;  3KEB A;  5INY A;  5F07 A;  3VUR A;  2CQ9 A;  2NBS A;  4ZL8 A;  4I97 A;  2NPB A;  1N25 A;  2HT9 A;  4V2M A;  1T3B A;  1TRW A;  1U88 A;  2CVB A;  1SVM A;  1TW9 A;  5H5S A;  2GSQ A;  4TXV A;  1KEB A;  3EMP A;  4AKG A;  1XWK A;  1PA3 A;  4XHM A;  2MZC A;  5H5R A;  5C00 A;  1YEW C;  1O73 A;  4WKW A;  2A2S A;  4Z7X A;  2O5V A;  3CHX C;  1QQ2 A;  17GS A;  1OE8 A;  3FR6 A;  1SJI A;  2MMZ A;  4W66 A;  2L5O A;  3EU3 A;  3H8Q A;  5ECL B;  2JAC A;  5DJM A;  2P5Q A;  3LWA A;  5HR2 A;  1FOH A;  3F4R A;  4I8B A;  2OJL A;  2PN8 A;  2C0G A;  2PGT A;  3D5J A;  5B8B A;  1SJZ A;  5KN1 A;  2EIO A;  2VUP A;  3QMX A;  2M80 A;  4O32 A;  2WJU A;  1K0B A;  1XWC A;  4I5Q A;  4XIH A;  3GKN A;  4FO5 A;  5J4U A;  3RPP A;  2OE1 A;  4GSN A;  1GSE A;  3UL3 A;  4JE1 A;  1UVZ A;  2PVO C;  3ME7 A;  5D9X A;  2XPD A;  4MZW A;  1OYJ A;  1XW9 A;  1RQM A;  2VKZ G;  3MWH A;  1ABA A;  1O85 A;  1Z5Y E;  9GSS A;  3LGC A;  3J7Y b;  1ZYN A;  4PUF C;  1ERT A;  1ZCP A;  2I4A A;  3F3Q A;  4KND A;  3F8U A;  2HRK B;  2R4V A;  5D96 A;  5IIZ A;  1A23 A;  3R3E A;  4MF6 A;  2LJK A;  2DKI A;  2P5R A;  3NZN A;  3F63 A;  3RHC A;  4RQX A;  3M8N A;  2H19 A;  2X8C A;  2EIQ A;  2GT5 A;  3UVT A;  4POM A;  3LOR A;  2JU5 A;  4K6X A;  4IVF A;  3SWL A;  3HVN A;  2HFD A;  5ID2 B;  1G0T A;  4J57 E;  4TR3 A;  1K3L A;  1TXU A;  4HZ4 A;  4PI2 C;  3EE2 A;  4Z2U A;  2C1Y A;  1A2J A;  5G2Z A;  2JAD A;  1GNE A;  1M2A A;  2XBI A;  2E0Q A;  2FWE A;  4L8E A;  1AUC A;  4AJ7 A;  1X9S B;  2YWM A;  4IS0 A;  2YWO A;  1SD9 A;  4G01 A;  1PQN A;  3ZIV A;  4HOJ A;  22GS A;  1BJX A;  1XVW A;  4WF4 A;  2DJ2 A;  2YZU A;  5AIV A;  3LSZ A;  5JCG A;  1VF1 A;  3DVW A;  3HJM A;  3BJ5 A;  2R0C A;  5HFK A;  2BMX A;  4GQC A;  4NPB A;  3VWV A;  3N9J A;  3M9K A;  1YEP A;  4PQI A;  3QR6 A;  5HR1 A;  1PSQ A;  3HXS A;  4RQR A;  2R5G A;  4TOP A;  1PN9 A;  4OCF A;  3HDC A;  4POB A;  3VWW A;  4MJE A;  2O85 A;  4DSS A;  1ERV A;  4WXT A;  4XRD A;  5LD0 A;  4E8E A;  2WS2 A;  3ISO A;  2AV4 A;  2OBI A;  4K7O A;  3TGZ A;  4GQF A;  2N5B A;  4K7I A;  1XW5 A;  5IMF A;  1MEK A;  1K0M A;  4ZL9 A;  4X43 A;  2KLX A;  1GUM A;  1U3I A;  16GS A;  4F0B A;  1EOG A;  2OAD A;  4NAX A;  1F3A A;  4POL A;  3D21 A;  5IMV A;  1TTZ A;  2H71 A;  3VPQ A;  4FQU A;  4BVX A;  2I3Y A;  1PFO A;  1FG4 A;  2DML A;  1R5P A;  1YQ1 A;  3QPM