4IBUA

Human p53 core domain with hot spot mutation r273c and second-site suppressor mutation t284r in sequence-specific complex with dna
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
197
structure length
197
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVCVCACPGRDRRREEENLRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of p53 inactivation by DNA-contact mutations and its rescue by suppressor mutations via alternative protein-DNA interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Cellular tumor antigen p53
total genus 51
structure length 197
sequence length 197
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ibuA00
3WTXA 2ADYA 2GEQA 4AGPA 2J21A 3EXJA 2VUKA 3KMDA 1HU8A 2RMNA 2X0VA 2MEJB 3Q05A 4G82A 1E50A 3US1A 2J6WA 5LGYA 3KZ8A 3QYNA 3WTYA 2FEJA 3WTWA 4KVPA 2J1YA 4IBSA 3D05A 2J20A 3US0A 3EXLA 4GUQA 1H9DA 4AGMA 2XWCA 4IBZA 2BINA 2H1LM 4IBUA 1IO4C 1TSRA 5AB9A 2BIQA 4MZRA 3ZMEA 4LOEA 5AOKA 2IOMA 2IOIA 4IBTA 4IBVA 3VD0A 3WTTA 3Q06A 1KZYA 5G4NA 2BIPA 4IBYA 5AOIA 5LAPA 2J1ZA 3D06A 4AGQA 4IJTA 4AGOA 5AOLA 3TS8A 3VD2A 4A63A 4MZIA 2ATAA 1GZHA 3WTVA 4IBWA 3D07A 2XWRA 4QO1B 2AC0A 1CO1A 5KBDA 4G83A 5BUAA 4L0YA 3D09A 2IOOA 3D08A 3QYMA 4IBQA 2J1WA 1UOLA 4HJEA 1TUPA 1T4WA 4AGNA 5G4OA 5G4MA 4LOFA 5AOMA 2BIMA 2WGXA 2AHIA 2J1XA 2X0WA 5ABAA 2OCJA 3WTUA 1YCSA 5AOJA 4AGLA 1EANA 3Q01A 1HJBC 1EAQA 4L0ZA 1GZHC 3VD1A 4L18A 1EAOA 4XR8C 4LO9A 2YBGA 3IGLA 3D0AA 3WTSA 5A7BA 1CMOA 2PCXA 1LJMA 2P52A 2X0UA 3WU1A 1HJCA 2BIOA 5ECGA 4GUOA 3IGKA
chains in the Genus database with same CATH superfamily
4JDZA 4JO3L 5GHWH 3V4PA 4DP6X 4OJEH 5ID0B 3HW7A 4FQHB 2ROXA 5C2BL 3ESVF 1KJ3H 1K8DB 2YRPA 3GXDA 5A16A 1I3GL 3WN5C 2X3AA 4W6WB 5EZLB 1QFWM 3HRZB 4G8IB 3L3DB 4N8VA 2YGVA 3NSCA 4GAGL 4QHPA 1WS8A 3LKNA 1GH7A 3CJJA 3CCHA 3ARZA 1JYXA 2HFFA 1VFBA 5D96C 4LVEA 5E2WH 4JPWL 4NO0A 2MOQA 3MRDB 1A1OB 5LJYH 3JUYA 1DQML 2X4NA 4RH4A 2O93L 2DLTA 1RAMA 1YG9A 2B0SL 4AGMA 1RLWA 1BZ7A 4DOHE 3BAWA 1O7SA 5KVEH 4IKIA 4TSAH 3X2QB 1PS3A 4XMZA 3W2DL 1WTGT 3HRZA 2CLRB 5DR5L 2EZ0C 3B2XA 2VDNB 3K6NA 3X17A 1KZYA 5EOCL 3UTSB 1AXTH 1A7BA 1J1XL 2X38A 2ZCLH 5I6LA 1DVFC 4Y19E 3ZL4L 3LQAL 4XBGA 3QIWC 1EERB 4C57C 5TE4H 3EIFA 4WI0A 3TFBA 1QWHA 4WRLA 2WXMA 4I1NB 3AFLA 1T22B 1EFXD 3ARFA 3D07A 1EZSA 3TZVA 5C0FA 4KC3B 3R4DA 5CJXC 2XJKA 1WISA 1M2VB 2EINB 4KY1H 1F6FB 3AUWB 5EU4A 3LEYH 4NT6A 3MFGB 3QYMA 4IBQA 4U1KB 4KO7A 1V3KA 5BZWA 5IJDC 1AGDB 5EORL 4PP1D 1P84J 1OQOA 1ZGLB 2ODIA 1X9LA 4YHKH 1Z32X 5C86A 4LL4A 1RJYA 3BP6B 1F1DA 1T83A 3UJIH 4JL2A 1S7UA 1Z9SB 1HXKA 5IFJB 4OM0L 4P4RB 4WHTB 4BSWB 3WXWL 3KDMA 5D1ZC 1H3GA 4YGVB 2V3EA 3QDAA 5CCJA 4Z7OF 3GTNA 1JCVA 4N0FB 3D39D 5CGYC 3RY6C 3WY2A 2GITA 3D18B 1EO8H 1RLBA 2DM2A 4JFDA 2E7DA 4UT9L 5DC0A 1JWMB 3RWDA 4P9HH 4W4NA 5JPMC 2OJZH 3QVAA 4H20H 5T1MB 5M7QA 3HNSL 4LSSH 2Y7NA 3B9KA 1E9OA 1UCBH 3QQ9D 3O9WA 2F1EA 1WQVT 3Q2NA 1JAEA 2WIMA 4F9LC 2QHRH 3T4AB 2OMNA 1XIWB 2ZG1A 3BUTA 4QRTA 5DRWB 3ZL1A 3FT0A 2AGJH 3UBXB 2WP3O 3RE0A 4JFEE 1UJ3C 5B7EA 4NKQB 2R2BB 3VI3F 3B5GA 4RRPM 3QYNA 1ORSA 2Y69B 3HOGA 1T03L 4G9DA 2DL2A 3QARA 3MFFB 1UYWH 1F45A 2Z93A 2CG9X 2W9EH 3BFQG 1W8NA 1E9OB 2P80D 1B90A 1BSIA 4QYOB 4K94L 4MD5B 2DQIH 5AVRB 5JQIB 3P9LB 2GFBB 2PF6A 3T4AA 3ARBA 3WJLC 4YHYB 4PGZA 4LLMA 4JRXD 3ZMRA 2QBWA 1B3JA 5C07A 3NZHL 4FN0A 4S1SH 5BRZD 1SLUA 3KGUA 2QKIB 2Z8VC 4HOMA 4MTMA 3VFGL 4F2MA 2G30A 1T21A 4X98B 1B3IA 1CXHA 3G7TA 1R46A 1QRNE 5ICZA 2V2WB 1S3RA 4W9KC 3VQLA 5B3NA 2VTFA 4P5TB 4AYFB 5CZXD 1G43A 4XO3A 1E43A 4FG2A 1URIA 2BP0B 2Z93B 1HOCA 2XU9A 3BAIA 4HUUB 2FTAA 3NRQA 4EAEA 4GW5B 2AJSH 4MZIA 4XX1E 4FQXA 4Q2ZA 4YSRA 3B3BA 1O6SB 1FZMA 2NNXA 5DVPA 2JJVA 3IDMB 4Y2DD 4MX7A 1EEUA 3ATAA 5FW6A 3V7MA 5L8KB 1KTKE 3QGVA 2O5YH 4F2MB 3HA0A 1MNUH 5FKPB 3VFTB 1FL6A 5DD5H 3OZKA 3SGKA 3F7LA 1T0MA 1BJ1J 1ZA3B 4AYFA 2FJUB 3UTZA 1JSYA 1C5CH 1NKOA 1HOCB 4DSYA 5IFHH 3GLZA 4TNFA 2MRYA 1BAWA 4L3CB 4FQXB 3BZ5A 4FTDA 4XXWA 2XIIA 2F08A 3T0EC 3AXLB 1TSHA 4BM7A 3CFJA 3C5ZA 3HLAA 3TA3C 5DMYA 1QUPA 4OVVA 1M71B 4MZ2A 3VFNA 1AHWA 3S37X 3X3FH 4NC0B 5FCUL 1Y0LB 1Z66A 1U8PB 2BS9A 3LVTA 3N91A 3DIVA 4HDIB 1D7CA 3Q5TA 1G6VK 3E8UH 4AV0A 3O3EB 4GRLB 4FG6D 5D8JL 1C1EH 2FLBT 5T3XH 2NY7H 1TITA 1AD9B 2XY2A 3CHQA 5FA3A 4OD1H 1FSKC 1FIGL 2HB0A 2O30A 2PTUA 3MCLH 2BW4A 2GY7B 2F8XC 2J6EA 4NHUB 3CWGA 1HZKA 4UU9B 3BP7A 4NX0A 3D3VB 4HJSA 4PWJA 5LN4A 3CFJB 1ONQB 1UOKA 3FO1B 5AYUL 4PIRF 3TBSA 1M71A 4J3TA 4GKOA 4HWEL 4DEUA 3DTXB 5DYFA 5GXBB 1FNHA 1U8PA 4RAVA 3BVVA 4NKMB 5GGTL 3MLVL 3O3EA 1EDYA 3VX0A 8CGTA 3EG9A 3T2OA 1DSYA 1GZQA 