4IBSA

Human p53 core domain with hot spot mutation r273h (form i)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
193
structure length
193
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVHVCACPGRDRRTEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title Structural studies of p53 inactivation by DNA-contact mutations and its rescue by suppressor mutations via alternative protein-DNA interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 43
structure length 193
sequence length 193
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ibsA00
2ATAA 3Q05A 2AHIA 1KZYA 4IBTA 4HJEA 4IBUA 4G83A 1H9DA 2J1XA 1IO4C 3WTVA 2BIQA 4G82A 2RMNA 3IGKA 4IBWA 2YBGA 3WTSA 3WTYA 4AGNA 2FEJA 1UOLA 4IBSA 4IBYA 2VUKA 3D0AA 2ADYA 4LOEA 1EANA 2IOIA 1CO1A 2IOOA 3Q01A 3WTTA 5AOLA 2BINA 4IJTA 5AOKA 4AGLA 3D09A 4LO9A 3VD0A 2X0UA 5KBDA 4AGMA 2J1WA 3EXLA 3WTXA 4MZIA 2J1YA 4AGOA 2BIOA 2J1ZA 4IBVA 1TUPA 2XWCA 3WTUA 5LGYA 4L18A 3IGLA 3Q06A 2X0VA 3KZ8A 2GEQA 1HJBC 5BUAA 2PCXA 2AC0A 3D06A 4XR8C 4GUOA 2IOMA 2J21A 2X0WA 1YCSA 4A63A 1CMOA 4L0ZA 3QYNA 3D08A 3VD2A 1EAOA 2H1LM 4AGPA 3ZMEA 1TSRA 1E50A 1T4WA 3KMDA 4GUQA 1HU8A 5G4OA 5ABAA 3EXJA 2BIMA 2BIPA 3D05A 5AOIA 2P52A 5AOMA 5AOJA 3D07A 3WTWA 4MZRA 5AB9A 3WU1A 4L0YA 2WGXA 1HJCA 3QYMA 3US0A 3US1A 1GZHC 4IBQA 4AGQA 5G4NA 3TS8A 2J20A 4QO1B 4IBZA 4LOFA 2XWRA 1EAQA 2MEJB 1GZHA 2J6WA 5ECGA 5A7BA 1LJMA 5G4MA 5LAPA 3VD1A 4KVPA 2OCJA
chains in the Genus database with same CATH superfamily
5I0YA 4UT9L 3SGKA 2F54B 2YQ2A 1E4KC 5LXVA 3JTTA 2BRRH 2WLLB 3CSYB 3BUDA 3QUYC 3QFGA 4CMMA 4IBUA 1F1DA 2ICES 3ZZSA 4ZS7H 4IDJH 2J1KA 2YUWA 5DJ6B 4X83A 5BOPA 4B9KC 4Y8DC 5JHDA 1ODUA 3B34A 4OZFA 2VH5L 3QIUA 3CQFA 4YDKL 5DWUL 5JOEA 1SVBA 2BNUB 5FYLH 2X6BA 1S7RA 3TT1H 1Y6MR 4XB7A 4QRQB 1DSFL 3VWKB 1WCBB 1UT2A 1ETZA 2G0LA 5D7KD 2JFCA 1ZD6A 2GUOA 4PSPA 2VWEE 2X2IA 3INOA 3FOMA 1JWMB 4C56D 5IMLA 4P5RA 3O2DH 1NANH 5E8NA 4HIHB 3SPCA 5KBDA 5JDSB 2F1BA 4LKCB 4V1DE 4KFZC 3C5ZA 2J1WA 2NMSA 4WZ9A 2P43B 1SJHA 4U6TA 3FT9A 3O0RH 3E6FA 1D5BB 4DEPB 2N1TE 4OCNC 1EXGA 4UWQB 2ZKXA 3N43B 1GHFL 3KZ8A 5IHHA 5J89A 4JRXB 3KXFB 2W0PA 4AW4A 3LS5H 4MA3B 3QI9D 5F71A 3NZHL 1XR8A 4PJBE 4UQBA 1RZ8A 4LFHG 1H8OA 5BCAA 1NEZG 2O93L 2VW6A 3QORD 2AJ3B 3VXMB 5K9JH 1BGXL 2EE3A 1CL7L 3KGRA 2D0FA 5DMIL 5KBNC 2NY5C 3MV7A 1PD6A 2WXOA 3SDDB 3V0WL 1U8QA 1CFQB 4CBPA 3SE3C 1RUAL 4TQEH 5E9AA 1HAUA 3HG4A 4JCWA 3L2NA 4XODA 1YNTA 3WNIA 1HHHB 2DQEL 2J25A 3FT1A 3EXJA 1H6EA 4Y2OB 1MWAB 2AZAA 1E6OH 2D8KA 2FJUB 3WS6A 3ZBMA 4KI5D 4RVBA 5FO8A 4JM4H 5KTEL 5F1IB 5CCKL 1PPIA 4A04A 4NJ9H 5BOZG 1H15A 1F56A 3TFKD 1KJ2A 2B3IA 4RGNC 4LEOB 5T3ZD 3FTVA 5IQ9B 5DUJA 3UTTA 3HZKA 4QO1B 4OIIH 3FO1A 4L1TA 4PI2A 1I3VA 5CMAB 1GZHA 1HN1A 1A9EB 1Z9SB 2CO3A 2J6WA 4HJTA 5IQ7H 2FWLB 3IMVA 5ABDE 2JLLA 3ENEA 3KLAA 3MRJA 3OG6B 2DQDH 1WGOA 4M6NL 3HE7B 4PMEA 3LHPL 1CDYA 5SX4H 1N64L 2P8MA 1YMMD 3GPSA 5FHAL 1LWRA 4ES9A 1K4DA 3TL5A 1RUKH 3DO3A 2Z31C 1S7WB 3Q6FB 4OF5A 3UP1A 4KGJA 3WFEL 2OULB 2W1NA 5DT1L 2YO3A 5DMJB 4L48A 3HFMH 1MLCB 2R4SL 4D8OA 5EF1A 3CXDH 5IVXF 2FIKA 2FJHB 2HT4C 3DSFH 4J3SA 4NQCA 2CBPA 3CDGB 2HVJA 3HB3D 3VTMA 2LLLA 1LEGA 3EFOB 4HZ1A 5A6LA 2ADYA 4NHCH 3QDJE 1HEZA 2KLSA 4TVPD 4YDLC 3W11C 1PLGL 3GBMH 4QRSB 4GOSA 3FU8A 3IDYB 4NQDE 2XXFA 4TVUA 1QSED 5J0BA 2UX7A 2YEVB 5E51A 1CFNB 1SN5A 1U6AH 2HAZA 3EO1A 3ZE0E 3O8XB 1UWGL 4ZPVB 4OFQA 5H8DA 3FF8A 3BRGC 4G80A 4PG2A 5J1SC 5ESVB 4UDTB 1AIFA 3C6LA 3VI3E 1DVYA 3L2LA 3PAUA 4K71B 4XNZC 4LGRB 2SEBA 4GBXD 4XCCH 1R3KA 4FI6A 3WIHA 1GOHA 1PMYA 3WY2A 4L18A 3V8CA 3ZY7A 3PREA 4TMPA 1LO3H 1OQXA 4ENEC 5IIEA 1TVBA 2G9KA 1A65A 4I0CC 4JGJA 4OZGA 3ULUL 2OMWA 3FTZA 5IB3A 1CICB 2R7EA 3ROLA 1PL3A 4HIXH 4MNQD 1Q9KB 1S8DB 1YNKL 3MRQA 5J6HB 2HZHA 1TSHA 4MB4A 2V2WB 3HC0A 1HWHB 4N0UA 4JRYB 3RJDA 4PB9H 4P23B 1JZHA 5DJ0B 3FBKA 3Q1EA 4NCC1 3KPLB 4KK9C 4QYOB 3BE1L 3DLQR 3LB6C 2Q7NA 1J5OL 3K6OA 4CRPA 4Y2DD 2W94A 1U8HA 2UWEA 1J1OL 3MODL 5E1AA 4RGOL 3A22A 3V0JA 1FE8L 1VF5C 3J7HA 5KUMA 3B9VA 3AU1A 2VTFA 2V7HB 4AQ1A 5C3LD 3BZEA 3B2VL 1KFAL 3JWDH 3TN0C 3V9CA 3P77A 1P1VA 1XB3A 1KJVB 4NWUH 5CJ5A 1H6FA 3W81A 3AWGA 5E4IA 3E2HB 1XSKA 2XN9D 1K2DB 1OAZL 4Z7QB 3MRDB 2WTRA 3SQOH 4ANVA 2VIRA 1YZZA 1IGTA 1L7IH 2W88A 4ZPTB 1JPST 4ZFZB 1QR4A 3RTQC 4AL8L 2E7LC 4K7PL 4CVWA 3QJFB 1IL1B 2CO7A 2H0FA 3QJOA 4G9DB 5D8JH 5HHPA 4H0HB 4QWWD 2XWJB 2NY1D 2XNAB 1MHEB 2JJSA 3ESVF 4FL4C 1AHWA 4M9PA 3MV9D 3LXAA 4HWZA 5I75B 3EG9A 1ZHNA 4GRLD 4TL5A 4JHVA 2NW2B 3IDIB 4JKPL 3DC0A 2NUTB 4BKSC 3BLBA 3CVHL 4OLWH 4BUGA 5M7QA 1AVAA 5EUOF 5D71H 4Z7WE 1BYPA 3GXFA 2Q86A 4NO2B 3ZT7A 4WAFA 4KQ4H 1LP9F 4OV5B 4LHUB 2QEJA 5DF0A 2J5WA 4R4FH 2VN3A 3MLRL 2UUDH 4TOYH 4N2HA 2VZSA 4KKBC 2VR5A 3S36H 1ONQB 3DKHA 3SDCC 3RL1B 3PU7A 4Y1AA 3NPSB 3D9AL 4PJDF 4Z76A 4KNTA 5EZLA 1XGTA 1SJMA 2G2RA 4M3KB 4BZ1L 4WFED 2YPVL 2FLMA 1UEYA 2X53A 2I9LB 3HZ3A 5ICZA 3V4VB 2HA1A 3NOIA 4NUGH 5FYJE 1MZZA 3PJLA 5T1KB 4MDRA 2Z35A 5IROA 3BZ5A 3GLAA 3ZYZA 3X3FL 4J27A 5FYKE 2Q6WB 5H35A 2MPAH 1P4BH 3JTSA 5IMKA 1ZMYA 3V4PH 1SYVA 4D0CB 1IB5A 3T0WA 1L5GA 4HIPA 1CS6A 3ULVC 2XTJD 5F88A 