A;  4EC0 A;  1PL2 A;  4PQ1 A;  4ZB8 A;  2OKA A;  1X5E A;  1XFL A;  2BTO T;  1OKD A;  2CZ2 A;  1BED A;  2FLS A;  1PN0 A;  4JU5 A;  2H0I A;  3CXG A;  4LLR A;  1WIK A;  1PX6 A;  5ECR B;  2A2R A;  3GKK A;  4D73 B;  2PVQ A;  1XIY A;  4DSR A;  1XWA A;  4NXI A;  1K0N A;  1QXH A;  2O3E A;  4L0U A;  4X1U A;  3S9F A;  4EIQ A;  1B9X C;  1T4Y A;  1NSW A;  5E59 A;  2IN3 A;  4O5Q A;  2DJJ A;  2C4J A;  1XXU A;  1FOV A;  4O7H A;  2O36 A;  1TOF A;  2HZF A;  3SBC A;  2H76 A;  2YPM A;  1V57 A;  2DIZ A;  3TCO A;  5CAX A;  5BMU A;  5CRG A;  1NHO A;  3TKQ A;  3HYP A;  4GCI A;  1V98 A;  1PMT A;  2WZ9 A;  5GAP D;  4XTS A;  2F9S A;  12GS A;  3HHV A;  3Q18 A;  5GSS A;  4EF0 A;  1V40 A;  2OT3 A;  1E6B A;  2DJ0 A;  3A5I A;  4EUY A;  1S4B P;  3TOT A;  1M99 A;  5CO3 A;  20GS A;  2GQK A;  5ELG A;  3N5O A;  1FVK A;  3GFK A;  2KOK A;  3EVI A;  3P8W A;  5A34 A;  4ICY A;  1XPV A;  4TR0 A;  4I2T A;  1TK8 B;  5J4V A;  4WBR D;  4EVM A;  4MDC A;  2V6K A;  1LJR A;  3KMO A;  1A0R P;  3GL5 A;  3IAM 2;  3PIN A;  3GKM A;  3GIX A; 
#chains in the Genus database with same CATH homology
 1TDI A;  4MZC A;  1EZK A;  2ZCT A;  1A8Y A;  5DCH A;  4PNG A;  4WF5 A;  4V1A g;  5F8B A;  3MIX A;  5JCW A;  1GSY A;  4HEA 2;  2CAQ A;  4XS4 B;  4OFM A;  3WT1 A;  3GTU B;  1PGT A;  3TKS E;  4ECJ A;  2B3S A;  4OWY A;  2LUS A;  4KUN A;  5A5H A;  2YWI A;  3L78 A;  5FWG A;  1YVL A;  3EU4 A;  2HSM A;  4K0G A;  5EY6 A;  2GSR A;  5KOW A;  4NV2 A;  8GSS A;  1WE0 A;  3R2Q A;  2CX3 A;  6GSV A;  3CSI A;  1GTA A;  1JFU A;  2WUL A;  5DJL A;  3LEF A;  11GS A;  2YP6 A;  2VIM A;  3QFB C;  1WWJ A;  2MYG A;  3UBK A;  1GSD A;  2VLV A;  1BF5 A;  4K5S A;  1BG5 A;  1O81 A;  2VLT A;  2JZT A;  1GSF A;  2HI7 A;  3KH9 A;  3ZTL A;  3TUE A;  3GX0 A;  6GSS A;  3ME8 A;  1EWX A;  2H75 A;  4YQV A;  5ECI B;  2DSA A;  3A5W A;  3V1W A;  2H73 A;  3QAG A;  5ECS A;  2EFC A;  2VCX A;  2C3T A;  5BRT A;  2KP1 A;  3GN3 A;  4GLT A;  2FCH A;  4LMV A;  5G5F A;  4PX1 A;  3WGD A;  4IP6 A;  2E2G A;  3IC8 A;  4EDY A;  4K0N A;  4IQ1 A;  4K2X A;  2PBJ A;  3CWG A;  2IMF A;  1AAZ A;  3ZRE A;  1OE7 A;  1WJK A;  4CW9 A;  1IYI A;  4LMW A;  5IMA A;  3CTF A;  3GUS A;  3L9V A;  2LJR A;  2VCQ A;  3QAV A;  5KEJ A;  3KGK A;  2PMT A;  4MH2 A;  2HSH A;  1K0C A;  2N5F A;  3KM6 A;  4BWS A;  4K5R A;  4XRA A;  1M9B A;  2GQM A;  