4IBSA

Human p53 core domain with hot spot mutation r273h (form i)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
193
structure length
193
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVHVCACPGRDRRTEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title Structural studies of p53 inactivation by DNA-contact mutations and its rescue by suppressor mutations via alternative protein-DNA interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 43
structure length 193
sequence length 193
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ibsA00
2GEQA 3WTYA 2J21A 3D08A 1H9DA 1E50A 4LOEA 4L0YA 4IBWA 3Q05A 1TSRA 1GZHA 2VUKA 3VD0A 1LJMA 5G4OA 4AGOA 3WTXA 2AC0A 4GUQA 3EXJA 4L18A 1TUPA 1CO1A 4GUOA 3VD1A 2X0WA 2YBGA 4AGLA 2P52A 2X0UA 4IBZA 2XWCA 1KZYA 3IGKA 5G4NA 3Q06A 2WGXA 4AGPA 1EANA 4LO9A 3VD2A 1HJCA 2H1LM 2XWRA 4G82A 3IGLA 4MZIA 3WTUA 2BIMA 2ADYA 4LOFA 5G4MA 2J20A 2J1ZA 4AGMA 2X0VA 2PCXA 5AOJA 4AGNA 5LGYA 1YCSA 4MZRA 2BIQA 2AHIA 1IO4C 2BIOA 1GZHC 2RMNA 3Q01A 3TS8A 2J1XA 3US1A 5KBDA 5AOKA 3WTVA 2ATAA 4XR8C 4AGQA 5AOIA 3WTWA 3EXLA 1HJBC 5A7BA 4L0ZA 1CMOA 3WTSA 2J6WA 5AB9A 4IJTA 5ABAA 2FEJA 2OCJA 2BIPA 1HU8A 3KZ8A 2IOMA 4IBTA 2J1YA 5ECGA 1T4WA 3KMDA 4A63A 1UOLA 4QO1B 2J1WA 5AOLA 3D0AA 5AOMA 3ZMEA 3US0A 2BINA 4HJEA 4KVPA 4IBUA 3D06A 1EAOA 2IOIA 1EAQA 3D07A 4IBSA 2MEJB 4IBYA 4IBQA 5LAPA 5BUAA 3WU1A 3QYNA 3QYMA 2IOOA 3D09A 4IBVA 3WTTA 4G83A 3D05A
chains in the Genus database with same CATH superfamily
4QNPE 3GUFA 3TU6A 2XG5B 3EF7A 3QZNA 4L4TE 1F4HA 1Y18B 2BSTB 3EGSB 4XVSH 5IMKA 5DD1L 4BD4A 4PREB 2ISDA 4JPVL 3GSOB 4KUZH 3V4UL 1N2RB 1YUHA 3M1BA 5CN1A 3ZHKA 2UZIL 4P3CH 4XI5D 4WW2F 2W9EL 4F57L 5D2NB 3VD5A 2VE6A 5C86A 3Q5TA 3SJVD 3S3CB 1TUPA 4M7KH 2X0WA 3M45A 2P52A 3TFKD 2I9TA 4QHUA 3HG0A 3V9EA 4N20A 3VU1A 4OFYA 3RY5A 5CJXA 3QXVA 1MCWM 4PJAF 3AG1B 1SJMA 2GFBA 1RZJC 5LQBH 3WFCH 2C9QA 3NZ8A 4I9WE 4UMSA 4C8XA 1A1OB 1EGJA 1CLYL 1M6OB 3OR6B 2XACC 4L8DB 4QYOB 4FG6C 2IANB 2MHAA 5L2KB 1P7BA 3B83A 3I6GB 1NGPL 2G4GA 4FI8A 3ZTEA 4TNVK 4YDKH 4CW1B 4NHCH 3MRFA 5I76A 2BSCA 1KJ3L 5C07D 5JHMA 4QTIH 4HV8A 5DC4B 1IBGL 3FTGA 2RFXB 2XY1A 5DS1A 3FHAA 2X42A 3AU0A 4XVTL 2AK1L 2OP4H 2DD8H 2FK9A 2H7WA 4P5TB 4WEMB 1DSWA 3IF1B 3FTWA 3O45A 4UQIM 1SN0A 3OKDA 2Y07H 3HRPA 3UDWC 5GRJH 1PDKA 1UJ3C 4TSBL 4GRWB 4LSVL 4TUOB 2WP3T 4CILA 1T22B 2NUPA 3VB8A 2I07A 3ESOA 5CZKA 3PQYD 4NNPL 3RVWD 1Q94B 3SE4C 4JFDE 1OSZB 4G7VL 1O7VA 2FWOB 4BFFA 4H44C 4ZUVA 4X5QA 1ONQA 3TCXA 4JG1L 1DQDL 2HJFA 4L48A 2OCCB 3NZSA 2R39A 5K9QI 2R1WB 5I1JH 4P2CG 5DJ2B 3MR9B 4YVNA 4Z23A 3AC0A 3WFBH 4Q56A 4AMWA 1XXFC 1QO3B 3TT3L 3TJHD 3DRTB 5HJDA 3VXRD 1GY2A 1KBGL 4KTEL 1G6RL 4ZO8A 3TX4A 1NGXA 2PPCA 5MI0C 4OFYD 3G6JE 4PW9A 3T1WA 1RUQL 3MRIB 4CBPA 2L7JA 4JZNB 3QO0A 1V5JA 1X7SA 3BVXA 1HFUA 1U8CA 4GSRA 2UWEF 3QHFH 1I1AC 3RWFB 4WUUB 4PJ8C 2CDFA 4IRZH 1R5IB 2A5UA 4JB9L 4B3EA 3QUMH 4JZOB 3AREA 3K7UA 2NW2A 4KHTL 2PR4L 3P3SA 1BOGA 4AVHA 1OL0A 3H42H 5D8JL 3ULAB 1BYPA 2YQ3A 5SWSE 3NJNA 1IAOB 4NQVA 5K1NA 2NNAA 2Y2WA 2YRBA 4WO0A 4HIJB 2R0LL 1X5IA 3MRBB 1PAZA 3BN9C 3BRFA 5KVGL 4YIQA 4W9DC 3RWEA 3TO2A 1I7RA 3ZDYE 1TITA 3GS4A 4BZYA 1W0WA 4F7TA 1ZDSA 1J86A 1I9EA 2EC8A 3F7QA 3QT2A 3IDUA 4O2FB 5IG7A 2YOCA 1Z9SB 3I9GH 2QSVA 4CC4A 3GFUA 3JVFC 4YDZA 3IJYA 1MXDA 4P3WA 3FMGL 3OJDB 4GMSL 2BM3A 2YD3A 2AVFA 3OGCA 4X4XA 3D25B 3PAVA 2WSPA 5C7ZA 2BOLA 4R7VA 1U8JA 2JQZA 2A83B 1AIZA 4GAGH 4E41D 1G1YA 1UATA 3QS2A 4EZJA 5CD3A 1XGZA 4PJBB 5EULV 3EG9A 4K5NA 5MERB 3MX0A 2EXWC 1T5WA 1TJGL 1YMMA 2WUBL 5F7KC 2VRQA 2ITCB 2XWBB 3V6ZB 1A7NH 2H8PA 2G5BA 2NY7H 4IMLB 1J1OL 3MCKA 2DI9A 2E9BA 5AYUH 2YR3A 3FUJA 2EEFA 2FWUA 2V7HB 1R3LB 1PG7W 2VO5A 2IPTL 1V7NH 3EDFA 4R2GD 4HOWA 4Y8AA 4YX2L 1UD3A 4JANA 1FYTB 4P9HL 1LNUA 2J1XA 3CNKA 3FFOA 1T6BX 1AY1L 2NY6C 4MQ7A 4R6UA 1K2DB 5F96H 4FQQB 4K7FA 1FC2D 5JW5B 3RVXD 1DBBL 3FOMB 3VGDA 5H8DA 4AT6B 2WCSA 2W59A 3BFQG 4OF0A 1YAZA 3ARED 2D3LA 3U30C 1J1XH 5D2NE 4HPHA 4ZZFA 4TYUA 2IJ0C 5A2FA 2AI0H 1L0XA 3IFOA 4Y2OB 1F00I 4S1SL 3MCLL 4Y9FA 1UXWA 4R3SB 4YDVB 1IEHA 4JDZA 3VXPA 4DEUA 2WLLA 5FDWA 4YWGH 3HB3D 4DP9X 2Z1KA 5LNEA 1KGCD 1U58A 2MPAH 4CMHC 4F93B 4NRYA 1GC1H 4GBXB 2NLJA 1KELL 4F2ME 1OTSC 1QFHA 2IANE 3RY4A 3SE6A 1EVTC 3EOBB 4ZFQA 2NY4C 4APQD 2X87A 2A77L 4TMPA 4HCIA 1XO8A 2WWOA 5EU6E 3VRJB 4PRHB 4ACTA 1T0MA 3LQZB 2P44B 1R24B 5CEZL 2ZG1A 4LGSB 4GKNA 5E8EA 5HGAA 1QW9A 3TH3T 3B9KA 3EJUA 1KTLB 3MRLA 3VFRB 2GTZA 4FQXB 3AABA 4MA1C 3U46A 5D1ZA 3PJLA 3QIUD 1X5AA 1UVQB 4CJ1A 3TYGL 2W95A 4NWUL 5D6CB 4ZAKD 2XWTB 3P40A 1GPOL 3BKYH 4B97A 3P3UA 5KN5B 1TFHA 3NAAL 5C0AA 4A2FA 3EBAA 2GJZB 3MJ9L 2CO1A 3OXSA 4KI5D 4B7LA 1JK9B 2EYTA 4HZAA 3VQ1C 5KJRL 2BDNL 3O81A 4GRWE 4M03A 3BZFB 3KPSB 3U1SL 1JUFB 3FCGA 4GMTH 4K7PY 4LASL 2XQYG 5FA3B 1CDCA 1FZJA 4TLTA 2QHLA 1LWJA 2AC0A 4GUQA 1OT1A 3O41A 4GRLA 4K23L 1F18A 1XH3A 1N5AB 3FCBA 4ZQKA 3BH8B 3BP4A 3IBEA 1IAII 1WICA 3P4OA 3U0PA 3GLZA 5T5NF 5H4ZA 4IGBC 1XZWA 2YEZB 2FLBT 1T0PB 4O58L 4FI7A 3CSFA 4PGJA 1FLRL 4QHLA 2DDQH 3C5ZA 3KJ4B 4WI9A 1Z7JA 1SYSA 4YZFF 3KR3L 4N2HA 3C5SA 4ANVA 2GABA 2YD1A 2ZOOA 