2FB4L 1OGAE 1M56B 4BK5C 1PFOA 2VW7A 4QRRA 4URKA 1ID5I 3CK0H 4G1EB 3WNOA 1EERB 3EOTH 4XVSH 4WI7A 1U8PB 4MJID 4OAWB 4PJIE 1T5WB 2B1AL 3WN5C 1RJCA 1G9ML 2ZSWA 4DVBB 2MQ3A 3SKOB 1BQHA 3MRCB 4R7NB 2FEDC 1CFVL 5GRXG 3L5WB 1DE4B 1FWXA 2QVKA 2E7CA 3OKOB 2EC8A 4W9CC 3W39A 1HYSD 5D93B 3AY4C 2Y07L 3FQ2A 3D39D 1OF2A 3RVXD 2YWZA 1QEXA 4KKZA 5IKCB 4WFFE 1WD9A 3MUHL 1KV3A 3O6MH 1RAMA 1MJJA 2JV6A 3DYMA 4HOZA 4XPGH 5G4MA 4U2ZA 1OKEA 1I1YA 2ICEC 1ULVA 5GGTH 1DQIA 5E2TL 5IEKA 1I7RB 5DHEA 4L3EB 4M7ZB 5IHUL 4P4RA 1AQMA 4RZKA 4XNQA 1ECYA 3EF7A 1OTUD 5AUMB 4MDIB 1QO3B 5ADPH 3ARGD 3KYOA 4PTUB 2BVPB 2O30A 1YJDL 4M6ML 5EDXA 4K9EH 2YBRB 2ODIA 3B5GA 3PWPB 3BESR 5L9DL 5GJSL 4OJFL 4Q14A 5BVPH 4JFUA 1G9HA 1DJXA 3SKMB 3U30B 3EJCA 4XWGH 2DZEA 2QHRL 2XKNB 2ZG3A 1AXTL 4PY7B 2LAAA 5HYQB 7CGTA 4G42A 4P9HH 5DUMH 4OQTL 3KBHE 5AFAA 4GB9A 3ZSSA 1LO5A 3VFMA 4DGVL 1SUJA 2OMNA 3MCG1 5DJDA 4G3YL 4C4KT 2OR9L 3LD8C 1T0NA 1X7QA 4BCXA 4MZIA 2XA8H 3U79A 4PJEE 3P9MA 4JFDA 4YHLH 2F54E 2NNAB 1KPUB 1CLOL 3UJTL 2WP3O 4TM9A 3W9EB 1L9TA 3B9KD 4PWGA 2P5WD 3N42F 2HG5B 1BIHA 1QW9A 2OV0A 4YPJA 4APQD 4BIKA 4AYDC 4HD9A 1HCFX 3IXTB 2A83A 4MCZA 3HG1D 1IAMA 3HBGA 4YR6A 5EO1A 3NESA 4QAWA 2KH2B 2F19H 1IBFA 1JV2B 2JH2A 3A47A 3B9DA 4X7EC 4BK8A 4MXQD 4GMSL 2OMYB 1XL4A 3UOAB 2DQCH 1A6TA 1XGQB 2DQGL 3BUQA 4L8BB 4FZEL 5E1QA 3G5YB 2EICA 4AT6B 4JZOA 3N41F 5DHYA 1NBQA 4RIRB 2DQFA 4G7VH 4YUEL 4R26L 5DFVD 5FYJH 1F11B 1NCCH 1WWBX 2K8QA 3NSJA 4CN1A 4U1KA 4F33A 2IGFL 3MRNA 4NKMA 1IBYA 4Q9CA 2CALA 4HIEB 5JA8B 4HU8A 1KLUA 1ES0A 1EFXD 1OE2A 2NSMA 2Z91B 3BFQG 4G11A 3D3VE 3FL7A 1BP3B 2P44B 4ODWB 4G6MH 4WEUD 5A16A 3OMAB 4KK5D 1GGYA 3FU0A 2E6QA 4WU5A 2A0LD 4JRXE 5HGHB 1EK3A 1Z9NA 3ESNA 1E65A 3KXFE 1XSIA 4P3DA 1AJ7H 5E9DD 3NJXA 3GQFA 2DQHH 5HHNA 1QBAA 4GQ9H 2AQSA 2CLZB 3KLHD 4KOBA 1EGJH 2G3XA 1JHTA 3BN3B 4MD0A 1WE5A 3NSYA 3TBTA 2H26B 3MTXA 5EB9A 4DO5A 3OQ3B 1QFWL 1SHSA 3AFLA 3CX5J 2QADC 3VWJA 5BW7C 4FGMA 4LLDA 1I31A 2ESVE 4KDTC 1DL7L 2QTVA 1OEZW 2DQMA 2H0JA 1DO6A 4JANA 4LB8A 1HHJA 1JPEA 4YFDB 3BP7A 5KVEE 2XACC 4AXWB 1X5ZA 3MBEA 4IHOB 4OIAA 3MROB 3HPLB 5D7LB 1MCJA 4MXWL 5D2LB 3ZUNC 1F3JA 5T1LD 1KXVC 2DI7A 3Q44A 4LVOC 3HMWH 3UAAA 1XDTT 2FWUA 4HKBA 4ZDHA 2ZUXA 3B1TA 4K7FB 3KEHA 2H1PL 3N9GL 5D9SA 3G6JF 1MVUA 5SWZE 3IDNA 5MERA 4YHZH 3VGAB 4PJFF 3W5MA 1T21B 3MUJA 2IPKA 2Z65C 2OSWA 1JNLH 2CDGA 3QFJE 1NGWA 3REWA 3VXPB 3NBNA 5J1AA 2APSA 2DEXX 2GSMB 4CU8A 4ZG1A 4CVZB 1XFPA 3JTTB 5ESAA 3BPNC 2VR8A 2OTWA 2ICWI 5KW9L 3NA9H 1MCEA 3B2UD 2EIMB 4UNVA 3RX8A 5C2UB 2VDLB 2A6KB 1Z5YD 1D6VH 1VJSA 1UD3A 1UEMA 3QARA 3RVUC 4PJXB 4OZFB 5J4MA 1QLRA 3QIUB 1P4UA 4LCIL 5EEXA 2PABA 2C5DC 3BPCA 3KCPA 3HRPA 3ZSTA 1ETZB 1QQDA 3O0LA 5C0BB 3PAYA 3L5XL 2GUOB 1NBYA 2DQJL 1II4E 4X42A 3FOMB 1XGYH 2HSIA 3L54A 4ODVL 4P2AA 1TZOA 1MHPH 3LN4A 1DQJA 1VFAA 2A9NH 5E8NB 4U1NA 3C5ZB 1PKQB 3SGJC 4X4ME 2UXGA 3QH3A 4HKXB 4JFXA 2FECI 4KKNA 3BIBX 3K5RA 1SJHB 4DN4H 4S1QL 3LDBB 4HHGA 4ZX4A 2WZ0A 3IJSA 1M2OA 3E6FB 1YEJH 5IJKC 1M3JA 4H20L 4KK8D 5IJDC 1A6VH 3B4NA 4HBQA 3BKCH 4F7MA 3VYPA 2FJSA 2WQSA 3HUJA 4WCYH 1X44A 1XR8B 4EXPX 3OLGA 2J1XA 3ZE2F 4U6YA 3WDJA 4JRYE 1H5BA 1R5IB 1I85C 1ZTXL 3PYCA 4TUOA 3WI9A 2DQUH 1X9LA 1W8NA 4FFZL 3DX8A 1U8QB 1JNNH 4RQQA 3FH7A 1JMXA 2UZXA 2CA4A 4IKLA 1MFMA 3NEEA 1YNTB 4FQXD 2AABH 5K93A 1HTYA 1QRNA 1UM6L 4P9ML 2LVCA 4XP5L 4PWFA 5AYQA 4L5FH 2ZUYA 3T2NL 3GTTA 3MNVA 3X2QB 4O02H 2DAVA 5FO8B 1NBVH 4M1GL 2LU5A 4OZIA 1NWOA 3P3SA 5F1NB 1G7HA 1I9JH 1H15B 2VO8A 5F7DA 2YQBA 1KJ2B 4LHJB 1JV5A 1DFBH 4Z7QE 4P05A 4N9GA 2E74C 1GY1A 3CZNA 3UTTB 4HHWA 1FIGH 1NMAH 4J7RA 4QOKA 5TPWH 4IRZL 3ARXA 3X14B 1T7ZA 2VXTH 4XHJD 1TZGL 8CGTA 2BVEA 4IW4C 4YZFE 5CKAA 5EO0B 4XMPL 3AREC 3MRJB 3MV8D 4UZGA 1U3HD 3WNJA 2J88H 3Q5TA 4J3OC 3VRIA 5TGBA 3UDWC 3U2IA 1XIWA 4X7TA 5KVEH 1N6QL 2OJZH 1BVKA 2X1PA 3RGVC 1E40A 3S3PA 5C0EB 3J2PA 1KPVA 2HH0L 4WJ5A 5D7IF 1C16A 1WBXA 3OLEA 1RFDH 3KJ6L 4FCAA 4MZ2A 4Y88A 4KJPD 1A9BB 4XOAA 3ZTJH 2E3VA 3HJ0A 2WXQA 3H6JA 1AGFA 3BW9A 1GZPA 4NQCB 3QJVB 4XNMA 1QWUA 2O6CA 2P26A 3QORB 3BN9C 1AXSA 1GGBH 2XC8A 1T83C 1HEZB 5CZXD 3EBIA 3KM2A 3NFPB 5K33A 2J8UA 2MKWA 4HWBL 5LBSL 4S10A 1E28A 4XVTH 4KKCC 3VFOB 5DEZA 3OHMB 4KAQL 4NRYB 5I76B 3WG7B 1WUZA 3ISWA 3TU6A 3AB0B 3EO1B 3IPEA 3Q2CA 3B1UA 4AKOA 5EU5A 4Z5RA 4G80B 4N1EA 1AIFB 1OARL 5C0CE 1IIIA 5T1MA 2FEEI 3DTUB 1BG1A 2J6EH 1F58L 5D70L 3WSQH 2BCKB 3SYPA 3NAAL 1KCSL 4LLQA 2CKBH 2Q5BA 5IIEB 5HY9B 1WFNA 1KGXA 4OZGB 4ODUA 2OMWB 2YHGA 2JELH 3ROLB 3W82A 3LRMA 1SLVA 3MRQB 5E4EB 3VI4F 2FNBA 3PDDA 2VLMD 1MHCA 3HC0B 5CINL 4ADJA 4ZK8A 1YMMB 3BEVA 1QAWA 3FUNA 4PI0A 4GY4A 5FUOL 1Z0NA 1MG3C 4U6VL 4YO0A 1NAMH 4G8FA 4CVUA 3RFZA 1U8HB 2P7TA 2UWEB 1L6ZA 3IU4H 3Q8CA 5KSAA 3P4OA 3MLPA 1CF1A 1YQ2A 4LPCA 3AU1B 4AQ1B 1JF1A 2A9CA 3DOSA 3LPFA 3RZCA 3IDJB 4FE9A 4NNYB 4ORGA 3MRFA 3P77B 4HG4K 5FDWA 2Q7YA 4ZW8A 3TO4A 1SRDA 1A7PH 1X7TA 4NKOA 2WANA 1CK0L 4P2YA 3LPGA 4ZBJA 1IGCL 2DYPD 2WTRB 5JW4N 3JT0A 2VIRB 2EXWD 3FB7A 3HCVA 3LEYL 1UZ6F 5C07A 1BJ8A 3DDGA 4AVHA 3NJGA 2A6DA 5IOPA 1QSEB 4KRNA 4Z3HA 4NRZA 3QEHA 5CHNA 2CO7B 1TTFA 3WTUA 4L3EE 5HHPB 4DJMA 