3RBT A;  4N10 A;  5GST A;  1FW1 A;  4E68 A;  3FRC A;  3FR9 A;  1TI3 A;  5DDL A;  2DMM A;  2FA8 A;  2V32 A;  5D9W A;  3CSJ A;  5AGY A;  4MP4 A;  3QD9 A;  2NTO A;  4N0Z A;  1UC7 A;  2UV8 G;  3D0Z A;  4IKH A;  2B6M A;  5LNK e;  3A2X A;  5B7C A;  4AJ6 A;  4WEY A;  1S3A A;  2YJH A;  1ZYQ B;  1HNC A;  1ERU A;  1GTU A;  4ZXG A;  2FWF A;  5J9C A;  4O5R A;  1W89 A;  4OCE A;  4ECC A;  3TKS A;  5ECM B;  1SU9 A;  2MMA A;  4POK A;  1A2L A;  3E0U A;  3CRT A;  2AJQ B;  1SVL A;  2IMK A;  3L4N A;  1XCC A;  2YJ7 A;  3W6G A;  5JCU A;  3DKS A;  4EE0 A;  1VRS D;  3RPN A;  4IJI A;  4K8M A;  4MAB A;  3D6I A;  3DGQ A;  4HQS A;  3EMX A;  2UZ8 A;  2JL4 A;  4JZQ A;  3WD6 A;  3VFI A;  3TOU A;  2GZZ A;  2QC7 A;  1HD2 A;  1MTC A;  4HJM A;  2XPE A;  3FMW A;  3ZML A;  2M72 A;  1V58 A;  2FNO A;  3GH9 A;  2L6C A;  3MNG A;  2A4V A;  1G6Y A;  2V6O A;  2XHF A;  2DIY A;  4TN8 A;  5G30 A;  3GSS A;  1HQO A;  3ZLP A;  4PGT A;  1YY7 A;  4G2E A;  5DAL A;  1OC3 A;  1SK2 A;  2V2G A;  1DE2 A;  1LU4 A;  2HXK A;  5G1L A;  5ENU A;  3WGE A;  5A1N B;  1JZO A;  4ULX A;  5ECP B;  2IFQ A;  2H8L A;  1X5D A;  3BCK A;  5KN3 A;  3PH9 A;  4DEJ A;  4LL1 B;  5HR3 A;  3TJF A;  4QMK A;  1AQV A;  3HZ8 A;  1U6T A;  1YDK A;  3IHQ A;  1GSU A;  4KSM A;  5G5E A;  1ERW A;  4YAV A;  4ACS A;  4AKI A;  2LS5 A;  2GLR A;  3EUR A;  5F05 A;  4I6X A;  3TKS C;  2I9H A;  4WR4 A;  1B8X A;  3IHG A;  1YJ6 A;  1YEX A;  1VF4 A;  4F82 A;  5CRD A;  2TRC P;  4NHW A;  1CQH A;  1PRX A;  1Z7P A;  4JBB A;  2VLU A;  4TR1 B;  2N5A A;  4EO3 A;  4JR4 A;  3GNJ A;  1XWG A;  4OMV A;  3IE3 A;  4ML6 A;  1GNW A;  2GZP A;  4GWR A;  1T1V A;  4BVX B;  1ACV A;  3IAS 2;  2B1L A;  2QGV A;  2D2Z A;  1XOA A;  1QGV A;  2CZ3 A;  6GSU A;  2FA4 A;  3KIJ A;  2M46 A;  1S3C A;  1OKT A;  2LRC A;  3MDK A;  4K7N A;  4PTS A;  1SK0 A;  2X4A A;  2JSZ A;  4AJ8 A;  4EDZ A;  3M3M A;  3HY2 A;  3F6D A;  2VL9 A;  5DAK B;  1FAA A;  1QMV A;  4GTU A;  4AKH A;  1R7H A;  3GX8 A;  3US3 A;  3FYG A;  2H70 A;  4FH8 A;  2FGX A;  1KTE A;  3FR3 A;  3ZVJ A;  4E8H A;  2OA7 A;  5EPF A;  2WFC A;  2LV3 A;  1F37 A;  4PXO A;  1FVJ A;  1X5C A;  4KAE A;  3QFA C;  5LCZ A;  2H72 A;  4KW6 A;  2H1A A;  3HVS A;  5ECH B;  2K8V A;  5B8A A;  5F0G A;  13GS A;  2TIR A;  1CQG A;  2KP2 A;  3G7I A;  1ST9 A;  5A34 B;  5IOX A;  2F3M A;  6GSY A;  3P90 A;  4ZBA A;  