4IBSA

Human p53 core domain with hot spot mutation r273h (form i)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
193
structure length
193
Chain Sequence
b'SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVHVCACPGRDRRTEEEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
molecule tags Dna binding protein
source organism Homo sapiens
publication title Structural studies of p53 inactivation by DNA-contact mutations and its rescue by suppressor mutations via alternative protein-DNA interactions.
pubmed doi rcsb
total genus 43
structure length 193
sequence length 193
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ibsA00
3D07A 2MEJB 1EANA 1E50A 5AOMA 1TSRA 4IJTA 3D09A 3WTUA 3US1A 2XWRA 4LO9A 2BIOA 2XWCA 1KZYA 5ECGA 2ADYA 2FEJA 3WTXA 2IOMA 4KVPA 4HJEA 5G4MA 2BIPA 5A7BA 3WTSA 5LAPA 2J1ZA 4AGNA 4IBZA 3QYMA 5LGYA 5KBDA 1HU8A 1EAOA 1UOLA 2BINA 2AHIA 3D08A 5AOIA 4AGQA 3WU1A 3WTYA 4L0YA 1YCSA 4L0ZA 2BIMA 4GUOA 4A63A 3KZ8A 5G4NA 5AOJA 4G82A 2ATAA 1H9DA 2X0WA 2J1XA 3Q01A 3WTWA 2PCXA 3QYNA 4IBUA 1IO4C 5AB9A 3VD0A 1T4WA 4AGMA 3US0A 2IOOA 4IBVA 4IBWA 2OCJA 3Q06A 2X0VA 4AGOA 4L18A 1EAQA 1LJMA 5BUAA 1TUPA 4QO1B 3WTVA 4IBSA 3KMDA 2J1WA 1GZHC 2J1YA 4LOEA 2IOIA 3D06A 3TS8A 3IGLA 4GUQA 3D05A 1HJBC 1HJCA 4G83A 5ABAA 2X0UA 2WGXA 4MZIA 2H1LM 2RMNA 2J21A 2VUKA 3EXJA 5AOLA 2GEQA 5G4OA 3WTTA 5AOKA 2P52A 3EXLA 1GZHA 3VD1A 2BIQA 3D0AA 2J20A 2J6WA 1CO1A 2AC0A 4XR8C 3Q05A 3IGKA 4AGPA 3VD2A 4LOFA 4IBTA 2YBGA 4AGLA 1CMOA 3ZMEA 4IBQA 4MZRA 4IBYA
chains in the Genus database with same CATH superfamily
3B3BA 2K8QA 4H26B 3ULSA 3GSNB 3V0VA 4W9GC 3FQ4A 3OQ3B 3LHPH 1LO5A 3D85A 5DUPL 3BT2H 4BEIA 5HYFA 1INQB 3VI4E 3IJHA 5AW8B 4P2OA 2OR9L 4DEPB 5E5RB 3V6ZA 4Y9CA 5D1QE 5BZWA 5C0AA 4AL8C 4I4WA 2YWZA 1YC7A 4Z7NF 2QHLA 3BOVA 4RGOL 3T09A 4DGIH 1U4EA 3L48A 3CFEB 5FYLL 2I60H 5DZVA 1G0DA 1G94A 2CNZA 1T2QL 2FWSA 1E67A 2VDPH 5IB3B 2DM4A 2VRAA 5AVXB 3B2UD 1PZ2A 4AGQA 3Q44A 1UOVA 4BFEA 3AT0A 5ICZA 3WU1A 4P99A 3KNBB 4DN4L 5E6ZA 2CO7B 2X89D 3PWPD 2IJ0C 1UXLA 3UC0H 1M9WA 2GK2A 4L5FL 2EE6A 2EO1A 3WFDH 1A7RL 3FU8A 5EU3A 2YPVL 4OCMC 4QDGA 5ID1B 2GTWB 2ZKYA 3WNMA 3MV8D 1IKNC 1N19A 2A9DA 2DJUA 4HBCH 2CO1A 2V4LA 3HC4L 4Y4HC 5C97A 4MA7H 2X1PA 4MMXA 5AZUA 2DLHA 2ORBL 1BBJB 3P0VL 5E9DA 4OTXL 5FGSA 2BSEA 2L7JA 5T1DL 2H3NB 2MCAA 1I4FB 2ZAGA 5F7LB 3WI9A 4BH8B 4U1SA 1YAIA 4GIOA 3PU7A 1U8KB 5IW6A 3MRGA 4NM8H 4CSSA 5F1OB 5HJDA 1OT2A 2BH0A 3OWEA 2ZUTA 2ZOUA 5JW3H 2FK9A 4JANB 4NAQA 1NFDA 4JY5H 4LU5H 3EJZD 2YA0A 1A7QH 4JE4B 4OAWA 4DEPC 3IDYB 4AVIA 5T1KB 1BZOA 3ILEA 2G5BA 1FL6B 3H6AA 2AXGA 1HS6A 3MLWH 4HUUA 4X83A 3VFRA 4Y4KC 1UJ3A 3L81A 2BP8A 3FOMA 2OTWA 1AZRA 4OSUL 3WTTA 4ZD3H 5JXAL 3T6XA 1XR9A 5CINH 1KB5B 1CIDA 1JV2B 1KXTB 2UZIH 3L5WA 4E0RA 2MOQA 2K6ZA 4DO5A 3WSQL 1RZQA 1XD1A 5B1BB 4LCVA 4PRDB 4B5ZA 5FYKE 5CM1A 3IDNA 2Z91B 2ZP8A 1HXKA 2VLKE 1TTBA 1HOCA 4CMMA 1CVRA 3DX4A 3P11L 2Y23A 2CLVA 4OFKA 4IBYA 3CBRA 2Q3XA 4LSVH 1IGYB 2WWOA 4QAWA 4KZEL 1JXGA 1RP8A 1BEYH 4FQJH 4MA8L 4PW4A 3RIKA 3NJHA 5JHBA 5DD0L 2BSTB 3LCYA 3TX4A 3VFWB 1UOWA 2MMXA 3FO2A 4N2OA 5I0VA 4XP5H 5FC9A 2O6FA 1VGEL 4L8DA 4LIQH 5IQ9A 2XXMB 4QNPE 4XN4A 3F3HA 1FZMB 1BVNT 5B8CA 1I1RA 1TZIB 2PNDA 3SPIA 1UM5L 4G8GA 4NQCB 1E3XA 4K55A 1I1FB 3GIVA 3ZXAC 5J12B 2V2TA 5D70H 4GAJH 4IDJL 3IGAB 3B2PA 1U8PB 4G42A 4JO4H 1R24B 4JQXC 5B1JC 3VNZA 3C2AL 4PBVC 4BK4A 4M1CC 5E2VH 3U6RA 2OZ4A 4L3EA 1PBYA 4AC4A 4UIKL 3RA7H 1K2DB 3BYTA 3ESPA 4NUGH 1FSKC 3MLYL 1ADQA 4L8CA 5AG9A 5AB9A 2VDMH 4DEUA 2TRHA 2FZ3B 2RFXB 4ZPVA 1MCWW 1W9XA 3EF4A 2X10A 3NQKA 1F3JB 4HWBL 1TFPA 2AK1L 1SYVA 5EZLA 1B2WL 3HUJB 3QI9D 4FI6A 3FO0L 2C3XA 5GS1C 2LABA 1OCWL 1EAQA 5HHOB 5ENWA 2CUIA 4FCAA 4Y4FC 2NQ3A 3TA3A 4LSQL 2VIRB 3SPCA 4D0CA 4IKJA 2Q1EA 3ZGIA 5FYLD 1MNUL 4TYUA 3RKDC 1L9MA 1ORQB 5KVDL 4CU7A 1XR8B 2BO0A 2YGPA 4JM0A 1RERA 2W0LA 1OQOA 4YE4L 4YS4A 3GUTA 3OKKA 3QIUA 1ZT1B 3AAZA 1YQ2A 3QDGB 2DWXA 2ZKMX 3NCMA 4TUOB 4LESA 5C07B 5JXEC 1PDKB 4PVMA 5EZOH 1HVXA 4U05A 1INEL 2VLRB 4Y5YC 4PJ8D 5F3BA 1AFVH 3IBOA 2RH0A 4DCQA 3EYVA 3BGAA 5GRXG 4OLZH 2WY3B 3X3FL 3X1FA 4FYQA 5CWSA 1TITA 3F6LA 4YX2L 2CPUA 1LMKA 1MHHB 4LIQL 1YY8B 2QADB 3S5YA 4NGHL 4BFRA 2JQZA 1LQSR 2H32H 3D87B 1T5KA 1XGRA 5GRUH 4XRCB 3RVVC 3W39A 2XVLA 2FZ3A 2RFXA 2XVBA 1NANH 3KPQB 3N40F 3FT2A 4LASL 1QSEE 4X6FB 1OPGL 4ZTPH 1IGCH 1IIIA 4J3BA 4WI3A 5CFHA 5E2JA 2R1WB 1QUNB 5KYYA 2IAMC 1BM3H 3FRPG 4YHPA 1HQ4B 3Q5TA 4F92B 5AZEL 1TPXB 3TVMA 2VQ1A 3T6ZA 1QUNA 5KYYB 2VXQH 2YD8A 2DQDH 3IU3B 5I6MA 3KBPA 5D7JD 1VESA 4HCIA 4ENED 4HWBA 1E5UI 1CL7H 1P7KB 1OGAE 2CKBL 1MKFA 3O6KL 3GSWB 4GFXA 4LCWE 3S35X 2G4GA 4ZAKD 5B8CB 3OX8A 3C6SB 1I1AA 1UA6L 5KYWB 4Z1PA 4RNRA 2PN5A 1CD9B 1FYTE 2BIMA 5C7XL 4YBQC 4DP8X 3V55A 4FYRA 1G6RB 5DO2C 1E6JL 4DSYA 1ZE3H 3B6SB 3QPQC 4FEIA 1EO5A 1R0AL 2CHDA 3FO9A 3PPSA 3VD0A 4R90H 3ATFA 5DD3H 3S96B 3S2AA 2WLLA 4PRHD 3L9RA 4XPHH 5I1AA 4RGOH 2OLDA 5IMLB 2VKWA 1QEXA 1TG8A 1Z3GH 2AJUH 4Q7DA 4B97A 5HJBA 1JXJA 1UM6H 2OR7A 5EOCH 2YZ1A 4IRSD 1NFDF 4N8VB 2AMGA 3MGAA 1FN4B 1B4JL 4YC2C 3FAWA 3AREA 5B8CC 3ZTJG 4PJ5D 3MNDA 3CH1A 4B0MB 5H4ZA 