2XXMB 1SDDA 1IVTA 4M4RB 3D85A 5GRZA 1AHWB 4DP6X 2NNFA 4O02A 4OGXL 2AC0A 2ZX7A 4G9FB 4HWZB 3EFDL 1CD0A 3OSVA 3DURA 3X3GL 4YBLC 5C9KA 2ZZUT 1OCOB 1HS6A 1PKOA 1HQRA 4WHTA 2ZUTA 4YDVA 3PWPE 4WV1C 3SPIA 3HC2A 1VESA 3AW5A 4ZQTA 2OI9B 3QAZC 1MDTA 1EZLA 1ZRUA 2Q86B 4O2CA 5KG9A 4DPBX 2YWYA 3TVMC 2CJTA 4PQXA 1I1AD 2Y7OA 1EWHA 5F7FA 3TBSA 3DETC 3LVTA 4YDIH 1TQTA 4Y2DB 2LLNA 2C3HA 2FGWH 2GQHA 1P84K 3FN0L 4Z76B 5EZLB 5B1KA 1XGTB 1QMUA 5FAAA 1CU4L 3T1FA 5HBBA 1PZ2A 5IBLD 4KJWC 3N6YA 3EH1A 5HDBF 4HSQA 4LIQH 4S1SL 3ESPA 1Z66A 4AYEC 2Z35B 2X4SA 2CCWA 2V5YA 1NIFA 4H25B 3H42H 4X4ZA 3UG4A 2J43A 3X1GA 1DBMH 3QEUA 5CGTA 4I0PD 5H35B 3LNEA 1OIOA 2WVTA 4JFOA 3OAUH 4HIIA 1SYVB 1RIHL 1L5GB 4YE4L 1TQCC 4FQLL 4DNLA 4JO2L 1P4LA 1ET7A 4QRRB 3K2UL 4FXKC 5FGBA 2JNZA 2WBJA 4XBEL 1OM9A 3T1WA 3QAQA 1RIUH 2PWHA 4KO9A 4WFGE 1IM9D 1TJGH 2ZSWB 3X1EA 1BQHB 3CQQA 2DYRB 4JFZH 4NC1E 5FOJA 1HOCB 2B4CC 1FQ9C 3LQAH 3RI5F 4U1IA 4X9HA 1LE5A 3W39B 4UB0H 4ZW3A 1IE4A 4M8RA 3GSNL 3H56A 4M93B 3TH2T 4MAYC 3FO9B 5GGQH 3FQRB 5E95B 3BPOC 2ZF8A 4EN3D 2Y5TB 3SQRA 4JB9H 4PD4J 4DUXA 4PY8I 1MJJB 1E5YA 2BIOA 3ARBD 2J1ZA 2VLKD 1I1YB 1Q9WB 1F4XH 4Q6YA 3K2MC 2FBJH 3GMQA 4RMUA 3IPBA 4H44C 4QXWA 2NW3A 2QV4A 1PCXA 1MFDL 3SSGA 1J9CT 3DTXA 3GMOA 1XCWA 4G6FD 2LU7A 4P4RB 3IETA 4NZFA 1SBSL 2APXA 2AF2A 1N8ZA 1ESOA 1T3FB 1NMBH 4V33A 4HDIA 1YPZB 4P46D 3CTTA 4GLRI 5F1OB 4NCDA 4APXA 5BNXD 4A2MA 5EEYA 3KYOB 1NC2A 4MA7H 1DSYA 2QT6A 3RBSA 4JW3A 5GZOA 4K23H 1W0VA 4GRWF 2DWYA 1A4BA 3FSAA 4BINA 5I1HH 3QJUB 1LQBC 1VPOL 5E5RB 4LSQH 1FO0A 1K9TA 4G1MB 2COQA 2WLZA 5DURD 2XV3A 3P2BA 1TJMA 3CN0A 3L4WA 2XTJB 4G7QB 2IGTA 5D2LE 1UA6H 2X4OA 4LLUA 3F05A 1DVFA 3FB6A 5AB9A 4NQED 3CLWA 1LHZA 5CN2A 4U1GC 2A73A 4NX0A 1LO5B 3PFUA 3US0A 2ZX6A 2GK2A 3M86A 3VSTA 2ARJB 4R8WH 3EIFA 3TJHD 2ZKHL 1T0NB 4W93A 4A7QA 5FKAB 5LGHL 5ENWA 3ATEA 4IBZA 3HRZA 4OLVH 3P9MB 4TQ8A 2VN4A 4R6UA 3DWTA 2WZ5A 4PJ8C 3N5AA 3UP6A 3E8UL 1B4LA 2K45A 4CW1B 5DWUH 3CD4A 3C2SA 2HFFA 2A83B 4G7YL 1YEGL 2H6PB 4MCZB 1DDTA 2AEIT 4YR6B 1GVIA 1QHQA 3S96A 1AZBA 3O6FA 3BQVA 3V52H 1T2JA 2YAFA 4PJXE 4KZDH 1MY7A 4C58B 1L0XA 5KVFL 3LZRA 1WIOA 2AXJA 2XWZA 1YG9A 3PE9A 2GTQA 4JO8A 4YFLI 3WTSA 1A6TB 4EI5C 1MJ7L 1FI8C 4HCIA 4A7SA 5C0BE 4JZOB 1QI3A 5DHYB 1XB6A 1RZPA 2CNYA 2DQFB 3FT0A 2VLLA 3P02A 5I19H 2PYEE 4WW2A 4NXKA 4WUKH 3CXHJ 4U1KB 4D9QE 2CBOA 4F33B 2X4QA 1W6LA 3MRNB 4NKMB 2FGZA 1TTBA 2EQDA 2Z8RA 3UYPB 1PKQE 1HQ4A 1TENA 5HJ3A 3S3DB 4HJJL 2P49B 4OSUH 5DJXA 5HHXL 1UXSA 4KUZH 5A16B 5HI3D 2IAMA 1BMWA 2Y2WA 3WFBL 4FXTA 4ATWA 2CZNA 3TZVC 1TFHA 5DHVB 3W56A 2XWTA 4WU5B 2FYYB 1BF5A 1GJWA 2AK1L 1A6ZA 3Q9QA 2CU9A 5GRJH 3QQ9C 3VM7A 4E9YA 3KLQA 3VVWA 2WQRA 5HHNB 1HT6A 2VLRD 3DVIA 1U93A 4OZFG 1USZA 2ERJC 1JHTB 4IU2A 2C1PA 2LQRA 3TBTB 4GXUM 4ELMA 2HRGA 1J1PL 5CD3A 3PP3K 4MB5A 3B9KB 1X6NA 2P5WB 4J12A 4GT0A 3VWJB 4JDEA 1LE9A 2VXUL 1MOEA 2DF3A 4LLDB 1T1WB 2NNCA 5DEJA 4GKLA 5KTEH 1UJ3A 2HXAA 4TNEA 2A9ML 3HG1B 4B9GA 1ZS2A 3NZUA 2H1LM 1X5JA 1YQVH 5F7BA 4YSPA 3BKYH 1Z3RA 3N0PB 1QSFB 4JANB 4LRNH 5TQ2L 1K4CB 2X10A 2WB7A 2ZQKA 3BP7B 3ILPA 1WCQA 4WGKA 1Y1DA 1SHWA 3MBEB 4KUCF 3PRZA 3MN8A 3QNFA 4K2UL 2OSYA 1NEPA 3MGAA 1F3JB 1OCWL 3Q2NA 1EAPA 4BFRA 4ZTOH 2QQKH 4HKBB 5AVSB 3WY3A 2GJJA 3QULA 4ZDHB 4JHWL 1R46A 2G4GA 3I9GL 3LHPH 5D9SB 4XVUD 3DARA 3A0OA 5FHAH 4C56E 3APMA 5GGVL 2R56L 4QUOA 1CGSL 3OC5A 1PY9A 2PR9A 2Q1EA 1F4WL 2IPKB 3TEXA 5E2VL 2CDGB 2MEJB 4MD5A 3REWB 1NGWB 4J3OF 5J1AB 3ZMRA 5DT1H 1R5WB 4NM8L 2NX5A 1NCBH 4Q58C 4NZUH 3BDYL 4P2CG 4PRIA 3WY4A 1E9OA 5F1KC 5ESAB 2FR4A 2F58L 3M1OA 4DO4A 2YA1A 3EF4A 2WLIA 3CN1A 3GLZA 2HTLD 4UT9A 6PAZA 2AS5M 2AXGA 2NXYB 2JCCE 3GB7A 3GBDA 2VDQH 3W57A 3GRBA 4LBAA 4MMZA 1EH9A 3UTQA 3MX0A 1IJNA 4Z7UB 2Z1KA 4PJGF 4N22A 4GYBA 1OPGH 4QLWA 4L8SB 4P3CL 1QQDB 5I82A 3UZQA 4WJG3 3WKNA 2EIEA 1KCBA 1SXAA 4Z95L 1NFDF 4FQCL 4YBHA 7PAZA 1E5UI 4KI5E 1T7VA 3V0DA 3LN4B 4MA1B 4U1NB 1TETH 4OD2A 4P4KD 1CFTA 4JFXB 5EULV 4OFIA 2FX9H 1QZNA 1YNKH 5T3ZE 3LS4L 1D5XA 4Z3EA 2MNJB 2QKSA 3BYTA 2YSSB 3N50A 4U2YA 3NG5A 3K3QA 3MLVL 2F1EA 3OMZA 2DL2A 4HT1L 4YLBA 4F7MB 3G04A 4WO4D 3HUJB 2YUVA 3BE1H 5KVMC 2JE8A 2YKLL 2WAHA 3WEOA 1VZIA 3MPCA 3EDFA 4L1LA 5F7HA 1H5BB 1YMME 4RGOH 3ULVL 4EUPA 1M7DA 1FE8H 4TUOB 4WNJA 2NSQA 2ZXEB 3DX8B 4RAHA 4RQQB 4XN1A 2CRYA 1RULH 2OSXA 5JDJA 5K9QG 5FHBL 4WWKD 2YAPA 3BMWA 4Y5YB 3W5NA 1VGKA 1BECA 3OL2A 4QKTA 5I1IH 4Q74A 2IFFL 1QR1A 3MNVB 3P11L 3T6ZA 4WK0B 4OZIB 4K5LA 4X9GA 1CURA 4UI2A 1U8CA 4IGBC 4GEIA 1G7HB 1YO4A 4HBCL 4V2BA 5F7DB 1I1CA 2KC0A 4TVPE 5I8EA 4BHUA 5IG7A 4N9GB 3WL9B 5HDQH 1HHIB 2ENPA 5MENA 4QOKB 2F7PA 1AI1L 2Y6TE 1QSEE 2W80C 4JJ5B 4NN6C 5JQ6H 3H9ZA 2NY0D 2MQGA 1PJWA 1QA9B 3TBCA 3VD3A 3S3BB 4QRPD 4Q7DA 5L2KD 3RWHA 3U1SL 3EADA 3L3DA 3CVHH 2D7TH 2NQDA 4Y1TA 1FNGA 3BWUC 3K4AA 2WZ6A 4G9FE 4N24A 4XBPA 1JYVA 3K6FA 3W0WD 1XIWB 4X7TB 4D0DB 1YLBB 2C9PA 1KPVB 4WJ5B 2IBZY 1C16B 4KKLD 1WBXB 1RZKC 1GRWA 4DF9A 1NCDL 3MLRH 2YMOA 5J06A 2DLFH 5EIQA 1AGFB 3BW9B 4W9ZA 5EWIL 1GZPB 3F04A 3SO5A 2Q3AA 5D72H 4XNMB 3D9AH 4XCNA 5DWPA 4RNRA 2N56A 1B0IA 1DLFL 2XJKA 3KVQA 1H3WM 1INDL 3I6LD 4RRPG 5JW5A 2YPVH 