5CNW A;  3H93 A;  2H30 A;  4KCA A;  3A3T A;  2H1D A;  2G2Q A;  3DVX A;  2LNT A;  5GZZ B;  3UOM A;  4BA7 A;  1OC9 A;  2R0P A;  3ERG A;  2AB6 A;  4X4J A;  4QL9 A;  2IWT A;  5ID2 A;  3F4S A;  1PD2 1;  4KX4 A;  4GST A;  5J5N A;  3MSZ A;  1Y1U A;  1QUW A;  2HRN A;  4OD7 A;  3RAZ A;  2K18 A;  3KMN A;  4MPG A;  3TJG A;  4IJ3 A;  3HKR A;  4MJA A;  4KH7 A;  4ML1 A;  5J4Y A;  4YAP A;  2H6Y A;  3GL3 A;  3KZQ A;  4KA0 A;  2PER A;  2VD0 A;  4PQH A;  5A5H B;  1G6W A;  2GSS A;  4JED A;  1FB6 A;  4PUA A;  5C04 A;  3TKP A;  3I6A A;  1WP0 A;  2H0G A;  3IXR A;  4GF0 A;  3RDW A;  1X9W B;  6GSX A;  2AYT A;  5F06 A;  4GSS A;  2R0G A;  2DBC A;  3D22 A;  2IPA A;  3LW9 A;  1PL1 A;  3FZ9 A;  4BPY A;  1OAZ A;  2O87 A;  6GSW A;  3PPU A;  2I81 A;  3VI7 A;  4K1F A;  1UA5 A;  4ILF A;  4V2L A;  4IN0 A;  4JR6 A;  3G7Y A;  3J7Y k;  2C3N A;  2WRT A;  3FHK A;  3WYW A;  4ZBD A;  1ZL9 A;  2L5L A;  3L9S A;  1O8X A;  6GST A;  3PGT A;  3EC3 A;  3HVV A;  4Z2R A;  4OFT A;  1EEJ A;  2H74 A;  2OE0 A;  2C0F A;  2HSY A;  2WB9 A;  2H6X A;  3TJK A;  3FKF A;  2L4C A;  3QOU A;  3F3R A;  4KE3 A;  5D8I A;  4ZL7 A;  1Z6M A;  4MH3 A;  2R6K A;  4BL7 B;  1TRV A;  3ZIJ A;  4HI7 A;  5JWQ B;  2PWJ A;  5J41 A;  3FZA A;  2L6D A;  3DD3 A;  4N0V A;  1B4Q A;  3M9J A;  5A5K A;  3TJJ A;  3WT2 A;  2LRN A;  1TRU A;  4G9H A;  4OO4 A;  18GS A;  1Q4J A;  3CSH A;  4NMU A;  5A4U A;  4L5O A;  2Z9S A;  4ZIL A;  4MJC A;  4YKG A;  4GRF A;  5H5Q A;  3ERF A;  1MD4 A;  3HJO A;  1EOH A;  3BOA A;  5KOX A;  4HU7 A;  1X9M B;  4BVY B;  4V2N A;  1NHY A;  3ZL5 A;  4GXZ A;  1XVQ A;  1AIU A;  1GSQ A;  2X8G A;  3VWX A;  2H1G A;  1MDI A;  1JHB A;  1M0U A;  1BQ7 A;  5DVB A;  3HZ4 A;  3APS A;  1UN2 A;  3CTG A;  5HR0 A;  4YKF A;  2PU9 C;  1S3D A;  3IK9 A;  2YCD A;  3A2W A;  3W8S A;  5IMC A;  5DCG A;  5JWO B;  2MBS A;  1Y25 A;  3P7X A;  5KN2 A;  2G0F A;  2QA1 A;  3KXO A;  5HQP A;  1YZX A;  2RII A;  3IC4 A;  2HZE A;  4L5L A;  3BBY A;  1BYE A;  1XW6 A;  3C1R A;  2P31 A;  5G1K A;  1OVN A;  2X49 A;  3FY7 A;  2V41 A;  3FZ5 A;  3UMA A;  2REM A;  3C7M A;  2ES7 A;  1J0F A;  3LJR A;  2YNX A;  4G0K A;  4XCS A;  14GS A;  1KBN A;  5DAL B;  4AF2 A;  4IW9 A;  5AIX A;  5AN1 A;  3A2V A;  5FT3 A;  1T00 A;  4XS4 A;  2B5X A;  2XC2 A;  3GTU A;  1THX A;  2B7K A;  3DRN A;  4RUV A;  5B6N A;  1AQX A;  4PNF A;  4QQ7 