5H35A 2W65A 1CE6B 2DL2A 5AVWB 1TJIH 4GQPH 1T04A 2ZUQC 4O02L 4ACPA 2X3BA 1XXFC 3VD7A 4D0CB 4A2EA 1KXVC 5GJSL 5GZND 3HRPA 1CZ8H 3VFRB 4HUWB 3BP5A 4ZFQA 4R2GD 1A4KA 2NSQA 4NQVB 3RLSA 1WUZA 5B39G 1TYRA 2YUZA 4S2SB 1ZLSL 3RFZB 4ZDHB 1G1KA 3NZSA 2IV8A 1Y07A 5GGRA 3D0VA 3FU0A 2BC4A 1GZHA 2BIIA 5FDWB 1MIEH 4FQPA 3QUXC 4PJEA 1M71B 2HAZA 2XU9A 1EBPA 1HT6A 3NIGE 3CN3A 3NQIA 2BW5A 3Q3GA 3CVIH 4K7PL 3GLAA 2QVMA 4LLAA 3CHXA 1CD8A 3NSYA 3U4EA 2X1XR 5ANMA 2FT8A 1ITCA 4MBRA 3UMNA 4CSZA 4MMZA 1I1FA 4M5SA 2PCYA 1A7QL 4S0TD 1SJHA 2ZKXA 3K71B 5ALCL 2AQ1A 2C9RA 2IH3B 2W60B 3ZTCC 4OLYH 2V2WA 4BDVB 4KVCH 3LQMA 1JZJA 3QUKA 1NCUA 3VFTB 2ZX5A 1NJ9A 2APVA 2XSKA 3I50H 3T3ME 1KBGL 4LK4A 1WLHA 2VDNB 2OL3L 2TRYA 4O2EA 1IFHH 5CINL 5I19L 5IHBA 1JWUA 1NCCL 1M4KA 1FGNH 4P3CL 3IFNH 4IK6A 3CAFA 4R7NA 1ZVYA 3FMGH 1F90L 4R9HA 5FW7A 1Q0YL 4LOUD 5LGYA 5E1AA 4P2AA 2C34A 1NDGB 1FVDB 3MZGB 3OF6A 1NBQA 5EEVA 4K5PA 4PW3A 4OKDA 2BFVL 1G9HA 5L7XH 1Q9OA 3VFOB 2NZ9D 2DPKA 1IBGH 3HAEB 2AV1B 3D8MA 3QHTC 2Z8VC 1Q9LB 3EOYG 4Y1AD 1AJ7H 3IDNB 1CURA 4PJDE 1TU2A 4QJ4B 3VXRD 4QRUA 1FL5B 4TVPE 2SODB 3NGBB 1VZGA 2H6PA 3SDXE 4XC3H 4NZ8A 1OGTA 2R51A 2FVNA 2IGFH 2YMTA 4FMKA 3ULSB 3L4YA 4RESB 4M5TA 3FOMB 1SUHA 1KPRA 2BP5M 5D2NC 5C0AD 5ABZA 4KKRA 4F3FA 4NZTL 2RD0A 2IAMB 3DHMA 5C8JB 2Q86A 3TPUA 2MWCA 2W9EL 2VKXA 3HNVH 3SGKA 1BZ8A 4XNQA 4FS0A 4FI8A 1R4XA 5DUMH 4KO9A 4HJJL 1X7TA 1KGUA 3TGXA 4O2FA 3KWVA 3M17A 3FU3A 3T0AA 1DO5A 4N68A 2A73B 3RPIA 1TVDA 3X14B 4FTVE 1QWUA 3NIFF 1DJZA 2OMZA 1U21A 1DEEA 2FWUA 4N2HA 3SZKC 1JZFA 5HI4D 5CZXC 3PQYE 4FG4A 3K2UL 3IETA 4PRBB 2FJGA 3TV3L 1BZQK 3VWJB 3LY6A 4W93A 5CGYC 1AR1B 4PJCB 2HTLC 1IBBA 1CLYL 1U30A 4KJYB 3GXUB 4JKPH 1TTGA 4TF4A 1DE4B 4JNXA 3MRFA 4JJOA 4P59H 3HG2A 2ENJA 2D03L 2PCPA 5CSGA 4P4RB 1UCBH 4FHKA 4BGLA 3N0AA 2SEBB 3X3GL 2GSGB 5DLMH 3HAEA 2OJEA 4GIPD 2LFEA 1XGTA 4MD4A 3VXNB 1BX2A 2H2PD 4E9RA 5FECA 1FZKA 4WHTA 3C60B 1ES0B 4R26H 1PX4A 5H8DA 4LHUB 3PWLB 3QXTA 4X6DB 1OB1A 3R1GH 2IQAA 4JFZH 5HYQB 1TEYA 1BZ9B 4JFTA 3B7YA 5B22A 4JRXD 2NOYA 2ZOOA 4IKNA 4OJCA 2EACA 5EC1A 1SDYA 1EHLH 1NINA 5FDYA 3SE3C 5D1XD 1CXKA 3WTXA 2IXQB 3STLA 1BIHA 2VO5A 3BKCL 3BXNB 2ZWNA 5C0CD 5FKAA 5I0DA 5I8CA 1IQWL 2VLKA 3KPMB 2H32A 4B9JA 1J05A 3DO7A 5MEQA 2Y7MA 2NNAA 3AT9A 5CN1A 5ACZA 4HWZA 5HDBE 2K0RA 5GZOC 1JZ2A 2CJUL 1NBZB 3R4DA 1K3ZA 3G6JF 2VLLA 2I24N 1T83A 3SQOH 5KN5A 1F8TH 2UWEE 4O00A 4H26A 2WBWB 1VEMA 3LIUA 4OIIH 5F7AA 1L0PA 1R6VA 3WNLA 1FNEA 4AG4L 5IVXA 5JHAA 2IPKB 4XN8A 1MAMH 2Z34A 3VWKD 2JCCE 3O6ML 4Q58C 4F15B 1SQ2N 1EJOH 4JGMA 4R6UA 1Q1JL 2WSKA 3Q01A 5JXEA 2R59A 4PGDA 5HHMD 5C0IA 2O6EA 1BWMA 2X4NB 4AI7A 3GSQB 1RVFH 2RQ8A 2VQTA 3O4LA 5FGCE 2XV2A 4Z7VA 3EHBB 1JXKA 3MBXH 4X6CB 4E9YA 2JQMA 4NQVA 1D5ZB 1KPUA 1A14H 1F41A 3ZU8A 2C1OB 1OM3H 1P4UA 3VGBA 1QFOA 3KCPB 4DO6A 2H6PB 3FQUB 4PJXA 4ZW6A 1P4BL 3QJRB 3S4SA 1NUNB 3ATDA 2GITB 4ZG1A 3EJJX 2VGLM 5SWZD 4OQTH 3BO8A 4CU8A 4ZNEE 1MCPL 2XWXA 5FAAA 4BHUA 5I24A 4TNWK 2MNJB 4PTTB 5DQ9B 2NY7L 3U1SH 2BHFA 4JHAL 3HI1B 3IU4L 3U46A 4X50A 4HIXH 2H1LM 1JGLL 4FC3E 1HHJA 2E9IA 1KJVB 1PSKH 2ZOLB 3BUYA 3HMXL 3BEVB 2BRRH 3PXLA 5KVDE 4I7ZC 5C6TH 1KMGA 1ZGLP 2O6CA 5MERB 3P4LA 1A1MA 5B1JA 3REVA 5D7JC 1MCOH 1JZ7A 1SOQA 5CD5C 3BPNC 3T6VA 1JWUB 3NIDB 3RVWC 4YHMH 2HVKA 3MLXH 3GSOB 1P84K 4HZLB 3FK3A 4BZ1L 4LBEB 2XZCL 4FQQB 1WSST 1P2CA 5HHMB 2H3KA 3HE7A 3B9KB 3LIZA 5A43C 4ODHH 3MGTB 5MEPB 2B20A 3WKNA 3F5WB 1CN4A 3OXRA 3FQRA 4U6VH 3DV4A 3ZYJA 4NQCE 1LE5A 1TETH 4JHWL 3IJ7A 1E4XL 1Q0EA 4OZIA 4ZX4A 1BF8A 4OFVA 2ILLA 3FBQA 4KJPD 3REWB 3TJHC 3VXTA 4TNWF 4EZMA 4HXBL 1U8CA 5KBKA 1A9VA 1IC1A 1W2KT 5IW3A 3FRPA 3SPVB 2WXGA 5F8QC 3VD4A 2IDTA 3EW3B 1PJWA 2FCBA 4HHAA 4AT6B 1KLUB 5DMIL 5C0JA 5KBDA 2J8OA 1UOLA 4Z7VE 2EDOA 3CZNA 2BOCB 3G6AA 1UKSA 1FE8H 4P5KB 4YC2B 1FH5L 2O6DA 5DD6A 2EDRA 1TMCB 1QPXA 5ALCH 2D4DA 4PGCA 3V4VL 3ZE1B 5DSCB 2X4PA 5C9JA 4M6AA 4MQTB 1NCIA 3WIHL 4XP6H 4JG9A 4N9OB 3MXVL 3QUXD 5J3HC 1KYFA 5A2FA 1ZSHA 4MAUL 4Y9EA 4QY8B 1IFHL 4HLEA 4JVUA 4JM2A 4RDQF 1HNFA 3BAEH 3REVB 1ZEAL 5CAYB 3FT4A 1FNSL 3RGBA 3QJFA 3BP7A 4H1LA 1SPDA 1E7VA 1N2RA 4Y88A 2FJFA 5KW9H 3QJZA 1NSNH 1BQ5A 1TYEB 2ENSA 4URKA 3GDCA 3T4AB 3H4FA 3TN0D 3V9CA 1XR8A 2ZG3A 4BQCA 1HHKA 1TEFA 2RTTA 2EDHA 3KWWB 4PP1D 1W72H 4DGYH 3K6SA 2K78A 2NR6C 4J2XA 1XZ0B 4JGUA 3JTSB 2NNXA 4J3OH 1TZAA 4RNRB 4LARH 2NY0C 2VL5B 3GTNA 3NMEA 1PTZA 1LO4H 1O7VA 2PYFA 3B7RL 1SYVB 5SV3A 1QVOA 2CIKB 4XP4L 1TLKA 2VW6A 4Z7VB 5I16A 2EDMA 4YDIH 4QXTA 5EU5B 1QLFB 3KWUA 1NCHA 1WEJL 1KCRH 3S3BB 1GGYA 3VD5A 4PJXF 3T2NH 1RK0A 1E3ZA 1I8AA 1QFPA 1Z5YD 2OP4L 5FO9A 2OZ4H 2VN5A 3QK0A 2H0EA 5AYTA 4QOKE 4U0RC 3VFGH 1BYOA 3GDBA 5KYUB 5IV2B 1KTKE 3E8UL 1GJUA 4KAQL 3QORA 4WFGE 3FL7A 1YY8A 4M7ZB 1HI6B 1JHTB 1REIA 3ULUE 1UQSA 3WEMA 3LQAH 4HZLA 4ILDA 4PTUB 4U4BA 2VLKB 2HFFA 4NNXA 1CYXA 1AGDA 4GSQA 4HIQA 1A6WL 3WIHH 3BIKB 3PWNB 2DLFH 1Q1PA 1NEPA 1HOEA 1LDPH 3MV7D 4R7DA 1T1XA 3U0WL 2JTDA 5DGQA 2CCVA 1ZLWH 5I82A 2AEPL 3X3GH 3GGWB 35C8L 1KPVA 5JPNA 3CZKA 4HS6B 4AK1A 1QEWB 3WE6A 2WQAA 4NM8L 5IEKA 4R5TA 2K4WA 2G0KA 4X9GA 4LCWA 4JVWA 3FQXA 4P4RA 5HDQH 4PRDA 3OAWA 4HD5A 