4KDTC 2D0FA 2EZ0D 2YD2A 3IMTA 2BVTA 3PWJB 4LAJH 2B3IA 1GYVA 3HG1B 4BK8A 1XB6A 2A0LC 3QIBB 4WK2B 4FF9A 1SJHB 2XA8L 1L3WA 3ATBA 1FFNA 3IS0X 1RU9L 5ID1B 5L7XL 1II4E 4WV1B 4LLDA 1H8SA 4X9BA 3WJMA 2MKWA 2DQIL 3QUZA 4LASH 4H13C 3N1FC 3BRFA 1JIBA 3IXAB 8FABB 1PG7W 4HK3N 1QNZL 1T1YA 3NFSL 5EOCJ 2J8HA 4OGYH 2X28A 3CN3A 3B7YA 2R8SL 3VRJA 1EBPA 2X5PA 2AEWA 4TRPL 3SIKA 1WG3A 4M56A 3L17A 4N26A 3PHSA 1XF4A 1BGXL 3D0VA 4IOIA 4PJ8A 4F7CA 4F15C 5I2IA 3BMVA 4WCYH 5LBGA 3ZTDC 2NXYC 4Z23A 3GGWB 4AK1A 4Q58C 1JPSH 5AW2B 2X40A 1ADQL 1NDGB 1T1YB 4HKBA 2YWYA 4YHZL 1NKGA 2BSSA 2CXGA 4RMBA 4Y5VC 3K0WA 1FZOA 4Z0XA 3V0JA 3VJ6B 4I3GA 2QFPA 2YXMA 1I7ZA 5IIEB 4YHOL 5ILTH 4H26B 1HHHA 3BQUA 3IDUA 5BZXA 3SDCC 2CK0H 2CBMA 5L4MA 4YHIB 4C83B 4NLHA 3WKML 1AY1H 1QFUL 2SEBB 4KUCF 1EPFA 4L5FL 5E99L 5F9AC 5AW6B 3B7TA 2N56A 4PGJA 3QJSB 3VGFA 1PG7L 3NZSA 3B4NA 2KLSA 1XR8B 1BYNA 2EYRA 3U46B 1UOVA 5HHNB 1KCRL 3DPBA 2DQHH 5AVSB 3J27A 3QQXA 5EU7E 1J1PH 5G5DB 2JJWA 1NUDA 2BVQA 3KXFE 4YC2B 5J1SC 4LLUB 4N0UE 4F7PA 3NP3A 1PIFA 3Q05A 4E41E 4FNTA 3WUWG 2XTJD 1B6DA 2CLZA 2F5AH 1RK0A 2OQJA 4GIAA 2YD9A 4R0LA 5JHBA 1FV1B 4KZEH 3BP4B 3VNZA 2A6JB 4BZ1A 1ZT7A 1YEJL 3QEGL 2VXQA 2D7QA 3KPOB 4OZHF 1K8IB 4YPGB 5EU7C 3G08A 1SF3A 4KVPA 3F6LA 3H9SA 1Q72L 1F11B 1VADB 3LRSA 3G04B 4BCYA 2EP6A 2BVQB 3QISA 4BQBA 2WQRA 2ESVB 3NGBB 1R47A 3A6BH 3X1NA 4F7PB 1ZS8A 3GJEB 3ZR6A 4EZJA 3QPQC 4O58L 3SOTA 1S7TA 1IAOB 2VLJD 5E5MA 3MGAA 5F89A 1MLCA 4R4BB 2FR4A 3DETD 4GKLA 1ZLWH 3ZHNA 2NDGA 1E8XA 2ATKB 3BZDA 3FFCA 4AQZA 1SDDA 4N2EA 4UDTA 3UJJL 4G6AC 5E08L 1K8IA 2YUXA 2KH2B 4JO5A 4L0PB 4WEEA 5EN3A 2OSXA 3D2TA 4X6BB 4LKXB 3BT2H 4N8CL 2F8IA 3OPUA 3S4SG 5B3JE 3JT0A 4WJ5B 5EO1A 5I6OA 2D31A 3ZGIA 3RPIA 2EC8A 1MIEH 4CUCA 3CXHJ 2PPDA 4HBCL 1TOXA 32C2B 6FABL 1LXMA 2FBRA 3E7JA 5IQ9A 4X6CB 2QLYA 3BIAX 2R2EB 4NENB 1Q9WB 2OSWA 1XGUB 3SYOA 1JP5A 4N1EA 5E24E 5DU7A 5CR1A 4O4YL 2KKQA 4MJ5B 1MQKH 1UJ3A 2FEDD 1WC7B 4X6BA 5ADPL 1IGIH 2RD0A 3GIVB 1RD6A 3QNYB 3RVWC 5I73B 1MFDH 1QLEH 1W0VA 1C7TA 4E9YA 3M45A 3RPIB 4S2SB 4FJZA 4GO6B 5C6TL 4OTXH 4HLZH 5C09A 2PPEA 2P24A 2G0KA 4IYKA 1MJJA 1BF8A 4G71B 2X10A 1CYGA 4RWYL 2Y1YA 1Q9WA 5FW7A 1S7QA 2MTAA 4J4PD 2LABA 3AU0A 1SYSB 4IEFA 3U6RA 5IW6B 4YHLL 3MGOA 5CIPA 5F6IC 5GS1B 5LDSA 4P5TD 1QTYT 2Y1VA 4AZ8B 2ID5A 4NGHL 3KWXA 4PRHA 3O3DB 3EDKA 4YHPA 3MO1A 1G84A 2BNQA 4A66A 3Q43A 4Y4HA 5AW9B 1BFOB 2APFA 2E56A 3K72B 3DUSA 4KKQA 2WQSA 1FH5H 2PXYC 1TJHH 1J0ZA 1A4AA 1IIKA 1JPTH 3N04A 1U58B 1NEUA 2WV3A 4QEGA 4XNAA 5JQ6H 4JHWH 1LGVA 4NQDE 5FO2A 3KE0A 1D7BA 4JFFB 3SKNA 4ZUSA 2O72A 5ELIA 5CINL 2AQSA 2ZXAA 4R26L 3RURA 4ZXBD 1CDCA 3MUUA 4HPYL 3K7UA 4LHQB 2PCFA 1PEWA 3HG5A 1HHIA 4AV5A 4UTAL 1JFQH 1V27A 2YN3A 4F58H 2B5IB 2WLZA 5IHBA 2AZUA 3HEIB 3D39E 3BXNB 2ZP9A 5C0JA 1XD0A 4KK8D 1EMTH 1R24A 2F53A 2VXTH 1DBJH 3FULA 1E2WA 5EO0B 3NFNA 5KSAB 4ZOCA 4MAUH 4YDVB 1RJCA 4F7MB 5DFVD 2FJSA 3IWUA 4X4XB 4R2GB 3FSAA 3GSRB 1A3RH 2HPTA 4PIBA 4M7LT 2F8OA 5IBUB 1DL7L 4LP5A 1AHWC 1KF9B 3KEDA 4PWGA 1IFHH 4HLJA 3HE6B 1LNUB 1UXWA 4KI5D 2W65B 3AS3A 4ZMYA 2IH9A 4BFGA 2JB6A 2VDQH 1MDAA 1V54B 1X5YA 1A3QA 3IFOB 1UQSB 5CIPH 3D3VD 3FAXA 2G5BB 4A7UA 2EIBA 4P4KA 4AKOA 2FWOA 4MS8C 4X2UA 2BIHA 4NN7C 4P23B 5DJCB 2AK4E 3VXSE 1G1KA 3CBRA 4Y5XA 1WGVA 4RX4A 1MWAB 1FL3A 3HMWH 1MFBH 1WCQA 4TRPH 3MV9E 3CSYA 3FL7A 1UXWB 3VG0L 3QQ4A 5IUCA 3HZMA 1K4DA 1FWXA 2AEIT 3RFZB 4X0NA 3RX9A 3FU7B 3U9UB 3BGFB 4APQA 4A7VA 3TNNA 1YQVL 5DEJA 4LCCA 2NNFA 4FGMA 1LO4L 4KV5E 2X2YA 5DJXB 5D1QD 4A1RA 4JDEA 3TN0B 5I6XB 5IOPB 3OAWA 4G8IA 2XUWA 4R3SB 5INCA 3MCLL 3B9KD 5LWYH 1G7LB 1AC0A 1KCSL 1T1XA 3STZB 5GQBA 1PZ5A 1YY9C 2ZSWB 4JFDD 3V4UH 4W9FC 4YSCA 4GXUM 3BP6A 4TQ8A 3LN9A 3CMOL 3RU8H 2TRHA 5C71A 4XVTH 3FU7A 4P4RA 4B9FA 1ZLSL 1AG0A 1OAJA 3VU1A 4LCCB 4BSJA 4ETQB 4ZOBA 4WJKB 4RLDA 4ENEC 1F00I 1ID5I 3TN0A 1FC2D 4U1GC 2PWDA 3AG4B 3B3IB 2B4CC 1XTLA 5T1JA 1CIUA 2XFXB 2FDBP 2DWXA 3OJMB 4Q4EA 3GSOA 3GYRA 2MCPL 2QR0A 5T1LB 1U8OB 5CSBA 4XBGB 1YSOA 2O6EA 4LLVA 4PS8A 2CLVB 3SGJC 3IMWA 1R9FA 1XEUA 3WL9B 3QO0B 4WI0B 4HJTA 1P6AB 2BNRA 2VT0A 3D6GA 4MAYB 4EE2A 2DQUL 5AENA 1GAFL 1CFSA 1T22A 4L37B 5C0FB 4XMTA 4U1HB 5HDBF 1KNOB 1GJIA 3O4LB 3IDJB 1J0KA 4OZIA 1UA6L 2AJZA 3L2MA 4AGOA 2FSDA 5EUKA 2BSBA 1OB1A 3PP4L 3ZHLA 1YYMH 2GSGB 1HT6A 3VXQB 3QBTB 3QUXC 4OKVB 1GGCL 1RMFL 2A6IB 4TLSA 2M8XA 1BGXH 2JCCE 4U2ZA 4HCGA 4PJFB 3WL9A 5JHLA 4MD5A 5I76A 3ULUL 2ZXBA 3JV4B 3MZGB 4JRLA 1Z9SA 3MJGX 1YN6A 1JGVH 3QJVB 2RQ8A 3ARBB 3VXUE 3KDMB 1AIFA 1K2DB 1TQBC 1OCOB 2VR6A 5T3ZL 3VD4A 4FNUA 1HK6A 4P05A 3ULVD 4P46D 5CLYA 3VGDA 2CO7B 3OJDB 1T21B 