2X6CA 1WG3A 4Y16D 3II3A 1MVFA 2MKLC 1N0XH 4U1SA 3NSCA 3IJYA 1GIGL 1DANT 3QO0A 2KDGA 3CC1A 3A6CH 4NQXA 1FCCA 5HYFA 1BAFH 1U8MA 1I7UB 3GUTB 5J12C 4DTGH 1IARB 3VMPA 3X3FH 1CIUA 3QZPA 4KKAC 4D8PA 5F3BB 5L0QC 1TUPA 5GXBB 3TH3T 4AEIH 4P5KA 1WD8A 3IRCA 4F7CA 1ZVYA 1T1YB 3HNTL 3TPUA 4ODUB 5BV7C 2R29H 2PPEA 4XNYH 2NY3C 1MJ8L 2QKIA 1EUUA 2O5ZL 4OLUL 4G2AA 3IMUA 3MNZB 1MHCB 1FZKB 3DVNA 3V6ZA 4I2XA 1U3HB 2B1AH 1ZLVH 3WCYA 3BEVB 2WTPA 4QRRE 1MNNA 3FAWA 1CFVH 2UVFA 3T0ED 4ZUWA 1G7IA 5F7LB 4KHTH 4W9HC 4XO8A 2NYYD 4YO0B 1IU1A 4G8FB 4R0LB 4ALAC 3RFZB 3AU0A 2DKUA 2P7TB 4OM0L 2EADA 5IB1B 3P4OB 3FPYA 3VX1A 4JN2B 3B7UX 1JF1B 2R9HD 3DOSB 1TYEB 4H8QA 5CN3A 1OV8A 4G7SB 4ORGB 3O6LL 5KSBF 3MRFB 5FDWB 4ZD3H 5DUPH 4A66A 1OTTC 4QRBA 4NKOB 5E2TH 2EO1A 4NO0A 1OP3K 1UKSA 3C60D 1VACB 5IHUH 1OZTG 4NRXB 3FB7B 5G5DB 5E5MA 3HCVB 2Y7MA 4YAQB 5FA3A 5IOPB 1D7FA 2A6DB 3DYOA 4LP4A 3BEWA 3B5HA 4UUJA 1NCIA 5A7BA 1QLEH 4NRZB 3QEHB 5CHNB 5HDLA 5HHOD 5KJRL 3CC5A 1KIRA 4WFEE 3SY6A 4KZEL 3EKCA 1YJDH 4PS7A 1SDDB 2BP5M 4M6MH 5D7JC 4BA8A 3D85B 1YPZE 3NACL 1CXKA 1PW3A 5GJSH 4OJFH 4WHYH 2GYSA 3RZWA 4NYLA 4PLKC 3OKNB 3DURB 1LK2A 2QHRH 3FRPA 4FJ6A 1AXTH 3Q8EA 3QIBA 1HQRB 1D9KA 4WHTB 4YDVB 3KPOB 1MEXH 5I71C 3MRKB 4OQTH 5C2BL 4TVPH 2VQTA 3ZTCC 1U91A 3CFUA 5HYSA 2NZ9D 1AOHA 5IHWA 3R0NA 2XTJE 4O2CB 2VR4A 4DGVH 3S0PA 3POHA 4Q9BA 1F2QA 1A47A 2OR9H 1A1OB 4YIQA 5JHLH 4Q4EA 5A2JH 3CVHA 5AKTA 4JDTL 1ZA3B 4ZX3A 1K6QL 3QNXA 2K9FB 3TBSB 3KNBB 5T5NG 1XTLA 3DOIA 3GMMA 4XXCC 4EXKA 5A2FA 3UJTH 4QXVA 5T1JA 4KVNL 4PCTA 2G5UA 1YNLL 3IU3B 5ICUA 3AQXA 3DECA 3OF6D 1NINA 4IOSD 3TWYA 2DYPB 3DK2A 2X4SB 3K72A 2FLRT 4W6XB 5I30L 5HVHC 4YSRA 5CJOL 3IGLA 12E8L 3LNIA 4KI1A 2E9GA 4BZ1A 2DQGH 1KGIA 2YPVA 3VGFA 1CUOA 1P1ZB 3QEUB 4FZEH 1UVQA 4I1NB 1UD2A 3TA3D 1NH6A 5F7UA 1NCWL 4JFOB 4HIIB 1EHAA 5F2FA 4YUEH 3RVVD 3RB5A 5CJ8A 1IGYB 5DTFA 2D31B 1QI4A 2HX7A 2FCBA 1P4LB 2G3NA 2IGFH 5D1XA 3IRZA 4XPBH 5CGYC 4MRBA 5LBGA 4XOCA 2WBJB 4HLJA 2H9GB 4YHIB 4B50A 1E9QA 2OSLB 3I9IA 3VRLF 5JPNB 2BHZA 3MRHA 4QTIL 4LLMA 3BO8B 5JPMB 5JXEA 5TF1L 5CGMA 3OLIA 1CR9H 3CFCH 2C3XA 4I7ZC 4WF7A 2EDFA 1AG0A 1ZS8B 3GKZA 1LE5B 1XR9A 4U1IB 4GSDH 4WDIA 1I1AB 1JRHL 2F7RA 3NPZB 2WXMA 4HAGA 1NDGB 2DLGA 4B53A 1KMGA 2W0KA 2FQEA 1CE1L 5JNYA 2BP8A 3JTBA 1TU2B 3NMEA 1RUPL 2VDNH 1Y18A 2WXPA 2NW3B 4MS8D 2EKSA 4PR5A 3DTXB 3GMOB 5BRZA 1QSVA 1DL7H 4TUJA 1N8ZB 3SO3C 3AQYA 2PP7A 4HDIB 5I8OH 2R1WA 3UX9B 4TQPA 2F61A 1QFOA 2OMTB 2P5WE 3G9VA 2B16A 7PCYA 3C6LC 1NC2B 3CSFA 1H0DA 3KCWA 3OHXC 3GXNA 3HG1E 1HKLL 2O6FA 1RLWA 1W0VB 3AXLB 4MXWH 1QSFE 1GYWA 2Z4QA 4N0CC 5E7FA 1BM3H 3ILQD 3GJFK 1FO0B 2GAZA 3SCMA 2H1PH 4MJ4A 2Q7AA 3HEIB 2X4OB 4LLUB 4LCWD 1DVFB 4B9CA 4FP8H 3A4DA 1LP9E 2BOCA 4H7VA 3A67H 4PLNC 2J44A 4CSZA 2V37A 1NCJA 4W6YB 2A73B 2NRDA 2HN7A 3HE6A 2XSKA 1UOWA 3S9DB 3MSPA 5ENWB 5HDWA 3QWOA 2DWXA 3RWEA 1ZGLM 4OQTA 1YEFH 4FEIA 4R3SB 4LSSL 5DI8A 2VR9A 5I16B 2RFXB 4IBVA 4I1PA 1IKNA 2BFGA 1LGVA 1WFTA 4M61A 3TP4A 1ZVNA 2E0PA 1AE6L 3NGBB 1Y0LA 5ACMA 2Y5QA 4MQTB 2X2JA 2VCOA 4OJYA 1C7SA 2EO7A 2HFFB 3FCGA 3I84A 4QT5A 3VXUA 4IEFA 2GIYA 3OKEA 3IE9A 1J9RA 3VXRD 5CN1A 3O6FB 2X42A 5DD6A 2COVD 3AXIA 3L5XH 1FZJA 4TSBH 1NSNH 3VFVB 2W95A 5HD8D 4I18C 4Z7UE 1G6RH 4PP1D 4JK0D 3WHXA 2R2HA 5IEHB 2D4FA 4P46B 2BNQA 4ODVH 5DC0A 5EFIA 3CMOL 4NSKA 2NOYA 3ESUF 4XP4H 3OR6B 2H3XC 4J28A 2VLLB 1FV1B 2R4RH 3KLDA 1KIQB 5A2AA 4GG8A 2IMMA 4S1QH 5AOMA 3PWVA 2DMCA 4Z3FA 3P1VA 1Z0MA 4L4VA 4C47A 5EOQL 1NIDA 4KBPA 1C1EL 4LNRA 1HQ4B 1NKRA 4KZCA 4WQOA 5D6CA 5LNDA 2HX8A 3NYKA 3ABGA 1JSYA 5DRZA 5HJ3B 3FQXA 3L6FB 5DJXB 1UXSB 2ADIB 4G6KH 4GO9A 3DJRA 1P9MA 3MJ7A 4H1LH 1JPGA 1YYML 4DGUA 1KGYE 1T89A 2YAOA 1S9XB 3UTSA 1KCUL 3EO0A 2XWTB 2X38A 3HBQA 5D2NE 4NN5B 1A6ZB 2JKXA 2W59A 4FFZH 4BZ2L 2ZCLL 1HYRC 3S8GB 4S2SB 1U93B 4I48A 4MMYA 3V95A 1OZUA 3DX4A 4IU2B 5PCYA 4ERSL 1UM6H 4P9MH 4ELMB 2Z8VC 1F90L 4XP5H 5ICXB 1SXSA 3N1QC 4Y5VC 2W92A 5AVUB 5KSVB 3WTVA 1U58B 1P69B 4JDEB 4JFFA 4M1GH 3QEQD 1UURA 3L1OL 4G82A 3U0PA 3BVTA 4GKNB 2D7NA 5DZPA 1FG2A 3BAEL 4NPYA 3DXAD 2R0KL 5IROC 2CUMA 1WFOA 2AFNA 3GYRA 4W70A 4NWTL 4PJ6A 3ILPB 3AG3B 1TLMA 2NY2B 2A9BA 5ALBL 4OZIE 5DHVH 4OGYL 4IRZH 3VG9C 3GSUA 1AD0A 1Q0YL 3S34H 3L3KB 4UIMB 2OMBA 1IAIH 1NGPL 5JIKA 1KXTA 3GXIA 5CCGE 1NLDL 1ZT4B 3PV6B 3ZXAC 2YQ3A 3S37X 1EEYA 1N6QH 3DROB 1WFJA 2P46B 3KPSD 1WAAE 1FDLL 3QUXC 4MD5B 4AGOA 2L0DA 4UTAH 2BFVH 4M7LH 4XZUA 3NTCH 2XY1A 2X88A 4ZSOA 2VXQH 3KJ6H 2K3TA 4MNGB 5CBEA 1E9OB 2CR6A 3MGTA 4TQIA 2FR4B 3QUZA 3DI3B 3O3AA 2WLIB 2ZCKL 4JPIA 4OCSH 4I5BA 1KB9J 4LVHC 1MY5A 4U4BA 3QUML 4A63A 1OB1A 2Y1YA 5ANMB 3WMPA 3WFHA 4Y4FA 4QXUL 4HWBH 1OAJA 3UTQB 1I9RH 3MX0B 1PS3A 4YXHL 2BS8A 4OY9A 4EDWL 4KAQH 3ZHNA 1E90A 2EH8H 2OK0L 1GH7A 1ZGLP 2AJXH 4YMPA 4CGTA 3UZQB 2I32A 4MD4A 1C12A 3JWDC 1OARH 1U41A 1XH1A 1V5JA 4W6WB 2K9UA 1FAIH 4EOWH 1P0SE 1PZ5A 1IT9L 2YD8A 3FU9A 5D70H 1RP8A 4E9QA 1BQUA 4DKFL 1KCSH 3DIDA 4EI6A 3FTYA 5I8KL 2Q8BL 3GFUA 4Q9RL 2NY6B 1RPUA 5E5UB 3QIWD 1CFTB 2B1OA 1V3MA 1NMCB 2H32H 4PRAA 5J3HC 4J4PA 4HKZB 3QHFL 6PCYA 5IUCA 1S46A 3ULSA 1D5XB 2OMVB 1I8LC 2WN2A 2RQ8A 3PWLA 