4RCAA 1RKRA 4PWFA 1A8ZA 4NNYA 5FIEA 5D2LA 4YXKL 5LBSL 2PNDA 2BJML 3CSGA 4LSDA 2ICWJ 3MLVL 3GXTA 3JSSA 4S1DC 1GZHC 2X70A 1G7QA 1SHXA 3KVQA 4PJGB 3X3FL 5SX4H 3HNVL 2ZSVA 3KPRA 3PP4H 2AZUA 5FHBH 5KBDA 4UOZA 1DJSA 1ZVYA 3I74A 5D5MA 4MBOA 5D1ZD 3QWRA 5DZJA 2MWCA 1P7KB 3BSGA 5I16A 3CN3A 1SLXA 1EJFA 2HFFB 2PCPA 3KPQA 3O6FA 2JVUA 1HILA 5ADOL 2X4PA 2UZXA 4WVRA 2R2EB 1KB5H 4JRXD 4J3OC 4XMPH 1PG7H 2ESVA 4KUCD 2ENJA 3SKNA 3L3GA 4I77L 1CFMA 1HQ4A 5JXEA 1CYWA 1FA4A 1IGYA 1HINH 2C3GA 2EDOA 4NFCA 1NFIA 2X40A 3GSQB 1XD1A 2AXFB 5I5IA 4XPHH 2FIKA 2JI2A 3LD8B 3FT2A 4FOMA 3K8MA 3ECBB 3OLEA 4JQXC 1G6RB 2PYEA 4LBAA 1MREH 1QSFD 4PJBE 4CKQA 3W0WA 4L1DA 4C4UA 3EYVA 1FIGL 2QVIA 2AK4D 2BHYA 4P9ML 5C0JB 4NQCB 1IILE 3TH2T 1KLGA 4B9KC 3BUQA 3MTXA 5I5JA 2WSKA 2ATKA 1W0VB 3QJUB 3VVWA 1EDHA 3TJEH 3C5ZD 4BHUI 4Y88A 5I6NA 1FYTE 1EHXA 5EC1B 3FN0L 3WNLA 2I85A 1JD7A 3QC5X 3UAJA 2H0FA 1JPTL 1FORH 5TDOA 2Z65C 4YHNA 1TLKA 2WC7A 4AYEC 4LF3B 1CE1H 2V6HA 4OI9A 2VWEE 5BXFA 1IQWL 2DB8A 2WPGA 1UB5A 2F8OA 2WYHA 5DMJB 3QUYB 4HWEH 1XL4A 1QFPA 4XNUL 2OFQA 4K94H 4PM1A 3F7VB 5J12C 1LMKA 1OALA 1NCTA 4JGMA 1ASQA 1HQRB 2FL5B 5JIIA 4U0QB 4FKHA 3DGCR 2A4EA 4XMUA 1CDIA 3DSNA 3AROA 2Q6WA 2N7SA 3QRGH 4XBPA 3QEHB 3ARQA 3O6FD 4IDJH 3FBKA 4Q9CA 5KSAD 3GIVA 3UJJL 3TTYA 4PRHE 2PPEA 1I9JH 4JREC 4MD4A 1I8LC 1NGQL 2ESVD 1UB6A 1F4WL 4G3YL 4J28A 4HT1H 4KKRA 3N41F 3NJJA 3UROR 2VOTA 4DGUA 4PRPB 1OTUC 2R0WH 2OL3A 3LHPH 4YDNA 4ZOBA 4Z7NB 3Q2WA 2DBLL 4TLKA 5FOJA 4HC1A 4HJJL 4D9LL 3TEWA 3BXNB 4PJIF 5ICYB 2Y9RT 4KRNA 3WHE1 3IFPB 4KPHH 3BIAX 4HEMA 5T1LA 2ZSWA 3EFDH 2R69L 2AEIT 2TRHA 3T77B 2DH2A 2DZEA 2Q87A 2JIXB 4IKIA 2Y4SA 3KYAA 1UD6A 3KPSE 3MLPA 4V2CB 1JWSA 2Z3FA 5DMIH 5EU6A 5IM7B 5K1JA 1ZLSL 1KB3A 4AQ1C 1J1PH 2G0LA 1JTTA 1MQ8A 2CBQA 3RAJL 5I17B 3ABLB 3NCJH 2DLFL 2UZYA 2EDYA 4AE1A 1YRKA 3L95A 4L05A 3GI9L 4BE6A 1S7QA 3GJEA 4FFVD 2HN7A 3D33A 4PR5A 3VXSB 2QZQA 4NQDA 3FFCA 3DK2A 1NEPA 3OQ3B 2YIHA 4M3HA 4YR6B 4IRSD 3TV3L 5K69A 4XXCC 4O00A 1WFUA 4JM2F 4LVOC 2ZUUA 3ZRSA 5FK9A 4M5YH 3OAUH 3LN9A 4NO2A 5CGYD 5I6XB 3HAEA 2YBRB 2FB4L 4HSQA 5GSVA 1SJHB 2WVSA 1TG8A 4BA0A 1QW8A 3WJJA 4RBPK 1MCHA 4PWGA 1I7TB 1FCCA 1NUFA 4TRPH 2LT9A 4YHKL 3GMNB 1MQKH 3WTTA 3SCMA 3BWSA 2EO1A 1TJIL 3L54A 4PJGE 4PSRA 2Q86A 3MNVB 5IB3B 4PJEE 1WBYB 5KUMA 1HNYA 1ZEAL 4ZDHA 3MYZA 5JOFA 2WWMD 1G87A 2KKQA 1F45A 5IJVA 4K7PL 4QXTB 5EEWA 3ARGB 1EGJH 3F58H 2RQ8A 3VG9B 1A7OH 4OUOA 4JPWH 2OSXA 3S5LG 1NKGA 3A67L 4PLOB 4OIBA 5A1AA 2UYLA 4HKBA 1S3KH 3TVMB 4DWHA 1DE4A 4X0KB 3LNIA 3UGXA 5ICZA 3SGJC 1LE9A 3NP3A 1S9VA 4MJ5B 2MOGA 4NO0A 4QRAA 4DVBA 2PPAA 1XGQB 5E8NB 5KYWB 1JF1B 1K4DB 2EIMB 1I8IA 2GIMA 1RU9L 1YQVH 5DWUL 3T3PB 1EWHA 4LLDB 4YHPA 3TT1H 1JZDC 3WDIA 2J88L 4HH9A 1MEXH 2W88A 4NENB 3II2A 1YEDB 3LH8A 1PTZA 1MLCA 1WZKA 3JUYA 3MRGA 1MPAL 1CZ8L 3HCVB 3B2UD 3F6JA 4KNUA 4ZMYA 1G7PA 1TZOA 2AV1B 3GTTA 3WMSA 4NQCE 4PJCF 4X6CA 4ZOCA 5J11B 4MZ3A 2VW4A 4JFYA 3P9MB 3BKMH 4FQJL 2XA8L 1IM9B 4R4ND 1JZGA 5D7IB 4W9FC 2FR4B 2WN3A 1OARH 4LCIL 5A2BA 1OTTD 3KH3A 2Q0ZX 4LNRA 3QO1A 3JWDH 3WHXA 3K2UL 3TN0A 4BQ8A 1U95A 4KKPA 3N06B 2DLEA 3GMOB 3SDCB 3QEUB 2C9RA 3PAYA 5EOTA 1I85A 2FWSA 4TQIA 3BHBA 4BRVA 1GGCH 3O8XA 5I1LB 2NQCA 3TA3C 3ZKXB 5GQBA 3QULA 1FZOA 2X4TA 2VXVL 4HWUA 1FG2A 3BP5A 5L0QB 1T66C 2MNJB 3C08H 2J2ZB 2WNWA 3SKJL 4HS8L 4O2CB 4HJUA 1TFPA 3UTQA 3I9IA 4MB5A 2FGZA 2X4RA 2QR0B 2ZYRA 5HGBB 5F7EH 2ZUTA 2CAKA 4QRSB 4YC2C 4MDRA 4D8OA 3KDMB 4QGTA 4V2BA 3CSYA 4YPGB 5E5RB 3PJNA 5E56A 5FUCC 2AMGA 4OD1H 4AYSA 4JJ5B 3TBVA 3P77B 1OE3A 4KDVA 4R5VA 5KEZA 3HRZC 3HJ0A 1SVBA 4UM8B 4PRBB 2IPKB 3E0GA 4W93A 5AB1A 4LLUA 4NO0D 1BJ1H 3S37X 1MNUL 2E7DA 3TWYA 4XCNA 3D1MC 4PRPE 1B90A 4Z7NE 3QYNA 2Q8AH 5L7XL 1FN4B 3EADA 2R1YB 4WK0B 3ZL4L 4C59B 1U4EA 2HFEB 3QPQD 4O02A 5EIQA 3H9HA 4DW2L 2I5YH 3BVNA 4FZEH 3VSQA 4LCUA 1LP9E 4TXVB 2JLPA 4OFQA 5FYKD 4GAJH 1FZKB 1AC0A 3ESPA 4UQ2A 4D0BA 1IEAB 2R29A 3LEVL 3IDNA 4OR1A 3OKLA 3P4MA 2EDKA 1OP5K 4ENED 1HEJC 3JV4A 5G55A 4YDIH 1MI5B 5HYJE 1NPJA 2HVJA 2ED8A 5CP3A 3ZOAA 3TTSA 4MNGA 3ES6A 1NAML 1QKZL 3VXSE 1OF0A 4L4JA 4JN1L 3WNPA 3F05A 3NFNA 5E2WH 1F3JA 4NO3A 5FUOH 1LO2L 4X9YA 1MCOH 1KTJA 1A47A 1SF5A 4DNLA 1IGML 1AZZC 1OCOB 3AG3B 1P4LA 4MZIA 3T2NH 4JRLA 4N0UA 4P46B 4FDWA 3BGFC 4PWJA 3MUZ1 4MZ2A 1IVTA 2NY2B 4P23C 1DJHA 1LDSA 1YCSA 2ERJC 3G5VA 4X6BA 1IAKA 1S7WA 4PJ9C 1G5AA 3GLEA 1IO4C 4DO5A 1B3JA 2H6PB 3H9SA 3TP4A 4BV1A 4KKAD 4AV0A 4GG6F 2WLHA 1K4CA 3B3BA 3FH7A 3SPHA 3M86A 4G80B 3KG5A 4N90E 1WFIA 1OSEA 5FA4B 3SYOA 4OD2A 3ATDA 4XN7A 1WEJH 2B1HL 5FW8A 1QI5A 2V17H 3JVGC 5IVXB 4R5XA 1SBBA 2VJ0A 2NY3C 3DX6A 2WLIB 3OAZH 4U49A 3MLTA 3U4EB 4KZDL 2OZ4L 1MCBA 4ZFGH 1TZIA 4JW3A 3VXME 4Y7MA 2WAQA 1RH8A 2XY2A 1Z0NA 3BIKB 3GSUA 4K8RC 4DGIL 1OLZA 3ZT7A 4E5XG 2Z0UA 1OZUA 1UHVA 1ETZA 2X1WL 3O3AB 3CLFH 4AQAA 1N3NB 2P5WA 2XN9A 3NJIA 5DZ9A 3WL9B 5HYQB 1KN4L 3T3PE 2DQFA 4AC2A 1PJ9A 1KEML 4HWBL 5JOPE 4PWKA 5ID1B 3H1ZA 1E8ZA 3SYPA 1XB6A 4JFQB 1D9KD 3L9BA 4JFEB 2A74C 4M8QA 4HF5H 3C8KB 5FLVA 4FMFA 5I30H 5A6IA 1TCMA 3FO0H 3Q8AA 2EVJA 3WY3A 4JL2A 5BUAA 2QT6A 2WUCH 5ACZB 4HLZH 1W0YT 3D09A 1KMGA 