4TUUA 4X98A 2J57A 4S1RL 4AW7A 2X4TB 3KWTA 4RRPG 5PCYA 4P5TA 3GXPA 4QCIA 3WFZA 5AAPA 4HBCH 4P46A 3VA2C 3ZDZE 1EO5A 1KIUB 3A67L 4HUUA 4LKCB 1WCBA 5I8EB 3O9WB 4ECNA 1N3NA 2XX0A 3OM3B 4N0YH 4L5FH 3V5HB 3RWCA 1JE6A 4EO5A 5INDB 3D25B 1JK9B 5E6YA 2ZYHA 2X4RA 4TULL 1R3KB 5HYSB 4RZKA 2OJZL 1IM3B 1GGUA 4HEMA 1DVYA 3FUMA 4EKJA 5J6GB 4QT5B 3C09B 5J9PB 1KJVB 4IK6A 1XGRB 4HC1L 2QEJA 4N2AA 3S5ZA 5D7JC 3KS0J 4JO8A 2EDJA 4L9DA 2B16A 4PRIE 4WI5A 4MXVE 1K6QH 1RZ8A 1ZXQA 2E8YA 4N2GA 4PQXA 4AQAB 1S9KC 4R4FH 1WCBB 4JUTA 5IB2A 3BAXA 5FO9A 3US1A 3EYVA 3D2UD 1NUNB 4GPVA 2H0FA 3P9LA 3UG3A 1U8JB 4OCXH 2HRPL 2XCMC 3K3QA 3SCMD 4FXTA 5E6IA 5A2AA 4ACTA 1QQDB 1HL8A 4OAWB 1MFCL 1ZVNA 2XWJA 1IGCH 1Y0LA 1WIOA 3SDXE 4G7SB 3M6DA 5EU6B 3SE3A 5ICZB 2P45B 2IXQA 3ERXA 4D2NA 4JHZA 4N0YL 3EADA 3FN0L 4HXAH 4WO4C 2X1PA 3FTGA 4HEME 3WUZA 1KPRA 3TH3T 3H3PL 4JRYD 3BPOC 3UCQA 5IB2B 3BGFC 1NUGA 4MJHA 1SBSL 5CILH 3BLBA 3BIBX 4BD4A 1O6SA 2F58L 1QPPA 2MNUA 3TBYA 1NGPL 4PJFE 4GRWB 2WIIB 4KPHL 3BE1H 3IN2A 3TBSB 3VI4E 3EJYC 5HJ3B 3PWPA 2C9VA 5DK2A 4V1DA 3F5WA 4R4FL 3BH8A 4XE5B 4PMEA 3FCUB 1HN1A 1RVFL 3MLRL 3T3PF 4C54A 1T6BX 3LNDA 2L7QA 4BQCA 2CDFB 1ZD6A 2JK5A 4M6MH 2VISB 4XMKL 4ZTPL 1DP0A 3ZOAA 4BJLA 3DOSB 4XCYB 2F7QA 1EHXA 4ERSL 1P6WA 5IW3A 2NNCA 3AT9A 3PPSA 5FYKL 1G7HA 3RJOA 1L9RA 2A9NL 4CN6A 5DFAA 4QLRA 3RP1A 2R2HA 1FFRA 1CR9L 1K5NA 5LCVH 2V0AA 4LPXA 5H4ZA 5I8OL 3FSZA 5EMYA 3EJSA 3KYMA 3MNWA 4I48B 3LKPA 4X6CF 1W0WA 3ARDA 5ABAA 5HYJE 2WVSA 5B38A 1WBYA 4L4VA 4FC3E 4P2QD 4BZ2L 4L9LC 5CXPA 5EUOA 1IB5A 2P5EB 1UKQA 1OP3H 1QSFB 1MG3C 3SJVD 4L8CB 2WZ0A 2Y3NA 1S4IA 3DX1A 2IAMB 1J1OL 4OFVA 5A7EA 2DYSB 3EO9H 5J12C 3IPBA 4FHJA 4NQCE 1OAXL 5HVWA 2C9PA 3ZIYA 1UGNA 3DOIA 5IP4A 2QZQA 1SBBA 4ZBJA 4UTBH 3DTXA 4UZUA 2WXFA 5I2IB 4IJ3C 3VM5A 3DGGB 3UBFA 3KYNB 4K3DL 2LTQC 1R6VA 2OX5B 3PWPD 3KPRA 4UNTA 2YKLL 2MSPA 1G9ML 1SLVA 3J2PA 5I1AB 1NC4D 1QSFA 3T2PA 1LE9B 3ZTJG 1XWVA 4C4BA 4K5NA 4PJ6A 2AJYL 4UOQA 1T89C 3VJ6A 1AD0A 4FKKA 2LU7A 2C3GA 4M9OA 4WO4A 4CU6A 2CGYA 5IIEA 1OVZA 1X7QB 5JHDB 3CFUA 2BC4B 2HN7B 2J2ZA 5BJTA 5AB0A 3EFDL 3MRQB 3HJEA 1HIML 2FD6L 4Q8BA 1FO0A 2K9FB 3LSOB 3MBED 5E6SB 3QXDB 4WW1B 3EHBD 3V6OE 2E59A 5D7LD 4NFBA 1TMQA 1IEAA 3U0WL 4BE6A 1JZEA 2I7SA 2WLMA 4JFOA 4NNYB 5EC1A 5G5DA 5I1HH 4HUVB 3DX2A 4LCUB 3TIDA 4G7QB 5I1LB 1NMCB 2A74A 2GB2A 1I7UB 2ITDB 5JUEL 4K3EH 4NBZB 3MC0A 4OLVL 3QQ9C 3BKYH 4QGYA 3D0VB 4M48H 4WTZG 5B1KA 2QHLA 3TASA 2RQEA 5ICUA 2B9AA 2Q8AH 1NICA 3P77A 5BV7B 1WA0X 2IH3B 1FVDA 1BPLB 2FBJL 4UANA 1U8CA 1IEAB 1NAML 1JS4A 2ZYRA 3DO4A 4BFNA 1UH4A 1HOEA 4JFOB 2Y7LA 4HUVA 3HBQA 3CGTA 2QSTA 3ULVL 4W1TA 2AW2A 2CRZA 3RQ3A 4A7SA 3GJEA 4UUJB 4Z3HA 5B3SB 1EEYA 4YVUA 1EZLA 5HVHB 1KIPB 3HZ3A 5I26A 3UFIA 4P2RA 3NQKA 1JNHA 2P1YA 1E6OH 1QI5A 4OLUL 5IJCC 1UT9A 2NY2C 3K2IA 3ZPDA 5SX5K 1RIVH 3WS3A 3MLPA 2ZX5A 4EBQH 1CGYA 3PWLB 4PJXA 4KNTA 1AMXA 1NL0H 2YQBA 5IROC 3LNGA 4QHLA 2AXGB 5K9JL 4R4NC 1X7TA 2UWEA 1MY7A 3ILPB 4PV1C 1BQLH 5IVXE 3OMNB 2AI0H 3QZLA 2D31B 4QNPF 3DRQA 3K1KC 5BS0B 1YUKB 1T6WA 2AJUH 1GVIA 2Z31D 1CI5A 2NY1C 4BZ2H 2D7MA 2OW6A 5EUOF 1T3FB 3EHBB 1KCSH 2R2EA 3P3UA 4JFUA 3RY6A 4R97B 1LK3H 3CFEB 3SCMC 2A6JA 1ZTXH 1ZT7B 4DIXA 3V6BR 5DVOA 1C08A 3BOVA 3PQYD 3RIFF 1ZANL 5EEZA 1CF8L 1F4YL 2OZ4A 2HTLD 3AS2A 4NQDA 4X5LA 1ZEAH 3QNYA 3ZHDA 4FOMA 4XVOA 4M7JH 1T5XA 3NSDA 1L5GA 4KZEL 5KBPA 5KSBF 3DRQB 4YDNA 2H2SD 4AQEB 1Q38A 2ZKHH 5D7IF 2FWUA 5EB9A 4K8RH 3KLHD 5J3HD 2A73A 1MJJB 2E9IA 3GRWA 2MQ3A 3U0PB 2F0CA 1MCOL 2ZOTA 3IJSA 4NQCD 1UFGA 2CK2A 4PJBF 3UAJA 3DJRA 3KR3L 2ZNWA 1E27A 4JJ5B 1Q9LB 4NM8H 3FQYA 2R8SH 1KTRL 1P4BL 3ALPA 3QCUL 4S1QL 3VFUA 5A6MA 5A6LA 1PW3A 4N9GB 1EBAA 1FFPB 1NCGA 3ARGA 3UX9B 2AQNA 1FC1A 2WB7A 2X1XR 5C9JA 5IJKA 2BP8A 4J1UA 1FLRL 2X4UA 4W9ZA 5A2JH 3MRIB 3AG3B 2OL3L 1LILA 5HI4D 2IG2L 5LNGA 1U8LA 4N2OA 1UASA 2Y72A 4PJEA 2BPBA 1XGQA 1X4XA 3WY3A 3CU1A 3K72A 4GG6E 3QUYA 1B4JH 2X3CA 5BV7L 3QDJE 4TUOA 4WJG3 3V52L 1U58A 4PJGA 1QW9A 2XVGA 1CQKA 1IM3D 3S4SA 1HCYA 3L3JA 5GJTH 4Z6AT 2N1KA 3KNBA 1UJ3B 1YEIH 4H1LG 3M1OA 3ARGB 3X12A 1BZQK 1LVEA 3MLSH 3QJRB 4G6FB 4YHOH 1I9JH 2QLVB 5ILTL 1FN4A 1OF2A 3UZQA 5CLXA 5JXEC 4FZEH 4FA7B 2XHNA 4YNYB 1UEYA 1U8LB 3BQUD 4MDRA 2IGFL 3FFDB 1LWHA 5C0RL 1KGUA 5TQ0L 3MV01 3P4LA 3BXNA 3KPRD 2NYYC 4AJYV 4I18A 2GCYB 2CDGA 4IMKA 3I9AA 4UT6A 3MODH 4GINA 5I75B 2B8OT 2UWEE 2FX7L 2YAMA 4WTWA 1UWYA 4CDHA 2P7TA 3LAFA 3P73B 3QDJB 2N59A 3OC8A 2VDPH 2ZUVA 3BPNC 5KG9B 3ABGA 3X12B 3C8KB 5JLZB 1GY2A 4XI5D 3L5WA 3IVKB 4AZ8A 1DEEB 3HE6A 2KT6A 1SDYA 4LT7A 2BNQB 5HDLA 1OTTC 1R3HB 5ESAB 3T9WA 1A3ZA 1CGWA 1G1OA 