4OF8A 1XGQA 3FQ2A 1PYWB 1IGJA 4PS4H 4XX1E 1DQML 3BKCH 5AW3B 3LS4L 3QWOA 5IMKA 4LSUL 3KPRA 5E2WH 1VFUA 2ZSVB 3MGOB 4FXTA 4RZCB 4Y2DA 3C5XA 1D5ZA 3F7YA 4B9GA 4WVRA 2ZUUA 4KTDL 4MJID 1TMQA 3C5ZD 3GBNH 4APQD 1HHGA 3B2VL 5CBEA 1M3IA 1ZV5A 2A73A 3RPIB 3X14A 3E2HB 3L9YA 3L95B 5DFVC 4JHVA 1NFDB 4PG2A 3SGKC 2H0JA 5T3XD 3SEPA 1C5DA 1JN6B 1W0YT 2Z7UA 4PV9B 4PYHA 3N6YA 1KT2A 5IB1B 1ZXKA 4NP9A 3AADB 1WK0A 3KYMA 1ESOA 3V4PB 4Z77B 2PWGA 1Q72H 1RLWA 4FP8L 3N42B 5F21B 3T8VA 1A6TA 4UM9A 5F7DA 3TO4B 3O3AA 3GHBL 4W4OA 3GSNL 3UTTE 5CJOL 2HJFA 2R69A 2F74B 4HPYL 4OCWH 5DI8A 4PCKA 4DOHE 3QB7C 1F45A 5MEQB 4G11A 4XP9H 1ZVSB 3GMQA 3EDJA 4H20L 2OAAA 4X8GA 1M6UA 4LL1A 4FNPA 5TE6H 5AVUB 3WENA 1SGKA 4LOUC 3QNZA 4H88H 2FSEB 4ZW5A 4LSTL 1ZTXL 4D2NA 1FVEB 3QRLA 2CRZA 5C07E 3U9PH 3RWGA 1RZFL 4JREB 2F8VA 2JJUA 2UVFA 2DKSA 5EBLB 4H0LC 1HL9A 2NXZB 1QHPA 1C1EH 4GRWE 3FYIB 2DYPA 4NERA 3WEOA 4EIBA 3MOQA 3TF4A 5KVGL 2FNWA 4EQ3A 1G7PB 4YPJA 4TPRL 4H2CA 1XGPA 4OZFH 3L45A 1FVEA 4YDZA 5A2KH 1MCOL 1WV7T 3VFTA 2IDUA 3J7HA 1HSBB 2NUPB 4GAAA 1S7XB 2CG9X 3DX0A 1BQLH 3Q9QA 3QDJD 3WFCL 1DBAH 3ETBJ 3SKOB 1AD9A 2ZSWA 1NFAA 3D12B 1ROWA 1QTSA 1YEFH 5IFHL 4HCRA 2XQYA 4GB9A 2AHIA 4WO4A 1T5WA 2FLBT 4PLNC 5JHLL 1SJHB 4ZMZA 2R23A 2V5TA 2VLJB 5F96H 3EJQA 5D2LE 3FRUA 3AJ7A 2F0CA 3KYMB 2XV3A 3QUXA 1UB5B 2E46A 3C5JA 3QZLA 3U4EB 4WHCA 1XH3A 4NC2B 4YGAB 4XP1H 4DKEH 3HLKA 3KDMB 2YA2A 4CU6A 1DQDH 5HD8D 4HKBB 1YVLA 2AXWA 1ZTMA 4G6KL 4L2YA 3W11D 3WXWL 1NFDE 4X7SL 1XMWA 1F4WH 4HISA 1J5CA 5B1KA 3EDFA 3R7QA 1FFQA 5I16B 5LB1A 5I1HL 3K6NA 4G8AC 4XH2B 2DWDA 3EF7A 3LEYL 3S5LB 1UZ6F 4K3DH 5E9DB 3B8SA 2DLGA 1QWNA 1PGRB 2IAAC 3GSNH 3QR1A 4Y2DB 4Y19E 3H3PH 2W0KA 5ISZE 1XZ0A 2ZUSA 2G9HB 5GGVL 5J5EA 3CXDL 3ARGC 4A1RA 4FABL 4Y4KD 4AQ1B 2EE2A 2YAFA 3CBKB 3F7PC 2QSTA 3FN0H 1SXAA 5K93A 4IJ3C 4PP2B 5C09B 1M7IA 2VYRE 3QR0A 1KULA 4LVNC 4ACTA 1ZS8B 5BV7H 5KTEL 1BIIA 3PF2A 5K5YA 1UVQB 5IESL 3QEUA 2P24B 4L5FE 3P4OA 4RMTA 4Z7OE 3BFOA 3VX0A 4PGBB 4AW7A 2OR8A 2GHZA 1PCXA 1A6AB 3BAJA 2EQDA 5GGSB 4EIZC 2APTA 1VKXA 4YL4A 1G1YA 2Q9OA 5AZEH 1KCWA 2TSAA 3QDGE 1NCDL 3A47A 2CGRL 4P07A 4TUUA 2R39A 1I8KB 8PAZA 5JW5B 1H5BA 4UU9A 4HIPA 2DLTA 4ENEC 2UZYA 2MRYA 3HMXA 2IDSA 4PJ8C 4MZRA 1HWGB 4AIEA 2IH3A 1ZLDA 2J5LB 1BQLL 2UY6B 2PPAA 3UTSB 5DJ0A 3TOPA 4RDBA 1HEJC 1W0WB 3T0BA 2BNQE 5CHNA 5C0JB 2AEQL 1TJHL 4WGVB 4RDQG 4JCWA 4P5SA 3FT9A 1YEJH 5L9DH 1WFJA 3QDAA 4V2CB 4GP4B 4DWHA 1KCRL 4HV8B 1O9WA 4XGZB 1V5JA 4W9EC 4ATTA 1JYNA 4XP1L 4P23C 1UT2A 1ZAGA 5A2LH 2Z93A 3QWRA 4L9LC 3MFFB 1TCRB 2CGYA 2OS7A 3KPSB 3NCCB 2AJUL 1VCAA 3GUFA 3DV6A 2CIKA 3FQRB 3RFZA 5K9OA 5EOCL 1JZ8A 4QXVA 2GUOB 4LFHG 4LCWD 5DD0H 1R47A 1QBLH 3IDXH 2MPAL 4NKOA 5IB2A 3ETTA 3EH5B 2ENPA 5JXED 3NIGB 1UC6A 2WLZA 1IBZA 3AVEA 5E94A 3CH1B 4ABWA 1UXWA 2JVUA 4LPTA 1EXGA 3BPLC 3N42F 4I89A 1UUNA 2R0ZL 5DJYB 3QQ9C 3U48A 2HP4A 4WRLA 4FFZH 1T3FA 5AW0B 4JN1H 5EB9A 3QPQD 1F11A 5D7LE 4MNGB 1UFUA 2IFGA 3HI6H 3KPOA 2XA3A 3MLSH 3OAUH 3QUMB 4F33A 3WS3B 1D7CA 3GRBA 2K9FB 4H1LG 5FHAL 4YDLC 5JPMC 1OAQL 1V3MA 4XE5B 4K7PH 1J5IA 2QQLL 4P3DA 3QWNA 1ORQA 1WA0X 5FX3A 1QMUA 3QJXA 2FJHA 3FTSA 4YZFE 3SDYL 4RLDA 3F8UB 1QO3A 2Y7NA 3LXUX 5IB2B 2XY2A 3FQUA 3DX1A 2FE0A 4LLUA 3AM8C 2WLKA 4WO4C 3TJEL 4KY1H 3UC2A 3HHMA 1KPUB 2AK4E 1CT8A 4MQXD 1HIML 3LH9A 3O3EA 5DYOB 4UILH 2RAMA 2MNWA 3WHXB 2G3MA 2EIBA 3ZO0A 3NJMA 4EO5A 1CLZH 4PAZA 1RUQL 1MW1A 1AANA 3D0AA 1A6VL 1FL3B 1FV1B 4AIOA 4NWTL 5ITBL 3RZCD 1ZLVH 4BWWA 3MNVB 3VD2A 2QKIC 4KVNL 1SYSB 1GXEA 3FQTA 1K4CA 4FDWA 1DBKH 2RB8A 3WFHA 4X99A 1LEGA 4ALAH 4KZCA 4F7EA 4XVUD 1DUZB 1JXDA 1RLBA 2JKSA 5GHWH 3V10A 4RQQA 5KSBA 3TN0A 5EIIG 5LGKA 4YHLL 3HE7B 5GRWA 5I1EH 2B16A 5ICYA 4UQ3A 3ZDYE 2KPNA 3DK0A 4S1SL 3T0WA 5IQ9B 4KQ4H 4XZUA 2JKXA 1GIGH 1V3JA 2F19L 1RIUL 4MB5A 5LBSA 5A40E 2YPVH 4P2QA 5C0GB 3SE4C 4JDVA 5E4AA 1VLXA 2BVYA 3FC8A 4LEOB 4TLSA 3VG0L 2PTVA 4M62H 4OQTA 2N7AA 3IN2A 4RFOL 1PDKA 1D9KD 3KPNA 2Y1YA 5ID0A 1KCUL 1R3KA 2A99A 2ZZUT 2NSXA 5B3SB 4Q14A 4I2XA 4PS3A 2BWDA 3FCTA 5D7LA 1M53A 3U46B 3UX9B 1U33A 3NFNA 1OIOA 2Y7QA 1S3KL 2DMBA 1UM4H 1Y6KR 4TVPL 4N20A 4ODTL 5EOQH 5TQ0L 5HJGA 4FQ2L 5IHLB 4CJ1A 3MREB 3QYCA 5E8NA 4LHJB 5AOJA 2NR6D 4D0DB 1YEEL 1OQXA 2PCPB 1HWWA 3U9UA 3MUY1 3O11B 5I8OH 2H1PL 2XJLA 4LMQE 5ABDE 3QUYB 1KXTA 3UPAA 4AE1A 1OSYA 2Q6WA 1UJTA 3QIWC 2HH0H 4AE0A 2C4XA 5CEZH 3TEZA 1XF1A 2Y7OA 4FMVA 4LHUD 3C12A 2D2CC 2F61A 1FAIL 3K6OA 5IFHH 2BNUB 2Q76B 3OKNA 1RQ5A 2ED8A 3TT1H 5DFVD 2G5BB 2CQVA 1XGYH 1MEXH 2X2HA 3N43B 1U93B 5ICXA 3GYRA 4GPVA 4O2FB 4H1LH 5HI3C 2X40A 5F97E 2A9MH 3SCMC 2VMCA 1N4XL 3F83A 3V5DB 1EGJL 3MVSA 1AY1H 1ETJA 5JZ7C 3Q5OA 2NXYD 4NQDE 3B37A 4L1TA 4WI4A 3VB9A 4YXLH 1LO2H 4P48A 1W72A 4NN6C 4B9FA 3P11H 2NY1D 4N2FA 2C9AA 4X4MA 4GW1B 1L0YA 5CZVH 1MJUH 2FHFA 2ZSWB 4V1DE 3CHRA 1NGQL 5EUOA 1HSBA 5FKAB 1CVSC 4PV8B 5MI0B 1E9QB 4FQHA 5AWNH 4G6AD 5FYJE 2V5SA 3S2CA 2YEVB 1PKQA 3NJFA 3CXDH 1XGPB 1S9YB 4Y4FD 5JORA 3GBEA 3HE7C 2AAAA 3WDJA 4NN5C 3SJVD 4A2GA 1MCLA 1JYWA 1M3JA 3H2PA 2PW1B 3CIAA 4PHXA 4LB8A 3US1A 4AQ1C 2D4FA 4XMWA 2DTMH 1SN5A 1QRNA 1LK2A 3ILPA 3O6LL 4Z0XA 3ARFA 5D2LA 4ES9A 2Z91A 