4IOSA 3MV7D 1D7DA 1HCFX 5D7IE 3UZEA 1NSNL 2AJ3B 1TKWB 4XAKD 2ZKHH 4DZ8A 3MCG1 1PEWA 5BO1H 1MJJB 3H9ZA 5E70A 1AGBB 1QLFB 2GHWB 1I53A 2ENYA 5E1AB 4OJEH 4HZLB 2A6JB 4P59L 5ID0A 3NG5A 1E9OA 5IR1B 5FGRA 3NSJA 3WN5C 1ROCA 1FE8H 3H9SD 4LL9A 3CZJA 3RUGF 1B2WH 3L13A 3E6HB 5I66B 3DXAB 4DIXA 1JERA 2H1PL 5F9OH 1CF8L 4URKA 1HDMB 3MJGX 5ANMB 2OTWA 3ZL2A 3GI8H 5E1HB 3BVWA 3WO4B 1CK0L 2TAAA 1E3XA 1TO5A 3ZE0B 3CBRA 1ZHLA 1C5DB 2NSMA 3WDHA 1PFCA 3CIAA 3CJJA 5MI0B 3ROOB 1J8SA 4LMQE 1JNHA 3L3IB 3OKNA 3BEWA 1OY3B 4JRFA 5K9JL 4XTRC 2PW1A 1I1AB 1CB4A 3IRZA 5FHAH 4PJ8B 4LXFA 3SDXB 1IL1A 4B9YA 5EZIH 1KXTB 3MGTB 1B0IA 2J5LB 4KTDL 1KCSH 1ACYH 4F7MA 2N59A 3JYCA 4X7FC 1D5BA 4NQEB 1M71B 4F3FB 3DX2A 5EWIL 4YEEA 3BE1H 5CINH 4BE5A 5E8OB 5IQLA 3MV01 2LFGA 4Y4HD 3OHMB 1NCWH 5E23A 1A1NA 5E7BA 1ACXA 5INDA 4ZW5A 3HE6A 3HLAB 3SE8L 2ZWNA 5KBPA 2CPUA 2YPKB 2FSEB 4OZGA 4IOSD 1MI5E 1EJOL 4MD0B 1OLLA 3LNGA 4AYGA 2BH0A 4PGCB 2E7HA 1CL7I 2FX9L 4BDVA 4NKIL 5AAWA 4YVUA 2IADB 1PQZB 2GI7A 1KCBA 3R18A 4FKEA 3PXHA 2Z92B 1BD2B 5LWYH 2HMID 2VN7A 4LRNL 1FQ9C 2OYLA 4HUUA 3PWPA 1HHGB 3IETB 3TCLB 3M07A 1DP0A 2F1BA 1KYOK 1YNKH 4OAWA 2YKKA 1DL7L 4ZFZB 1ZKAA 3SIKA 4XOEA 2XX0A 4JG9A 2GCYB 3FQTB 1DBML 1FHGA 4W6XB 1OW0A 1W72H 2AJSH 1J0ZA 3BWAA 1UQSA 2JWYA 1KN2H 1XR9B 2D03H 3F8UB 5HYJA 3SODB 5INCB 2A9ML 2EZ0D 4JFOB 3X2QB 2IV8A 3T2PA 5TE6L 4EKJA 1KTCA 5K9KA 1Z3GL 3MRMB 2Y0SA 4UQ3B 3QRLA 4LCCA 3UTTA 1TVDA 2BP0B 4WQOA 2QSQA 3FO9A 4RWYH 3RTQA 1KBBA 2NY6B 5F0LB 3HNSH 2YKLH 4L3EE 4OB5H 4DP1X 2G75B 1UD8A 3QZWA 3EDEA 1E50A 1JPFA 4P2QD 4K71C 1XGRB 3IN2A 2DYPB 4W70A 5IVXE 5TE7L 3U30B 5DRWA 4AQ8C 3FT4A 3RURA 3RGHA 4Q0XH 2EDBA 5D7JA 3L3HB 1GAFH 4OCSL 2IQAA 4RESB 5DJAB 1W15A 2XPGA 3LZFL 1NKOA 4N8CH 1S6NA 1PW3A 4N8PA 5LO7A 1NAMB 1J5IA 3WNIA 1AMXA 4TF4A 2VYRE 5F71A 4H20L 4NOBA 5E5LA 4L9DA 3SKOB 3VWKA 4AKOA 5KBLA 5GSRB 3JTTB 4FQIH 3DJ9A 5HJGA 5JNYB 3LOWA 4HC1H 2PPFA 4LO9A 4UUJB 3MODH 5AAMA 3AT0A 3ZT6A 4HBCH 5IKCA 3UYRL 4ABUA 3S3JA 3ULVL 1AGEA 3QHZL 5DJZA 4YAQA 3K8LA 1RZ8B 1HSAB 3CHPA 5C0DA 2VM4A 3CDZA 3VXNA 2Q8BL 3EO1A 5LG1A 4GIOA 4U1MA 4H1LB 4ZK8A 2NXYC 3VXMA 5K9OB 4I5BB 3OKMB 4R96B 4Z7VB 4CGUB 4GH7B 4L5FE 3C5JA 3RNQA 1DUZB 2P3YA 2BIHA 3EJZC 3FRPB 1MW2A 2MOQA 2VQ4A 3HE7A 2QSTA 3T4AB 3U36A 4BFJA 3M8OH 1GS6X 2EUXA 1RJYB 4MRBA 1G4RA 1QSEB 3WXWL 1NIEA 4H0IA 3UG4A 2JK5B 3N9GL 3MTRA 4R7DA 4WKZB 5GGTL 4M8RA 1FL3A 1HCYA 3DXAE 4NM8H 3U7YL 1NMAH 2R8SH 3HAEH 3DROA 3VVVA 4AYFA 1JXDA 2WXMA 1MJ7L 3ZKND 5ANME 5C0RH 2G5UA 2YMOA 3MLYH 4BCXA 4J27A 4YDJA 4IGBB 5C92A 3D6GA 1T4WA 5JHLL 2ICEB 5DZNA 4XHQA 1K5NA 1KY6A 1NCAL 2D2OA 1I8KB 3IJ7A 3ZE0E 4LSRH 4X83A 3O2DL 2A73A 4EMZA 1JMZA 1N4XL 1ZPUA 5IUCA 4CNIB 3MXVH 2BHFA 2DICA 2BP3A 3KWXA 1GCFA 1TU2B 3H2PA 1HYSD 1AS6A 5F7MC 1A6AB 4IIQB 1AKJD 1P1VA 1BF5A 2OM5A 3D7PA 2IALB 4JN2B 4W9JC 3S4SB 3SDXE 5EV7A 3X3GL 3ZKMC 4X4YA 5IB1A 1MHPL 1J9CT 2HWZH 2ZUWA 3BJLA 2QGCA 3MRNA 3MYJB 4HJGB 1EHKB 4UIKL 3UBFA 4NQEE 3VFGH 4MXQC 2QDVA 4WTWA 4F2EA 4JO3L 2G60L 4FQHA 3J8F7 3KYMA 4OZFG 1WH0A 5D7LB 1GW6A 3JUZA 1BG1A 3ARDC 2Z0BA 1G9EA 4IKKA 1UM6L 1OCWH 5KYUA 4CSPA 1PNCA 3EJYD 3EDJA 1G7JA 1UUNA 3B2VH 1T20A 4EI6A 3MC0A 4ODUB 1AMYA 5DRXB 2WQSA 2MIZA 4Q6IA 4JDTH 4ZO6A 2LV4A 2DIBA 1YNLL 1NEZA 2X09A 4GXUN 1M1XA 1T7WA 4NKMA 3HS0A 3NEEA 4U1NB 2Y3NA 2YSSB 1INDH 3IDJB 5DVMA 5DJ0B 1NCDL 1E4WL 1IEBA 1CTOA 4YO0B 2XPYA 1CLOH 2J1ZA 3APMA 1D2OA 2HTKD 3B2PA 4NKDB 4OF6A 5F89A 5AOZA 3KW7A 1T21A 1X9QA 4CVWA 1NBCA 5E99L 5IV2B 1KT2A 4MSWA 1B4RA 4UDUB 1WYJA 2VDLH 4H7VA 1TTUA 3S9DB 2LLLA 3WKNA 1ZHBB 2O5ZH 1NOLA 4GINA 1FSKC 9CGTA 3CFCH 2GJRA 1DJYA 1GXEA 4PB0L 3GLAA 4HS3B 3CHOA 4Q2ZB 15C8L 4GW4A 5J12B 3MRJB 3G5YB 1YEHL 3CD4A 2GUYA 3NQIA 3KLKA 4WU7A 2KC0A 5ESQA 2EKJA 2YWZA 3L4XA 2R4RL 2QSCL 3P9LA 4QJ3B 1S7RB 3BP7A 1R46A 2GSIB 2EECA 3VWJC 4O02H 5CD5D 5T3XD 3BPCB 1CFVL 5KOVC 4L3EA 2ZYIA 2PXYC 5F2FA 4QCIB 3BUIA 3WMPA 2V9TA 4QRUB 5KYYB 1AP2A 4PGEA 1RIUL 3KL0A 4ZMVA 4TNGA 1NINA 2R29H 2O6DA 5EO0A 1E4JA 4HETA 4UCFA 1A64A 2P45B 3BAKA 5EBMB 4Z7VE 5BO0D 5KVDH 2FYYA 5KSBB 3PP3K 3VYNA 2IOOA 1ZLVK 3MDJA 3G5XA 2EE9A 1ZT1A 2JB6B 3C12A 2C8NA 4JO4L 5E2JA 4B9ZA 3PE9A 5E6IC 4YSDA 1MHHA 4DN3H 1KZQA 2Y06L 1KNOA 2K7QA 3CE1A 4L1TA 1RL1A 2ZAHA 4AKPA 1QSEE 2D3JA 3GMLB 4G6KL 2O72A 1MH5A 1P53A 2P1YA 4KVCL 3D12B 4N8VA 3RB5A 3T8XB 2J3SA 4AQ1B 4Y2NA 3UTPD 2XTSA 2BY3A 2Q3XA 2PO6C 5I8OH 2VXUH 2M8XA 5E00B 4K8RL 5EOCL 2C9UA 4Y19D 3VI4F 5IHLB 4IMKC 1LO4L 2DQIH 1XCQB 1NDGB 2AAVA 5JUEH 2X05A 3WTXA 1A6WL 4L2LA 3UO1H 1IIIA 4AQEA 3DV6A 4LVOB 4LEXL 3HC3L 2B59B 1B4LA 4RGOH 4LBEA 1EMTH 3D39B 5HPMB 3S3SA 3W38A 3FNKA 5BMFL 2ZCHL 5AZEL 5B3JE 1UJ3A 3KWVA 4E42B 5IVZA 3DWTA 4IOIB 4PV9B 1S78D 1TENA 3DRQB 1BFVH 2ZXWB 5JPNA 4PJ5A 3BPNC 2IH1B 5ANHA 4QRBA 1CGTA 1TT6A 5FW7A 1X4YA 1JGVH 5SWZE 4JG0L 4NQUA 1GKOA 5LXGL 1OP4A 4YGVA 4I3RH 2BIOA 3W5MA 1CFSB 5KBKA 4PU2A 2XZAL 4TUJA 2F7QA 4DGVH 1IC4H 1P1ZA 4F27A 3OPZH 2NYYD 1RP8A 4BBWA 5D72H 2WXIA 3MJ7A 1OP3H 2NUTA 2VQTA 2VIRB 5DVNA 1LEGB 3LY6A 1D5RA 3TPUA 2A9NH 3DC0A 4XOBA 1TSHA 5H35B 1UEMA 3VD3A 4BYHA 5J1SC 1XH0A 2WK2A 5DK3A 4OCXH 4YHML 3OZ9H 3HTLX 