3RGHA 3QRFM 4YBHA 5FGCB 3EDDA 3FT4B 4NO5B 4XNBA 3HZVB 3LZFH 1N6UA 3CN1A 3Q5OA 1KSRA 1RZKL 3H9SE 1ASOA 3P2DA 1M4KA 5L88H 4WUUA 3MLYL 3SKNB 3GD1C 3FQ2A 3E6FA 4LSDA 3GXMA 1OSEA 2ZWKA 2VLRD 5EN2B 7PCYA 1NOFA 1E7VA 5DEZA 4HKJB 1HHIB 1IRAY 4PJIB 3WHE1 3ZTEA 5EU5A 1UM4L 1XX9C 1TF4A 5I1IL 2K0RA 3WUWB 4J3OH 2CR0A 4KROC 1IEBB 4NO5A 3ZKNC 1F4XH 1A0QL 1BWMA 3ZE0F 2Q1EA 1HSAA 2BIQA 5IB4A 3QUMA 3MRPB 4NCC1 2OYMA 5BS0E 1EUTA 1N6VA 1A4BA 5FHAL 5I0ZA 5I1EL 2QSVA 2VRQA 3QUXA 1RCYA 1PZ5B 4AYSA 4PG2C 3CK0L 1IC7H 4LVHB 4M62H 3FBKA 4LDEB 4Y2OA 4KTYA 3RWHB 4A6YL 5JZ7C 1AP2B 4OZFA 3F00A 3CFMA 4Z78B 3IDGA 5FHBL 1PF3A 3TT1H 1GZHA 2ZUQC 3HNVH 4PR5B 4CBZA 2G5BA 4PD4K 1IT9L 1KJ2A 1R5WA 3CD4A 2XKSA 3G5ZB 1HSAB 2YRZA 4J4PA 3V95A 4M5SA 1FYTE 2W9EL 5DUBA 4ESKA 1HZHH 3PAZA 4DKFL 2EYSB 5E94A 5FO8A 3P0YL 4PU2A 2CLVA 3QPXH 4NYLA 2HRLA 1LE5A 4HH8A 4PCKA 5C0NC 3R1GL 2WXRA 3I50H 4APQB 5DJAA 3L48A 2WKOF 4MA7H 4H8HA 3QR2A 2HLFD 1Y6NR 5HGDA 1NAMH 2YOCA 4MB4A 4L4VE 3B5HA 2WN2A 4OIIL 2AK4D 5EUKB 2CDEA 4CC4A 4D8OA 4KVNH 3BLPX 3RB7A 3PJSB 5A3IC 4XTRC 4OKVA 1TDQA 1JPTL 2AJSL 4JGUA 2WXJA 1JGEB 1IC1A 2DMHA 3CAFA 1BVKB 3JTSB 3MLZH 1A22B 4G59C 4JGJA 3SE6A 3KL5A 3ASNB 3NSYA 5EBWA 4JY4B 1MHEA 3E38A 3LIZL 4LBEB 2WWNA 3TZVB 3QUZC 3SHSA 1AO7A 4N3UA 4DO5A 4GG6F 2QKSA 3MRFA 1FHNA 2GJZB 1C12A 1XO8A 3M07A 3NIGF 3SDAA 4U6XB 5JHDE 3QFDB 3U1PA 1AACA 2SODB 1DLFL 1SN0A 2XFGB 4ZPVB 4CVUA 4HUMB 4PV9A 2VXQH 1TTFA 4PJHB 3IGAA 3DJTA 4HIEA 2FEJA 2QR0B 5T1LA 3I50L 4UTAA 1ZGLA 3ARRA 2WUBL 1GMIA 3E8VA 3IRPX 1KYUA 2IF7A 4R8WH 1N3NB 3V5HA 5BOPA 5JW5A 3LRGA 3BWUC 4UV4H 3J7HA 4OFKA 1AR1D 5FCUH 2ISDA 4RDQG 5D7IE 2BK8A 4HH9B 5FFGA 2XICA 5KSBE 4LSQH 2IBZY 1AZNA 2XSKA 5GSRA 3MLUH 2OW7A 2EUXA 4FQ2L 3JWOH 4MJ6A 1F4HA 4UILL 5DJ6A 4PJ7E 1OB1B 3RWDB 3I85A 2XZQH 5GS0L 2IGLA 4L48A 1D5IH 3N9GL 5T1MA 5LGHH 3TO4D 3HE7D 3WKMH 4MMXC 4AEEA 5EIIG 4P9MH 5CEXB 2DM3A 3KL0A 1U8JA 4LSPH 2A9ML 5ICYB 3KH4A 1VA9A 1F41A 1XD1A 3OKMB 3KVQA 2ZOKA 1FZJB 4QNPE 3O4OC 2FJGB 4NDMA 1IZJA 1UM6L 3Q9QA 4FQPA 4DCQB 5HHOD 3B2PA 5HVFB 5GGRY 1KCLA 1CICB 2V37A 3ARFB 3MUJA 1KPRB 2WXQA 4GW4A 4OU3A 4M9PA 4GS7B 4ZTEA 2C8NA 4Z7VF 5FV2A 5JIIA 1KIRA 3PAUA 3FB6A 5TTRA 5BRZB 4Y19D 4RISH 4HZ1A 4CMMA 5GJTL 3MRGB 5TD4A 2Q3AA 4LLMB 1A4KA 4DT2A 3H9ZA 4AUUA 1X5KA 3EJJX 2ZOKB 5F7FA 5L2KD 3AM8A 3VI4B 1IQWL 2HCZX 4XPBH 1H5BB 1UZ6F 3ECQA 4AEIH 5J9PA 1BQLL 3ZYZA 3HE7A 4F8LA 4KKPA 2VW7A 5C0CD 1S7UB 2VERA 2GQHA 2CIKB 3WELA 2AJUL 1F8TH 4JFEA 4IDLA 4XVJH 2BP0A 1FO0L 3IYLW 1KB3A 3NIDE 3NJLA 4UQCA 5AVVB 3TVMD 3NCYS 5D2LF 2KYIA 3GMNB 3HG0A 5E2TH 3OQ3B 5GHWL 4ENED 4FP8H 2Q7NA 3II2A 3DMMA 4XN1A 3IJHA 1XF2B 2R9HC 1WF5A 4X5XB 4JFYA 2RALA 1MJ8L 2R7EA 4GKNA 3SDYH 4YZFE 1IGMH 2Y24A 1U8NA 2VLME 3SJVE 4HPYH 4E42B 4F2EA 5EU6A 4TF4A 3HE7B 4EF3A 3U2JA 1THCA 4JVPA 1M1XB 3SGJA 3CH8A 4ZMOA 1FE8H 2ZYIA 1DO5A 3ARGD 1ZCRA 2P5EA 3C08L 1IZKA 4JFEB 1KTLA 4LSSL 2YMOA 3RZWA 5L2JA 4B3VA 5CBAA 1KULA 1UCTA 5M95B 4GMSH 1MCOH 3UBXG 3BUIA 2BMKB 4WGVB 3SKUD 3ABLB 2NSXA 4BFEA 4HSQA 1OGSA 4GKNB 4X7SL 4ZS6C 1FAIH 1JG9A 1RERA 4PB0H 3IF1A 1U8NB 5DK2B 4Q74A 3V4VB 3JXAA 1HH6A 4DZ8B 1SUJA 3QUYC 4JFDE 3WTTA 3H7LA 4J3WA 5FGBC 4ANKA 2ZG2A 1BEYL 3D69B 4J3BA 5GZND 4KMLB 2Z4QA 4NJ9L 1T2JA 1E65A 2ADIA 4KRPC 4NQDD 2VISA 3U30C 2OKMA 4NAQA 4X8XA 5AL0A 5AQ0A 4RWYH 5I1CL 4L4TB 3MBXL 1MCIA 2H1PH 3HJ0A 3W1ZA 3SDCD 5C08D 2P5WD 3KYAA 1YMMD 1I8KB 5DZAA 1X5GA 3LEYL 3BN9D 5DD6B 2O5XL 5IT2H 4P49A 1I9JL 2JKWA 1DBBH 1FRGH 2FGZA 3A67H 1RUAL 3QEGH 4M6ML 4LSVH 4XMKH 4BCXA 4RAVB 2ZUXA 3B7RL 4DZ8A 1BFVH 5EA0H 3RI5K 2GSMB 3UAJC 1WBYB 4L4VB 2HLEB 5T1KB 2Z4QB 1OGTA 2Y3AA 4XNQA 2ADIB 2PTTA 3U1SL 4YBQD 5E1QA 4CVXA 3UTSD 1QMUA 4H1LH 3RWGB 2IAMA 3S36L 1GGTA 4J4PC 2Q0ZX 3BGMB 1KN4H 2QMKA 1BPVA 1YCSA 4ZS6D 2XN2A 5IJBC 1JI2A 2VDPL 1UACH 3U9PL 4FNPA 5I71B 1I1AB 2Z8WC 4Q6IC 3WCYA 5K9QG 3HG2A 1BF5A 5LQBL 2O5YL 3L4ZA 5E70A 4ZFFA 1QKZH 2JH2A 5A6IA 3HC0B 4UYPA 3P77B 1CGSH 3JV5A 1JF1A 3RX5A 3JVGC 1GPOL 4RISL 4X5WB 5HJDA 3AG1B 4NNPH 3ZTJH 2BP5M 4EI5B 2JIXA 1WTLA 1E5ZA 5ANHA 2YFNA 1AHWB 4JB9L 5KS9E 3ZR5A 1VCBC 4EIUA 3CUPB 2AKRB 3NJKA 3VRJB 2H47C 2J73A 4WO4B 4A2HA 5A1AA 4E36A 5KUKA 4GP8B 1N6QL 2G4GA 3GNMH 4HMDA 1AIZA 2BC4A 2HN7A 2QGBA 5A2LH 4E9RA 4P2RB 1GGIH 3MRQA 4F7CB 5FA3B 3QQDA 4QOKD 3E1ZA 2CKBH 4OV5B 4E9XA 1NFIB 4C58B 1TZ8A 1VGEH 5BW7A 5J11C 5E4AA 2AK1L 3BRGC 4WSJA 4AYMC 1EGJH 1TFPA 4D9RD 2BSCA 4L3EA 3FCTB 2G5RA 4LEEA 3KGRA 5AW5B 5BS0A 5ADOH 1A5FL 5F9WC 1B6UA 1YVLA 5JORB 4O2CB 5AW7B 1IAIH 3MZTA 3NSFA 3SO3C 3ZMEA 2Z7WA 1ICTA 4JANA 1X4ZA 2C9UA 1I1AC 4Z7UB 2GK2A 1DDTA 4FXKB 2JKSA 