A;  1LBK A;  1MD3 A;  1T7P B;  2EC4 A;  3LG6 A;  2IFQ B;  1A2M A;  5IQY A;  3U6V A;  5J40 A;  3IA1 A;  3G7J A;  1GP1 A;  2B7J A;  2EFH A;  1SYR A;  2AHE A;  3UVH A;  5ECK B;  2LQO A;  3APO A;  1TP9 A;  3KJY A;  1J08 A;  4G0I A;  2WCI A;  2VM2 A;  4RI7 A;  1BAY A;  1R26 A;  1J9B A;  4YH2 A;  4TR4 A;  3APQ A;  3DML A;  1GWC A;  4BWQ A;  2LEG A;  3KP9 A;  2FD3 A;  2LTK A;  1I5G A;  1PKW A;  3IDV A;  4HQZ A;  1M2B A;  2YV7 A;  3FEU A;  2GDR A;  1GLQ A;  3F9U A;  2YOI A;  2GS3 A;  1ON4 A;  1AXD A;  2GTU A;  4Q5F A;  4AKX B;  2VCZ A;  3IK7 A;  4HU9 A;  4OFN A;  2GZY A;  2GT6 A;  3GUR A;  3IRA A;  2QKE A;  5ECO B;  1SVO A;  1AW9 A;  2EIR A;  3L0H A;  2VD1 A;  4NWY A;  4N30 A;  3GH6 A;  3TB2 A;  3DXB A;  1TJD A;  2CVD A;  1I9D A;  3LYP A;  1C72 A;  4YQM A;  1K3Y A;  4HZ2 A;  1SEN A;  4X0X A;  4MF7 A;  2E7P A;  3IOS A;  4XS1 A;  4USS A;  2LST A;  5L71 A;  2HSN A;  5CRW A;  1TU7 A;  1GUH A;  2F51 A;  2GGT A;  1FHE A;  2J9H A;  4YQU A;  4GDF A;  1ZYE A;  3EIN A;  4KGI A;  1SL0 B;  2KHP A;  3C71 A;  1SL2 B;  3HMJ G;  5D9V A;  2OAC A;  5DQS A;  4TW5 A;  1ILO A;  2CVK A;  3M0F A;  3WGX A;  3W8J A;  4PUR A;  2AUV A;  3O6T A;  4A5P A;  3QDN A;  4KDU A;  2PPT A;  3NIV A;  2B5Y A;  3D4T A;  1T8E B;  4AGS A;  1B48 A;  3VLN A;  1SKR B;  4TXO A;  3F0I A;  2VAF A;  1V9W A;  1EGO A;  1MDK A;  3FZ4 A;  1Q98 A;  4F0C A;  2YV9 A;  1JLV A;  4DSS B;  1GL8 A;  2IMI A;  5ECQ B;  1XBS A;  5IPH A;  1F6M C;  2R2J A;  1K3O A;  2F8A A;  3TU3 B;  3KTL A;  5KN0 A;  1GTB A;  4Q5N A;  4IGJ A;  2CV4 A;  3E3E A;  2HRF A;  2OE3 A;  4MA9 A;  5COH A;  5B6M A;  2H0H A;  3ZMK A;  2BJX A;  4ZBB A;  4V1A p;  1USB A;  4Z2T A;  2IME A;  2DLX A;  4RI6 A;  4CY6 A;  2VCV A;  1SK1 A;  4TKY A;  1OC9 B;  2K8S A;  2R37 A;  2CA8 A;  4N3Z A;  2H66 A;  1SJ6 A;  3CBU A;  4CY8 A;  3MAK A;  5ELA A;  2L4Q A;  2B1K A;  4KCE A;  3TRP A;  2C8U A;  1TXX A;  2B5E A;  4G10 A;  3IV4 A;  4L0W A;  2O89 A;  2V1M A;  1URM A;  3K8N A;  2C0D A;  5DQY A;  4DVC A;  1SD8 A;  5IM9 A;  1W4V A;  1K0A A;  4KDX A;  2JSY A;  3UJ1 A;  1T4Z A;  2GST A;  1TI1 A;  2LRT A;  1JZR A;  1VF3 A;  2XBQ A;  3UAR A;  1THO A;  1X0R A;  2LNS A;  1GUL A;  5J47 A;  5ABR A;  3HD5 A;  3VK9 A;  1BG1 A;  3M1G A;  4ISD A;  5D9T A;  2K9F A;  1G7E A;  1RW1 A;  1VF2 A;  4P3Y B;  4KB3 A;  2K6V A;  3BD2 A;  4ZB6 