5CINH 2QVIA 3ZDWA 2XI9A 4PVMA 4LPXA 2EXYC 2VDOB 1JXKA 2NY4B 3G04B 3RPBA 2VC2L 1WTGT 4M1CC 2X4UB 1SJEA 2DWEB 3P0YH 3MV8E 3OGCA 5FCUL 1MFAH 1IV8A 4RDQG 2EDJA 3BP6A 3FFCD 3NFSL 4Q0XL 4WWOA 4EUPB 4F2MA 1A25A 5F6IB 2VISA 3RDTC 3ZHDA 3ETTA 5LWYL 3K8KA 3BFOA 3CFJA 5GS1A 4H1LA 4L0PB 2KUTA 3CMGA 1GZQA 1VGKB 1LMKA 1RI8A 1IGCH 3O41A 3TO2B 5FW6A 4UM9D 1XV8A 3S5YA 5CSZA 2DQIH 1B0WA 1OSEA 2C9AA 4FFZA 4HYTB 4H8PA 3V0GA 4JL2A 3BT2H 2OYLA 1U8CB 1NZRA 2B4CL 4RFOL 2ZAHA 3MA9L 4TNWK 5MI0B 1X5MA 5I8EB 5IG7B 5L4IA 4XXWC 3PDGA 4PRPD 5T1DL 3EOBA 4GKZB 1ZT1A 2Y1ZA 4QAMB 1J8HA 1L9SA 4XI5C 1NQBA 1Y6NR 3RUGB 4OGXH 3GXPA 4C83B 1LXMA 2AVFA 2CK0L 5AENA 1REIA 4QCIA 4TS6A 1R47A 5SV3A 3X3GH 3C5SA 4Y9CA 4PN6A 2A6JB 2EE0A 1WT5A 3L3DB 1KUMA 4PJ9D 1FNGB 3LMJL 4XBPB 4E42A 2H2PC 4IRZA 1NC4A 2H47C 3PJSB 1Z3GH 3TBVA 3WIIL 4YHML 2BXYA 4BWUA 5HGGS 4F57L 1DDHA 3MOBL 1JGEA 2OXHA 2ITDA 5D1QD 3APCA 4MJHA 1DTUA 4KU1A 1C5CL 3FFDB 1GS6X 1TDQA 4YSEA 1AZUA 1MI5D 4FN0A 4PYHA 3RWFB 1HILA 3QQ3A 2VLME 4J1UA 1ZANH 2JKSA 1IKFL 2RH0A 4MSWA 1BFOA 3MOAH 3OKKA 4XCNB 4ELDA 1R3LA 4RNRB 4RBPK 1CU4H 4IRSA 4O2EA 5EU7E 3KWWA 3CFQA 2LT9A 3DMMD 4X9FA 4A38A 1P7HL 1PYWB 4FCHA 2WNXA 3IJYB 1YSOA 3PHOA 3UZEA 3KM1A 4YK4B 5EEUA 4S1SH 5EUOA 5C08A 4HV8A 1EEZA 4QJ5B 2CLRA 2VDKH 1U8MB 1KBKA 2EDWA 5E4OA 1E4WL 1AOZA 4KTDL 1K8IA 2J8OA 4HWBA 5LBSA 2Y0SA 3C6SA 5EN3A 4B5ZA 1NCTA 5IVZA 1DBAH 4GSRA 1RIHH 4HC1L 4P5KB 4FG6D 1RL1A 3Q2LA 3K91A 4YE4H 3QSKB 4KVPA 2CHWA 4PJDA 2WXHA 3B43A 3TPUB 4JO2H 3FAXA 2C7UB 1B6UA 3L9BA 2NY0B 4HAFA 2QKIB 5DD3L 4QRPB 3RGHA 2MPVA 4XBEH 5L2KB 1ET8A 1C5DA 2IADB 2CDFA 4AYID 1KBWA 4KH2A 4MHHI 3DVNB 3T8XB 3HI5H 4I2XB 4K9EC 4HS8H 3DIVA 3M1BA 4HLZG 3BQUD 1I7TA 4ORZC 2F15A 3GLDA 4ZUWB 1G7IB 4WUUA 5KVGE 5C0RL 1FZMA 1ZE3H 4D3CL 1NPUA 3GSNH 1JDAA 1O6TA 1EBPA 3FONA 1JK8A 5ADOL 3II1A 1E8WA 4P9HC 3LKPA 3WJLC 1GOGA 4XRCA 1SHMA 1CO1A 1U42A 4U3CA 4IMKA 1P5UB 3CLEH 4TPRL 1ZLWH 1LO2L 3HVNA 1DFXA 2K8MA 3ES6A 2XFXA 1MFDH 4WEMB 4LO9A 4NO0B 1FGVH 1RUQH 4AGMA 2PTUA 4GI6A 3PL6C 1GGCL 5E5MB 4NO5A 2V6HA 2VOTA 5FA3B 3L3HA 5KYYA 4U3SB 4PG9A 4UUJB 3RLSA 2XZZA 4K0OA 3CC5B 1KIRB 5F9WC 1Q9LA 3NRQA 5JOPD 3BVWA 1ZV5A 3EHBC 3M88A 3ZL4L 4R83A 4MB1A 3TBYB 5J7CC 3TWCL 3IEAA 4NYLB 1OCCB 1HKFA 1LK2B 1P5VA 3FRPB 5JPMC 3EJQA 5CR8A 1WAEA 5ECJE 1D9KB 3HMXL 4ONHA 1IEBA 1BREA 3C8HA 3T4YA 3T65A 3GRWL 4LDCA 2O5XH 5D7IE 1FL6A 3ALXA 4KQ0A 4DW2H 3CPLA 1U91B 5IM7B 1CYXA 5ILTL 4OVUA 5HYSB 3L9EA 2WK2A 3GM8A 1EZVX 2K0RA 3ZKND 3ZRSA 1MCHA 1OPOA 2ZKHH 4J3WA 4RH4A 3O9WD 3QNXB 2CJ3A 4DVRL 3UMTA 4Q9QL 2VDPL 4L0YA 1CG9A 2BLFA 2E9IA 1ZEAL 4FYSA 1BEXA 4JE4B 4RLDA 1NA8A 3E8UH 1QHOA 2IH8A 1GSMA 2NXZB 4JGMA 4G7YH 4POZD 1YEGH 2K4AA 2AJYL 3DO4A 1BQRA 4HAKA 1D3CA 3S35X 1KN2H 4O51A 1MCPL 3PXJA 2BM3A 3K72B 3RP1A 5FOBA 2EILB 1YUKB 4AEHL 2GTWA 2VJXA 5C0FA 1NCAL 4KXZH 2VLKE 2D2CC 1MJ7H 3GUFA 3RRQA 2NCMA 1J0HA 1UVQB 4HLZH 1E4HA 1V7ML 2ALAA 2WVVB 1E4KA 3VFWA 2X70A 2O4EA 5DZVA 1BPLB 3GXMA 1W8OA 1QNZH 4NDMA 2ZP9A 2ZXCA 3SY0A 3NRFA 3QUYA 5DTFB 4N8CH 4JHUA 3HC3L 1AYOA 3IN2A 5D1XB 3CN3A 3UJJL 5IVOA 2RTTA 4WJKB 2QHLA 4YJZL 4OLYH 1VKXA 1NCNA 4FF9A 3KPPB 3NCBB 3MRHB 2BVOA 3CH1A 2F5AL 1NFAA 4LLMB 4M3HA 1G84A 3DUSA 4XP1L 1DJWA 4LLYA 3VFTB 3WFBH 2B2XH 4JPQA 3QPXH 3QZMA 2QMKA 2ZOLA 4OTXH 4AMKH 3NJVA 3CCHA 5JW3H 2AAAA 3WDHA 3WUWB 3WLWD 1EJFA 4FQXA 5FA4B 4NQEE 5FUCE 3F5WB 3B3IB 4DAGL 3OJDA 4ZAKD 3UG3A 4MYWB 1MXGA 1V3JA 2BP8B 2ZOKA 1MRCH 1Y18B 5EORH 4X6DB 3FCTB 4E0RA 3GSNA 4AENA 4PR5B 5KVGH 4GG6F 5BRZB 1B4TA 4HS6A 3NDYE 3LAFA 4KY1L 4TUJB 1D5MA 4ELME 1AQ8A 4U1HA 1X6LA 3SJVA 2R1WB 4YFLF 1C9SA 3FULA 5KN5A 3RB7A 1IBZA 4KRPB 4AKQA 3BVVA 4OKDA 3HA0A 3AS3A 4K2UH 3RVWC 3W2DL 2YD0A 4MJJA 2RA1A 2HMID 2VLJD 2ZYRA 1U2YA 4L3FA 2Z4QB 2CMRL 5FGRA 3VRJA 3WKML 5EC2A 2EDRA 2ITEA 2WJ5A 3HFFA 3PGCA 3I9GH 4JHWH 4O9HL 4QXTB 4XTRC 3KMDA 1ZLDA 1HE8A 3CLFL 3SE3A 4PJCF 3TURA 2R56H 2YAQA 3WOVA 1BDYA 4Y4KC 1JYXA 4KROC 1IC4H 5DD5L 5HHMB 1S3RA 3I50L 5AB0A 5E2VH 2BOCB 1FFNB 4TN9A 1ANUA 3WAKA 4XNAA 3BSZL 3WMSA 4OD3L 2PW1A 4NM8H 1TTUA 1I3UA 2BP3A 3HE6B 1MPAH 1XZ0B 3BDYH 5AEAA 4FQ1L 2F58H 1F86A 1SFDA 2JKJA 1KC5H 2ID5A 3HC4H 4MNGE 3VFGL 1EO5A 4Z78A 2D7MA 3GEWB 3NCYS 1U2HA 3QDMA 4M61B 1FYTA 2C1OA 2PR4H 3RZCC 1MQKH 3DHUA 2WYTA 3P2DA 2R59A 2YPKA 4MASA 3VXTA 1R34A 4HHAA 2BVUA 2XU9A 1Q1JL 2CA3A 4PP2A 4IEFB 3OKEB 3VAEA 5ANME 1WYJA 2DJMA 2VLRE 4P3CH 4XC1L 4YBQD 1KNOB 1FZJB 5EZOH 1ED3A 2ZX8A 5K69A 2QGDA 2Z31A 4BE5A 1F1GA 3WHXB 2OZNA 2R2HB 2YAHA 4OCRL 5EFIB 3RWDA 2BNQB 1SLWA 3VCLA 2A4ZA 3SDXA 4FQJL 4GT7A 4FA7B 4JFPA 3P30L 5GIRA 2ZXGA 2WXRA 3DSNA 4GXVH 4UOJA 4E41B 4R2GC 2NSXA 4DIXA 2J73A 3PWVB 4PJBF 3ML9A 3EGSA 3LS4H 1SDAB 4L4VB 1N5YH 1E3FA 3QUHA 3I9PA 2K6YA 4LNRB 2FQDA 4O4YL 2D0HA 4GINA 4HT1H 5DRZB 5ALCL 4FYTA 3FQXB 2W8CA 5LCVL 1J5HA 2Z6FA 3U6RA 5TDNA 4LCWB 4A39A 4BSWB 3CE1A 2EEDA 2BY0A 3L9YA 5E8DL 3ECWA 1JPGB 4U33A 5L4FA 2LOEA 2DIJA 3UTSB 1QTPA 4R5VA 4DP1X 2PN5A 4XNBA 4ZS6D 5JIIA 4RETB 3JZ7A 4F15B 1SF3A 3NSXA 2GITA 4I48B 1OVZA 4JQIL 4LESA 4MMYB 4N2EA 5H94A 4L4TD 2B08A 4DZ8A 4FZ8L 1AS8A 2YMTA 4ZUVA 3W3BA 4YSTA 3RJQB 4WFHD 1FSKC 