1MCDA 1OAUL 2QQQA 5EU4B 3MJWA 2EAEA 7PCYA 3BVUA 4KQ3L 4CVXA 3VM7A 1MCFA 4JPQA 3EJCA 1EFXB 2XTJC 4D3CH 3JTBA 4LPWA 2AVGA 3WUZA 2H26B 2WYZA 4XCCL 3VDAA 3WV0A 5MP6L 3L5IA 5EFIA 1VGEL 1NGWA 3QUKA 4N2EA 4AH2A 4EPSA 3Q7JA 4NPJA 4HUWA 4NO5B 1U30A 3PV6A 3ARFC 5HDQL 2GTQA 4NJ9H 4LLYA 4QT5A 4HAFA 2V3DA 4OCRH 2IFGA 4IBQA 4PB9H 4PRAB 2R0KH 5DMGD 5C0EB 3OBAA 1MUJA 1T1XA 4P2OC 1EO8H 3QORA 3RVVD 1WSST 1M2VB 3JV5A 5F1OB 4CVZB 1KTDB 3PL6C 2VXQL 3VGAC 5E4EC 1MFDH 2VSMB 5C0CB 3VQ2C 5ADPL 3A3YB 3BIBX 4LLAA 4ZTEA 4LSTL 2DY2A 1JHTA 2XFXB 1OAJA 3NIGF 3EJTA 5K39B 5M94B 3HC4H 1TOXA 5DRZA 1OF2A 4EUPG 4DKEL 2B16A 3V0JA 3QZBA 3NA9L 3OHXA 3QEQA 3DMMA 4YH6A 5C70A 1REIA 3KWWB 5C0GA 3C2AL 1ZJBA 4XP4H 5A2CA 4GXFA 2WWNA 1IQDB 1J8HB 4HHWA 4BXVA 4LCYB 2XG4B 3DPBB 3DJRA 3P0VL 4PJDF 4EI5C 4Z5RB 1HJCA 3HN8A 2ZX9A 3EW3B 3L7EA 2PMZA 3VXUD 2BPBA 3QUZC 3TO4C 3FRUB 4FFYA 3ELQA 4OGXH 4F1ZA 4M48L 5KW9L 2X0VA 4HHAB 4QHNB 5KSBE 2CR3A 4UZGA 1F5WA 2Q7YB 1XD0A 2ATPA 5F6HJ 3QEGL 2N1KA 2Q7NA 3EOAB 3QXWA 3NTCH 4NYLB 5GJSL 3WFHA 4PJFB 2RA1A 3IJHB 2LVEA 4JY6B 4ZW3A 1DQTA 3EFFB 4NX0A 4Y5XC 1D3CA 3LIUA 3MV8A 3S48A 3U79A 2DIAA 2VZTA 4OTXL 3G5ZB 1N67A 1QA9A 4HS6B 4PJIB 1GGYA 1BQRA 1IAIL 1UXSB 3GHEL 2J7LA 5CCKH 3QORD 4MNQB 3BD4A 4JPIB 1N59B 4TVPD 5KYNA 1HH9B 5T5FA 4L8BA 1TQBC 2BSSB 4BINA 5IQ7H 3E1ZA 3MQIA 3CQFA 3WE6B 1NICA 4ODTH 3H53A 3NJHA 2Q3AA 3MA7A 5I1HH 3DX1A 4LIQH 4MXWL 3D39E 4PGDB 4EDXB 3ZSTA 4KKZA 1PLBA 3QDGD 4K73A 1A7BA 1IGTB 3ULVE 4QRRD 4K9JA 3I50L 2H3XC 2F2HA 3BGFB 2Q5BA 1T83C 1OP9A 5ABZA 2OKMA 4F80A 2J4WH 2ERJB 3QEQD 3G6AA 3DMMD 4PJ9B 3TNMA 5T1KB 5M95B 3RG1C 4M9OA 4F37K 2Z35B 4M1DH 4YZFE 4GKOA 4YSRA 2YXVA 2RHEA 2VN6A 1G1OA 2YUXA 4MMXC 4QHPA 4YK4C 1SEBA 4XB7A 2YPVH 2WVUA 2OMUA 2OTUB 2GEQA 3GTVA 3V5HB 2CLRB 2NY3B 3LIZA 3HI5L 4XN8A 3AS3A 2YUZA 4PS7A 3FQUA 2VDKB 4XVJL 4E2OA 5SX5K 3CC5A 2LHAA 4YBQD 4GFXA 2ADFL 3MV8D 1GZHA 2FATL 3LQMA 2XNAB 5I9QB 1MHEB 4N1EA 5SWZA 3DUUA 4WWNA 3SY0B 5IGXH 4NZTH 1NM4A 3FQRB 4R8WH 5ECJE 4A2HA 3AGVA 2X0UA 1GJWA 1P9MA 3QNYA 2WVTA 4N2IA 4W1TA 5DJXB 1GGBH 4UTAL 1LE5A 3UG5A 2NX5A 4HFWB 1MFVA 5TFSH 3GSVA 4KH2A 5DUML 3RVUD 1H3VA 3KEDA 2QPEB 4NPYA 2R23B 4QEGA 4AEHH 2XN0A 1E4KC 3KVPA 2FBOJ 3REWB 2OULB 4AEFA 4ZX5A 4PTUA 3ET9F 4APXB 1A7RL 1HHIB 3K91A 2EABA 3VYPA 4G6ML 4UQBA 4HFUL 4EXPX 5B4MC 5L4FA 3UEZA 4I48A 2J1KA 4AL8C 1N8ZB 4A6YA 1W91A 3F83A 2I7OA 1ES0B 5CMAB 5HI4C 1DHKA 1GGTA 1FGNL 3FT3B 2YGQA 3V9CA 2D4FA 4UT6L 5F1IB 2IDFA 1RXLA 3DV4B 2AV7A 3DIFB 1HHKB 1QP1A 5K59F 4JQXA 5I2IA 1MOEA 5C0CE 3UJIL 4K0OA 4MWFB 3VJ6A 3AS2A 3GB7B 1S3RA 3F7PC 4G6FD 1P4IL 3WS3A 2XKUA 1H3UA 1X5KA 1ZE3C 3BAJA 5KSUB 2CNYA 3PJSB 5DJCB 2EVFA 1EHAA 5E9AA 4GNKB 1F58H 2OQJB 4OLVH 5ICXB 4DETA 5DR5L 2AQNA 4QHMA 4GSUA 4MAUL 5C1MB 5JDJA 3CSTA 2AJUL 2KLTA 3P69A 5FUCE 3ECWA 1SHSA 3BP6A 3NABH 5F1NA 1X6LA 3KHOA 2CIIB 3OKKB 4XNMB 4GXVH 3WFEH 2OMNA 3QR1A 1BG9A 3QPXL 4NP4H 3CMOH 3KH4A 3FL7A 4QWWC 4QXWA 1BFTA 1YPZB 2R51A 5I1EH 5FKPB 2NX5D 5T3XH 4XNXL 5DS2A 2XN2A 2BRRH 2DWDB 2VDNH 4PJFE 4IBVA 3GTNA 3Q9PA 2HA1A 1PZBA 1N6QH 3RZCA 4K7PX 5E4AA 4OT1H 1V8HA 4J6RL 4XC1H 1UWEL 1S7UA 4PJIE 5DK0A 2DQEH 4ERSH 3KW8A 3Q13A 2DLTA 2DQJL 2WZ5A 2G2PA 4RAVA 1RSFA 4MNQE 5D7KD 3QXAB 3QAZC 2EIJB 3QJSB 3C75A 4BSVA 4KK9D 3NYKA 5IVOA 2ED7A 2IPUK 4X4ME 3WELA 4Z0BL 3V8OA 35C8H 4WWPA 1D6VH 4J4PA 4YHOH 3QJFA 3DSFH 3IT8D 3JWOH 2ZOLB 3TA4D 2DJMA 4OCNC 4WWKD 1JGDB 1JV5A 5F8QC 4F92B 4ZPVB 3OG4B 4QF1A 1PKOA 1TQTA 1BVLB 2HFTA 2WVVA 1G9NH 4I0PA 2D8KA 4XPFH 1DN0B 1QWHA 2VQUA 1Z5LB 4N86A 3SQBB 1TJXA 3G08B 5FWQA 4G82A 3L7FB 2VN3A 5CUSH 5CWSB 2VLMD 5ISZE 5E5UB 5EUOF 4HK3J 4X8XA 1TF4A 3ILPA 4GG8B 4MQXD 4HKJB 4E36A 5LGHL 1XF1A 4ZUUB 4XHJC 3C9NB 3GZKA 3INOA 3PDOB 4HEPA 1FFNA 2FJFB 5DRNB 5E51A 3T09A 3RFZB 4XXCA 1HN1A 2Y69B 1I3GL 4JKPL 4HHGA 4JHWL 1AHWA 5BJTA 4QTHA 2O6FA 3QFJA 2FQFA 2CLVB 2V8LA 1DLFL 3TWCH 4UTCA 1NGYB 1P7QD 3MGAA 3L5XH 1HE7A 2Y25A 3BAEH 3O0RL 3OB0H 2C1PA 1U3HB 3IDXL 3VFPA 5EEZA 4OIIL 1XGYH 2R56H 4N0CD 6FABL 2NRDA 3RZCD 1QG3A 2XICA 5KJ7E 2CDGA 4ZMLA 4B9PA 4BQ6A 3W1ZA 2WBJA 2Z31C 2VLJD 4XP9L 2VQ1B 2P48B 1JZ3A 2P24A 3FK3A 2DTMH 3VRLF 1BXVA 1E5UI 4PS8A 5E8DL 3IJEB 5TF1L 3K8KA 4U7SA 2NTFB 1A2YB 2VZSA 1H8SA 2E47A 4LSPL 1WFMA 4A37A 2EVIA 2CGYA 1IKFL 1FPTL 2NY1B 5I8KH 4J4PD 5FUZL 2NXYB 2ZOWA 1WT5A 4XCYA 4X6DB 5AYQA 3SD2A 1DVTA 4PWHA 3P2BA 3BDBA 1YN6A 1W6WA 3SGJA 2HX7A 2Y5EA 3FB5B 1WIOA 4CSZA 4H5SB 4I0PD 4LCWA 2O6EA 1E4XL 2Q9OA 1DQJB 1QPXA 4PWIA 3VYOA 4BEIA 4N24A 2QHRH 3LRSB 3AGWA 3DPDA 1JN6A 2IH8A 3CZSA 3NCBB 5CIPB 1KXQE 5HYSG 3H85A 1COBA 5EEYA 3FZUC 3P54A 1GOHA 1U8NB 1I4FB 2CR6A 4KXZH 4QOKA 4GSDH 2O5XH 1AGDB 5D1QC 2FTAA 2YAMA 2AF2A 1TTBA 3UP6A 3RL2A 4KFZC 5BRZB 1WHOA 2F53A 2V0AA 2NXZC 2XQBL 3IXAB 4HMCA 4FQCL 5CXPA 3D51A 3VFWA 4RFNC 1BF8A 5HD8C 3MRRB 1I9IH 5F8RC 4Y1AB 5DMKA 1U8IB 3QK0A 4PG9A 1WS8A 4ZYKA 3VTAA 1UH2A 4L3CA 4I9WD 1WCQA 4JQVA 3WGUB 1CICA 1JZEA 2IH9A 1B4JL 1MVFA 1N0LB 4K3EH 4ACPA 4AVKA 5KJ4A 3RQ3A 4IU2A 1QABA 2WBJD 3KM1A 2DJSA 1KYAA 5A2KH 3VRIA 4UI2A 1WRFA 2EILB 3ZTCC 3TA3A 5I5RA 3IU4H 4ZSOB 4LEOB 1YPZE 3CWGA 4LOFA 4MKTA 4NRXB 