A;  2MBT A;  3ZIT A;  1AQW A;  1GUK A;  5A1N A;  3D4M A;  1XZO A;  3C8E A;  3I9V 2;  2RM6 A;  5CRE A;  4IBP A;  5CP1 A;  5BMU B;  2C0E A;  3VI5 A;  3QCP A;  1HNB A;  2IL3 A;  1EGR A;  1WOU A;  2A4H A;  4WET A;  4MJB A;  1TK0 B;  1TKD B;  1FB0 A;  2E2M A;  5J9B A;  3KTB A;  3ERW A;  1N2A A;  2KUC A;  1VGL A;  3GA4 A;  4EXJ A;  2HNL A;  4MK3 A;  3KH7 A;  4ECI A;  5E4W A;  3DEX A;  3DIE A;  2HRK A;  1A0F A;  3QAW A;  1U3A A;  2YZH A;  1XOB A;  4LL4 B;  1AC1 A;  2GQL A;  3IR4 A;  1WPI A;  4MLY A;  4IEL A;  1H4O A;  5DBQ A;  1YKA A;  4G19 A;  2IMD A;  3OR5 A;  2CAI A;  5ECN B;  2O8V B;  3C73 A;  4KDY A;  2HQT A;  4MF5 A;  4TR1 A;  1NM3 A;  2X8H A;  3UIW A;  3L9U A;  2C3Q A;  2NDO A;  1IYH A;  4HS1 A;  3VPT A;  4KF9 A;  4MMM A;  5J3R A;  3ED3 A;  1SKW B;  4LA1 A;  1YF1 A;  3CMI A;  3Q19 A;  3C1S A;  4J2F A;  5EL8 A;  2QSI A;  2HE3 A;  1ZZY A;  1PKZ A;  2O7K A;  3DYR A;  2X64 A;  5IO0 A;  3GRX A;  2C80 A;  2HSM B;  1Z6N A;  4MPF A;  4HUA A;  2CT6 A;  1F2E A;  1PX7 A;  2H01 A;  3EWL A;  2R3X A;  3MYD A;  3P2A A;  1Z3E A;  2F8F A;  4IQA A;  2I1U A;  3I69 A;  4IP1 A;  3KP8 A;  1M9A A;  3JCM L;  5D93 A;  5DAK A;  2DJ1 A;  4ZB9 A;  2RUE A;  1GH2 A;  2WDU A;  1SYX A;  2HRA A;  5A4V A;  2J23 A;  2FUG 2;  4ID0 A;  2OBK A;  2IIY A;  3GV1 A;  1XWB A;  4K9Z A;  3Q74 A;  2VL3 A;  3UEM A;  4ZIJ A;  3Q6O A;  3GKX A;  2FY6 A;  3CYN A;  3HJP A;  2ZNM A;  1V2A A;  2VCW A;  3E9J B;  4NV5 A;  1BX9 A;  2VM1 A;  4JRR A;  2DKH A;  4IHU A;  3TRQ A;  3O3T A;  3ZZX A;  2LKU A;  5IOW A;  4KSO A;  3ZVJ D;  3NOF A;  1QFN A;  5IMD A;  3TJB A;  4N11 A;  1JZD A;  3F6F A;  1M2D A;  4F9Z A;  3PR8 A;  2YWN A;  1A24 A;  3O76 A;  3F4T A;  3FW2 A;  3GHA A;  1GLP A;  4FIW A;  2HZE B;  2RLI A;  1ZMA A;  4Q5R A;  2H1B A;  3TKR A;  1SL1 B;  3KCM A;  3H4K A;  3U5R E;  10GS A;  4J56 E;  4DSQ A;  2L57 A;  3EPT A;  1R5A A;  4HDE A;  3RHB A;  2DC5 A;  1TK5 B;  5EVO A;  3IPZ A;  2MMO A;  3LXZ A;  2RUF A;  1TU8 A;  2RM5 A;  2FWH A;  3GYK A;  1DE1 A;  1K0O A;  4QL7 A;  5IPG A;  2ON5 A;  3ZFB A;  1Z9H A;  4TRX A;  1ML6 A;  2PUK C;  1E2Y A;  2WGR A;  4O92 A;  4HJ2 A;  4EL1 A;  5GAN D;  1G7O A;  3TRX A;  4XS6 A;  2TRX A;  3DWV A;  3TDG A;  2DJ3 A;  1RK4 A;  3G9B A;  4ECB A;  2IJY A;  1Y6E A;  1ZOF A;  2AAW A;  1EP7 A;  4CHS A;  4D73 A;  3UAP A;  2CX4 A;  