5JIDA 3O2DH 2EIKB 1KGXA 4Q14A 4J3OG 1C08B 4AQ8C 4PJBE 5DQ9B 3NCEB 3NJVA 3HG1A 3DPBB 4KHXL 2R1XB 1BZ9B 3Q6GL 1SJHA 1A1NB 4FFWC 3F7QA 3UTTD 4LLUA 1A6TA 4LCYB 2W9DH 4NNXB 4KI1A 3WJMB 4RQQA 1U8IA 5EZOL 2IPKB 5I1JL 3QHZL 3VWJB 1F02I 1TTUA 3WNLA 2XXCB 4YSEA 4O2CA 1R1CA 2XWTB 2NY5C 3FUKA 4NI6A 1SM3L 2FGWH 5CD5D 3NEOA 3AGWA 3T3PB 3HC2A 43C9A 1E27B 1CLZL 2GJ6B 5GGQL 1HINH 4IOFC 1J5OH 4JM2C 2XTJB 1U41A 1UUSA 4U31A 2W60A 3WXVL 3BMWA 4MNQD 1KGJA 5DEGA 4H8PA 2R1XA 5HDRA 2APBA 5FWRA 3G04A 2FJFB 5GS2D 4OLYH 3AROA 4WWOA 2FAUA 5D2NA 1BMWA 5C0DB 2CJSA 3NA9H 1A6TB 2VZUA 3QDHA 1ZA6B 4ODXA 3TA4D 2B7DT 3A3YB 3RVUC 4IKJA 3W56A 1UM6H 1JMZA 3K80A 4MBOA 1IILE 5KBLA 1OK0A 3QW9A 3VD3A 4KWUA 1J10A 3L3JB 4PI2A 2AJYH 4LDOB 5C8JA 1DL7H 1J8HA 3KBEA 5F7AA 4KVCH 2CE6A 4JN1L 2EIMB 3ARFC 1LJMA 3ZTNH 1XCQB 2X0UA 3QZPA 4GSDL 4D3CL 2VDLB 5D1ZA 3NIFF 4C47A 4DAGL 3RRQA 1QHQA 1QEXA 4HIHA 2FJFA 4A55A 1JRHH 2OI9B 4PS4H 1DVFA 5JHAA 1A6VL 4M7KL 3V0IA 2Q8BL 3KMDA 32C2A 4LSUL 2MEJB 1UWFA 4G82A 2K9UA 3LKSA 2GAZA 3IDXL 4JHAH 5D4IA 5E8OB 3C6LC 4G6KL 1LK2B 1LWRA 3U46A 1PEZA 1CZ8L 2QGEA 2HLFC 3QRGL 4KGLA 1SFHA 4EMZA 3UGXA 4KNQA 2J44A 4JJ5A 3W82A 3NCFB 4OLYL 4BSVA 1QYGL 1J5IA 2HAZA 3I9IA 1WC7A 2WSKA 2VDMB 1XTMA 5JLZA 2FHBA 3W9EB 4AV4A 2Y7OA 4QKTA 5GRUL 3F7YA 4TOYH 4OT1H 1TTAA 2EDDA 3OMZA 2ED8A 4NO0D 4H1LA 4HPOH 1XB8A 3VVWA 2YS4A 3JWNG 2DD8H 3QG7H 4IOSD 3MRKB 2XOTA 15C8H 3B9DA 5E8OA 4BRJA 5MENB 1GXEA 1RIUH 3I6KB 5FR3A 3A22A 2XNAA 2VWEC 3LRSB 1GTFA 4JHUA 5L6YH 2NW2A 1F58L 3RTQB 3ZDXE 5ESQA 3B2MA 3VMNA 4NZFA 3MKGA 3OR6A 1UENA 4WTQA 4RNRB 4NKDB 4WO0A 3WY1A 4ZSOE 5FK9B 4B50A 1A2YB 2DDQL 3LHPL 1I1AD 3N43F 3VFSB 3NJJA 1MLCB 1Z3GH 3H42L 4R4BA 4ONFL 1NCAL 5D6DA 4E41A 1BFOA 1SDDB 4EBQL 5KBDA 1ZHKA 1PY9A 1L6PA 2WOBA 1TJIL 2AJVH 5DMGC 3Q9PA 1JVLA 4LSTL 1VEPA 3KXFA 3MV7D 3LS4L 4HGMA 4LKXA 4TNGA 4ZYKA 1J8RA 1I8AA 2IDUA 3QIUB 2ZYSA 2OTWA 2J8UF 4LOFA 1A4CA 2V7HA 2Y07H 1X5LA 2G60L 2UZIH 1KXQA 5T5NF 4RNRA 4KK8C 5H37A 4U0RB 3IVKA 1H8LA 2UY6B 4MA3B 5D72H 3MBWA 3FKUS 3SQOL 2WKOA 1MWOA 3QHFH 1XCXA 1YEGL 3DX8A 5KYXB 1ZTMA 3PAVA 5J8OA 4PJHF 1SY6L 3T2LA 3M7OA 3WV0A 1ZHLB 2NTFA 1WFTA 3OSKA 2DJUA 3VX1A 5I28A 2I27N 3FO9A 2OJEA 2QPSA 4F9LA 5JTWA 4YDVA 3T6WA 2WMPB 2VXVH 4LCIH 2IDSA 4QIRA 2J72A 4UIKL 4GAAA 5E8EB 3DV6A 3VSUA 2APVA 1W6LA 1D9KB 2VITA 3BDBA 5HSFA 1S78C 5E94B 5C07D 5I6KA 3LYRA 4P5MA 5FOBA 1G9EA 4PRNA 5D6CA 1YYCA 2ZP8A 2OMYA 3FJTA 2Y5TA 3BZEA 4F9PC 2X89A 2FWLB 2BNUB 2AJXL 1YRKA 3N0PB 4I5BB 5LQBH 3OMIB 3VWKB 2XWEA 5C08B 4Q0XL 4YEFA 1KJMB 3GKWL 3KCPB 5GS1A 2NTFB 1UZ8A 4P5TC 3SGEH 2I26N 5F8QC 5AEAA 1IFRA 3Q6FB 1UWGH 4P4KB 2LFEA 2EEFA 1DE4B 2QQNL 5CP3A 3U0WH 3AT0A 3HZYA 2YUWA 3SQOH 3UTTE 5TH2A 1T03H 1L0QA 4N9OB 5IB4B 3LQAH 1HSBA 3DV6B 2OMUB 5BV7H 4LCWB 5IEHB 3VQ2C 5KWYC 3VXPB 4WUUD 5J7CC 2HH0L 3MOAH 5SX4I 3ZO0A 1RP8A 4XC3L 5DGRA 2Z65C 2Z7ZA 4KTDH 4WY7L 5CJQH 4DPRA 2CJTA 5EBWB 1QYGH 4NSKA 5AVYB 5FFLA 3BH9A 1JF6A 1BJ8A 4PR5A 2OMZB 3W11C 1TNMA 1SRDA 1TLMA 2DLHA 2YLKA 4Y16B 4NOBA 3P0VL 1NWPA 3HI6H 2AK1H 1ZTXE 2VLKB 3HZYB 2Q2EB 3IM1A 5TH2B 5CU9A 5J6HB 5MEQA 3LNHA 1U42A 4JRXA 4M02A 1J1OH 4AQ1A 5DUBB 3IGAB 3VYNA 3DHMA 3U4KA 3ZY7A 1QI4A 4M5YL 5LXGH 3PNWB 3FSWA 3CVIH 2P80A 4L2LA 3FCGA 4F93B 5L6YL 3ARDD 5EO0A 4UNVA 1WAAA 3SE8H 4GRLC 3LVEA 2E7HA 3KPRE 1MFAL 3MR9A 4GIPD 5B8CA 3GSRA 3MRBB 5IQNA 2X87A 5E1IA 4D0BA 1XSIA 2D3JA 4ETQA 3APNA 12E8H 3T8VA 4Y8DC 1JJUA 2KERA 4XXWC 2D3NA 2X09A 5DJ0A 3ME0A 1B88A 3PGDA 2HTKC 2H9GB 3QFJE 5F7BA 3UCRA 1JZ8A 4JFQB 2D0GA 1TTGA 4JRXB 5DJ6B 1CK0H 1DJSA 4GI9A 2OTPA 3K2KA 1R5VA 2XWZA 3OKDA 3VXMD 3PWUA 1OXYA 5D5MF 1YEKH 1FFQA 2C34A 4FEMA 2FB4H 4UB0H 3ZIMA 3V4VL 3DO3A 2YRBA 4P4KD 2K3TA 2WP3T 4H8WL 3WI9A 3L4YA 4GI6A 4JY4A 3UH8A 4YXLL 4Z7VE 3WKNA 1SUHA 4AVIA 4F8TA 1CGSL 3QA3B 4D9QD 2PP9A 5DJZB 5JOFA 1TXKA 1CCZA 4HJ0C 4LCWD 1L0XA 1JYVA 1KB5B 2YA0A 4OJYA 1C12B 1WBXB 3NCWA 5DJ0B 3ME0B 4I77L 4LOUC 1L6XA 4NO0B 3UTQB 1A1OA 1MHPL 4ZPVA 4U3SA 1UXMA 1YNLL 4K2UL 4NHCH 4TYUA 1A7RH 2H6OA 4Z3JA 3HAEG 3LIUA 2YD5A 3TNNB 4HJGA 3VFPB 4QXWA 4GRMA 1HU8A 1LP9E 4X5QA 3BCFA 4M48L 2VRKA 5ALCL 1O9ZA 5MEPA 1E4KA 1MJUH 3CC5B 1QUNB 3LB6D 1A4KB 1OT1A 5GRJH 4ODHH 1P5VB 5DMKB 3WSQL 1KB5A 5DURD 1JHKH 5EZIH 2CO7A 1PVHA 2C1PB 3NUKA 4R26H 3SO3B 3OQRA 4UQEA 1VGKB 4HOZA 3MRLA 4QJ5B 1QRNA 2NZIA 4PSRA 4R8WL 4TQPA 1AZUA 4LVNC 4HP5A 4A38A 1RUPL 5I18H 2CIKA 4P46B 5F1KC 4GXFA 5HHMD 1KYFA 3HHRB 3I3EA 3EO9L 1M2VA 4M93B 1XT5A 3I74A 2HFTA 4LOEA 1W72L 4L23A 3KS0H 1V7MH 1XZ0B 3BIKA 5CEXA 4JZNA 1INDH 4MVBD 2VIRA 1X6LA 3D25A 1ASPA 2XFXA 4FCAA 2R7EB 4BCZA 4NZUL 1YEIL 