3L4TA 5FUCC 4F5CE 2ZXDA 3W5NA 3NA9H 2V2XB 2H2PC 4ZUTA 5E0FA 2N1TE 2UXVA 1YEEH 2WO3B 1E2WA 2DIJA 2VNCA 3QRGL 3ABZA 3MODL 3R18A 4L3ED 1EAPA 2YPKB 3PHAA 3UOAB 3HG1A 4LPXA 1WAEA 2KL6A 2EXYD 4UWQB 3PDOA 4UNVA 2OA9A 4PWKA 5C0AE 5A7EA 5KVGE 3I3EA 4M48L 5F7DB 5EDXA 3TO4A 3MU3A 4UM9B 2DF3A 1L9PA 3PYCA 1U8HA 4UDUB 3VWKA 3T65A 1U8QB 4C4BA 3TNNB 1T6BX 2WQRA 4HIHB 3CVHA 5IFAH 4NQUA 3HKFA 4F57H 4P46A 4JY4B 4KUCF 4TSCL 1A6ZB 2JWYA 4M9PA 3AABA 2WB7A 1ZV2A 2EADA 1EGJA 3RP1A 3LS5L 4KK5C 1DQVA 1LM8V 3DHPA 4KTGA 3S0PA 2VUOA 2M1KA 4B0MM 4NPKA 3CFIC 5BV7C 1RK7A 1H6FA 2E5EA 2ZE0A 2QTVA 1AKJD 4LNRA 4TL4A 4ETQB 1SN0A 5A2AA 4HULB 3CV5A 2QPSA 3HCVB 5DJ8B 4S10A 5FYJU 1X5ZA 4GXFA 3TASA 2CO2A 3WO4B 3MGOA 5KSVB 4MLSA 2X53A 3PDOB 3EJSA 3FQNB 5B21A 2WKGA 3W38A 1AQKH 3HG1B 2NDFA 3D7PA 3ENEA 2K4AA 2CCWA 1SNRA 2XQBH 3ZHLA 4A67A 3MRMB 1S7QB 1DVQA 4BQ9A 5I8KL 4AKPA 1KWKA 25C8L 1QEWA 2FGWL 3CCHA 1XH1A 2WGXA 4Z0BL 4NBZB 2CXKA 3CFMA 3TBYB 4N6RA 4YEFA 1S7VB 3WJJC 4LDCA 2A1WL 5BRZA 3DWTA 4JMXA 2AITA 4UNTA 2DYSB 5IW1A 4RBPK 4OD3L 2VR9A 4XXCA 3AB0B 5T3ZE 4L37A 3DYOA 3RNQA 1NCOA 3U0TB 4HFUH 2MCPH 4U3CA 1J0HA 3CFQA 2FD6L 2XBTA 1AO7E 3MPCA 5E4EC 2HFFB 1JGVL 4NAMA 4NNXB 2ZAIA 4F24A 3KW7A 4LVHC 1ZVHA 1V05A 5F89B 4J4PD 2GG1A 3V0WL 1LO5B 3UJJL 3O2VH 3MR9B 3VXSE 2KT6A 3BKYL 4UYPA 3QIWB 4XCCL 5KYUA 3IAQA 3GINA 4XVSL 1NA8A 1OE1A 2EE9A 3HE6A 4ZMXA 1PLAA 5DI8B 3HE6D 5IBLC 4JKPL 3SB3A 4PREB 3JWNC 3NJXA 2VABA 1IT9L 4MSWA 3WBDA 5DRZB 3V4PA 1CLZL 3KLAB 2CCLA 3CDGA 4IU2B 4DPRA 2O5YL 1FA4A 5LAPA 5EO1B 1G4MA 3CFCH 2WXJA 3EBIA 3LS5H 1T1WB 1G7LB 2IWEA 2V9TA 3IRZA 4A7QA 4S2SA 3ZT7A 5D93C 4HZ1A 4XPHL 4OM0H 4PEEA 4W9CC 2ZXCA 3UBGA 4ABUA 4TQ8A 4XI5C 1AI1L 1AIFA 3LH2H 2D3VA 2DI8A 5GGQH 4NENA 2YN5A 2QFPA 3L6FB 4A6YA 5LBSH 1B4JH 3GI9H 5IMKB 2WXLA 4AMKL 2YSTA 3KPPB 1CDCA 1NH6A 5ERWA 3PGCA 4AEEA 2ZXWB 3QDMA 1X7SA 2EEDA 3VWJC 1Y18A 5BQ7A 3W0WA 1IAOA 1CWVA 1AO7B 4A04A 1KXQA 1OE3A 4HAKA 1GZQA 5JHDB 3UACA 3UGEA 4WK4B 1LL1A 1CICA 2XC8A 1JFQL 1FC1A 4KQ0A 4L1BA 2WXHA 1MFMA 4R2GC 1FIGL 3II3A 2WVVB 1X5AA 4IHOB 5E2TH 5DZPA 5EG6C 4A7VA 4NO0A 3BUQA 3RQ3A 3FOLA 5DWPA 1AGEB 4IDJH 1E8XA 2WLJA 1IBHA 4PB0H 2YK1H 2E7MA 1UH2A 4WW2C 1LEKB 2K70A 2JH2A 2VDNH 1F4YL 4XN2A 4HC1L 1B90A 4NNYB 4NO0D 1U95A 5F9OL 1P84J 1KZQA 4KAQH 5C09E 1E7UA 1ID5I 3MFGB 4ABQA 5C0NC 2V7NB 1KYAA 4HGWB 1JPEA 2J8UA 3ME0A 1N9PA 4KUZL 1GS6X 1MRDH 4GW5A 4XNZC 1K5NA 4GXUN 3JUZA 1GR7A 3FQTB 4XWOD 5GGVY 5EEWA 2JQAA 3I02A 1LDSA 1WGVA 1JK8A 3FUNA 3K72B 2BP3A 2LVEA 1PMYA 3BISA 3HJ0A 4IS6A 2WINB 3U0WH 3U6RB 5I1LA 1PAMA 4C59B 3AZUA 4WI0A 1P5VA 4IKKA 1I7TB 1RZ8A 3I02B 5DVOA 3WE1A 4JN2B 5DJ2A 2LAAA 4YHNB 2AK4A 2MEJB 4P4KB 1N6QL 4WK0B 4R96A 5J11B 4W6XB 1G7MB 3UTZA 2GK0B 3PL6C 4JFQB 4OM0L 3UTSE 1HAUA 4HS8H 2AEOA 3VWKC 1GOHA 1HYRC 1QNZH 4F2ME 3LH2L 4IRSA 5DS8B 2IMMA 1MI5B 1TJGL 1KFAL 5EHFA 2DQJL 1L9RA 4G5AA 3E1F1 2XZCH 3T08A 3LZNA 4YZFF 4DCQB 1EEQA 2FJHB 1A7OH 1QKZH 1IZKA 1G6VK 2DTSA 4M8QB 4WI6A 3S8GB 4OLZL 3DJZA 4KTDH 3MLRL 1WBZA 5GRJH 4ZODA 4XMLH 3B2VH 3F58H 1J8SA 3P3TA 4MXVE 4GSXA 1AQDA 1DN0A 4JPVL 4Q8BA 5IROA 3TONA 4AQEB 2X4UA 1NCBL 4Q6YA 4EF3A 4EIGB 1R5VA 3BP7B 1DFXA 3GRWA 4MD0A 1QSVA 3GJEA 3I75B 4HS3B 1JTPA 3MV8A 5IVNA 5F70A 3DSNB 4WJG3 5D6DA 2DN7A 1IKOP 1T21A 1AAJA 3S4SB 1YSOA 4E0RB 3KE0A 1BD2B 1JV2A 1KB5A 3L5WB 1WT5C 3QEQD 4FFYA 1N0LB 3B4NA 1YMHA 3APMA 5SWSA 1FYTD 1XSKA 4UQIM 1S7WB 3S5LG 3O6KH 3MV9B 1EVTC 4G43A 4JQVC 43C9A 4YBHA 5C0EB 4CN4A 5CN3A 2X87A 4P4KD 5T3XH 1PG7X 1JWMB 4G8EA 4I88A 1OWWA 5KVFL 2HMIC 3NFSH 3MXVH 3EUUA 3OMNB 1YEHL 3EFOB 4BSVB 4JANA 2ITDB 4HA1A 3RVWD 1JGUL 2NUTA 2R2CA 2P42B 1I1AC 1IMHC 5FCUL 1J1XH 4MRCA 4I5BB 1RZGB 2GBVA 5K9KB 3ARTA 3MRGB 1ZS2A 4PJCF 1WWAX 2AKRA 1YEKH 4ELMB 4RH4A 3IVKB 1BFVH 3GIVB 4FQXB 4NC1C 4YDKH 2JCCB 2QGBA 4AYBA 3I6LD 3RWFA 5E08L 3TVMC 1ED3B 3GXIA 5KW9L 4P9MH 4HWZB 1J8HA 5BXFA 4WF7A 4R5VA 3U7AA 2H32B 1OEZW 2YJQA 3DXAD 1WWBX 4JFWA 2J25A 3RRQA 1H3TA 3QS2A 2YMXL 2A9CA 3ZTJH 2DQUH 5F89A 1MG3C 1WVZA 1IX2A 1DFBH 1WF5A 4LBEA 4S1QH 5BUGA 1YUHA 1RZJH 5HPOA 2B15A 1AC6A 1GC1L 1OGAB 2HVKB 4HCRH 4QMEA 1U8MB 3GM0A 1LO4L 2KZ1B 3CZSA 3D4ZA 1G7JA 2CO7A 5DD5L 4JDZB 1F2XK 1AGCB 4K5OA 5EUKB 4XP4H 2EVGA 2XCMC 5KANI 4CNIB 3I6GA 4MAYD 1VKXB 1EANA 1FYTB 1KELH 4G1MB 5FFGA 3UAJD 1HKLL 2JMRA 1ACYL 4PVNA 5IB3A 5J1AA 3V9EA 5DDHA 3QFJA 1NCBH 2V3EA 4M29A 4NPJA 1M42A 5C70A 3A21A 2DAVA 2Q8BL 1M7IB 3O41B 3MBEA 2ZOKA 4Y16A 5IMOA 4UMSA 2BIPA 4Y1AE 2MPVA 1W0VB 4P2OB 3PDGA 2GITA 4HP5A 1Z9LA 5SWSE 4KITB 2V0AA 2KZKA 4P5MA 1RZIB 1QW8A 5AOIA 4ELME 4F58H 4OI7A 2WPGA 3H7BB 5F6HI 5T1KA 5CEYB 4PJEE 3S5LA 3HRZB 3SJVA 2VR8A 3IS0X 3QH3B 4Y4FA 3NEOA 3C6EA 2R1XA 3ZKXB 3T0EB 1T03L 2HFEB 4OJAA 2OL3H 4G1MA 5IESH 4MWFA 5ISZA 4YHIB 2VC2L 4MLIA 3NSJA 1AACA 3T6WA 3CXFA 3ZY7A 2DYRB 1Q0YH 1U8MA 4QHNB 2WGNB 4CILA 1E4JA 5LLIC 4G3YL 2WZPA 4HIEA 4JL1A 5ETUA 3U4BL 4TLTA 4ODXA 5F72S 1YUHB 3KG5A 1FNLA 1T5WB 3GLDA 2VLLB 1YMMA 4WO4B 5KN5B 3T1WA 2KHAA 2WXOA 4F2EA 1WO2A 4V1DB 2NY4B 3MTXA 2DS4A 3SQBA 5AKRA 1MZYA 1VZHA 2YPKA 2NCEA 3CVHL 3HPLA 5BXFB 3V7AE 3WV0A 3GNMH 1LILA 3WHE0 1A7NH 4JQVA 3BFQG 1IVTA 