1FH5H 1OB1A 1N5YL 3BDXA 3WJMB 2APXA 4AK1A 4YDLB 3D4YA 3VSVA 2QFPA 2P28B 3VDBA 4S1RL 2PW2A 5DEFA 4BZ2L 4G8GB 1D6EB 1RUPH 3ILEA 2PETA 4OZ4A 4ODWA 2YQGA 4AZ8B 3MLZH 4L29A 2QADC 2YWYA 1TQCC 4KAQL 1DCLA 3WFDH 1JI2A 2F15A 3GJFA 2XRAH 1RVFL 1SXAA 1B0GA 4IBLT 1EBAA 3HRZA 1FJ1A 4RZKA 4TOYH 4LARL 2VC2H 2DQDH 4LCWD 1S9YA 4RAUB 5DFVD 5CBEA 1TETL 1IGIH 4RIRA 1UACL 3FOLA 4S10A 5GS2D 4XO9A 2L8AA 5C2BH 4KMTL 4QOKD 2DQCL 1RMFL 2GSGB 2M1KA 1ACZA 2K3HA 5IWLA 4PI2A 3UGEA 5BQ7A 2AJZA 5DHDA 4ZW6A 3HHSB 2F53D 1MRFL 3ZE1F 3GYRA 2L04A 4WFEE 3S36L 1OWRM 1VADB 1RHHB 5AZ2H 4IHOB 5I6PA 4ANWA 2P8LA 3AXIA 4H0GA 5JA9A 1FL5A 3IK2A 4P0DA 2HFGL 2IGFL 4FJ6A 2UX6A 5DF0A 3BKCL 5CEXA 4JZJC 3BQUC 4M62L 1QBMH 1CICD 1WFJA 1EXUB 5EMYA 3EOYG 2BVQB 4YFEA 2F5BL 5FOBB 3IMUA 4RQQB 1U8HB 4X4MA 4Z7UF 1GGIL 1TQSA 4BGDA 3T65B 4HW6A 2RCSL 4L8CA 1H9VA 4XNZB 1XF4B 1KB9K 1UZ6F 5KG9B 3MCYA 1YJDH 4F91B 2ZT9C 1V7MH 4M7LH 4RDBA 4U3SB 3NDYE 4XP5L 3O4LB 4P23A 4NZUH 5FV1L 1PSKL 4H8HA 1OO2A 2X10A 3MRDA 2EQDA 4OCYH 4KJYB 5ISZA 3PHQB 5L2KA 4FFYH 1OHQA 3RDTB 3Q6FA 3DTXA 4EZKA 2X6MA 4WUKH 5M7QA 2B3RA 3HZVB 3N1FC 4WFHE 4WCYH 1QYGL 5CJQH 1Q9KA 2PXYB 3CZGA 3NCYP 4KTYA 3T0AA 1CDJA 1BZ8A 3U4BL 1ECYA 1Q0EA 3FPYA 2Y3AA 1XGTA 3I75B 4X6DE 5C0ND 4RX4A 4LQ1A 4MVBD 1GYAA 1YYLL 2WMPB 3ZDXB 5DK2B 5T1DL 1DEEB 3GGWB 3S5LB 2VAAB 5T5FH 1VACB 1ED3A 2BNQE 2C9AA 4HJ1A 5IVNA 1AQDA 2R2BA 1Z32X 2Q76A 3L1FA 2X6BA 1ZANH 2ZP8A 1J05A 1KYUA 2GJ6B 4RMVA 1XXDC 1KIRA 2CXKA 2WBXA 4XNYL 2W0FA 1BQHA 3K6SB 2V7NB 2RMNA 3TS8A 5I1GH 3HPLB 3TIDB 3N85H 2MPVA 4DZBA 3DI3B 1OGSA 4GW1A 2A74A 3PY9A 3ZZSA 2AABL 3EKCA 4IS6A 5TDNA 5HJ3A 3VCLB 5BRZE 3RWIA 3VFUA 4C58B 1NKRA 2X2HA 2Y36H 3LRMA 3IDYC 4Y1AE 5FM5M 4ODXB 4UM9B 3ECUA 3F2LA 1AG6A 2CIKB 1PX8A 3CXHJ 2GAZB 2OZNA 1NCOA 4I1RA 4MA8H 5E94A 5B8CA 5A2JH 4XPBH 1RJZA 2XKNA 3QUXC 1JWUB 4HKXA 3EHBC 1LEKB 4WI2A 1YO4A 2IAND 3WN5A 5L2KD 2XPZA 2HLAB 4O9HH 2XYCA 2DI7A 3CFBB 2BNRA 1FGVL 5I8EA 4DPBX 4WEUD 3VW3L 4ZO9A 5DS8B 4IRJC 4ZSOE 5EOQH 1YY8A 5IMOB 5EZLB 1ZTXE 2QQLH 3NCYS 3QGVA 2WIIB 2VDOL 5JDSB 1AD0B 3A0OA 4G8GE 1WPCA 1GIGL 4K9EH 2OMTA 1CL7L 2AXGB 3VTTA 1I82A 4G83A 4PYHA 5DHMC 3PWLB 4HK0B 4NM4H 3ULSA 4RX4D 4P5TD 4OLEA 1IC5H 2WTRA 2K78A 1U93B 3K5RA 3IMWA 2EDRA 3PUCA 1PIGA 4OGAD 4YHLH 5J8OA 3P4NA 4KC3B 4JNXA 1MF2L 4YXHH 2Y7NA 1OP3K 3GZPA 3TM6A 4BCZA 1OAKL 5I0YA 1QPPA 4U1GB 3LQAH 4OJCA 3QXDA 1NJ9B 3QJHA 3QQ9C 3SBWA 1A6TA 5ERWA 4RISH 2XTJB 5D1ZI 1YHPA 4PV8A 2ICCA 2CDEB 2W60B 5KSVA 5GRVK 1CO1A 2MCG1 3EXJA 3LKQA 5FYJL 3MLSH 2ZOUA 3O11A 2W65A 2XJLA 3IGKA 4ODVH 1II4E 5CZVH 1HKLH 1KCKA 1T1WB 2DIJA 1I8MA 3ARFB 4FXTA 3STZB 3BVTA 4ELMF 1BW8A 4UV4L 3FQYA 3RNKB 5TDPB 2YPLA 4G8FB 1QUNB 1EFQA 2DEYX 4JFZH 4WUUD 3FQWB 5I8CB 4Z3JA 3VAEA 1M7DA 4FN0A 4HLZG 1UYWL 4WAFA 1ZDQA 4PTTA 2BNRD 3D69B 4Y16C 3RX5A 1RURH 2A1WH 3L45A 2UY6B 3B37A 2FNBA 4Y5YA 2V2XB 4YDVA 3D2TA 3E2HC 5E4EB 5MEQA 3KLAA 3O2VH 4TULH 4BRJA 2NSQA 3LKRA 5GS0L 3IGAB 4GRMB 3U6RB 3TURA 3O4LE 4FLHA 2D9CA 1N0XL 3UBHA 1R0AH 1EEYA 5J3HD 1C16B 3UBXA 5HHVH 4AI7A 5AVVB 3P2TA 4KHXH 2YLHA 4F7PA 3F12B 4FNRA 2YAFA 4XOCA 4JRWA 1MFEL 4PQXA 4WNQB 4AXWA 2UY7B 1XV8A 4U6YB 1X7QB 4EI5B 2KPWA 2X53A 3NFSH 1C1EL 3LS5L 2X4SB 4OVUA 4MAYC 2VSDA 3C60A 4FFZH 5LN8A 4C83A 1JNNH 3MREA 2X2JA 3E8UL 3GMRA 3I6KA 4U1SB 2W80C 5B39G 3U9WA 4JQIA 2HRLA 2GYSA 2EH7L 3B2XA 2SEBA 3RA7H 5CBAA 1JK8A 1JHLH 3ZDXE 2VL5A 4J23A 5J9PA 4LGPB 3ME0A 3UL4A 4FC3E 4Y5XB 1LK3H 2GJ6E 1ZY9A 3ZSSA 2QL1A 3LEYH 5F97E 4E5XB 2OI9B 1FYTD 4ZUWB 3BOVA 1BMZA 4BSWB 2XOTA 1BAFH 1QHOA 3CBKB 4B0MB 3FQXA 1PNDA 2EYSB 2KZBA 2IDCA 2R9HD 3PWUA 4LDEB 3KPOB 2DQHL 1KIUB 1FFPA 1S46A 4LOEA 1DEDA 1GC1C 2IPUG 4OLYH 1W8NA 1DBAH 4ZPTA 5B38A 5BV7L 5FAAA 3QC6X 4Q52A 2KHAA 3D50A 3REVB 1CLZH 1F3RB 1WD8A 3ATFA 3HFFA 1SOKA 3TIEA 1WBZB 3DA0A 3DIDA 3ZY7A 2JTDA 2BNQA 1S9KC 4PD4K 1IC7H 2FEDC 4GLRH 2YRPA 3WXVH 3FTUA 1JNLH 2W9DL 4GBXD 4XGZB 4X80H 5E2UL 1TEGA 2JCCA 3DO4A 3S8FB 1QACA 3VD2A 3AG4B 3G6DH 4RAHA 4V1DB 2VSKB 5HGHA 4EI0A 4KFMA 5EG6C 4Z8FL 4LSQL 3V0VA 5HHNB 2H32H 4IM8A 1CFBA 2Z1PA 5ALBH 5JMRA 2EUWA 3GD1C 3FO2B 4X7CC 5IJCC 3RX8A 1TJMA 4QI3A 2FDBP 4YK4B 3E80A 2CD0A 4HIQA 2OJZL 1OPGL 2HTLD 2BMKA 1BLNA 5CSZA 8FABA 4G7YL 4ZRGA 3V4PA 4DEWA 1QI3A 2MTPA 4O5LH 2OX5B 1DCEA 4N2NA 1MCRA 3NJFA 4N28A 2A6DA 3S37H 4W9CC 1B3IA 3KLSA 4WLCA 1FBIL 4OLZL 3ERXA 4UNIA 2ATAA 1RUKL 1UURA 2MRYA 4O4YL 2IMNA 4M5TA 3U2SA 3WIHH 1CR9L 4G7QB 1JCVA 2XTJE 3LZOA 4PW4A 1FNGA 2O5NA 4OJYA 4UDTB 1G9MH 4NZDA 5F7HA 1CT8A 4X7EC 5I6MA 2V9RA 1WC7B 4ONFL 5TE4L 2WQRA 1Y0LA 1K8IA 1QR1B 5A2AA 1X9LA 3W11D 1NWPA 2OMWA 2H2SD 3ARDA 4NQSA 4WO4A 5GS2H 4N9GA 4DGYH 2P9RA 1MFMA 3FSZA 1JFQL 3FU5A 1YC7A 2BSRA 4MJIB 1AS8A 4FQ1L 3RX9A 2EVHA 4UB0L 4XVOA 5C8JB 1IGCH 3ETBJ 3B7UX 3EH5B 5FO7A 1QNZL 2VDOB 1JBJA 2P5EB 1KENL 4KQ4H 2OMVA 4XNQA 2HH0H 2F58H 3P1VA 2WWKO 1A7QL 2VERA 4LKCA 5JIPA 2Z4TA 3LH2L 3ZDZF 1KEGL 2YA1A 3KPLA 4UU9B 5GS3A 1WZMA 2FQGA 2G2RB 4LLMB 1ZLUH 4KZEL 3GMQA 1RJLB 4RMRA 2G9HB 3QDJB 4XO4A 4N26A 4UT9L 4EQ2A 2VLLA 5E6UB 1MJ8L 1LMIA 2YOAA 3EYUH 1TTFA 2FO8A 1R33A 3ARWA 3FT1A 2Y7OA 1MFAH 1R5WB 1MIEL 1SXBA 3KYNB 