2CJ3A 3OXSB 4WDIA 1XL6A 1IM3A 1QWNA 5AOIA 5E9DD 2X1QA 4ZG1A 4NPJA 1MNNA 1HC1A 2NY2B 4X4ME 1WIPA 4DEWA 1NLDL 4J23A 3QO0A 2O61B 2N3JA 3SOBH 5T3ZE 1M1XA 2MCPH 3QUYD 3C6SB 1A6PA 3NYKA 1A6UL 1C5BH 5DD1H 1DJYA 1JVKA 2AQRA 2J88L 4Q7DA 1RZ8B 1YNTB 4NUGH 4JCLA 5FDYA 5E95B 1MAKA 3MCG1 3HI6L 3G5YB 3LMJH 3ZBMA 4XB7A 5GS2H 3FUFA 1E4WH 4UQ2A 4ORGB 4X9IA 4OAWA 2I07B 4PUBL 4TUKL 1BZEA 4U3HA 2XWJB 4ZOAA 3QXUA 3RTQC 3UAJD 2AHIA 1FNGB 1YY8A 3IU3A 1SHWA 1HH6B 1J0HA 4LVOC 1KENL 3HMWL 3U0TB 5I24A 2PO6C 1BF2A 1Z3GL 3H42H 3FO0H 4PB9H 5CEYA 1E28B 3QJOA 1HCFX 1WAPA 2YPVL 4KX8A 1RMFH 3QB7C 2Z92B 2H1XA 4JKLA 4N2KA 4M5ZL 5ANMB 4UWQB 4Z7NE 3VXTA 1FUNA 1PJWA 4GH7B 5KN5B 1IBZA 1CR9H 2WPGA 4J28A 5DD3L 4EUPG 2WBKA 1SFDA 3PNRB 4APXA 4F1SA 4NB7A 3VM7A 2X7LA 3ECVA 1UHVA 4G9DB 3BHBA 1A6UH 1L9TA 2BIOA 1QFHA 5ANME 2HT2D 5F7EH 3G6DH 5I8EA 2QPDB 2DYRB 1RK7A 1OP9A 2L04A 1MLBB 2D3LA 2GI0A 3RWCB 2GFBA 4KRNA 4LL9A 3VD5A 2AVGA 3CFTA 4XCYA 5DC4B 5HYSA 5EPMB 1MW2A 1KEGL 3HLKA 1RURL 4KI5C 4ZAKC 1YPZB 1MPAH 2QKIA 4XBPB 5FKAB 3ZUCA 1E42A 4AMXA 1U93A 2QPUA 4GAJL 3B5TA 3FO0L 4AIOA 2X7LB 1ECZA 1CUOA 2Y36L 4ALAL 4Q9CA 3C08H 4U1NB 1X5IA 2WTPA 1CD1B 4RGMC 4JM4H 3ARDB 4ATTA 1Q72H 2IANB 3EAKA 5FO9B 4DGIL 1JF1B 4YL9A 4LSPL 1EJ8A 3OKOA 3EO1A 1HNFA 5GRJL 4Y5XC 3BCDA 4L8CA 4YDKH 1N26A 4KJPC 3P9WB 1DDHB 1DANU 2NY0C 1J0YA 3CQFA 3T04D 4NRZB 1EZVY 4PJ7B 3VVVA 3ETBJ 1D5RA 4FMFA 4XCNA 5DC9B 1ZA3A 4RCAA 4AM0Q 1IL1B 1DUZA 2D03H 4EEEA 5TF1L 5FM5M 5GGVY 4I0PA 3C8HA 3RKDD 4AJWA 1BFTA 1Y6MR 1J9CT 1I8IB 1TKWA 4P9HL 1QSVA 2IBGA 2OX5A 4HW6A 1H8NA 1NZRA 2PXYD 3N41B 3EO1B 1DJZA 1P4LA 2VDKL 3VSVA 5I1AA 1S8DA 1JGLL 2WIIA 1N59A 2ZQKA 4OR1A 4EDWL 1OY3B 1L0YA 3PWPB 3HHSA 4IOSA 2KZ1B 3MRJA 1MCNA 1DLHA 2VXSH 4GAFB 4QRBA 4XE0A 4IK7A 5D7LA 3MGTB 4XCNB 3WEXA 2Q86A 2BZDA 5AOMA 2BIMA 1AD9A 2YN5A 4JGMA 3U25A 2ZWLT 2AQTA 2UXGA 3MHZA 1CWVA 2CU9A 1P4IH 1RUML 5DQ9A 1KCUH 4UNIA 3S36H 2VSKB 2ARJQ 2CRIA 4I13B 3S37L 1KC5H 2NY1B 4IMLA 4A2MA 4YHMH 5GZOD 2YD0A 4KJPD 3DO7A 1BVOA 4IIQB 4KUCD 3ZL4H 4E9SA 1G0XA 1A1NA 3LDBB 1SYVA 3AXIA 1QZ1A 1KJ2L 2PO6D 3QS2A 1LO5B 1W0WB 1DLHB 4XP6H 2HX9A 2IPKA 3B6SB 3VXSA 4A68A 4DEPB 2O6PA 1QASA 4X6EA 3RA7L 2VMEA 1HKLL 2CA3A 1KOAA 5MI0B 4O02B 1HWGB 2EDNA 3QQDB 3ZZQA 1DQVA 2FRGP 3BVUA 2GJ6A 5D70L 1J18A 3UO1L 4UOZA 1NFIA 3WFCL 1EUUA 5IK3B 4FLSA 4F37K 1GJWA 2R39A 1TTCA 3K46A 4DO6A 5F7WC 1SXBA 4FMKA 5BQ7A 4GT7A 1WFUA 1UG9A 3FCTA 4ODXB 2EUWA 2LU3A 5HBBA 2CKBL 3MLUL 1TYRA 1JGUL 1IAKA 8FABA 1DUYA 1U9KA 2C4XA 4LE8A 2UXTA 1OM9A 2CR3A 3DURA 4O02A 4ANVA 2IIJA 1H9DA 2GYSA 2GC4C 1JVOA 1DBML 3FTVA 3QQNA 5JXED 2ZKMX 3IAPA 1E90A 1P1ZB 4GUCA 3H2QA 4AL8L 4NRXA 1DJGA 3GK8L 3TCXA 3GHBL 3WIFA 1BZ9A 1NBVL 4HIHB 4K5LA 4TS6A 2H6PA 3O9WC 1LHZA 2ORBL 3EFFB 4XGZA 4X6DB 5D70H 2DMCA 4HUNB 4F5CE 2G3NA 3RKPA 3DK0A 3GSWA 4FDWA 3QCUH 2WBJB 3QJXA 3DX4A 4JFZL 4M7ZC 1A7NH 3FSOA 2GEEA 2DQCL 5KVDL 3RJQB 5EF1A 2JLLA 4IOFD 2F61A 3T0WA 1D6EB 3N0AA 4U1JB 4LEBA 3D4GA 4N2DA 3D09A 5CD3B 5LVEA 3W0WB 1QBAA 3F7YB 5LO7A 1F2QA 2FQGA 2NY0B 3S98A 4KKLD 3L3KB 1HAUA 1FVCB 1DQLH 4GNKB 4XN7A 3LRMA 2B15A 3MRNB 3I6KA 4WFFD 3DV4B 4YHNA 5E99H 1QA9B 2JKLA 4TLUA 4P59L 2ZAIA 5JPNA 4JR9H 3RTQA 2DIAA 3S5LB 4N8UA 3SZKC 3WOVA 5HI5D 3QJZA 1N6QH 1IM9D 5C9JB 1FPTL 1R4XA 2IPUK 2VZ3A 4QHKI 1RZPA 3KPSA 4GIOA 2HPOA 2OXGA 4Q9RH 3VFSA 1CFVL 2EECA 1JNHB 5F3FA 3FTZA 2QDVA 2W0PA 1DVFB 1QBBA 4O9HH 4KTEH 5DVLA 4EI0A 3HTLX 1P4IL 1RUMH 2N4IA 1N8ZA 4PJXB 4ICXA 4XCEA 2LR4A 2XWDA 3X1FA 1X5XA 4TUOB 1Y18B 5HY9B 2UWEB 3HMXH 1CE6A 2OR9L 5LUMA 2DQGL 3V0AC 2ESVA 4MNHA 2BVYA 1DCEA 2XLLA 3FHEA 3FB7A 3V5KB 4DN4H 1WZLA 2YPVA 2P5ED 1N67A 4ODUB 1DVSA 4G9FE 2BVOA 1ZY9A 3EUUA 4MNGB 2CUAA 5DJDA 3VCLB 2IAMD 1ZHLA 3QWRD 1BQHB 1H3PH 3VXRE 2XNAB 4AKQA 3VGBA 4F8PA 5E00A 1CE6B 4FFZL 2AAAA 1QW8A 1SMDA 3FRPB 35C8H 2NY0D 4UQAA 1IAMA 5JIQA 4N8CH 5IB1B 3C8KA 2C9SA 1FNFA 5FK9A 4P5MB 5FOBB 3LHAA 2IALB 4N2HA 4CKVX 5T33H 1TZHB 1BQHG 2A2QT 1BXUA 3CBKB 5MENE 1DBBL 1FRGL 4XPBL 4E41B 4XMXA 1G1CA 5C08A 2YWZA 3IWVA 1I82A 3KXFB 4ZYKB 3V55A 1XCTA 1WITA 5ISZA 3V6OC 5K59F 3BRDA 2WLNA 3QIUA 3CHOA 4DWHA 3QORC 4XCFL 3PCYA 4HCRA 4TSAL 5SX4H 5L9DH 4U4IA 2Q9OA 1CXEA 2APSA 2P24B 2LVEA 5IBTH 4ZW8A 1YECL 4Q97A 1NAKH 2HT2C 4LP4A 2IH1B 2XN9B 4PRDA 3V0EA 2FNWA 2VGLM 5AZEH 1F13A 3ARED 3QWQB 3X3GL 5L4IA 4PJCF 2Q6WA 2Q10A 2UXFA 2VLRB 4X0KB 1JZ3A 2BX5A 4OI7A 1EJFA 3GI8H 4AK2A 2VUOA 2J3SA 4J8RA 3IU4L 3FO9B 4MMZC 2E46A 4K15A 5T33L 1G1YA 1NPJA 1AGFB 1K4CB 4BA0A 1ADQA 2A1WH 1UWEH 3FTUA 4Y4HB 1NBZA 2YGOA 5DD3H 1EDHA 1R3LA 5F6HJ 4X80L 3SPIA 3UAFA 2R9HD 4YVNA 1N18A 1MJ7H 