4QRUB 1XEDA 5K9QI 2XHNA 4KKRA 5AVWB 4F58L 5DHXB 3P11H 4YSUA 4F37F 1A22B 4JFFB 3B6SA 4P57A 5AZ2L 5EN2A 5T3XE 3D6GA 5A40E 1FG2B 4NPYB 1J9QA 4ALAL 1H8SA 3HI6H 5LKNA 3RL2A 5I1AB 3AAZB 4A68A 4JREB 1T04B 3ISYA 4WWPA 1N4XL 3CSTA 5FEBA 2NPLX 2BWQA 2AQNA 4UU9A 4U7MA 3IDUA 2O5YL 3K74B 4M3JA 5CEZL 2MHAB 1KXTB 3U1SH 1RD6A 4CBZA 2JK5B 2DPKA 3BHBA 4RA0C 3RUGE 4AYMC 4QNPE 3FZUD 1D5ZB 2FBRA 3CH8A 4KHXH 2ZJSL 3E6HB 3TN0A 4DK5A 3GIVA 3V6FB 5FM8A 2J20A 1BVNP 3AZUA 3VMOA 5EBGA 2E7DA 4JN1L 4ZSOB 3EGXB 3ME0B 5GZNC 5D96C 3IWUA 1SQMA 1VADB 2DI9A 3FCUB 4E9VA 1E6JH 5EMYA 5JR1H 1IZJA 4F20A 3RTQA 5LUMA 3QUZB 4N6QA 2E7LA 3O3AB 3IDYC 4X7DC 5A43C 4I5BB 4IOIA 1WS7A 2IQ9H 4LP5A 3U7WH 2C9SA 4PJ7B 1INDH 3GS0A 4Y4FB 1TYRA 3VI3F 1ASPA 4KO7A 3R8BB 4K71C 1GIGH 3ESOA 3MUY1 4WI4A 2OMXA 1QABA 3M46A 5EG6C 2HWZH 1H9VA 4I0PA 5LQBH 4RX4A 4DP5X 1RZIB 4UZUA 2X28A 4MD4B 1C12B 1G9NC 4NUMA 3NIFB 2CWRA 3R1GL 2NZ1A 1OAQL 1WH0A 3GTVA 1CICC 1NFIA 1PZ5B 2GK0A 1CN4A 3V5DB 5CD5C 3LIZH 4KX8A 3STZB 5H4ZA 3GNML 5HI4D 4JAMA 2WBXA 1F02I 1LL1A 1HZHL 5B1AB 3HNTH 1ETB1 3DJTA 4LFHD 1XBDA 4PRAB 1JGVH 3QC6X 3SDCA 1PZCA 1IEHA 3OD3A 2O5ZH 2APWA 2QDWA 2QPUA 4HEME 4P2OD 1NDTA 1W72H 3PWLB 4GUPA 4M7KL 3TIDA 2V2XB 3P0GB 1DVQA 5ISZD 1MFCL 3KPSB 4F92B 3F65A 2X0VA 4QRPE 1P6FA 1U8KA 4HK0B 5L2KE 2PCXA 4E9SA 1A7OL 2EYRB 2MRYA 1M7IB 1JTOA 2A6IA 3OGCB 4HUXA 2QQNL 1KYUA 2I26N 4X99B 2MFNA 4OM0H 2YUXA 1YEDA 4MB3A 4UIKL 2PO6C 5BZZA 3W0WE 4LSTL 3BWAA 1CDGA 1HC1A 5JIQA 4UV7L 2VISB 2DDQL 2DLEA 3ECQA 4UV4H 1T22B 4XC3L 1I3RA 2OYPA 3MRMA 3AACA 2O61B 5GS1B 1QFUL 5AW3B 3RURA 4N0FA 5B4MC 3FH8A 1RERA 3O41B 2A74A 1LWHA 1QBML 2X6AA 5CSZB 4UT6H 5F7MC 3ORJA 2YOAA 1OP4A 3G08A 4HQQL 1KENH 1RJZA 4AITA 5EEVA 3GEFA 4ODBD 5KJRH 1OAXL 4H0LC 3NP4A 3VACA 3NP3A 3EOBB 1ZT1B 2ZXBA 3MRIB 3BZ4A 1J8HB 4N0YH 4BH7A 1E2WA 4A6YL 4YDJA 4UF7C 5E23A 2ZXAA 4Z7WF 2P5EA 4UBDC 2FDBP 1J0JA 4PLJD 4QCIB 3AY4A 3DX7A 4WW2C 4Z23A 2BRRL 5L4MA 5LLIC 2ZPKL 2O6PA 1BMGA 5EIIA 2VJ8A 5C2BH 2J2ZB 2WINB 1NC4B 4N2IA 4LKXA 4GRWH 1C8PA 2ICEA 3L5HA 5B3SB 5GISL 1N6UA 1BZ7A 1JGEB 2GI7A 4MYPA 1LVEA 2UUDK 4JY5H 5B1BB 5I2IA 3D2UD 1OD7A 2LGNA 4UOQA 4OZHA 1VEOA 2IAMC 3MREA 4JDTH 5FYLL 3TT1L 3QYCA 2Y24A 1HILB 3QQ3B 4ZQKA 1K6QH 4J1UB 5BMFH 2GKIA 1I3GH 1KEGH 2BNRA 3GSWA 4WSJA 4CL7A 1BFOB 2EC9T 3WO3B 3JV0A 4XE5B 4XZ4A 2Z8SA 2TSBA 1R3LB 5EH1A 3T0EE 2M26A 1WFUA 4LPVA 4KVNH 2UX6A 4NO3A 4PJGE 1XF1A 3O2DL 1IKOP 2I24N 2IOIA 1YNLH 3K6SA 4DFHA 3LQAC 3PHOB 2BZ7A 1EEUA 4N85A 4ABUA 1WZ1H 2BINA 4HJUA 5C08B 5I30H 1EEZB 2CLRB 3K81A 5E6YA 4X4YB 1HINL 1KTLA 5D1ZC 2BS71 1A6AA 2Y7SA 2GEEA 2YARA 2YD7A 2RGSA 2GC7C 5JMOC 4CU7A 1K8IB 3C6SB 1MFVA 4GAGH 4Z8FL 4JFYA 5IVZB 2DKMA 3LS5L 3U83A 1HL4A 1KBPA 4PRPB 5CJQL 2EXTA 4PJIF 1TPXB 2RQEA 2KZBA 2KQNA 1RV6X 3OJVC 4XX5A 4YLCA 1DQLH 5HHOE 3QWQB 1AO7A 4PJAF 2FUTA 4LL1A 5TDOA 5HYSG 4FNTA 4RFNC 4LBEA 3V0FA 2FZ3A 2G4EA 3IFNH 5C0AB 1MRFL 3MRGA 3M1BB 4PBVC 4WTXA 1I7TB 1OANA 3QNYA 4IOFD 4LZKA 5KSUA 3ZKSD 5EF0A 3T3MB 3TF7C 1RMFH 5JIDA 4WUUB 4L8DA 2VM3A 1URIA 3HKFA 3ZMEA 5IV2A 3DX3A 3M7FB 4XCYA 4Y4HC 1JK8B 4YNYA 3ZL2A 3LKPB 5KBPA 4XRCB 4LPTA 5H2BB 3CSPA 2IJ0C 2V5SA 1RK0A 4PWHA 1GTNA 1T4KA 1A14L 1N18A 3I2CH 4OIIL 1SJXA 3VJ6A 4XOEA 1OAKL 4MX7A 5ESQB 2XFXB 4B3VA 4F7TA 1BIIA 2DM7A 3DMMB 4P5MA 3HN5A 3CAFA 1N9PA 5CP7A 4NO5B 4NQVB 1PU0A 1RJLB 2BDNH 1G5AA 2DQDL 3L3HB 4JKLA 2VN7A 4X6DE 5KYYB 2MCG1 4FXGC 4WKXA 3DOHA 1M53A 4UQ9A 2W9LA 3MI6A 3GXDA 1I9IL 5D5MA 3WIFA 3U46A 1LNUA 3E8VA 3ARQA 1CE6A 3LRHA 1CDIA 3PG2A 4MXVE 2DW5A 1BX2A 4AYGA 1P5VB 2P48B 4TNVF 3CXDL 4PMFA 1FCGA 5GRUH 3DSFL 3DJ9A 3LZOA 4ONHB 3NJJA 2IC2A 4GP4B 1KIPB 1MG2C 4KNUA 2QPEB 3T4YB 1L9PA 5EZIH 3CZKA 4PJEF 5BQDA 2M8XA 4NHCL 2BSTA 4PRNA 2G2NA 1NEUA 1JHKH 3GBML 3WUWG 5BW7A 3QP3A 5HHME 1ETJA 5L4JA 4KDTA 5FF6B 2BXZA 4R7XA 2Z0BA 4DERA 4X8JA 1MUJA 3BRFA 4MKMA 1U6AL 4S1RL 5BS0A 1CG9B 1O6SB 3IT8D 2K70A 5I18H 4H2CA 5JOFB 3MU3A 1CFBA 1CTMA 3OKDA 1ASOA 4XP9H 3D0LA 1KXVA 3GKWL 4IRJD 2X9XA 1H8NA 1LO3L 2XXGA 1BXVA 3HAEH 4DKEH 4LP8A 4O51B 3EXLA 3I02A 1KULA 3X11A 4NENA 1NUFA 4PJHA 4F8TA 3I85A 4HIXL 5FOBB 1N68A 5FGCB 3G5ZA 1KWGA 5BUGA 5C0FB 3FO0L 3MNMA 5MEQA 3MHZA 1BXXA 3MXVL 3IF1A 4PB9L 4N2FA 2GJZA 3CMOH 2ZUSA 3D06A 3TJEL 2X70B 3VFWB 2YPLD 4NC1C 2HYMA 4NDMB 4NZJA 1URZA 3QXWA 3WO4B 3QUYB 2EH7L 5DDHA 2BNQE 3SPVB 2IH3B 2X4PA 3TLRA 4AIXA 5EUKA 1GCFA 1NDMA 1C1EH 3N43F 4UT7L 1UYWH 2CNZA 2DIAA 3ALWA 3BC9A 1VKXB 4E41E 3HPJA 4TQHA 1E50A 4JHBA 4WEBL 1TO5A 3HZYB 5JIHA 4LL4A 3HTLX 2BVOB 2R83A 1GXEA 3GRGA 5FYKD 2BIPA 3UAJC 3DUSB 3AUVA 2WXIA 4LLYB 1YYMH 1NCOA 3IKKA 5EU6A 2WCPA 3G5XB 4HALA 4WTZG 5SWSA 3SDAD 3SQOL 2VE6A 1PG7X 3S37H 2LFEA 3IFPA 3CCHB 1CC3A 3T71A 3V6BR 3BGFC 3IDMB 3ZKQD 3DHJA 4WWKA 4LCWE 1CDUA 4BZ2H 5IGXH 2ZCLH 1R0AL 4WEEA 1WTLA 4KITB 1LK3H 1MDAA 3ROOB 5D8JL 3TIEB 1RHFA 3UTSE 2F7IA 2XYBA 4LEXL 5CP3A 2ZOKB 5C0IB 3ARED 1YDPA 1BF8A 4E0RB 3F58H 2Y22A 4AJWA 3W1ZA 4AENB 2GBAA 3L1OH 5C0JB 4HS6B 5LAXA 2IDTA 3BAEH 4OFKA 4U1HB 5IJKA 1E5CA 1A4CA 5F0LB 3SJVB 3RIAF 6FABL 5HHVH 4NWTH 4G8GD 4OLWL 4HWUA 4JFFE 2YZ1A 5I1DA 4I87A 2JI3A 4WFFD 5D71L 3U2SA 