2V2XA 3V0EA 1C5BL 4IGBC 3LIZL 4CC4C 1CXIA 1ETB1 3QWQB 5E8EB 3IVKA 3DPBA 1DVFA 1KYOK 5HDBF 5MI0C 4MVBD 1GVIA 1FVDA 3EYFB 3MUZ1 3GRGA 4N28A 3M7FB 1HEZB 4XHJC 2WLIB 4KKBD 3VXQB 1CR9L 3AREC 5E1GA 5A6LA 4ZT1A 4D0BA 3BWAB 1EUUA 4K8RL 1ORSA 4ZMAT 4UQEA 3L3IA 4G8EB 5JORB 1WZAA 3NESA 3V6ZB 4LKCA 5BNXD 1QPPA 4JFEB 1Z5LB 1N6UA 1RSFA 4YHYC 2XG5A 3FH5A 3V6BR 1R3LA 1U2HA 5D7LD 4DN4H 2VZUA 3DRQB 4MAYC 4ORZC 4YXKL 3IGFA 1QR4A 1SLWA 3F6JA 5KJRH 4BHUI 2ALAA 4ZMPA 4M93B 1DEEB 2OMZB 4UT9L 4WFHE 3D2TA 3VTAA 2Q87A 1UWXH 5F9WC 3AG4B 1IUZA 3JZYA 4YIQB 1OZTG 3ML8A 3NZUA 1ND0A 3CHQA 5DJCB 5D1ZC 1JD9A 4C56A 4TM9A 4AQEA 2JV6A 3PQYA 1P1VA 1JZ4A 4G6ML 3QYMA 3B9KD 3VMNA 3NAAL 4LLWA 3UZQB 1J0KA 4ICWA 3DOIA 4MJIE 6FABH 3BP5B 5GS0D 2VJXA 3ECVA 4ODUB 1N6QH 2O1AA 2P1YA 4GIAA 4OH2A 1PKQE 5DWUL 4N9GA 3MJGX 1MHEB 3HZMB 2KKQA 3IGUA 3KGTA 5DFWH 5JQHC 1BA9A 2JK5A 5ITFB 1EMTL 2X2UA 3C60D 2CUHA 4JFDD 2Q6WB 2ICEB 4K94C 3O3BA 4AEIH 2FBOJ 2DMKA 2DQJH 3AREB 1YEFL 4L1SA 4XE0A 3O11A 1IO4C 3HPJA 3CVHH 1TO4A 5CJ5A 1T2JA 2B4CC 2ZWLT 3HS8A 1AZNA 4JFED 3MNMA 2J72A 3ZRCC 2V7HA 4L4VB 2H41A 3HVNA 2AEWA 3CNKA 5DZOA 1P5VB 4LGSB 5L88H 3HC0B 2UZIL 3L9RB 4IU3A 4QD2E 2VERA 3MCLL 1U91A 1JK8B 3ZX1A 1A6VH 4QOKD 1XV8A 3HBZA 4GQ9H 1H3PL 3DETD 1NGWA 4DFIA 1UXSA 3UTQB 1SXSA 1HCZA 5A3IC 4GEJA 1I8MA 1JG9A 4EN3B 1G6RA 2UVEA 1IEHA 4F9PA 4DP2X 4OM1L 1MW0A 1AGDB 3EO1B 3DLQR 4N90D 2RJMA 3U7WH 1TT6A 3ARZA 4KI5E 1ULVA 3U4KA 1USQA 1RU9H 1HI6A 2R27A 3JSSA 2Y5TB 3D39A 4WU7A 3RWIA 4X4YA 2P8PB 3VTMA 1KYUA 1P7KA 5FO7B 2P5ED 4E41A 2MCMA 4K3EL 4NQTA 3HI5L 3TO2A 1GGUA 3KHOA 1IAIH 1YEDA 3Q6FA 3TEXA 1A4BA 1ZA3A 2H8PB 4TTDC 1YEHH 2CM5A 4G1EA 3B8YA 5FXCH 4HDIA 4AZUA 1RP9A 4QRSA 2D2OA 1DJYA 1FHNA 1OCRB 5EU5A 2V9RA 2QGEA 1V27A 5DMKB 3ZMNA 4A7GF 4NKDB 1DYZA 4J2QA 3KYOA 1ZDQA 4JFOA 4ZO6A 4L4VD 4OCRL 2NY5L 2DYPD 2XWCA 3PIQA 2DQHL 4XVTH 5CWSB 1QSZA 5EEYA 3RA7L 3L7EA 4LT7A 3G9VA 2ADYA 2EH7L 2IOMA 2VDML 1JDDA 4R84A 3L3KB 2A6DA 1ICTA 3K81A 3UJIL 2QFRA 1W15A 4XMVA 3EO0A 1SBBA 2W65B 4IBZA 1ZTXE 2WMPB 4Q0XH 1R5WB 1T7VA 1UB6B 4LSUH 1E8ZA 4ANWA 2Z0UA 3AU1B 1QFWL 2G9KA 1XF2A 2Z0BA 1XH2A 4C56B 4WCYH 3NACL 1I8IB 4U1HA 4X4XB 1WZ1L 1XH0A 2YPLD 5K33A 2ZJSL 1NFIB 1NIEA 1HKLH 3IMTA 4FF9A 3NH7H 3O3UN 4HJIA 2P5EB 4OBRA 1T20A 3VXMA 3KLQA 4B50A 4LIQE 3E8VA 3W0WB 2K3TA 2VMFA 1PW3A 3DSFH 4LLQB 3CZFB 3G5XA 4M6OH 5KSAA 4X4KA 4WIQA 4HXBH 1P69B 3KL5A 4NQCD 1CBVH 4FNLL 5CZRA 3GM8A 4YZWA 3ZL4L 5LDUA 1NDTA 4Q89A 2OXGA 3GJFA 4OI9A 2WNGA 4GW4A 3IWVA 4F91B 2HMID 1XSJA 1I7UB 1MCJA 4W6YB 4FXKA 1KN4L 3K1KC 5ACMA 4RWYH 3ZQWA 4I13B 4JRYD 3QG6B 1N5AA 3NEXA 4C4KT 3CFBB 2Z31A 2Z93B 4HF5L 4JFDA 5FM5M 3KPRD 3IM1A 3MMEA 4M1GL 4YXHH 4U1NB 4YNYB 5C7ZA 3VJ6A 4Q6IB 1CF8L 2YAEA 1W6LA 4N6RB 4JO1H 4X5LA 2H6UA 4KK6D 2YD4A 4XN7A 4LASH 4ZTPL 2IADA 1UENA 4PG2C 5E6IA 1WISA 3HG1E 1ZE3C 5BRPA 2VXSL 4F9LA 1OAQH 5GS2D 5DJ0B 1BXXA 1X5YA 2DQMA 3RZWA 4KJQC 4ZO8A 3U4BH 1DSFL 3JQOB 4ONHB 2NY5H 4OZFG 1DEDA 3ULAB 4JY5L 4LU5L 4PJIF 1UH4A 3L5XL 2QV4A 3BZFB 4GO6B 2PP7A 3IGKA 4UU9B 1UKQA 2BVOA 4NWUH 5FHBL 1G9NL 1HIMH 2WBJC 2DWSA 4KDTA 2UZXB 2BVPA 4AX3A 5D72H 3EH3B 2RGSA 4KKBC 5D2LF 5D1XC 3U2SA 1HILA 1TFHA 3H9ZA 3NDZE 4ZUUB 4LSRH 5GGSA 5BUPA 4LHUG 1L5GB 1DUYA 2P49B 1F4XH 3OKEB 4GKZB 5B39A 5EWIH 1U8OB 2CA4A 3HTLX 3MRJA 1RK1B 2CLZA 2XT1B 2DM2A 3EOAA 2WXPA 3GMOB 5C09A 2QGCA 5H94A 5MHSE 3SDDD 4AQ1A 3MLVL 5FS5A 1HYSC 1PD6A 1SM3H 2ITCB 2PTTB 4FOMA 5JHDE 3VQ2C 4J39A 4MX7A 2BP8B 4ALAL 4M6OL 3MLTB 5CMAA 1EEYB 1UM6L 2NY3D 5KS9F 1XSOA 1U3HD 3TA3B 1D6VL 2ITCA 1QOKA 4MJ4A 2E9BA 4EJ1C 4UAOC 4JR9H 5DGRA 4QRPB 3V6OA 3LEYH 5J9PB 4YXKH 4CN1A 2OMTB 4GXVH 5JYMA 4TNFA 3UBXG 3HRZC 4FHBD 1JGDA 1TNMA 3X13B 2F9BT 5MEOB 2I5YL 3TIDB 4XBEH 2RQEA 3CDCA 3UADA 4HH9B 2HT4C 4A68A 4MHHI 5F7FA 3LKSB 4L48A 4DK3A 1L5GA 2OTUA 2B14A 3IAPA 2Y4SA 5DU7A 1RAMA 2C9SA 3FN0L 3KJ4B 3VYOA 4P5TD 4IRSC 4PJXE 2Y36L 2ERJC 5HDOA 5G2NA 4GAJL 3BW9B 1IGFL 4JAMB 4KKCC 3BMVA 4MBOA 2EDEA 5K69A 2H9GA 2NXYC 4RCAA 1CFTA 1U41A 4PJIA 4I0CC 1AMXA 2E56A 1WYJA 3CC5B 3LZRA 5BJTB 5FM4A 5JIMA 1NDMB 1J05B 3DO7B 5F7YC 4DW2L 2E74C 5EU3B 3MRBA 4GOSA 4J1UB 4JM4H 1JMZA 1U3YA 4XNBA 1IRAY 4YDVA 5E00A 2VSKB 2WXIA 5LWYL 1ED3A 4LCIH 5CU9A 3RWFB 2X0UA 4PUBH 3H4HA 1I9EA 3MRCB 2O5XH 1LNUA 4YDJA 4G8GE 4ONFL 4EAEA 1OM9A 3GBNL 4KJWC 1MWAB 4Z7QF 1A3QA 3C60A 3HN3A 3I50L 2NUTB 1BX2B 3HUJE 1X3DA 3C5ZB 2F53D 4MASA 2ZKWA 4NZDA 1KN2L 2C3WA 1BLIA 4U3SB 4X8JA 2E4TA 4GQ9L 2F58L 1LD9A 2F1EA 4GG8A 3P9MB 1ZJBA 2DH3A 3EH4B 3QHZH 3DGGA 4QHKJ 4X7EC 1S7WA 5F44A 3QBTB 1OF0A 3OAYK 2R7EB 3PQYD 3UAJA 5HPMB 5HYEA 3D07A 5ES4B 2XG4B 2B5IB 1YMHB 1KV7A 1ZRUA 5TPWL 3PRZA 5CCKH 4KKLD 2LU7A 1KTCA 3IJSA 4HJGA 5CJOH 5IK3A 1QR1B 4FYTA 4QIRA 2VLRD 3MV7A 1ASQA 2WAHA 3L3DB 2P80A 4FG2A 1SJVA 1JTTA 3DUSA 3AG3B 3I75A 4HS3A 3GHEH 4XCNA 1Z3RA 1Q9WB 4M3KB 3VXUD 1F97A 2DWEB 3VRJA 1A0QH 4IOFD 1VF5C 4ZX6A 1AQDB 4KY2A 3H3KA 2R69L 4LSTH 5GRUL 2ZONA 5JUEL 3ZE0B 2XKSA 1COBA 3A6CH 3HZKB 4BCZA 5IJKA 2ATPA 1NAMH 1WBZB 3IDGB 4RMSA 4HLZH 2WUCL 5DJDB 2W9EH 3GMRA 3QJHB 4JPKH 2BNUA 2D9CA 2Q76A 4PJDB 5KVEH 3F00A 4S1DD 1IGIH 3GMNB 1M7XA 1SLUA 1JK9B 