4FEIA 3LPFA 5DLMH 3S3BB 5HXMA 5T3ZL 4Y1SA 1VFAB 1GH7A 4EBQH 2O4EA 5AW8B 3GUTB 1FZMB 1JRHH 1ET8A 1MDAA 3LNFA 3W9EB 1SYVB 3BUYA 4XAWL 4ZS7L 5HDWA 3ZR6A 1FFRA 2YD8A 5IHHA 4MMZB 2NMSA 3HLKA 4JFFB 1U8MA 2WO2B 5HY9B 2W91A 4JO2L 4RGND 2YRZA 2YD7A 5CCJA 3T3MF 2GITA 4M1GL 4X5WA 4WK4B 2WP3O 4PP1D 5H2BA 3Q06A 1HSBA 4F7EA 3HMXL 4EVNB 2X3BA 5HHPA 5CGBA 5J6GB 4XMLH 1Z0MA 1B0RB 3GJFH 3UO8B 1JAEA 2KH2B 2MJWA 2VDML 3ZHDA 1DVFC 5F7DA 4WZ9A 4OLXH 4BWTA 1LK2B 2OSYA 3MLUL 5FEBA 4PJDB 1YEJL 5F6IC 4RMUA 5HI5D 4WFFE 2E86A 2YD6A 3FB6B 1WZ1L 4CMMB 4HUVA 4JKWA 3CFDA 4WO4D 1QFWM 1WP6A 3Q1SH 1KJ2A 1URLA 2E3VA 2BIQA 3D85A 4NSKA 3VWJA 4OZIB 1AQKL 2TRYA 3ZK0A 43CAB 4NB7A 3QQ4A 1FLTX 2AANA 2W38A 4K94C 1IGFH 1YLBB 3L9YA 3SPVB 1A4JA 2ZCLH 4FQ2H 4WU5A 2ZX8A 3FUHA 4ODBD 4LKXB 4YXLH 3QAZB 4Z76B 2BVOA 4FL4C 4K2UH 3ULUF 4PY8I 4Y8DC 1JD9A 4XI5C 2G3NA 5F9AC 2JKSA 4R4FL 3QUYD 5I5MA 1KV3A 3AAZA 4BH7B 3KPPA 5I1KH 2DMBA 4HIEB 5A7BA 3TFKC 4MYWB 4QRQB 3FXIC 2BWDA 2EUVA 1U92A 2D73A 5E6IA 4Q74A 2PPDA 2F68X 3BPOB 3GMPA 4DFHA 2XCMC 4OBRA 3T0WA 3Q43A 4R97C 4WJ5B 5IHZB 3QG7L 5D1XA 3N43F 1XR8B 4V1DE 5DHEA 3HI6H 3NACH 1A0QH 3HUJF 1YEIH 1P2CB 3K2MC 2PO6A 1Y6NR 1V3JA 5LGJA 3CFJA 1JOIA 3Q2VA 4KUZL 4IMKA 3D0LA 1CF1A 2YA0A 2HKHL 2OMZA 3ARPA 4PRPD 4B41A 1KIQA 4KH9A 3PGDB 4J39A 1DSFH 4F5CA 1VERA 2FH6A 3JTSA 4ZMQA 3T0BA 2G30A 5EA0H 2H5UA 1LWRA 2UVEA 4M7KL 4G6AD 1YYMH 2VLKA 2XVKA 1VEMA 3CHXA 4HYTB 1U8KA 2B9BA 2VITA 3HS9A 1HTYA 1A1MB 2PWEA 1JXJA 1QFUH 3WFCL 1WUZA 4YSOA 4F37F 4Y2DB 2Z9TA 4FJZA 3X1GA 3D85D 2JMRA 2NY0D 4MMYB 1XZ0A 1QRNE 5E1QA 3RVWC 4OF5A 1K8DA 2QMKA 5FB8A 3NSYA 3WS6C 2E9WA 4FF9A 3MLXH 1OK8A 1WV7T 4YDKL 4NCC1 4A7QA 1LO3L 3VXSD 4ZOAA 4PJ7A 5G4OA 4RDQG 3PWVB 1LTXA 3ABKB 5LBSA 4QNPF 2LAAA 2B5IC 3OC8A 1BJMA 4ONHA 2DWTA 5DUBB 4TNWF 1VLXA 3AITA 2DJ4A 5G4NA 2AW2A 1RK0A 4CJ0A 2OP4L 4KK5D 3TJHC 4MJIE 5CEZD 4ELKA 4OZFB 1L9SA 1LQBC 4KDTA 1NLBL 5DQ9A 5CJXC 4ZFFB 4EO5A 2Y07L 2FO4B 3GMOA 5GRJL 1ESOA 4KJWC 5DDHA 1SY6H 2AITA 2EICA 5G4MA 2MNUA 1M05B 2GI0A 3FTXA 1SM3H 3MMEA 5D1XD 5JXAL 1OM9A 4AM0Q 3FFDA 4OQ1A 2JKJA 4M6MH 4WHYH 5D1QB 4N90D 4WK2B 2N4IA 3QDJE 5KVFH 4ZUTA 4TVUA 3Q6GH 4HWZA 1GKEA 4AITA 3ARGD 5DEJA 4DVRL 2X7LA 4ATTA 3LXBA 4FYRA 2AJXH 4PRIA 2NXZB 3IRCA 1X5MA 3RJQB 1BM3H 3TC9A 4RFNB 1V10A 1JS4A 1VPOH 2DS4A 3MKKA 3CLEH 3EYOB 3RWHA 2Y7QA 1GMEA 2WN2A 4P2OA 3BEVB 3ABMB 3W9DB 3K6IA 5FYJE 3B56A 3VG0H 4JCWA 4JFFE 5E08L 5BVJB 4HLJA 5JR1L 3QHFL 1P7HL 4R26H 3GRWH 3V6FA 3PL6A 4OKDA 3SPJA 3QUML 1WGOA 3WEAA 4HMEA 3H42L 2WOYA 1U0QA 3ABGA 2VUYA 5GHWL 3C6SA 3JWDC 3VFOA 2VO8A 1IZJA 1I3RA 4PJDE 5J6SA 3P11H 4NN5B 3HC0A 4LFHG 4JO5A 1DANU 4LLQA 3UIZA 2ZKYA 4OZIE 4UTBL 1TQCB 2J72A 4R2GC 4XWGH 4KJQD 3GK8L 4ECNA 3FAWA 3ATAA 1XEDA 3I6SA 4P2YA 2EXTA 3SDCD 3FSVA 5KS9A 4PMFA 3BSZL 4LHJB 3RWCA 3GDCA 3QUZA 3TO4A 3OMAB 3RVXC 4R7NA 2PP9A 5KTEH 5CLTA 1VGKA 1L6XA 1ZMYA 4OUUB 3AREC 1L5GA 2VZVA 4P2RA 4UQAA 4B3VA 4TSAH 3KLDA 4KDWA 4QXUH 4JFXB 1VCAA 1MY7A 4GAGL 3G6JF 4KBPA 1E9QA 4OKVA 1C12B 3L17A 1UA3A 2ZXGA 4PGBA 3S8GB 1JHKH 3D0VB 2FHFA 3HB3C 4N85A 1A6ZA 3EF4A 1RZ7L 4TS6A 3IGUA 2A6KB 4RMQA 4DK5A 4XZUA 5A7EA 2KZKA 2O5YH 5AYUL 5EEVA 4PCKA 1V7NL 4APQC 2BCKB 3ISYA 4JVWA 4YSEA 4CC4C 2W07B 3EFOA 3PYCA 5HPOA 1PX4A 1U8OA 2Y5TB 3QNXA 1OM3H 2LGNA 5F96L 3VXOA 1I1FA 1CLVA 5GGSA 4FP8H 3FDWA 3ZDYF 2XZQH 4QXGL 1C5CH 3MA9H 2H47C 2CO6A 3SBRA 3QIUC 2X3AA 3D18A 2AI0L 3V0EA 3NIDE 4YUEH 5EUOB 1RP9A 2AGJL 4MCNA 2X4QA 4ZAKC 2F54A 4HIXH 4MKMA 5CEYA 3DURA 3HR5A 3ISRA 5GJTH 1AXTL 1NAKH 3T6VA 1BZEA 3NSXA 3T1FB 1T83A 4KI5C 1FWXA 1NBZB 1F11A 3QUGA 4IKNA 4MDIB 1GTNA 4RLDA 5HVGB 1EO7A 1G7LB 1G7MB 3GMMA 3H3PH 3IDMB 4HGWB 4JRYB 5AOKA 5L8KB 4NQXB 1KWKA 3LN4B 4JQIH 5C0BA 3FU7A 4NUJB 3KS0J 5DD1H 2IAMB 4JPVH 4MMXA 4DK6A 2F19H 4G5ZL 3V4UH 1RZGB 1ZLWH 3V0WL 3A4FA 3F5WA 5F9DC 2W9EH 4F57H 4HA1A 3LHAA 4D0CB 3KXFB 4IJ3C 2RB8A 5IB5A 2ITFA 4JDVB 1S7TA 2UZPA 3H2QA 3TBSA 3AWEA 3RBGA 2CJUH 5ELIA 2QPSA 3BKYL 5CP7A 2WQAA 3ALWA 4Z9KB 3GM8A 1KWGA 1HAWA 2QGEA 4P46D 1TZAA 5IESL 2I27N 1OAYH 2NY2D 3EIFA 4U7MA 1ZJAA 2FVNA 2GUOB 1QRNA 4F58H 1TPXB 3F85A 4NDMA 1U6AL 4AV4A 2BSDA 3MO1B 1JPSH 5LAXA 3B34A 3LZLA 4MGXA 4B5EA 1AGCA 1IBZA 1IFHH 3B9DA 3VD4A 5D1QE 4DJMA 3FSWA 3FH8A 4XMWA 1E4KA 3B2MA 2GK0B 1D5IH 3SE9L 3MACH 4ILDA 4OZHA 5C0FB 3T4YA 3EJSA 5D1ZC 1H0DA 3EH4B 3FF8A 3PXLA 2QKSA 2P43B 2GC4C 1JYVA 2R4SH 1Q9WA 3WO3B 4Y7OC 1VSCA 2IMMA 2WINA 4XVTH 2AK1H 4C56B 5K59E 4BFIA 2CNZA 1H5BA 4UQCA 5SWQB 1ND0B 4TTDD 3VFMA 1S9XA 1VCBC 3FJTA 5E8PB 1RZQA 3FH5A 4LSVH 1ZS2A 4S0SD 2KUTA 3ARTA 4I1NB 3EHBB 5GGVH 2CE6A 1M9SA 2CCLA 4FNQA 4FG6D 2H3NA 1J8RA 4NNPH 4YPJA 3QFGA 2H2PD 5EU3B 4YE0A 4G7VH 2O1AA 1VJSA 5C0BD 1CXEA 1HIML 1VB9A 3PP4L 1DQDH 4JG1H 4QO1A 2DEXX 3I02B 1EUUA 2W1NA 4PBWD 3QZWG 5E24E 4NHUA 1A9BA 1QVOA 4GRWF 4JFED 4WEBH 1JGEB 4LK4A 2OYMA 3QWOB 4TQ8A 3UMTA 3VXQB 4LLVA 4JLRA 4G7SB 2E9JA 2AP2A 1T4KB 3H0TB 3RX7A 4BFRA 1J5OL 1NDTA 3CN2A 4ZD3L 5E5MA 3U9UA 4HISA 2P8PB 5TJWK 4KTEH 1G6RH 3P0GB 3GSXA 1FRGL 4U3XA 3C5ZC 3WIFB 3K6NA 1ZVSA 1RUQH 3IMRA 5DVOA 3UJTL 2JSFA 2F74B 1PG7L 4RNRB 2XXCB 2D0FA 4I4WA 5H4YA 