2PLTA 4I18B 2JSFA 4XVTL 4KUZH 2XN9A 4ZMVA 3BZEB 3O3AB 4MQXC 4PN6A 1G7JA 4XRCA 4GQ9L 1SJVA 1DJIA 2BNUA 1JGIA 2K4AA 2O1AA 4X0KA 3PGFL 3KLQA 2XXMB 3IRCA 3KCPA 1OK8A 4FQLL 4PJAF 5KG9A 4D0BB 3CN2A 1A9VA 2WVTA 1ETA1 2AEOA 3L5WB 1H8OA 1DEEA 4YHML 4U7SA 2X0VA 4ZFQA 4FG4A 1HSBB 2HVKB 2YAEA 3STLB 3O4LD 3IETB 1XSJA 1U30A 3PPEA 3RNKA 1INQB 1MIEL 4JAMB 5FYJU 5E5LA 2DN7A 4OH2A 1JERA 3IMRA 5DSCB 3RHWK 2J1YA 3HG1E 4RX4D 1YPZF 3GFUA 4F8QA 4FG0A 4RSYA 5DJAB 3BH9B 1SOSA 2BDNH 2OMZA 2EO1A 3ELAT 3FH5A 1MCSA 5J13C 3WO3B 2CHDA 5FA4A 3W0WD 1X5JA 1S9WA 1UKSA 1YO4A 4KHXH 5HGHB 2FHCA 3O6LH 3EGDB 2TSAA 3CLEL 3STLA 4AQ1B 4M7LL 4JDZB 1Q1JH 5D1XC 2G2RA 4YZWA 2EABA 1XGZA 2BZ7A 4FQLH 5F0LB 3MNZA 3HB3D 1IEBA 3VFPA 3GMMB 3UERA 4JK0D 5TF1H 4Z3TA 1KGCD 1HCZA 5DSCA 1M7UA 5EZLA 3D12B 4FI8A 1BBJB 35C8L 5HHVL 2Z31C 3L7FA 3MRBA 3CDZA 2BHFA 1DJHA 1NAMB 5DQJA 4JPVL 4FQ2H 3LS5L 4JQIH 2XVKA 1F3JB 1KMGA 4AMKL 1VFBB 4U6XA 3DJ9A 2DM4A 4GKSB 1FE8L 3MROA 2H9GA 1DSFL 4G42B 3OPZH 2XJLA 4HWZB 4NQCB 5FOJA 4EZLA 3TF4A 2Y2WA 3OKDB 2ZXCA 1AP2A 2G2RB 3L9BA 3PWUB 3U7AA 3GZPA 2VDLH 1TTBA 4FFWD 4IRZH 4X83A 4HWNA 4Q9QL 4G8GE 4FG6C 1MCPH 2BOBA 4TM9A 5D7JB 1A7NL 3LKRB 4R7VA 1BBJA 3FUEA 4JZNB 4KJWC 2P8PA 2O26U 2J5LB 3HVNA 1J9QA 3QA3A 2X6MA 5I74C 4NO2B 4Y2DA 1DQDL 3OXSA 1BREA 4HH9A 5M94B 4LNVA 4GBXB 3CQPA 1WBXA 5I9QC 4X9YA 4AEFA 2GUOB 3QZMA 5DJ8B 4IW4C 4DGUA 4U3SB 2COQA 2Z34A 3C6SA 3NCBB 2NMSA 4MYPA 5DDHB 1GYWA 1ACCA 3D4YA 4GW1A 2OV0A 1WT5C 3ET9F 5CEZE 5FB8A 4CA4A 1MRCL 4I8DA 2YQ3A 4XMPL 3IJ8A 3QCVL 3G5YA 3H85A 5D7JA 3QZBA 4GQPH 5BOZG 1CZ8H 2OFQA 5AW3B 4LP8A 3BAJA 1Y1UA 3MPCA 4DPBX 1KYOJ 4UQ2B 4GSQA 3T8MA 3THMH 4JKKA 2MHAA 5AVXB 2C1PA 1WAEA 1BLNA 1Z5LB 2GUOA 5DJ8A 3U1SH 5TDOB 3FAWA 3MRLB 4DERA 5C09D 3Q0HA 1EVTC 3U6XS 1OOAA 3P3YA 4YX2H 4YR6B 1A7QL 1TQWA 4K3HA 5TDNB 3KXFD 2JE8A 4J6RH 1H15A 3GI9L 4MDIB 4NUPA 3BWZA 4G7RB 4DK3A 4KITB 1FCGA 2EDOA 4MB3A 1WFIA 4OZIB 5JXEA 3SDAB 4P2QB 1IGJA 3GLDA 1JCKA 5G55A 3TBTA 3CFIC 4L8BA 4NUQA 4B9CA 25C8H 2VIRB 4K7PX 4HKZA 2EDRA 5C0BB 3VWJC 3ZQ9A 4BFOA 1P6FA 5DVMA 2HLAB 2RGSA 2CHNA 5DD0L 4O02L 3UC0L 4DK5A 1PU0A 3H3KA 3B9KB 3IMBA 5C97A 1I1YA 3BLKA 3L54A 3L95A 3NPSC 3S9DB 2BW5A 1WD9A 1GKOA 2B4CH 2X44D 2WUBH 4QRTB 5F8RC 5JOEA 5JZ7D 1K2DA 1G4MA 5IWLC 5GGVH 4NEHB 2WVUA 3UBXA 2J1ZA 3DMMB 4DP1X 1BW8A 1KXVA 1OOWA 2XY1A 3ARGC 3GIZH 1ORSB 4JFYB 1B4TA 1NC4B 4OCLC 3H2WA 5BCAA 1X5MA 4IRJB 1CBVL 1E67A 2P9RA 5EU6E 5GGRB 1INEL 1F42A 4QTFA 1KIUA 3EGSB 1FNGA 3UJJH 4X4KA 3DECA 5F3BB 4QYOA 4FULA 4I2XE 3L95B 5CEYB 4OZGA 3OKOB 5J11B 4Z7WE 5L2JB 2E8ZA 4G70B 1NSNL 3R7QA 1L6ZA 5ETUB 3ZE0B 4Z3GA 4X9FA 2KUTA 4ZMQA 1BXXA 1DDHA 2LW3A 2QVTA 2VH5H 2BMKA 4JR9L 1OPGL 2B39A 1KJVA 3C87A 4KOBA 5AKTA 2VR4A 3ML9A 4RBPK 5AAMA 4DCQA 5TK4A 2V2WA 1QRKA 2H32B 1CICA 4K3DH 3S8GB 3OJ2C 4AGLA 1OP4A 3ES6B 2OK0L 3QT2A 2N1TE 4TNVK 4AQAA 1VRSA 3WGUB 3UAAA 5BQDA 4Q89A 1TKWB 2AF2A 4JQIA 2WYZA 1UB6B 4X4YA 1MLBA 3D69A 1YNKH 2E7MA 2ZD0A 4PJDF 1KB9K 5I75C 4EN2A 1LMKA 4X4ZA 5C0BD 5B1AB 2FIRT 4NQED 2ADFH 2DPKA 5GSVB 4KKCC 4GP5B 2APTA 4L4TA 1UACL 2BHUA 1U93B 1H5BA 3DA0A 1ANUA 3MRJB 4PJDE 5D7LB 4ZMWA 3PP3K 3EFOA 5FKPA 1I8KA 1FNSL 3VFTA 3EOBB 2VQUA 5I73C 1JWSA 1PNCA 2H32A 2BHYA 2ZP0T 2KL6A 4LIQL 4R5VA 3K6SB 4ODTH 1MFEH 4Y1AE 4H5SB 1QABA 4JREB 3JSSA 1VLXA 4WI2A 4AC2A 3QJHB 4RGNE 4L3CA 3CHSA 2VDPB 2BSRA 2XI9A 3H3PH 4I9XA 3AXLA 3HNTH 4N0RA 4IU3A 3RNQA 4D9QE 1D7FA 4IRSC 4CVXB 4U0RC 4Y19A 2EICA 2Y6SD 4HJUA 1ZHBA 2NPLX 4F7KA 1NPUA 2RCSL 4ZD3L 2BJML 4M4PA 4GUQA 5T1DH 1NLDH 1NOLA 3RL1B 1CVSC 1GGIL 1OO2A 4CU7A 2WN3A 1IL1A 1JHLL 3CZEA 1WZKA 3EBHA 3NOIA 5GRWA 4ZFFB 5FYLE 4RZCB 3FQXA 1NCIA 4H0HB 4WWNA 4LHUA 1TG8A 2Z31A 4JS7A 4LEOA 2Y9RT 4MFHA 1NFDE 2DIJA 3G6AB 1OTTD 4YSQA 5EOCH 5DEFA 1S8DB 1SY6H 3RNQB 3L3IB 3Q2WA 1MW1A 3HHSB 5JW3H 1IAIL 3L3OC 4HT1L 4DUWA 4NKMA 1IV8A 3V52H 1F5WA 1WBZB 2X4PA 3MGTA 3PU7A 4IKNA 3TPUB 5IGXL 3EG9B 3QP3A 2VLKE 3LH2L 2CJUH 4LEXH 2VWEE 4ZUVB 5J57B 2PPFA 1ORQB 2XN1A 3CTTA 4G8GB 1BD2B 2R0WL 2Z31B 2VDOL 3L5JA 3H56A 3S34L 1ET5A 3S5LG 3WMSA 2CGRL 1E3ZA 1BQUA 5EV7A 4HWBL 1TPXB 1YJDH 4R97C 4KBPA 2UWEF 3UG5A 1F0LA 4X5PA 3LXBA 4S10A 3WFDH 3L3IA 2MPVA 4OJAA 2D2CC 5CZVL 4MD0B 1NANI 5JO5B 1RIUL 5JORA 1SEBB 4GMTL 1G7QA 3EH5B 2WO2B 2YEZB 1SEQH 4UT6H 4M6AA 2ZCHH 3H6JA 2FBOJ 3NDZE 1OZUA 4Z7UA 1ORQA 3L4VA 1LEIA 5HPMA 4OJCA 1ND0A 2IWFA 2YBGA 4LU5L 4PD4J 3SDAD 1DZBA 5B39B 1WZ1L 2YAFA 5K9OA 1MUJB 2W88A 1TJXA 1QBLL 4OI8A 2R69A 1JNLH 3SBWC 5ECJE 1VFUA 3V4PH 1FFTB 2J6EL 2WAQA 2H3NA 2FJHA 4LQFL 5DUPL 3HB3B 4D94A 5BQ7B 1I9IH 1QLEL 3MLWL 2FATH 4RMWA 4XNXL 3HC0A 