2EDOA 4BFNA 4BKLA 4S1DC 4D2NA 4HMEA 1K3ZA 5DR5H 5JHAA 4KQ4L 4MA8H 1BSIA 3IGKA 1OY3B 5JUEL 2ETWA 1I85A 3VRJB 4R4FL 2F0CA 3BN9D 3ELAT 4KVCH 5EC2B 2XN2A 4TOYL 3CHXA 3PGCB 3U4AA 1NLDH 1XF2B 3S36L 5DSCA 1NIEA 1A4JA 3EJZC 1YY9C 4TULH 1FDLH 5AVVB 4WSKA 3I3BA 3WKQA 1ID2A 3SYQA 5J13B 2EJ1A 4R5TA 4P5TD 1T1ZA 1V7NH 2EUVA 4I8DA 3GT6A 1ND0B 1F0LA 2X6UA 3DJSA 4AYFA 1BD2A 1WFMA 3UIZA 5AZUA 3FB8A 1UA7A 2BERA 3FUMA 4FA6A 4RGNB 3TASA 4ZSOE 1JXJA 4RWHA 3QJSB 2WO4A 3QUMH 4Z78B 1FYTB 4QXUH 1YEIH 2MPAL 1P4BL 2YPKB 3VXTB 4XH2B 3O3DA 3UTPE 4C4BA 1FF5A 3V4PL 4FXLA 3QNZA 4HHAB 4FFVD 4QRAA 2AQ1A 2F53A 4E36A 1AANA 3CHSA 4PP2B 4ZOBA 1NGYA 5FM5O 4PJ7E 1QZ1A 4FFYL 2OK0H 4NT6A 2X6MA 5E00A 4JO5A 2Y7NA 4UTBH 3CK0L 3H9SD 1QBBA 2BY2A 4MAUH 2Z31B 4OF7A 5BZDA 3EOTL 4XVSL 2B59A 3RGVA 3VCLB 1JNHA 2F54D 2Y6SC 5A2BA 2HT2D 4A2HA 2VXVH 4TLTA 3SDXB 1FFOA 4YLQT 4DKFH 4JFPB 5I8KH 1TG8A 5GIRB 3NIFE 3DSNB 4OLZL 3ZQXA 5ITFB 3L3IA 2E56A 3BWSA 1CXHA 3LCYA 3TT3H 5C0GB 5J5EA 4Z0XA 3QHFH 2OCFD 4CJ1A 1EDYA 3VRLE 3BAIA 3S8FB 1E42A 4CGUB 3QIBC 1HI6A 3ZIYA 4Q6KA 3HR6A 2QVTA 4L23A 2D3VA 3ZRCC 4YDLB 3O6ML 5CILH 2FO1A 1R3JA 2YK1H 3E3QE 2GJPA 3OR7B 4XPGL 5TDNB 4H40A 5GGTL 2WQUA 3QQ4A 1WWAX 2PPDA 5FCUH 3NFSH 4Q0XH 4LK4A 3RIFF 1XCTA 3JV6A 3KPSE 4ZFFA 1SEBA 3LEVH 4U1MA 2BHUA 2BO0A 1A0QH 3IE4A 4XNZB 5DJAB 3T0AA 1EDQA 3Q9PA 1KGCD 2GITB 3QDGA 4JDVA 5H94B 3X17A 5IJVA 4QY8A 5ADPL 4Z7QF 3WGUB 5D55A 4ZUVB 1DJSA 4K9EL 1OT1A 5IBUB 2EDQA 5KS9B 1IC5H 5BVPL 4LGSB 4C4UA 2PLTA 2WXFA 3V6OA 1ERNA 2FAUA 3B6SB 4MLSA 4P57B 4BZ2A 2B4CH 4RFOH 3MA9H 6TAAA 1PEWA 4EAEA 2HUHA 4YZFF 1ZTXE 5B39B 1FFQA 4P9HL 2FHBA 3CZEA 5DUML 2VZ1A 2X05A 4UU9B 4S11A 2P24A 3D0AA 2E76C 2ICWJ 3D69A 3VFNA 3VXMD 3DRQA 3MRLA 1FL5B 3MAWA 3BOVA 5IB4A 3SDDD 2HVBA 4GAJH 3U4KA 3KGUA 2XA8L 2AV1B 2IQAA 2WPGA 5AOKA 1OALA 3VD0A 4YHLL 2G5BA 3GIVB 3QI9C 1CDCA 3STBA 3JWNE 5CO1A 1BZ9B 4F57H 5HGDA 2RCSH 3UTOA 1MELA 4D0BA 2A77L 3RU8L 1AGDA 3QORC 2DQTH 2AAVA 2V3EA 3ARTA 3FNKA 3VGBA 2QGEA 3K8MA 5ICYA 2IBBA 3M7OA 1DJGA 4MMXC 3CDZA 5FFLA 3P3UA 2HRPH 1CI5A 2XTSA 4JY4A 1RIVH 3N0AA 3AMKA 2UVEA 3FH5A 4RRPM 4MKTA 4QHLA 3VH8A 4FL4B 4JMXA 3HZMA 4FLOA 3FC8A 4UMGA 2WLYA 1KTBA 1S7TA 4HX1A 1M2VB 2KI6A 3R7QA 2A1WH 4X0KB 2OMXB 1YMHB 4G7VL 3HE7D 4BJLA 3TFKC 5GRVK 3WJJC 4AIZB 2YR3A 3H3BC 5FYJL 2KLTA 1IQDA 4WV1A 1KTCA 4KV5F 3QUMA 1UQSB 1ZV9A 2IBGA 4JO3H 5AWNL 4NI3A 4MNHB 1NFIB 4P2RA 5FYKL 2GK0B 3U9PH 3QRBA 4OJCA 4Q6IB 5I1CL 3JWNG 3TVMA 4BUHA 5KJ4A 4WTQA 4G6ML 1HNYA 1C8QA 2Z3FA 3QR0A 4MAYD 3VB9A 3AGVA 2CHDA 1VHPA 3NA4A 4JJOA 3MV11 3SDCB 1TKWA 3WNLA 3I3DA 3ATBA 4B9FA 5DD3H 4L29A 4PRPE 4PWEA 3TIDB 3BXNB 3JV5A 5MP6H 3VFSA 1EGJL 3B8SA 1EMTH 1PX4A 1KFGA 3CX5K 2K7PA 4KXZI 4D9LL 4FMKA 1KIUA 2DB8A 2R69H 3HB3C 4EEEA 5I5MA 4HUXB 1OE1A 4RISH 5C0AE 1S7UB 1YEDB 5ADOH 2CBTA 43C9A 1WO2A 3SDYL 3JV4A 4LLVA 4A2GA 3T3ME 3I6GB 3WEXA 3MRMB 4TPRH 5CJBA 1I8IA 4PCKA 4NB7A 3TNMA 4XBGA 2JSFA 1MI5E 3NCFB 4MS6A 5T5FA 1TFPA 2UV3A 3HMWL 2CO2A 1L6PA 3UYOD 4IK7A 3B9AA 4YHYB 5E7BA 1VFUA 3P9LB 3G08B 2X9WA 4GBXC 3TCXA 5K1NA 4P23D 1UH4A 3RPIA 3WFCH 1WISA 2KPNA 3WN5B 4CAGA 3BZ4B 3OZLA 3S35H 4BH7B 2QR0A 1QFWM 7TAAA 5E1IA 2NLJA 1UD6A 5GGRB 2G3ZA 3TWCH 3L4ZA 3LJ3A 3VW3H 3GJFA 3DX7B 1Q38A 4GIOA 3HMXH 2ADGB 3B2DC 3IJEA 3MUGB 3NA9L 3GRWH 3WDIA 3VDAA 2BY3A 2BZDA 2WVSA 2WNWA 4LKXB 5ILTH 2CE6A 3MFFA 2ICEB 4POUB 1D6VL 3CHRA 5I9QC 4Y2DC 1BZ7B 2E5EA 2IOMA 5E03A 5ISZB 3MLTA 3Q0HA 4OZHB 4DP8X 3TEUA 4ZQKB 4JM2D 1QBLH 3RWJA 3UPAA 2BNRB 3GSWB 2VDPH 5EOTA 1ZEAH 5MEOA 3CQPA 4R97C 4AGPA 4JNXA 1XGYL 1RZ7H 3O4OC 5ABAA 4NO3B 2P4AB 1ZVSA 1DO5A 1MHPL 2AJYH 4JQXA 2A9NL 3K6SB 3ASNB 5E0QA 4WI5A 3SQBA 1F18A 1MCPH 3VDCA 4E5XA 1TTAA 3VD4A 3HBPA 2I5YL 4DN4L 2ZKMX 1KTLB 5GGSB 1BOGA 1UXWA 2NY1C 1YEJL 3US1A 4JBSA 3VXSA 2FT6A 4KJQD 4QXGL 1V7MH 2JB6A 5ID1A 5A1AA 3TYGH 1A6VL 4HUKB 4LHUD 4Z77B 4JFYB 4ZW7A 3ARFD 4GRLC 4LOFA 4MJ5B 5FGCE 3Q5YA 1P7QA 4GAFB 4WCYL 1ROCA 3LD8B 4ZMLA 4YGVA 3PPSA 5KJ7E 2W07A 5EU3A 2ENJA 1HE7A 5B38A 3SPGA 2X87A 4XMXA 3H7BA 2Z64C 3EYUL 4A7UA 3GSXB 5TDOB 5JOPE 1SZNA 1YY8A 2BSBA 1JNNL 3MLYH 4LBEB 4PJ8A 3QXVA 4YVUA 4FTVA 4HC1A 2FZ3B 5C0ND 4H4NA 5C09D 1SHXA 2F5AH 1CGTA 1WBYB 3AM8C 5KSUB 3CFEB 4GIPD 3CFKA 3FO2A 4OI8A 5IV2B 2AERT 1NBVL 3F01A 4NM4H 5DQJA 4BWWA 4XCYB 1LDSA 4BUQA 4LASH 4DAGH 4EI5A 1S7QA 1DFBL 1RK0B 5I6NA 1J0IA 4YL4A 2DTSA 1ORSA 4YHOH 3OKLA 2P80A 2Y7QA 1T4KB 4ZYKA 3L3OC 5A3ID 1FIGL 1NMAL 5F70A 5I17A 3VJ6B 3NCJH 4ODTH 4MX7B 4F7TB 2VXTL 3FFOA 1F00I 3DX0A 3S2AA 4I0KA 4P5MB 4K3HA 4AUYA 3PNRB 43CAA 3PWJA 1KTJA 4HUCA 3WXVH 3CFTA 4XGZB 2WWMD 1OHQA 2G60L 1S5IL 2R23A 5CIPH 4CVXA 5KVEL 2OJZL 5D2LF 5D5MB 2XTJC 3W2DH 3WIFB 1KJMA 1LNUB 1TTRA 3U46B 1HWGB 1CE6B 2G75A 2CMRH 1RFDL 1BX2B 4GAYA 3Q8FA 2YLHA 3CLFH 3H1ZA 5DCCA 1BYNA 4V11A 1H3PH 1WF5A 4QTHA 5DD5H 2YLKA 3FS9A 1L9MA 2WYZA 1I8KA 5DA4A 2BSTB 1SF5A 4P2QD 1GGBL 4PRNB 4L3ED 1HYSC 2QADB 2UXVA 4XVTL 4FQ1H 4WI9A 1IAIM 1Z7JA 3HMXA 3RVXC 4A2DA 3GRWA 2WB1A 2IO5A 1K5NB 1MUJB 2F8OA 4PUBL 4X8JB 4RMQA 3UEQA 3ZL1A 4PGZA 3VFGH 5MHSE 3AS2A 5J9PB 5BS0B 3KE0A 5C1MB 2WGXA 3PWPD 1XF3A 2F18A 3U48A 3OKDB 