4OCRH 4ANXA 4TNEA 1YDPA 1YY9C 3MNWA 4OLWH 3D3VB 4BUHA 1WZMA 1L0XA 4GKNB 5CNHA 2DI9A 2F5BH 4FXGA 3SKUD 2WSDA 4M7LT 2CO3A 2DJ4A 2IOOA 4P4KA 5D7JB 2BSDA 4UB0L 3PV6A 1F13A 1WWWX 1EBAA 1SEBA 1TTCA 1XSIA 2GY7B 1GYWA 2OMWB 3OMZA 3TV3H 1SYSA 4P0DA 3IMSA 4FLHA 5IQLA 4LFHD 5DHVA 1UGKA 2A6IB 3DOSB 1L9TA 3F12A 4H8HA 5SWSD 4KZDL 3DMMC 4HK0A 1A64A 1ZLUK 1UEYA 2EEXA 3LPWA 2HJLA 3X1EA 4R7NB 1AHWB 5CIPB 4DIXA 2F6AA 3ISYA 4GG6E 3GMPA 3RDJA 1QACA 4WU7B 3RWIB 4KTEL 4X4YB 1SOKA 5LXGL 4X2UA 4O2CA 1UYWH 3SYOA 4CA4A 5F1NB 2FATL 3MBEC 2VDKB 1BQSA 1SHSA 2WB1A 3EYQD 2EH8L 1ECYA 1YPZB 1DJIA 3AQZA 3DIFB 4LGRB 4LVOB 4WUKL 4WUUE 5IV2A 1MREL 4Z7WA 1UZ8A 3DX6B 4FX5A 1ZWIA 5CILH 3CU7A 5E51A 1H8LA 1AS7A 3SDCD 4G80B 3U1QA 1S7RB 4DVBA 3EDKA 3II1A 5J6HA 4OFDA 4N2KA 2F8XC 3KGRA 4XBGB 3DVIA 2O72A 1MCNA 3KGSA 5DC2A 4K71B 5AEAA 4YXHL 5HI5D 3TEUA 4W4OC 4KDVA 2AJZA 4E68A 2EUXA 1BJ8A 3I6LE 3MOBL 2AK4D 5DS1A 4YSRA 2ZWSA 1MFUA 1NEZA 1UM5H 4OIBA 2ZQKA 2X9XA 1NGPH 5I66B 2IBBA 1AMYA 2YXMA 3WNNA 3SKMB 2XZZA 4CVXA 2KERA 3DVNA 4N5UA 3C2AH 4CVZB 4NRZA 4ZPTA 2KQMA 3K46A 4TKWA 4X9FA 3RU8H 2A6KB 4IEFB 4UIKH 3L5XH 1GKOA 5H35B 3ZR6A 3MRDB 2BOLA 5KSBE 3SIKA 3ARDC 2EKSB 2JSFA 3U83A 4ESKA 3FUDA 5J13B 1YN6B 2DIEA 3KPSA 3MFFA 3BUTA 3QJOA 4WNJA 5F8RC 2FLRT 3HE7D 1QAWA 1TQBB 4MJIB 3O2WL 5I9QB 4KZDH 2ATAA 5FCUH 5F88B 4TUJA 1FZOB 2J1XA 3RVVD 2P5WB 2EYTB 4FTVB 2X4QA 4XCFL 1DL7L 1BFVL 1P7QD 1RUPH 1FG2A 1A4AA 2QSCH 3ABLB 3QT2A 5A2CA 4L4TD 3SCMD 3CMOL 1KTLA 4ZFZA 2K7PA 4Z6AT 3P9LA 2I9LA 3PJSA 5C9JB 4APQC 3RI5F 3RTQC 1TVBA 2H45A 1UYWL 2OW6A 5D5MF 2ZG2A 2NRDA 4QTHA 5TFSH 2B3RA 2GUOA 2WZAA 2BOCA 4J3OD 4U3SA 4ANKA 1FZJB 1ORSB 4FD0A 5I76B 2NY2D 5E8PB 43CAA 4QHLB 2VDOH 4Y1AB 4GXVL 5FGRA 1FH2A 3IU3A 3MV9E 1FORH 3QEHB 5IROC 5JMOC 3VXRB 1SHWA 1ODAA 4D9LH 4BWUA 3VD9A 3FCSB 3MRCA 4YBQD 3TBYA 4LCUA 1U2YA 3QEUB 4HBCL 4JDTH 5GRVK 1GH7A 4NZTH 2R56L 4O9HL 4QGYA 1C16B 4DEWA 4MA7L 5B4MC 2PR9A 4K9JA 4XC1H 4OU3A 3G5WA 4GH7B 1XAKA 2NZ9C 3RNKA 2Y6TE 4IMLB 3RX9A 3UTSA 4I9WE 2PYEA 2CDEB 4QTIH 3EO9H 2VDNL 4BKLB 4AMWA 2AJSH 2R2EB 3ZTNL 4H5SA 4S1RH 3KLSA 4AUYA 2Q10A 3ROOB 2P5WE 2ZXBA 4MDRA 1L6PA 3GLZA 1PL3A 5EIIA 1FH5H 1VCBC 2IEPA 3B3IA 1PY4A 4KJWD 4PMFA 5GSRB 4M7ZC 5FR3A 1GPOL 3OKLA 5IBUB 2GJ6A 5IBUG 4QRFA 3FT3B 4YHZH 4BA0A 3RUGA 4B3EA 1J8RA 4PHZA 3EJUA 1JGEA 1SFHA 3BP6A 3BWUC 4HEPA 4J4PA 3TIDA 2YAOA 4XN9A 2ZP0T 1C7TA 5C0ND 4O58L 1YNKL 2D03H 2MNUA 1E2VA 4WEBL 1BZEA 2WO4A 4LDLB 4WKXA 4ZD3L 4Z76B 5J4MA 3QE5A 3QQ4B 3TNNA 5BOZG 3S48A 1QTPA 3KS0J 4KVPA 3WUWA 1I1YB 2MH4A 3QCTH 4PRPE 4X6CE 1QBMH 1PJ9A 2ESVA 4FNTA 5FUOH 1YEGH 1UH3A 3FF7A 2FWOB 2W9LA 3SKOA 2D7NA 1F6FB 4X4ME 1OV8A 3GZOA 4JZNB 3OZ9L 4HKXB 5TE4L 1BJ1H 4A63A 5C0RH 1FFRA 1JNHA 3Q8BA 4Z18A 3NCYP 2YSSA 3CK0H 4GFTB 2JB6B 5AKVA 5I1JH 4X9IA 3ZJAA 3Q2WA 2VQ4A 4JE0A 1U0QA 2UXGA 3RDTC 5I1CH 3S37X 4GMSH 1KCBA 3D2UB 1XO8A 3V0GA 3VGHA 4OIIL 4FKKA 2CUAA 3UYRL 3SGEH 4MCZA 1PZDA 2AZUA 2R69H 4H8UA 2X2JA 4M62L 5CEZD 4EI6A 2YGVA 3BSZA 1QLEH 2VN7A 3EGSB 5C0BB 2E7LA 4DK6A 1MFCL 3LKQB 5E2UH 4OUOA 1IL1A 4OF0A 1D9KB 5C07D 3ZO9A 4OV5B 1WCBA 3EUDA 5F7EH 4I3RL 3GJFH 2J12B 5GRVL 2B2XL 5HHVL 1NPNA 3ARBA 2BCMA 1BZDA 4ANVA 3KVQA 4G9DB 3FB6A 2AW2A 1CICD 3BXNA 1KXVA 4QXUH 2GI0A 3PHOA 4I9WD 4I0PD 2X6AA 4TOYL 2CKBA 5KSUA 3VFWA 1QWHA 5I6KA 3QC5X 3UL4A 3W0WD 5ICUA 3V0WH 3G7TA 1OSPH 1OM3L 2B1AL 4Z77A 1AR1C 5JNYA 2Y72A 3BAKA 5DK2A 2ZXGA 1P4BH 3RWJA 3FO0H 4PV9A 2G2NA 3BAYA 1U8NA 2VL4A 1A5FL 4IOSD 3V52L 1IAMA 1QQDA 2HG5A 4NO5A 4P2RB 2V3FA 3BP4A 3X12B 2J6EL 2FO8A 1F00I 1DTUA 3E38A 3IYLW 1CC3A 3Q05A 4PGZA 3D9AH 3B56A 3HMXH 1FCCA 3PUCA 4IQHA 3QCTL 1K8IB 1S7TB 2O5YH 4R8WL 4NKIL 4Z7UE 5GS0C 3PNWA 4R3SB 4CKQA 5FUOL 1D7FA 4ZK8A 2A5UA 3IETB 3LZQA 2IWFA 2OTWB 3UTTD 1IKFL 3F04A 1AXSA 2ALWA 1J1PH 2W07A 4OJFH 1MCBA 4FNRA 1HQRA 5FA4A 4QCIB 3F01A 2K8MA 2WOBA 4PBXA 1XAUA 4AEIL 3W2DL 5D1ZB 3GEFA 1U2CA 4LCWB 1WFNA 1MREH 1D2OA 3IBEA 1NGQH 4W9JC 2X12A 4H4NA 5LBSL 5T3XE 3RAJL 1HZHH 4YAQB 3CFUA 1ZK9A 3AB0C 5I5IA 4X42A 2GCYA 2WQUA 4NDMA 1XF2B 2Y6SC 2XIBA 4NC1E 2X05A 4W1TA 2Y1AA 1BYNA 4LEOA 1CFQB 2IAMA 4OI8A 3DRTB 3TBWB 2IAMD 3UYRH 2WNWA 4L0ZA 4XB3A 3LKPB 4MTMA 5L2KA 1W8EA 2P8MB 1RJCA 3PGDB 5IF0B 3HJEA 3SYCA 1WD8A 1MFCH 4JZJB 3LYRA 3BGFC 1AG0A 3WEXA 3LKOB 1AGBA 5TF1H 4JZJC 4LP8A 5FGBA 5J06A 2QL1A 5E5MB 2HLFD 4JUSA 4ES8A 4FE9A 3BRGC 3HG4A 4F5CA 1CL7L 4HOZA 1I9IH 4H20H 5T3ZL 1C16A 4LOVA 5B38B 4I18C 3O0RH 2ZWZA 2R8SL 4WDIA 3DGCR 3V95A 3VFVB 1ZLUH 1SMDA 1ZA3B 2H8PA 1RHFA 4HUXB 2R9HC 3B9EA 3LNDA 4P5RA 1BVLB 3U9PL 3FUJA 4KKCD 5AOZA 4UOQA 3U30B 4H0IA 3ULUL 4B9CA 1G7HA 4HMCA 4JKLA 1D5MA 4DZ8A 3NBNA 4I0PC 1T22A 3CZGA 1BQHG 2VLME 3DUUA 4TRPH 4FXKB 2YAHA 3BQVA 5DLML 4BDVA 3UG5A 4Q97A 2NY5C 4LLUB 2KMWA 1NC2A 7PAZA 4ZXBA 3N43F 3PHSA 2J56A 4GRWH 4K5MA 3V0VB 3C5SB 5AVVB 4XO3A 3FPYA 4P46D 4X7FC 4WWKC 4BYHA 1G9MC 3NP3A 1I1YA 1X5MA 3RDTD 3VNYA 2ZUVA 4KKPA 1SF5A 5ESAA 3MJ6A 1XTMA 4JG0H 4Z76A 4EMZA 2FJFB 1N18A 3OB8A 3QXVA 1IC0A 3WY3A 1H6EA 2L04A 4PMEA 5ESVA 4AENA 2X70B 2VAAA 4D9LL 1IQWH 3CTTA 4W4NA 3RUGB 1PZSA 3HG1D 1I8IA 2BP0B 1AO7A 1QLRB 3GLEA 4FA7B 1OHQA 3QORC 