4PGZA 4A2GA 2X88A 2APSA 4JB9H 3L9EA 5EBGA 5IBLD 3BYTA 5T3ZE 5D8JH 2YD5A 3DXAD 4MB4A 4XPHL 3SDAA 3FONB 3SB3A 4L8SA 4QY8B 3CX5J 2R0LH 3LKOB 1GS7A 1MWOA 5AW9B 4AE0A 5KVGH 2EE6A 4XCEA 4L4VB 4N2DA 1PZ5A 5INCA 3QUMB 4NKOA 3NRFA 2FAUA 2YC1B 1EVUA 4TUKL 1BFOB 1OGAA 2P42B 3BCDA 3BO8B 3O6FC 4TL4A 4U3HA 4U6VH 5T1JA 2WANA 2M2DA 5KSAC 3S97C 3NFPA 2IDTA 1ITCA 4RSVA 1J10A 3FMGH 2MKWA 3QIBB 4P49A 25C8H 4DCQB 3FSAA 1S7VA 1C5BL 1A5FH 1NC2B 5JXEC 1H6TA 3FULA 3MNWB 3ML8A 3PWNA 2JB5L 3OAWA 3AMLA 1JDAA 2EDDA 5A16A 3O3EA 3WENA 5EUOE 1HAUA 4NQED 1MCWW 1WWWX 3L5HA 4JBSA 3KYOA 1TJGH 2HUHA 4ZX6A 5IOPB 2WUBH 1XEUA 1BXUA 1A3LL 4WW2A 4Z7UB 2WQVA 3KEHA 3L3OC 2EDNA 4QRPE 3TYFA 5IMMB 3MROB 5AALA 4U2ZA 3QRGL 5MEOB 4JRYE 4Z0XA 1TEYA 5LCVA 4P9HH 1N10A 1SFHA 2HVKA 3QG6B 4X6FB 3VFVB 4AJWA 1BZ7A 4PJAA 1I9JL 2ZP0T 4PRDB 1MCKA 2EE3A 1BD2D 1KDJA 4BZ1A 4FFVC 4ADJA 2YHGA 2CLZB 4D8PB 2P7TB 2BOBB 2R0WL 3LHPL 3O2WL 5K9OA 4IRSC 1A14H 1KJ2H 4MAYB 1AO7B 1I1YA 4PJHA 3QQ3A 3SDAD 3NIFE 1KZYA 3EUDA 5CGYC 4Q9QH 4R4BA 4BUGA 4KPHL 3DLQR 1DJWA 2X1PA 3LH9A 1MFUA 3EFDL 4HLEA 4N2MA 3CDYA 3EZJB 4IEFB 1RJYA 2Z31A 3F62A 3B5GA 4AIZB 4BH8B 4HU8A 3VTMA 1OGAD 1IBBA 1SMDA 2B8OT 3HBPA 1PPIA 2OZ4A 3V4VA 3VA6A 2A77H 5I1AB 5JHDB 2NY6D 1HEZB 5DJ6B 5CEZH 4MS8C 4HG4J 2BX5A 3HPJA 4JCLA 5EBWB 3FTYA 3CXDL 3MKGA 3ALPA 2WWMC 3WKMH 1NEZG 1VA9A 3AT8A 4N6RB 2DYPD 5EF3A 1WA2X 1ZT7A 1S7XB 2X9YA 3WE1A 3TYGH 5IF0A 2WKGA 4G1MB 2B4CH 5I75C 3DX3A 2DMHA 3OAUL 4C56E 2A99A 3NAAH 4A7VA 3GSRA 4KKCD 1DQLL 3TEYA 1BSIA 2EC9U 3MJ9H 2HB0A 3NPSC 3GXPA 3ZTJG 2CUAA 5F88A 3RIAK 1OAXH 2J6WA 4HAGA 3U1SH 2C7UB 3S36X 4TRPL 5CZRA 1CGWA 1G9HA 5C08A 1HOCA 1QLRA 2ZPKH 4LASH 2ZXAA 4U1KA 1MQKL 3GS0A 4FNLH 3X14B 4I2XA 3GBEA 1ZIBA 2B2XH 1T6VN 3CPLB 4WW1B 5JLZA 3TNNA 2GK2A 3PGCA 2UWEA 5D7HA 5JQHC 3CU1A 5I6OA 3B2UC 2XFGB 5MENA 5FF6B 1TQWA 1A7OL 1R4XA 3X13B 3GKZA 4JPWL 5F44A 2GTWA 4O58H 4B9CA 3QQXA 2JJTA 4YHYB 3RGVA 4R4NC 1FLRH 2P8MB 4Y4KA 1F86A 1JWMB 3E9UA 3JWNH 4WDIA 4WGWB 4GT7A 5IEHA 1DVSA 1OTTC 1CVSC 3KR3H 4M6NH 2B1OA 2PABA 3US9A 4ORGA 4AKQA 5ACMA 3WJJC 4AYID 4X99A 4YXKH 1DDHA 5LBSH 4GJTB 5FYLL 1QSED 4K5PA 2CXGA 3DVGA 1UZ8A 2VISB 1SN5A 1KLUB 4S2SA 4KGJA 1YQVL 3X3FH 5J7CC 3T0DA 4U1NA 3F84A 1XF3B 1MEXL 2VKXA 4BIKA 2W0KA 3NUKA 3Q05A 3K71B 1TMQA 2AERT 3QI9B 2YAEA 2RTTA 2EIDA 3DECA 3LKPA 1NWOA 4MFHA 3CZFB 4M4PA 4S1QL 3E1F1 4L4VE 2ADIB 4TQEL 3VB9A 4O51B 5AG9A 3MOAL 2YBGA 5ADOH 5IV2A 4PJEF 1A4KA 2E59A 1P5UA 4HKZA 4KZCA 1U42A 1KPRB 4UIMB 5ETUB 7CGTA 1BBJB 2XXMB 3FS9A 4W9GC 2D7TH 1YG9A 3LN5B 1DUYB 3N55A 4GW5B 4OF3A 3JWDL 4Z77A 4JM4H 2ITEA 5E03A 1JZ5A 1QFOA 2TSAA 1QZ1A 3OJ2C 1GRWA 4AZUA 4N8VG 4I8DA 5DEZA 1W16A 4E9VA 3CPUA 2IGTA 1CI3M 3RU8L 3H7BA 1N12A 5E9DA 1GGCL 3RVTD 2HT2D 4P5MB 1SDYA 1JV2B 3SGDI 3VH8B 3C6LA 1UENA 3QPQC 32C2B 1VFBB 4ZXBB 1QTYT 1U8PA 1MRDH 4KXZI 5DO8A 4P9MH 4UYQA 3C08L 3X17A 4U4BA 1R3HB 4Z7UE 5D7LD 1OWWA 2E4TA 3L2NA 1ZLUK 3DOHA 1JMXA 5FYKU 5F7EL 5D4IA 4OCWH 4ENEC 1FYHB 3RGVD 4Y4KD 3APFA 1UWFA 3BQUA 3PABB 4R0LC 5F7AA 2IC2A 1MAML 3IKCB 3CVHL 2VJXA 5B1CA 2C4FU 2VR8A 3FUFA 1KGJA 4HXAL 3RIFK 3BX7C 1KJVA 1CG9A 2R7EB 3HKFA 3IU3B 3ULUL 4MNHA 1NIFA 4GKLA 1NZRA 2FEEI 1PF3A 1I85C 3ARZA 4ZI8A 3GHBH 5E7FA 2VXTL 1IQWH 2ADJA 4U1IB 1AD9B 1AO7E 2QMJA 4XNUH 4BQ9A 3ARYA 3D34A 2I5YL 3R4RA 4U1JB 4OQTA 3LXAA 4QRPA 5F6IB 1NFDE 4U6HA 4GAJL 2NCEA 4BKSC 1WD9A 1V27A 4XP1L 5AWNL 3QYCA 3GJFK 3O3BB 5E4IA 5JO5B 3JV6B 3S96A 3T6WA 4NKQB 5ESAB 5IFAH 1A6UL 5DJDA 1P5VB 4M00A 2AQ3A 4KKAC 2NNRA 1MLBA 2WLKA 5JHDE 2DKUA 2RAMA 2ZOKB 4GP4B 3DX9A 1NIBA 3QDMA 3JXAA 3MGOB 4OIFA 3MUHL 5F93C 4GAYB 3MZTA 4FL4B 3C09C 4WV1A 4NC1E 5EZJA 2DBLH 5E2WL 2XIIA 5FUOL 4D9LH 1MCOL 3C6LD 1BAGA 1OT2A 1JNJA 3MNZB 5BVPH 5AAPA 3CFNA 2BC4A 3ARUA 3L16A 3T2NL 1CIUA 1WTLA 4JX0A 4M93C 1ZGLP 2R69H 2ITDA 1OD7A 2KZWA 2A7BA 2PTVA 4PVNA 4NP9A 4LRIA 4TV3A 3K81A 4Z7NF 4ZTOL 5DU7A 5FGCB 3D3VB 1ZLSH 1ORQA 3OX8A 3TPKA 1AZRA 1AC6A 1NA8A 1RK1B 1FVCB 2OXHA 4RMWA 1LL1A 2DLFH 4GAAA 1LP9F 3DJTA 1NC4A 1M1SA 1EJ8A 3GI9H 4MLIA 4XX1G 2UUDK 3DARA 2JI1A 3PAZA 2PCFB 5C07B 1XTMA 4E9LA 2XIDA 1ETB1 1D9KC 4HSCX 1WEJL 5C7XL 1A65A 2V17L 4NJAL 5B7EA 2IWFA 3SZKC 4ZFGL 1Y1DA 3EGDA 4LQFL 4HD9A 2FB4H 4JFHE 3FC8A 4Z7WE 3QUXA 3BAYA 3TBTB 4MZRA 4XWOD 1XF5B 4J3VA 4X5XB 1YN7B 2BZCA 1YECL 4K5MA 2B20A 1CBVL 4FZ8L 3W39B 4C47A 2UXTA 4ES9A 1ZTMA 3CLFL 1J9SA 1OD9A 4IRJA 3L3KA 1TJIH 3WJLA 4HJIA 4FXGC 1UWXH 2ZNWA 2D7QA 3TBWA 3DX7A 1T03H 1XGPA 1ZEAH 1HHJA 2VUOA 2H26A 1S4IA 2WKLA 2XXFA 3U0WH 5IMKB 3BWUC 4OVVA 2VM3A 5DGQA 4DKDC 3D2UA 1YUHB 3M1BB 2WTPA 2F0CA 2WNXA 3D30A 4QUOA 5I30L 2B5IB 3LNHA 3FO0L 1QPKA 2VE6B 2GSMB 1AIFA 1BM7A 3A67H 1H6FA 3MLRL 5EF0A 5EZPA 4AG4H 3ULVD 5LKNA 2I9TB 4QHUB 3UYPA 4NRZA 3BZ4A 4M7JL 5BO1L 2E4FA 1A6VL 3DX8A 4AUJA 1OCRB 4HJTA 5IHUL 2GFBB 9PCYA 3NZ8B 1M7UA 1YMHA 5LLIC 4J2QA 1EDYA 2GW5A 1MVYA 1DYZA 2B7DT 1FE8L 3UG3A 4L37A 2MHAB 5CHNA 4WI5A 4HPOL 5HJBA 2J88H 3ZXAC 2JKTM 1BVOA 3CUPA 5F9OL 2D3VA 4HX1A 2HXAA 1CU4L 1MPAH 1CZ8H 3IDGA 3MRFB 4FNTA 1SZNA 1IAMA 3UPAA 5I76B 4IRZA 1HWHB 5F9WB 5F7WC 3GI8L 4HV8B 4Y4HC 3D05A 1DDTA 3FTGB 4FQJH 