4AMXA 2J6EL 3S3JA 1B2WH 1O5PA 1E4JA 4LVOB 1INQB 4HXBH 1LLAA 1VFBA 4IBQA 1OTUC 4GO8A 2CKBL 3RY5A 2EVFA 4ZX5A 3I02B 1VAHA 3X11B 5JIPA 2OZ4H 3U82B 1J86A 3ARGC 1I8MA 3P0VL 4U3XA 4UMSA 1A8JH 4OCRH 5MEQB 1KCVH 1DQTA 4FQJH 2GJZB 3LKNA 3QZNA 4FG2A 4JJHA 2B5IC 1G7JB 3V8OA 1MH5A 1SPDA 3BPNB 3IFLL 1EJ8A 2CGZA 5EBLB 4CDHA 4ZFOA 4QHUB 5DDHB 1NAML 5DJCA 2OX5A 4PY8J 3ARZA 3TTSA 5EUKB 1NDMB 5F6HI 1B4JH 2E4FA 4G59C 5I5JA 5DEFA 2YRBA 3CV5A 1X7SA 3HPJB 5ALCH 4MGXA 1XAKA 1G9NL 5KVFE 2TAAA 3RTLA 3KLSA 5LCVH 2W5PA 1A7PL 5E8DH 5BO1L 2A38A 4H5SA 5F7AA 5SWSB 2BW4A 3NJIA 2IXQA 3IFPB 3NCCB 1SN2A 1T5XA 4ONGL 3QZWG 1NFKA 2HKFL 3REVA 4AGLA 3VXNB 1YNTF 3X12A 3TH4T 4APQC 5CLXA 1LO0H 1WEJL 5L6YH 4YDMA 4FZ8H 4TF4A 3TEWA 1VENA 2NTFA 3NUKA 1T2QH 3D12B 4R4ND 3L7EA 5DUBA 1DVSA 4MXQC 5AZ2H 3HIZA 3CFDA 4JZNB 3DO7A 4HZAA 2D4DA 4OBSA 2OYMA 1WWWX 3IJ7A 4YC2C 2BVYA 4F5CA 1OSPL 1XF5B 3MBWA 5FK9A 3P73B 5KS9E 1SLUA 2PXYD 4BV1A 4WY7H 5FLVA 3T3PB 5I23A 1MCRA 5I1DB 4WU7B 2ICWA 3D8MA 1F4AA 3P40A 3L7FB 4BKLB 5DFVC 3U2SB 2O5YH 1NBZA 2N3JA 3NFNA 1JGIA 4LSDA 4OFYD 2CPUA 4IKNA 2WBKA 5CEZH 1CLYH 2XQYA 1R24A 2R1XA 3PGDA 1LD9A 1E2VA 4GQZA 3K4ZA 3KWXA 5DSCB 3RKPA 1A4JB 2ZJSH 3N2JA 4ZZKA 5CSGA 1QHPA 2AMGA 3BRDA 4KK5C 5SWQA 1D6EA 3DHPA 2KZ1B 2A0LC 4TUUA 1HXMA 1FNFA 2FHFA 2XBZA 4WW1B 4ADGA 1JF6A 2BSED 3RWCA 3DV6A 3U0TA 1O9VA 2BRQA 4AYFB 1EDHA 4IGBA 5HPMA 3KLHC 1G4RA 1M05A 1WAPA 4M6OH 4UTCA 4LVNC 2BIHA 3H42L 2V17L 1B3JA 3BSZA 4YSCA 1R17A 4YSAA 1COBA 5D7LD 1LDPH 2NR6D 5K9KA 1HEJC 4ZXBA 4RDBA 4CSTA 3SHSA 3KPMA 1AS7A 3O3DB 3UEZA 3OAUL 3CU1A 3HR5A 1CL7I 4LSUL 3QNZB 4QHKI 5IUSA 5LGKA 2F53B 1BFVH 2AK4A 3EDJA 3LY6A 5LDUA 4KI5F 1SXNA 3AREB 1NGYB 3SBRA 5B39G 1SGKA 1HK6A 5HGBA 2Y5EA 5IY5B 4HIJA 2F1AA 3LHAA 1U8LB 4G83A 4MA1C 3MC0A 2DRUA 4HEPA 4BHUI 5L2JB 5TJWK 1A6PA 1IZKA 3R1GH 4EMZA 3LNDA 3V4VL 3RGVB 2B59B 2JTDA 3GNMH 2EDLA 3TYFA 4KKPA 1JD7A 2AEQL 1TJGL 4OZGF 3FUJA 1EO8H 3WNNA 2J5LC 2P8LA 4ZMTA 1YC8A 2BWIA 1GOFA 3D18A 3NN8A 3I75B 3PCYA 4FQHB 4JFZL 4K94H 4IBYA 3UADA 5D2NC 3LQAL 4NGHH 4CNIB 4Z0XB 5AVQB 4UB0L 4BCZA 4PD4K 3QG6A 5GGQL 1HI6B 4JB9L 3QIUD 3MBXH 1MFCH 3EH5B 1UB5A 1DUZA 1BG9A 3NT0A 3PLYA 2QSTA 5KBMA 1AGEA 1F4XL 4KK6D 4BQ6A 4DESA 2WXJA 3OMIB 4IIQA 4RMVA 1XGRB 2UWEF 3B2UC 3IGAA 4Z0BH 5IZ7A 3QQ4B 3DPBA 4UIKH 1IAOA 1XCTB 3JV6B 4LSTH 4ZFFB 5KZCB 4UV7H 1NMBL 2DDQH 4G8EA 4ATTA 4M5YH 4XC3H 4OB5H 5LCVA 4XPHL 4JDVB 3QDGB 5IJVB 3C6EA 3QJTB 4QY8B 1QFUH 3C5ZD 4GXUN 4MA7L 1CVRA 4L2LA 5A6IA 4AK2A 1GJUA 4PJ5A 2ZTBA 3Q2VA 3N3EA 2MCMA 4FABH 3BZDA 1FL3A 2MQCA 3BAKA 5HVGB 4HQQH 4JQIA 3K2IA 5F0JB 4NKQB 5TFSH 5TK2A 3ULVE 2X7LA 3PNWA 1UA6L 4Y19A 2OP4H 4ZJ9A 2ZUQC 5GS0D 4HS3A 1JUFA 3F7YA 5D6DC 3D87B 5EA0H 3ZT6A 2P24B 2EVHA 3D05A 3DRQB 4IU3A 3MRLB 5FM5M 4R90L 4R8WL 4TLKA 5BQ7B 3MV7D 4PJCE 5IB4B 3GF8A 4KK8C 4HXAL 1JK9A 4QR7A 4WI3A 2ZPKH 4OLVL 4NKDA 1P4IH 2IQAB 2MNUA 3ZVVA 3H9HA 3W9DB 4QHNA 5KEZA 4PIRF 3AJ7A 3PP4L 5I1JH 1MNUL 5DS1A 5GISH 5HGDB 5G4NA 1XAUA 4H2AA 4D0BB 2DBLH 3MQIA 1AGDB 2CQVA 4XP6L 1B9KA 1A5FH 2JXMA 4HMDA 5C3TA 2HTKD 3CDZB 1HFUA 3V52L 1B4RA 5E2JA 3BJLA 4JY4B 5IF0A 1JBJA 1ZHBB 4FQXC 4GEJA 4X6CA 5AAMC 3UTTD 3VG0L 5ISZE 1EZVY 2NY7L 4S0HA 4KZDL 2Z7YA 3LQZB 1ZHLA 4QHLB 5D7JA 3VH8B 1S4IA 1EUTA 2Y06L 4HX1B 4N5ED 2H3NB 2VYRE 1ZE3C 3CXHK 4UZSA 2LE9A 2UY7A 1S5HA 1J8KA 5I19L 3MZTA 4YBLB 1OHZA 3PAVA 4WUKL 2MOQA 1HINH 4PW9A 4NP9A 1IFHH 4W9LC 4EQ3A 2CSPA 1G9EA 1TEFA 3L95B 2B3RA 1MLBA 4XHJC 1Q1PA 2EYSA 4Z8FH 4MRCA 4OSUL 1UD8A 2F74A 3TVMB 5CJQH 3FCBA 3T0VA 4KUZL 4BGLA 3FQ1A 4NQCD 1RHHA 2KMWA 4GLRH 3I9AA 3KYKL 4GW1A 4XNDA 1TKWB 2HX9A 4J8QA 2HFGH 3WELA 2F5BH 3OC8A 4XXCA 5GRJL 1ZLVK 3BKMH 3WS3A 9PCYA 2O1AA 3VFSB 1MRFH 4U3HA 4MQXD 4KJPC 1IBBA 3F3HA 5EZPA 4LU5H 1XD0A 4X7SH 1BF2A 2KPWA 1KIUB 5GJTH 4N86A 5CFHA 3C6LD 43C9B 1PDKA 5EU4B 5CZXC 1YQVL 3JV4B 4LLVB 5GPRA 1DBKH 3BKYL 5T5NF 4WGWB 5JHMA 4LRNL 3RJOA 4HFWA 1HXKA 3MNWA 3WEXB 2VQ4A 2D03L 4X8GA 4ACPA 4X9YA 4ZZFA 1A14H 1U8NB 2OJEA 1F4YH 4KO5A 3RHWF 5I0ZA 1I8IB 5AKSA 3TNMB 1OAKH 4XBGB 4I89A 1F6FB 1TQCB 4LPWA 3J27A 5D7EA 4P5SA 2GJ6A 3Q6GH 1YPZF 4ZTOL 2QQKL 4FXKB 3AG4B 5DHDA 4PRBA 3BDBA 1O9ZA 3L3GA 2QPFA 3RPIB 3VYNA 2VLJA 3NVQA 2YD5A 3V2AR 2NQCA 4POYA 4X5XA 1I9IH 2E46A 1HCZA 4L1DA 2QR0B 3NCEB 3HNSL 1F42A 2NLJB 2IFGA 4I77H 2YIHA 3PQYA 1XXDC 2XT1B 2ZOUA 1NCBL 1SXCA 4NZUL 1BQLH 1UZ8A 8FABA 3QA3A 3BPLC 2ZNWA 1E9PA 3D33A 4Y1SA 4LSPH 4MAYB 4KTEH 3LKRA 3IJEB 2CXGA 4U4IA 4I3SL 4DPCX 4FMVA 3MJ9H 4B7LA 3LNGA 4A6YA 3MFFB 3VM5A 2VNCA 4UAHA 2LLGA 3LKQB 2VDQL 2JQAA 1ZWIA 1NUDA 4Z9KB 1J9TA 3MLTB 3KWVA 1DQDH 2GHWB 3FT3A 2VDRB 3S5LB 32C2A 3G6AA 1OPGL 4S1RH 2BIQA 2MTPA 3H85A 2ADJA 2BX5A 1RK1A 3CVIL 1UACL 3FUHA 4TTDD 4ZW5A 3OHXA 1MCQA 2HP4A 2WXGA 4G9FD 5FGSA 2AEPL 2ZWKA 1G5GA 1ZVSB 2EXWC 3GKWH 5GRYA 2ORBH 4M9OA 5HJDA 4HD5A 4G8IA 3IJ9A 1TETL 2VDLL 3V4UH 4IJ3C 2FX9L 1QTSA 1BOGB 1UXWB 3L1FA 2E59A 3EJYD 3SE8H 2VQ1B 3TGXA 3FO0H 2YA2A 3VXSB 3O2DA 5INDB 3U4BH 4HIQA 3MXVH 2V9UA 2JB6B 5ID1B 4U1GB 2ZOWA 3QPQC 4I3RH 3AQZA 2Q10A 1P7QB 2GY7B 1ICTA 2V33A 2W07B 2EH7H 4IKKA 4LAQL 4Y1AD 5EU3B 1FLRL 1EVUA 5E1HB 2ENYA 3V0VB