2WXKA 2R56H 1HEHC 1YYLL 4ELKB 1O9VA 4ZFOA 3QO0B 2A6KA 2X4SA 4QHMB 1HINL 4RGMC 3VQ1C 4XCYB 4LEXL 3TEYA 1SOXA 1HHIB 3EYOA 1RZKC 4JHUA 2E7LC 2GC4C 2CO6B 4KFMA 3QO0A 1RKRA 1EAJA 2AJSL 4L3CB 3AGVA 3LZLA 5HI5C 4HPOL 4FQCH 5CZXD 2K9UA 2BINA 4FJ6A 4HJ0C 4HHAB 4X6CF 4DGWC 4OBSA 3S37L 4LP5A 1QLEB 4HKJB 2R0LL 3SPVA 4UTAH 5I30H 5AYQA 3P1VA 3MSPA 2PP9A 3VM5A 1BQUA 1WAPA 2CKNA 4NJ9L 3HB3B 5AG8A 4HDIB 4AWJC 3KWTA 1H0DB 2YAPA 4QY8A 3IPBA 1IC7L 3FO9B 4BFFA 4AEHH 4E5XA 1YNKH 2Y2WA 4GS7B 4F2MB 5JIIA 3U1PA 2LTQB 2ZXAA 2YPLE 3MOAL 1KOAA 2B4CL 2CR6A 3C5SA 1O6SB 4NYLB 4G8FB 1F90H 3A24A 2VXSH 2DQCL 4BH7B 4PGCB 1FFNA 3H1ZA 2BERA 1BG9A 1OAZH 2IDQA 1OWRM 1PSKL 5CLYA 3H7LA 3LZFL 4QO1B 3IDYC 5HDQL 4LF3B 1ETA1 4F2MA 4NBXB 3M1BA 3DECA 3FQWB 1VPOH 1K85A 1YECL 3V2AR 3LS4H 3W9EB 2ADGB 3E2HC 4XO8A 4LSPH 1DFBL 2NW3B 4S1QL 4KKZA 4ETYA 5KVEE 4D9QE 2FL5A 3S8FB 2N56A 4XB7A 3LHPL 2Y25A 4QNPF 2AABL 5T5NF 3ZN6A 3B7TA 2DD8L 4RMVA 2J4WL 4XRCA 4Y9BA 4KV5F 1JFQH 1RMFH 3D0LB 5DUJA 3ALPA 4L8SB 1X44A 1YQVH 3D69A 4OB5L 2ICWA 3UCQA 2FECI 5TH2A 1GGIL 3H9HB 4FQQA 2NW2A 4Z7WF 1SM3L 1DQIA 4MMXC 2GSMB 5F9AC 2WP3T 4ZFOB 1ZA6A 3C9NB 4JVPA 4QKXB 3LN4B 5JIDA 2Q7NA 2AV7B 4WFFE 1DBBH 4FQXD 3TBWA 3R7RA 2VMEA 1A2YA 5LNDA 5CJXC 4NM4L 3D52A 1WUNT 1QBLL 4NSKA 5F0JB 1LP9B 2VAAB 3CHSA 1EFXB 1EJFA 2PUQT 4X5WB 3FH7A 4RWHA 3ECQA 5DHVH 2BM3A 2YRZA 4DUVA 4Z23A 4EI0A 2NLJA 1T66C 3TEWA 1R3HA 4JKWA 3SE3A 3Q2LA 3DIDA 5GIRA 5C0DA 5KVMC 3BO8B 1TTUA 3DUSB 3JV6A 4M7JL 3UIYA 1JZDC 2F2HA 1OVZA 3TWCL 2CK0H 1OAXH 3OLDA 1VFAA 3N2JA 2P8LB 3NRPA 3MJ9A 4I3GA 3FN9A 3IJSB 4HJGB 2C1OA 4JFHD 3D51A 5ENWB 3VGAB 5DJ6B 1EAPB 3WTYA 1FNSH 5DHXB 2Z1KA 4RMRA 3O41A 3FZUC 3AROA 3QPKA 2L0DA 5C3TA 4FQ1L 3U6XS 5I1GH 4Q6IC 2ADFH 1FG9C 5KYNA 1KJ2H 3L3OB 4GG8B 3DTXA 4PY7A 4GUPB 2X38A 3KR3L 4PBDA 5DDHB 5D7IB 4R7VA 4FFWC 4PJHF 1ITBB 3V9FA 1FO0B 4KY1L 5I1DA 1U8NB 3M1OA 3WELA 2D73A 5ECJE 2M83A 3SDDA 2X1OA 4ONFH 3WFBL 3EFDL 1ML0A 4KRNA 1JPGB 2UX7A 1SVZA 5D96C 5JDJA 1QFWM 4J3OF 2WKLA 1JV5B 2JJWA 3QAQA 4PWIA 1PFCA 5J13C 1MIMH 4N2MA 1P5UC 5LCVH 4EDXA 3KW8A 4J8QA 4GKNA 3FTYA 2J1YA 3N9GH 4XCEA 3SO3C 2F53E 1G87A 2A7BA 4TNVK 3V0FA 1RD6A 3OJ2C 4V1DA 1VFBB 4WFHD 1P4IH 1K4DA 1L3WA 2X2YA 2YUWA 2AKRB 2PO6B 1F4AA 1TENA 4WK2B 1O7DE 1GAFH 3BUDA 4YHIA 2WD0A 3SKNB 4NDMB 3LSOA 2JJTA 5GZOA 1SVBA 1IBDA 5DA4A 2WKOF 3JWDC 4M5YL 4MXQD 3MTRA 4B6ZA 5J3HD 3WN5C 4GSRA 4A37A 3LQAL 3D25A 1WP6A 3NFSL 1A0QL 3MYJB 3MRNB 4QAMB 5JUEH 3BIAX 5GS1B 1HHGB 1INDL 3L4XA 3QQXA 1G9NC 3FO1B 1LDPL 1IJ9A 2AJYH 2VDLH 5EBGA 3IFLL 1NICA 5SWSB 2ZSVA 4RZCA 4NZRL 2Z31D 3CSYA 3ESOA 4Y1TA 1YJDC 3DO4A 4HIXL 5KG9A 3MLTA 5CMAB 1E6OH 5E1HB 3VB8A 3WY4A 1BHGA 4DP1X 4HUUB 1V8HA 3DJTA 3PY9A 4K8RD 3W9DB 3RZCB 1LWRA 3MRNA 5EF3A 1M1XB 4FG6C 5FKPA 3WIIH 3WUWB 5JR1L 5E8NB 4D0DA 1DJSA 5EUOF 1XGUB 5I18H 3ZT5A 4QLRA 1MCQA 2ADFL 1U3NA 3OAZH 3KBEA 3AG2B 4I2XB 2ODHA 1KPVB 1RZJL 2UX6A 4PWJA 2VXVL 1EFXA 4OT1H 4YDJB 1LP9A 1I9JH 2EDBA 4UBDC 5CEZE 5J1TC 2AI0L 3E0GA 3SPGA 3N1MC 4TVUA 5FA3B 3TJHD 2QZ5A 1N8ZA 2J7LA 4PJBE 5JHDD 2H3NA 2BZ7A 4P9HH 2YPLA 3OKMB 3FXIC 2COVD 3O3DB 3VXRE 5HVFB 1F1GA 2CNYA 5LGHL 2BY2A 2FX9L 1LEIA 4XPTH 5DZJA 4YK4B 3F7RA 3QYNA 1NCNA 1GY2A 2Q8BH 1FRGH 4PVLA 1S7SA 2GJZB 3UG4A 1E8YA 1TZGL 3KPSD 1S6NA 3K71A 1NM4A 5CXPA 3VGFA 4OM1H 3BW9A 4JAMA 4JR9L 5E6IB 2YQ3A 5IQNA 2BX5A 4G9FE 3QCUH 4Q9RH 2M2DA 4BINA 2JCCA 5H2BB 1AP2B 4HUNB 4HPYH 2CHWA 4OCWL 3DO3A 4UCFA 5FO9B 4EVNB 4K07A 2JELL 3OLIA 4MQSB 3BH4A 1QLFA 2BC4B 3WHXA 2XX0A 3PABA 1ZPUA 4N8CL 4HUCA 4UNUA 1MH5A 3FHAA 4PJFA 5KZCB 1P1ZB 3MCKB 3VQMA 5BVJB 1I7UA 2ZNXA 1IGCL 2C9VA 1JRHL 2GI7A 2R2HA 2Z65C 3IJ8A 4NNYA 3RWDB 5IT2H 4S0HA 4AUUA 4DGUA 4JPIA 4OGZA 1GOGA 1NGPL 4ZI8A 1H6TA 1DSYA 3JV6B 5KVGH 4N1CA 3GMOA 1GGBH 2VXTL 3RIFK 1NSNL 4LCCC 2V3DA 2VH5H 3WS3A 1KNOB 2F8IA 1T20B 1IGTB 4M3HA 1MRFL 4HK3J 4YHOL 5FOJA 3QDJB 3VXMB 1YECH 3TFKD 1ZGLB 1K5WA 2DLEA 2QKSA 3L2LA 3MLWL 4H1LB 5F7NC 2WWMC 5HDWA 1R5VB 4J12A 3FT3A 3QORD 1DUYB 4OVUA 3RURA 3VVWA 4ONGH 4P49A 3ZK0A 4R5XA 1R5WA 2YS4A 3QO1B 5DFTA 2VRQA 4BFIB 2GSIA 1UXWB 1YEIH 2IH1A 3DOHA 3QUZD 4JY6B 4ODWA 5DVLA 2NTSP 2CO6A 3ML9A 2YKKA 1SY6H 8FABB 4HUWA 4LLMB 5IR1A 3EAKA 4OGXH 4QXGH 1YJDH 3VRLF 4KK9D 3DX2A 4LLDB 2OJ1A 3CDZB 1KF9B 4CVWA 1JPSH 3FSOA 5DS8A 3T6QC 4MDJB 1NL0H 4LSVL 1HHHB 2OMBA 5F3HB 3GSXA 4AH2A 5K59F 4Q4EA 1MCCA 2D7MA 2CHZA 4XMKH 4X4ZA 1ONQB 2OYLA 4UBDD 3WN5A 3WNIA 3Q8CA 2GPZA 3WHE1 5D5MA 4NRXB 4HGKC 1VHPA 3DYMA 4ODVH 5EIVA 4IW4C 3ES6B 4GSUA 4K15A 4U1NA 1HQ4A 4YNYA 2ADGA 2DICA 1VGEH 2CDGB 4RWYL 4GAFB 5GRZA 4ZMOA 4XNUL 1WIUA 1OKEA 2AXFB 3KL3A 1BXUA 1JPTL 4X0KB 3KH3A 3OPZH 1HNGA 1DDTA 3DNKA 4RFOH 3MJWA 1K5NB 4AJYV 2Y3NA 5B4MD 4NJAL 1WT5A 2VUYA 4UM9D 2BNQA 4N1EA 5DEGB 4N2GA 4PJFE 2X0VA 2IANA 1AYRA 4HALA 2LW3A 2J8UF 1CLOL 1THCA 3ELAT 3ESUF 4NBYB 1F0LA 1FBIL 2CMRH 2XIIA 3ZTEA 4JK0D 4WTQA 2PXYD 4JX0A 3BI9X 4QYOB 2QTEA 3ZQXA 2Q7YA 1D5IL 5I73C 3N1QC 4RA3A 2VDQL 3MAWA 2ZT9C 3FTGB 1CFNB 1ACXA 4QI3A 3H55A 3L5HA 1DBML 2P80D 4NI6A 4FQ1H 3C75A 2VLRA 1AKJB 1GY1A 2AXHA 2CPCA 3DC0A 2VW7A 1EPFA 3QNXB 3KPTA 2P3YA 4HUXA 4L29A 4WGWB 1DDHA 4XBPB 