2XA8H 3T3PF 1ZXKA 2XWXA 4Q14A 3VQLA 5E9NA 4KOCA 1Z9OA 4A38A 2X1OA 2K9UA 3DIVA 3K2UH 4MRCA 3O45B 1WE5A 3H56A 3OKDB 3HG4A 3RGBA 3STBA 1PDKB 3SKUD 1RZFH 2IWGA 4FXKC 4Y16A 2HMIC 2NUPB 1EFXD 5FHAL 2I07B 3PUUA 4BWUA 4DN4H 3BQVA 4ZUVB 2VXVH 2ED9A 4RGMC 4AGLA 3MRKA 1ONQB 4ZMWA 4EN3A 2HJFB 3P0YL 3D2UD 3AXLA 3MPCA 3SKJH 3SY6A 5LDUA 4HS8H 3QJQB 1R75A 1VFMA 4OFDA 1UD2A 5FKAA 3U7WH 1J7VR 2CRMA 3KGUA 1A9EA 1H3WM 2DBJA 2E7LA 2EZ0C 4OGYL 2AQ2A 3DHMA 4M1CD 4OM1L 3UTSA 3HZKA 3GPEA 1NGXB 1OOWA 3L1EA 1PLGL 1TQUA 3QO0B 2AHIA 4ZODA 3ZO9A 1MNUH 1U8CB 5FO8A 3QIWA 2CDFB 5DZOA 1F4XL 5ENWA 5IROA 4XVUD 2ZX7A 3BN3B 3AREB 3ZL4H 1FI8C 2NW2B 5HHMB 1BOGB 4DW2H 1KJMA 3QA3A 4NQVB 2MKLC 2NNAB 1FP5A 3LSOA 4M43L 2IQ9L 5EU5A 3G04A 2AJSL 2WGNB 2EEDA 4KJPD 1XT5A 3B6SA 3KWUA 3LEVH 4YIQB 4JM2A 3RWEB 2E74C 3TO2B 1I7RB 2D03L 3OJVC 4X7SL 5BUPA 5KVMC 1F4AA 4J3OG 3UZQA 4F7TB 5LNDA 1THCA 1OANA 3ARXA 2WO4A 5IG7B 3SQOL 2DL9A 2V5MA 2NDFA 2EIZA 1J8HD 5AAWC 3MVSA 3MFGB 4PVLA 2W8CA 3IJYB 1NAMH 2VZOA 4N8UA 5AOLA 5C07E 4FYQA 4JN1H 1GA2A 3OGCB 4MA7H 4X4XB 1TZHA 3T0XA 4DPAX 5I71B 4HP5A 4LPCA 5DHYA 3N43B 2JFCA 3EO0A 3INUL 2N7BA 1U8JB 4KKLD 1NCBL 1XSKA 4GUPA 1CFQA 3ECVA 4EN3D 5CD3B 1SOSA 3EG9B 3MX0B 1OW0C 3SPCA 5I24A 3BAXA 1QSVA 1T5WB 4BZ1H 1YMMB 1TCRA 3QQDA 3CX2A 1Y1UA 2H8PB 4ANXA 3KYKH 2G5BB 2RBLA 2OL3L 3MCKB 1DN2A 1S7SA 3FQRA 4HCFA 2AQPA 2YLKA 3QCUL 3PQYE 3ROLA 1LYQA 4BUHA 4TVSa 4MNQD 4JANB 4JGUA 3P73A 4HBCL 1LNUB 2ZX6A 4R7LA 3RTQC 3ZRCC 3IVKA 4MQ7B 2MOVA 3I2CL 4K7FB 2K7PA 5AENA 3QIWD 2B1HH 3ZKNC 1UADC 1UOWA 5IROD 2HG5A 3CCHA 5IFHH 4P4KA 3JQOB 4IJ3B 2X41A 3IFOB 2OZ4H 3V4VH 2FYVA 4IU3A 5SV4A 4Z7WA 2DM4A 4QAWA 1MRCL 5DVLA 1UXWB 4JDZB 1ZLWK 3VXPB 5IW6A 3VXRE 2WLLB 1M4KA 5FDWB 1FNAA 3O3DA 4PJCA 4FKKA 4JM2D 1L7TH 1U58B 1JXFA 5IVXF 4NRYB 1HYSC 1BIIB 2NLJB 5T1KD 5DYOA 1H8NA 1KN4H 2CGRL 1MXGA 1F6FB 1TVBA 2C7FA 2C3VA 2GG1A 3DO3A 1VZHA 2FJGA 3LDBC 1KEMH 3WTUA 1VZGA 2GT9A 1NMCB 4YL4A 1L9OA 1T0MB 1FF5A 4GKNB 5E8EB 5HGAB 4H2CA 2HYMA 3ZUCA 2HLFD 3B9KB 3MRLB 2GTZB 4U4IA 5C0RL 3U46B 5D1ZB 5T1MA 5FYLE 3MBXL 4YHZH 4HOMA 1J5HA 1CGUA 1QEWA 4H8QA 4Z95H 4G5AA 4GXUM 3EJYC 5C0AB 1KGYE 3OXSB 3CIQA 5JYMA 2EYTB 4BUQA 2ZOTA 2KQNA 4AYDC 1ILUA 2LLNA 4GLRI 5AL0A 3WTWA 4J7RA 4JMNA 1LDPH 1FZJB 2OR9H 5DTFA 1KB5A 2C1OA 2QELA 4GYBA 2FEJA 4HEPG 3O41B 4GRLB 4E41E 1MELA 1XH3B 1IBYA 4ZQKB 3BP4B 3MJ8A 4BJLA 3P4OB 2J73A 1BZOA 4XPAL 3U0PB 2GKIA 1PYWA 2W5PA 4LAQH 2VXQA 1O6SA 2HTKC 2MCMA 3VFNA 4KO6A 2FBJH 4PW3A 1WISA 1OCWL 3Q44A 3C5ZB 2VLRA 4IBSA 3BT2H 4QKXB 5EOCJ 1SYSB 3C5SB 4N3TA 1URZA 1KBWA 4N4YB 2OSLA 4S0HA 4F33A 5HHQA 1U2YA 3MNMA 4NNYB 2OMXA 3IMSA 1UGKA 4G2AA 2X70B 3LKNA 4IKLA 3ZE0F 1G7QB 1DVFA 1MZYA 4PUBL 1KPVA 5E6RB 2ZSVB 3KPRB 4HZ1A 3PDDA 4FHJA 4L9LA 1INDL 3OKOA 5EWIH 5B39B 4ZTPL 5D5MB 5EORL 3ZW3A 1Z9PA 2HRHA 3SDXF 5BZZA 1KGCE 1BA9A 1MCEA 1CLOL 3LS4H 4PRNA 1KY7A 5E0FA 2DWEA 4R5TA 1EJOH 5I16B 2OA9A 2PCPB 2Y6SD 3KPQB 2D2CC 1YEGH 1HILB 5CD5C 1LJMA 2PN5A 2X4PB 3WNOA 2UZXB 2XQYA 4KNTA 5BRQA 3LKSA 2A9CA 2CJTA 1ACCA 2VDLL 2ESVB 4IBZA 2XWCA 4WFGD 3OAYH 3SKNB 3L3GB 1HHHA 1HQ4B 3MRPA 4GEJA 2O5ZL 1AACA 1IGYB 1JZ2A 3SJVA 3S35H 1NFIB 1DL7H 1U8QA 1ZCRA 2CBPA 2ZXCA 3HS0C 4GG6A 4W9LC 3STLA 2FIKB 1RPQA 3FT2B 2Z7YA 2HX9A 4H0HB 2PYEB 5AFAA 2FO1A 4RFEA 3W0WB 4H26A 3TGXA 1FVDA 2X4NA 3DOSA 3EYVB 3N40F 1YMME 4KI5E 4HALA 5HSFA 3RL1B 5I0DA 4HIPA 3VFTA 1KLGB 2EDEA 3U1PA 5DJYA 2G5RA 1BOYA 4O2EA 3GNMH 4FG2A 2VXSL 3W81A 2ATKB 1WA0X 4O02L 3JWOC 4EIBA 3DNKA 3FHEA 2FHBA 2VLRD 5DUPH 2OLDA 4PYGA 4OQTH 2NYKA 1CQYA 2F9BT 2ID5A 3NDZE 1F6AA 1JRHI 3V2AR 1G9NC 2XHNA 5TDOB 4YHNB 2HJLB 5DLLA 2R29L 5TE7H 3VMNA 2YXFA 1T1YA 4KRPD 5A3ID 3DGGA 2H0PA 4DTGL 5BXFB 1UB5B 4NT6A 5KVDL 2HKFH 3GBLA 4OCSH 1P84K 2Z91A 3GRGA 5CO1A 3LZFH 4WFED 5ACLA 5J6HA 4FLQA 3ZKSD 4EZLA 2EDWA 5CLYA 3ZYZA 4D9QE 4Z3TA 3T9WA 2C3HA 1S78C 4H20H 4WEEA 2K45A 3DSNB 3PQYA 2Q6WB 4XBPB 5AEAA 7FABH 1N70A 4HUKB 2BFVL 3WS6A 6TAAA 3CVIL 5C2UB 3BCFA 5D4HA 3GIVB 5I1DA 3KCPA 3UYRH 3SGEH 4ANUA 1IKNC 3QHZH 4MD4B 4YHIA 5I8OL 1UB6B 1H3XA 2Q8BH 3IDIA 2DQIL 4IIZA 4GEIA 5JUEL 3RUGA 3S6CA 2OL3B 1NIDA 2J8HA 2NYYC 5GGUA 3VXRA 5I75B 4UTAA 4RGOL 4OV5A 2R2CA 5J13C 5DA4A 4TKWA 4G1EA 1KLFA 3SDDA 5I1IL 1U3HD 1H3PL 4FI6A 3D4CA 5HDRA 5C0AE 1JGIA 2WWKT 4N1CA 5CILL 5T1LB 2ZSWB 4F2MB 3T04D 1BFVL 2IFFL 2BOCA 2DW5A 2Z4QA 4Z7VF 3WXWH 1JWSB 1J9QA 5EU6B 4CUCA 4LEOA 1OQXA 4WFHD 3U7YH 3QRBA 2C9SA 3GSWA 2UZYB 2E8ZA 3E6FA 3L95B 4I3RL 2DM2A 1S7QB 3GJEB 1EV2E 5ITFA 2HN7B 1EA9C 2NY1D 2J43A 2E56A 4PR5B 4RVBA 2EP6A 4NQDB 3FFCB 1BF2A 4XNDA 1IC4L 1PL3A 4C57C 3HZYA 5JHLH 1NCAH 2Z64C 3ESVF 3VGBA 5FK9B 5TK2A 5PAZA 3S34H 4NO2B 1ZSHA 2XV0A 5DMGC 1C7SA 2XSKA 2A9NL 3PXJA 3HAEB 4XPGL 5E4OA 2ADYA 3K0WA 3A6OA 2DF3A 5GSVB 1CC3A 4OCXL 5EU7E 5GRVL 3OZ9L 1DVQA 5D4QA 3RVVC 1NL0H 5FO9A 5D2LE 5DZAA 4OH2A 5JPNC 3X3GH 4ZNEA 1KPUA 3GXDA 4OLUH 1XAUA 3SCMB 3EH3B 4D3CL 4E41A 4AK2A 2CO4A 1KV7A 3TONA 4UIKH 1V3MA 5E0QA 4Q6KA 2Q86B 1ZAGA 3KPRE 1NDMA 3V5KA 4Z78A 2EDHA 4Z6AT 5C6WH 4LPUA 4KK8D 4ZDHB 2I9LA 2J55A 5JOFB 4WGVB 3KD4A 5K9QG 2OR8A 4JO3H 5TK4A 3MU3A 2G60H 4MB3A 4WI4A 5D5ME