4MNN A;  2VL2 A;  2VOC A;  3BCI A;  4CDO A;  2YAN A;  4WBJ A;  5FHI A;  1B9Y C;  1YF0 A;  1O6J A;  5AIS A;  1F9M A;  3H79 A;  1ZYP A;  1YKC A;  3ZYW A;  1H75 A;  1B4P A;  1O8W A;  1O7U A;  4Q5Q A;  3LQ7 A;  19GS A;  3GST A;  4TVE A;  4K2D A;  2ALB A;  2H6Z A;  1A8L A;  2A2P A;  2YN1 A;  4G0L A;  1GTI A;  2VO4 A;  1N8J A;  3HVX A;  1SKS B;  2HYX A;  4FYB A;  2X99 A;  1WMJ A;  1Z7R A;  4O5U A;  4WR5 A;  5JWR B;  2FHE A;  3VWU A;  3KD0 A;  3LYK A;  3EYT A;  1OC8 A;  1EP8 A;  1JLW A;  4H86 A;  4MZB A;  1GRX A;  3LFL A;  2HLS A;  3UBL A;  1TRS A;  1K0D A;  2H1L A;  1GSS A;  1NW2 A;  2HSN B;  4BL7 A;  3FK8 A;  2ON7 A;  4F03 A;  2ZUP A;  2JZS A;  3IBH A;  3H1N A;  4F2I A;  3LXT A;  2NVL A;  1R4W A;  4AI6 A;  2LQQ A;  1MDJ A;  5G31 A;  1ZGN A;  4EKZ A;  2L59 A;  4MCU A;  5D73 A;  3GMF A;  2EFE A;  1HNA A;  1KNG A;  1JZW A;  2VL2 C;  2QA2 A;  1EEM A;  2MMN A;  3AY8 A;  5A4W A;  3CRU A;  1DSB A;  1WRY A;  4TXO B;  1EV9 A;  5HFG A;  3I43 A;  4BVY A;  1U87 A;  4ZB7 A;  1M7T A;  5IMZ A;  5IO2 A;  5CRH A;  4FYC A;  3HA9 A;  1FO5 A;  2LJA A;  5CYY A;  2FWG A;  1DUG A;  1QK8 A;  5HFI A;  2P0G A;  3HCZ A;  2JZR A;  4FYU A;  2EFD A;  4OO5 A;  1DBY A;  2VCT A;  4EIP A;  4NHZ A;  2DJK A;  4I2U A;  7GSS A;  1HYU A;  2GVP A;  1EV4 A;  3ZFL A;  3ZRD A;  1F3B A;  3KEB A;  5INY A;  5F07 A;  3VUR A;  2CQ9 A;  2NBS A;  4ZL8 A;  4I97 A;  2NPB A;  1N25 A;  2HT9 A;  4V2M A;  1T3B A;  1TRW A;  1U88 A;  2CVB A;  1SVM A;  1TW9 A;  5H5S A;  2GSQ A;  4TXV A;  1KEB A;  3EMP A;  4AKG A;  1XWK A;  1PA3 A;  4XHM A;  2MZC A;  5H5R A;  5C00 A;  1O73 A;  4WKW A;  2A2S A;  4Z7X A;  2O5V A;  1QQ2 A;  17GS A;  1OE8 A;  3FR6 A;  1SJI A;  2MMZ A;  4W66 A;  2L5O A;  3EU3 A;  3H8Q A;  5ECL B;  2JAC A;  5DJM A;  2P5Q A;  3LWA A;  5HR2 A;  1FOH A;  3F4R A;  4I8B A;  2OJL A;  2PN8 A;  2C0G A;  2PGT A;  3D5J A;  5B8B A;  1SJZ A;  5KN1 A;  2EIO A;  2VUP A;  3QMX A;  2M80 A;  4O32 A;  2WJU A;  1K0B A;  1XWC A;  4I5Q A;  4XIH A;  3GKN A;  4FO5 A;  5J4U A;  3RPP A;  2OE1 A;  4GSN A;  1GSE A;  3UL3 A;  4JE1 A;  1UVZ A;  2PVO C;  3ME7 A;  5D9X A;  2XPD A;  4MZW A;  1OYJ A;  1XW9 A;  1RQM A;  2VKZ G;  3MWH A;  1ABA A;  1O85 A;  1Z5Y E;  9GSS A;  3LGC A;  3J7Y b;  1ZYN A;  4PUF C;  1ERT A;  1ZCP A;  2I4A A;  3F3Q A;  4KND A;  3F8U A;  2HRK B;  2R4V A;  5D96 A;  