4K0OA 4X7TB 2YHGA 3K4DA 3QDGA 5KSBF 2PYEE 2DZEA 3V0JA 1AQMA 1WAAF 3QNYA 3HG3A 3ZE2E 1IGML 1WFMA 4HWEL 3KXFE 3ZL1A 4KK8C 3NGBC 5EFIB 4E42A 4RA0C 3P0YH 5CGTA 2E6JA 3SQRA 2MQCA 1NFKA 4PJXB 4GAYA 1AY1L 2VTFA 1SY6L 3MNWB 5K1VA 4GRWB 3N9GL 4FFYL 1EDHA 4JJ5B 5E6IC 1AZZC 4HK3N 5HY9B 2FYVA 2OI9C 1RPQA 1XF3A 1JPSL 2XWBA 2ZD0A 1AIFB 3QPXL 4JKMA 2NX5A 3F64A 3FDWA 4ZPVB 5LBVA 5TE4H 1YAZA 4IJTA 2AFNA 5F1SA 3WCYA 2PPFA 4PI2A 5HGAA 3L3JB 2XKUA 2V5YA 1V55B 3PFQA 5DMGD 2Z31C 3DPDA 4PRIA 5MEND 4YAQA 4K3EH 1AOZA 4X7TA 4ZSOB 1P4LB 4B5EA 3Q7JA 2QLYA 1MCDA 1U8QA 3FH8A 3Q6FB 4TQPA 2WCPA 5F7UA 5ISZD 4YO0A 1WFIA 4G8GB 4PD4K 1JSYA 1K8DA 3E7JA 5IWLC 3M07A 3LVTA 3N40P 4ZQKA 5BRQA 3MYZA 3PGFH 4RSYA 1FIGH 2F7IA 3FB8A 3VI3B 1FZMA 2D7TL 2Y36H 5L8JB 2BSRA 4FG6D 3NJNA 3ZSTA 5DJXA 2MQ0A 1Y1UA 5EZLB 4CL7A 3PABB 4W68A 3CFKB 1AHWA 3QRGH 5CIPA 1D5IH 1N7ML 2B3IA 5CJQL 3KL0A 1LK2B 3EYQC 3ILPB 3PWVB 2CKBH 3K1DA 5A16B 5JW3L 2OL3A 1AIZA 4GRWF 2XTJB 1MQKH 5EU4B 1MWAA 5F9JA 3VXQA 1HKFA 5IW1B 3S3CB 5B38A 5DK2B 1UUSA 5JNYB 2W9DL 4LCIL 3K2UH 2EO7A 2GSGA 2OMYA 4OZGB 3GTTA 3L1OH 3CQFA 4Q0XL 1KCLA 4X80L 2X4TB 3G5YA 4F57L 3BEWA 1QFWH 2E3VA 3BKML 5GZNC 2QQKL 5ADOH 3HA0A 3SZ6A 4MMZC 3VI4A 4DP9X 5AKTA 3IJYA 1FC2D 4IYKA 3VH8B 4DVRH 1U3JA 1J8KA 3D9AL 5I15L 4FNSA 4EUPB 2VMDA 2V9UA 1LK3H 5TDNB 4QF1B 4RIRA 4Y5VA 1KYOJ 5TDOA 3CHOA 4O51A 5CSZB 4G6KH 2H9GB 2WQ8A 5FA3A 1T89C 5ABAA 4G83A 3D18B 1T7XA 4UT6H 4NZJA 3MUGB 3PP4L 3QDME 4B9KC 1DBKL 3M17B 2JB5L 5HGBB 4DP7X 4F7KA 3RX8A 2XFGB 4B53A 1EHLL 4MWFB 4NXSA 1B4TA 3ZYIA 5LKNA 5IHUL 3WAJA 4JPWL 1C5DB 4XNQB 4JFVA 4EXPX 3KJ6H 4UQAA 4O02H 5D7EA 3RAJH 3TBBA 2ZCLH 4KI1A 2J6WA 1JF5A 1TQCB 2DQTL 4JREC 2BWQA 4CW1A 3MRKA 1YNTF 4UTBL 1N59A 4JRXA 4WTZG 3ZR5A 3F58L 4F7TB 4O9HH 2PMZA 3VWKB 4QOKA 1GHFL 4A2MA 3IMBA 4XC1L 4F7PA 1DQLH 2R29L 3K8MA 3RL1B 4E36A 4CSPA 4MCYB 2VR6A 1FJ1A 2PR4L 4PY8I 1E65A 1EJOL 1F18A 2BW4A 1MNNA 2Z92A 3MZTA 3BQUA 4EDWL 1NUFA 1JGVH 3TCLB 2EYSA 3MHZA 4IK7A 4AK2A 2WSPA 3E3QE 4KX9A 2WV3A 5IGXH 4ZUTB 4RMWA 2AP2A 4R4BB 5LN4A 5AKSA 3APFA 3GGWA 4UV7L 5F6IB 1GS8A 5LO7A 2XI9A 3NIFE 5CUSL 5JW4N 1CK0H 1CGVA 4OLYL 2R8SH 5TK2A 4PH8A 3OG4B 3L4UA 1S46A 2E27H 4UIMA 2W80C 3RY5A 1KBGH 1PNCA 2A74B 3PAZA 3QA3A 5TJWK 3ZZQA 2N0KA 4KNUA 4NT6B 4H5SB 4PTUA 4P06A 1QBML 5E03A 3UBFA 4GO8A 2EUZA 2ROXA 1E9QA 2D0GA 3N55A 4OGXL 3B5GA 4QXGL 5DXWA 1HWHB 4E5XG 2XXCB 1A1NB 3RI5K 4X5QA 1N4XH 3US0A 1DUZA 3V8CA 4AGOA 4P9ML 4GW1A 1NL0L 4M61A 3UFIA 4CADB 3FFDA 5I9QC 5L4MA 4EKJA 2PCFA 1IBGL 5SWZA 2QBWA 2VSCA 1XIWA 5IQMA 5JTWA 1PLGL 2I07A 2CLRA 4KXZI 3RB7A 3JWNG 3CE1A 4LMQI 4U7MA 5AW9B 4ZW8A 4DP0X 1IJNA 1FV1A 2N01B 3CK0L 3IDJB 4HD9A 4XN1A 3LQAC 1CGUA 1OD7A 2NZIA 3DTUB 3RYMA 4I5BA 4WTXA 5J8OA 5IWLA 4XPAL 3HBQA 3VXRA 3IDXL 2PXYC 2MPAH 4WENB 4FN0A 2CALA 2GJRA 3KWXA 3L3OA 4X9HA 1T83C 4P04A 2UXFA 4EI5C 2ZCLL 1A7PL 4MJ2A 4Y4FB 5DD5H 4BSJA 4ZDHA 1JZIA 3NRFA 4J3VA 1MCRA 2XZQL 5ADPL 4N26A 4U1LB 5EU7C 3SDAC 3NP4A 1ACYH 3LRGA 2RMNA 4KK9C 3OF6D 3II2A 5J7CC 1EEYA 3JVGA 4HJTA 32C2A 2IALA 5E9DE 4U6XA 2FO4B 1BD2E 3N91A 5E6SB 5AOKA 5F7WC 3RL1A 4B7LA 1MY7A 4PJ7A 4DN3H 5DC4B 4AYSA 1RULH 4I3SH 2Q8AH 2X4QB 4PD4J 2IGTA 3VYNA 5FYJD 3BKJL 3K8KA 3WFZA 1FN4A 3DVGB 1WDAA 2P5EA 4E41D 4CW1B 3MV8B 4JM4L 3C09C 3NTCL 1XEUA 4DFHA 5IVOA 4P46C 4UQBA 4X4XA 4NSKB 2DQDL 2KLRA 3NDYE 1S5IH 3BH8B 4G6AC 4U1JB 2MTAA 4NUMA 4GT7A 3H3BC 2WUBL 3B3IB 5GSRA 5M94B 1GCFA 1USZA 1TVHB 3H42H 4N2CA 3A6BH 3H0TB 3AS3A 4DTGL 2J6EH 1OOAA 4P2QB 2VDOB 2B8OT 3N44F 3R06A 4JB9L 3KGUA 3PXHA 4WUUB 1LQBC 3IE9A 2JKWA 1B9KA 1BZ7B 3BVNA 5DK0B 2F58H 2WWMD 2I7OA 1R5IB 4U1KA 2R1YB 1G7MA 3UTZB 1RJYA 3A4FA 3POCA 3CMOH 1UFGA 2EDLA 2NQDA 5T1KD 3WYRA 4KRLB 4ADIA 4N87A 1KSRA 2FQEA 2AJZB 4ELMA 1VAHA 4JN2A 4MCMA 5DJ2B 2EVIA 3GSRB 1VPOL 5BO1H 5JHLA 4DKAA 4QRSB 5KJ4A 3W9EA 4Z7NB 2OL3B 2FECL 3UZEC 5EZJA 2EIZB 2VDOL 4QHLA 2P47B 2DM3A 1YEDB 3FT2B 2NY0D 2EEAA 3X1BA 2EILB 3HNTH 3K2IA 3TCXA 2AXJA 3IFPB 1TIUA 1ZHBB 3S88L 4N3UA 4Z3FA 5J6GA 3EGXB 3ZBMA 1PD0A 4Q9QL 2XZQH 3B9KA 3V4LA 3S36X 5DK3A 2IBZY 2D0HA 3AACA 5FUZH 1NOLA 4HUVA 5F2FA 1KBPA 4ZFZB 2D7TH 1CDJA 2J43A 3WO3B 1Q1JH 1BD2A 2CD0A 4XBMA 3E6FB 3DA0A 3GIZH 3O6FA 4ZMTA 1ZMYA 1LEKA 1YNTB 1SMAA 4GNKB 5HYJD 4P2CG 4XPFH 1RVFL 3RJQB 3SOTA 4ALAC 1MWAH 2OJZL 3EO9L 3D05A 4ZRGA 4YSSA 3GJEB 4IIZA 3FUMA 3L9EA 2Z7YA 4WUUD 4L4TB 2E7HA 4IU3B 2WVVA 4OGYL 2HJKB 4OZHA 3NK4A 2DEYX 1RZPA 4L23A 1FLRH 4XPBH 2PPEA 2WXMA 1D3CA 3B34A 4WI7A 1UJ3C 3VMPA 1B2YA 4F1ZA 2K1MA 3L1OL 3FTXA 3JT0A 3TYGL 4E9SA 2WXRA 2WBJD 4JQIL 4MJ5B 2R4SL 2B5IC 4JQIA 5HJ3A 4CJ0A 4OCXH 4A2HA 5SWQA 3MRQA 5JQ6L 4UOJA 3NSDA 2X4SB 5BZXA 4X6DE 4KRPC 3RX7A 3UJTL 3DHJA 3MJ9H 4OCYH 2E7CA 2FQDA 4N25A 5J89A 3ABKB 3G08B 1TCMA 5D6CB 3L7FA 3P73B 4W9HC 5C6TL 5KVFE 4J3TA 4RRPM 3O4LB 5DHYA 4C83A 3OKOB 4LLWB 3UZQA 3SGJA 4R4NC 4HMEA 4FI7A 4U1MB 1GW0A 2UXTA 1IAKB 3LNGA 4J4PC 5C0IB 4DERA 1U3HB 2DQUL 3NJIA 3P4MB 2WINA 2DWEA 5SWZE 5CZVL 3ZW3A 2WC7A 5HHME 1Q9WA 2NW3A 3FRUB 1L9NA 1KV3A 3H2QA 1YMMD 1MFBH 2HLEB 5LXVA 2O5ZH 1AKJA 1X7QA 1G0YR 1SBSL 2LQRA 5IVXE 5L4JA 3QUZC 3GXMA 3EFDH 1BREA 5FF6B 3CBJB 5LDSA