5IIZ A;  1A23 A;  3R3E A;  4MF6 A;  2LJK A;  2DKI A;  2P5R A;  3NZN A;  3F63 A;  3RHC A;  4RQX A;  3M8N A;  2H19 A;  2X8C A;  2EIQ A;  2GT5 A;  3UVT A;  4POM A;  3LOR A;  2JU5 A;  4K6X A;  4IVF A;  3SWL A;  2HFD A;  5ID2 B;  1G0T A;  4J57 E;  4TR3 A;  1K3L A;  1TXU A;  4HZ4 A;  3EE2 A;  4Z2U A;  2C1Y A;  1A2J A;  5G2Z A;  2JAD A;  1GNE A;  1M2A A;  2XBI A;  2E0Q A;  2FWE A;  4L8E A;  1AUC A;  4AJ7 A;  1X9S B;  2YWM A;  4IS0 A;  2YWO A;  1SD9 A;  4G01 A;  1PQN A;  3ZIV A;  4HOJ A;  22GS A;  1BJX A;  1XVW A;  4WF4 A;  2DJ2 A;  2YZU A;  5AIV A;  3LSZ A;  5JCG A;  1VF1 A;  3DVW A;  3HJM A;  3BJ5 A;  2R0C A;  5HFK A;  2BMX A;  4GQC A;  4NPB A;  3VWV A;  3N9J A;  3M9K A;  1YEP A;  4PQI A;  3QR6 A;  5HR1 A;  1PSQ A;  3HXS A;  4RQR A;  2R5G A;  4TOP A;  1PN9 A;  4OCF A;  3HDC A;  4POB A;  3VWW A;  4MJE A;  2O85 A;  4DSS A;  1ERV A;  4WXT A;  4XRD A;  5LD0 A;  4E8E A;  2WS2 A;  3ISO A;  2AV4 A;  2OBI A;  4K7O A;  3TGZ A;  4GQF A;  2N5B A;  4K7I A;  1XW5 A;  5IMF A;  1MEK A;  1K0M A;  4ZL9 A;  4X43 A;  2KLX A;  1GUM A;  1U3I A;  16GS A;  4F0B A;  1EOG A;  2OAD A;  4NAX A;  1F3A A;  4POL A;  3D21 A;  5IMV A;  1TTZ A;  2H71 A;  3VPQ A;  4FQU A;  4BVX A;  2I3Y A;  1FG4 A;  2DML A;  1R5P A;  1YQ1 A;  3QPM A;  4EC0 A;  1PL2 A;  4PQ1 A;  4ZB8 A;  2OKA A;  1X5E A;  1XFL A;  2BTO T;  1OKD A;  2CZ2 A;  1BED A;  2FLS A;  1PN0 A;  4JU5 A;  2H0I A;  3CXG A;  4LLR A;  1WIK A;  1PX6 A;  5ECR B;  2A2R A;  3GKK A;  4D73 B;  2PVQ A;  1XIY A;  4DSR A;  1XWA A;  4NXI A;  1K0N A;  1QXH A;  4L0U A;  4X1U A;  3S9F A;  4EIQ A;  1B9X C;  1T4Y A;  1NSW A;  5E59 A;  2IN3 A;  4O5Q A;  2DJJ A;  2C4J A;  1XXU A;  1FOV A;  4O7H A;  1TOF A;  2HZF A;  3SBC A;  2H76 A;  2YPM A;  1V57 A;  2DIZ A;  3TCO A;  5CAX A;  5BMU A;  5CRG A;  1NHO A;  3TKQ A;  3HYP A;  4GCI A;  1V98 A;  1PMT A;  2WZ9 A;  5GAP D;  4XTS A;  2F9S A;  12GS A;  3HHV A;  3Q18 A;  5GSS A;  4EF0 A;  1V40 A;  2OT3 A;  1E6B A;  2DJ0 A;  3A5I A;  4EUY A;  3TOT A;  1M99 A;  5CO3 A;  20GS A;  2GQK A;  5ELG A;  3N5O A;  1FVK A;  3GFK A;  2KOK A;  3EVI A;  3P8W A;  5A34 A;  4ICY A;  1XPV A;  4TR0 A;  4I2T A;  1TK8 B;  5J4V A;  4WBR D;  4EVM A;  4MDC A;  2V6K A;  1LJR A;  3KMO A;  1A0R P;  3GL5 A;  3IAM 2;  3PIN A;  3GKM A;  3GIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...