1FO0B 3T1FA 3T8XA 4QTHA 3ZT6A 3VUAA 5TFSH 1GIGH 2V5SA 3UIZA 1RZFH 4JVWA 4BH8A 4KHTH 3VWJD 2FEDC 3DVGB 4HU2A 3U9WA 2C3XA 2YPLD 5IZ7A 4IKLA 3M1CA 4K23L 3GSXA 4XPTH 4AITA 1YEGH 2FJHB 4HZAA 2OXGB 3DARA 2XZAH 4QHNB 4YHIA 3S35X 3SBRA 5I15L 3ULVF 2WLJA 4JHVA 2YK1H 3EFFA 1SVBA 4EVNB 3RDTD 3ZRFC 1L9NA 3AWGA 2VR9A 3BEVA 5AZ2H 3BPCB 1DVUA 4P04A 3U4EA 3T8XB 3HPLB 3N2JA 1OD9A 1WICA 2UZXB 3VRIB 1Z9MA 3VH8G 3D52A 4MMXB 2QQLL 3D0LA 3B9VA 2V5MA 3AC0A 1NKRA 4PRID 3ATFA 2ZX6A 4FZEL 2FQFA 3FMGH 3MOBH 5F9OL 1PZBA 4MDJA 3PRZA 2YGQA 3F04A 1FLTX 2CNYA 2QVIA 3W0WA 3TTSA 3RYMA 15C8L 1QTPA 3UJIL 4E9LA 1ZVHA 1PAMA 4XAWL 3EF7A 2HRGA 2VR5A 3E3QE 3KGSA 3PWLA 4NQEA 4OCXL 4YSDA 2TAAA 3A47A 1X44A 4FLHA 1BBDH 5GZOC 2N0MA 5IREA 3FXIC 4O2FB 1M3JA 1QA9A 2MH4A 4MMXA 1NGXB 2EVIA 1AGCB 1FZKA 4H0LC 5F44A 1S78D 4LCYA 3D85A 3EDEA 4AZUA 1NLBH 2ED6A 1ZDSA 1MCWW 2QVFB 2WOYA 2NDFA 4M1GL 5D7SH 1IAOA 4GRWH 4KDWA 1UM5L 3V0GA 1PJ9A 4CW1B 1F3RB 1KN4L 2HG0A 3KPQA 1NDTA 2ATKA 3NBNA 3SD2A 4GSRA 4DGWC 4CSPA 1N8ZB 3UDWA 5EO9A 4LDCA 1QHPA 3BE1L 5MENA 5HY9A 5ISZB 4LPWA 1F97A 3VI3A 4HKXB 4L8SC 1TMCB 4DN3H 4C56E 3WNNA 3G5WA 1KXQE 1JZ7A 1Q9OA 1UVQB 2Z7YA 3OC5A 3AY4C 4G1EA 5CZXC 4X6CA 3KM2A 3HBZA 5CU5A 4NENA 4DH2A 4TXVB 4JKMA 1IQDA 4OZFH 4F2FA 4U05A 4MAYD 3UBXI 4RDBA 1RHFA 4L29A 3IGFA 4IRJC 4TNEA 4LRNL 1OT4A 1T1WA 4G9FA 4OY9A 4N2IA 5B1BB 3GIVA 3T2NL 1BQHA 2VDRH 2DI8A 4LQFH 3HZKB 2XWBA 3EJTA 3GINA 2E86A 2Y2YA 2BSTA 4PJGE 4BQ9A 5A40E 3BFOA 2Y6SC 1SN5A 2IAMC 1L7IH 4QWWC 3C2AH 1S3KL 3S2CA 3MREB 5IB1A 1PKQE 4CC4C 1XFPA 5BOJA 2UY6A 4MA3A 2B3RA 2NX5A 3QIUD 1ZE3C 3FU3A 5HDBE 3VFWA 1P4UA 1G7JB 4XRCB 4XNDA 3CZGA 3EJQA 3DX8B 3S4SB 3KYOB 2DQDL 3AUVA 2VE6A 3MLXH 3NACH 3NABL 3SGEI 4PLKC 1W91A 3FQUA 3OHXB 1J8HE 3A4DA 4E2OA 2Z64C 4FE9A 1NDMA 4FQQB 2MCAA 3T3PE 1JD9A 1GS8A 1MHPH 1JXKA 3BC9A 1TU2A 1DBJL 4RFEB 2BFVL 5LBSH 3W9EA 3O3DA 4IBYA 4OZGF 3WHXA 2WMPA 2QKIC 3TZVD 1LO3L 2ROYA 4QXVA 5DRNB 2RBLA 5L4FA 1D9KA 2VITB 2V9QA 1PZ3A 4K9EC 4KTDL 4IM8A 5I19L 4XNZC 1INQA 2WC7A 2NX5B 1TIUA 2YHGA 4JAMA 4P9ML 5D2NE 1BWWA 3C60B 3MI6A 5FC9A 4ELME 1MJUL 3EUDA 4YUEL 4XWOD 2E75C 5IB3B 4OGXH 3VWKA 5ESQB 1V7NH 1YDPB 1HHGB 1XAKA 3T6XA 4ZW6A 4KPHH 2WINB 1A66A 3OHXA 5DGQA 3TH4T 3QDGE 5DK0B 4X9GA 3TV8A 4NKDA 4WFGE 1TVHA 1B0IA 1F58H 4DO4A 3EKCA 4KXZH 4RFOL 4O5LL 1KGWA 3WHXB 4RFNC 4HULB 5BXFB 1AFVH 1M9WA 4ZFOB 2VM4A 4OLXL 1IBGL 1ZHKB 4BFFA 5CZKA 4KX7A 3HAEH 1ODUA 4DGVH 4EN3C 1YYML 2YFOA 4A2EA 1MFAH 4YSTA 1AAJA 1FIGH 4ALAH 2AJ3A 5I5IA 3HNSH 3DX6B 4JPWH 3JUZA 3LB6C 4NN7B 1F90L 1EHLH 2AXHA 4XXCC 4WUUB 2CALA 3OLDA 3I6LD 2X9YA 2YD8A 3HG4A 1IQWH 1WLHA 5DQJB 3BW9A 1A65A 2C1OB 2FT7A 4Y16A 4HHWA 1F3JA 4P2RE 3GLAA 4LFHD 3LIZA 3TA3B 3UMTA 2CHXA 3NRPA 3AQDA 4DQOL 2HFGH 4C4KT 2JB6B 1T80A 1ZS2A 1QLRA 3ESOA 2GI7A 2QTVA 3MRCB 3WAJA 3IFOA 1A6VH 1UQSA 2WXNA 4U1SA 2EVFA 3G3LA 4OB5L 5ITFB 1T7WA 1QWUA 2OJEB 5A16B 1H6UA 3DX6A 3OGCB 2BOBB 4MWFA 2ZUUA 3GLEA 3V0WL 4HGWA 1GOGA 4G2AA 1XR9B 1PSKH 4PJ5E 3KJ4C 4LSQL 3LPFA 4BA8A 3MRPA 2P8MB 3KZ8A 2HX8A 3LRLA 4F7TB 2VDKH 4QHMB 2AP2A 4WW2C 4QI3A 5FA4B 4KY1L 4OLUH 2HFFB 2QZ5A 4PHZA 1A3LH 1A6WL 4UQIM 3MLSL 2YPVH 1QAWA 1BD2D 3EGDA 3GXFA 2R4RH 3PJNA 1D3CA 4KJQD 1DN0B 2VRAA 3Q2CA 3IDGB 3ROOA 3SDXF 4WNJA 4NUMA 3B2UC 3GRWH 4Z1PA 3MX0A 3Q6FA 1OPOA 2H1LM 3OGCA 1GW6A 4MWFB 1IO4C 3LPPA 5EF2A 1XF1A 1P1VA 5E2JA 3L7FB 5INCB 1KCUL 3ELQA 1LDPH 5DJZA 4XZ4A 3VXPA 1J05A 3DUHA 3MU3A 4HF5H 4QHMA 5JOFB 3DX7A 1BYPA 1NAKL 2E7CA 1G7IB 1UA6H 1IE5A 5I5MA 4WHCA 3LKOB 4H0IA 1KBPA 5FCSH 4JUSA 4HT1H 2CCVA 3LRKA 4XN4A 1F6LL 5E23A 3PP4H 4YR6A 4I3SL 1RJLB 1TQCC 3MBXH 1PCSA 4YDIH 5EWIL 2DMGA 2DQTL 3T3MB 1S2EA 5JW4N 4WWPA 1J8HD 3I6GA 2ZKHL 2XQ0A 3K2UH 2P8PB 3CC5A 3KBHE 3RGVB 2WNWA 1NGPH 1AGDA 3CDFA 2MPAH 1AY1L 1AI1L 4PJDA 1N5YL 1IBHA 3OKKB 4GXUN 4LLVB 4G9FD 4JRWA 2NLJB 2FLRT 3D3VE 5GGSA 1RJYB 2J88H 2L7EA 3NAAL 5HHMB 3AWEA 3IBEA 2ZG3A 4MAYA 1M6UA 3O3BB 1AQKH 2BO0A 5FYLH 4ABVA 4AVHA 4TVPE 2WO4A 4B3EA 4U1HA 1LEGA 2WSDA 1DQJB 1EJ6A 3DSFL 3EHBC 1XZ0A 2GABA 4OTXL 2ZXQA 3V7AE 1NC4A 2E76C 4PV9B 2XZZA 5T3XE 1R5VB 1RZGA 2CHZA 2GJPA 3C9NB 4RSVA 3VXQA 1KELH 2X05A 1SOKA 3MXVL 3UYRH 3BKCH 5I0VA 3MV7B 4P3CL 2ZWYA 1VZIA 3U83A 4DF9A 3CV5A 4WFFE 3MTRA 1UD4A 3C60C 4ES9A 5CN3A 3CK0H 1YN6B 2C9QA 3DDFA 5D1QE 5FIEA 1AOHA 1M57B 5TDNA 5DRWA 5EIQA 1SXZA 5ETUA 2N7BA 3DSNA 4P5SA 1G9MC 1QVOA 4KDTA 1DQJA 4APQD 5T1KD 5GPRA 4WIQA 3BVTA 3UADA 3M8OH 3IMSA 3UTQA 5DZVA 4E5XG 2X4TA 2X4OB 1TJHL 4QCIB 5FGSA 2HLAA 1Q0YL 3MFFA 1TNNA 3QEQD 4HK3J 2IQ9L 3W5NA 3CFDB 3CZKA 4V2CB 1J86A 3ZTCC 3VE0B 3QRLA 2LLLA 2C3VB 4OI9A 4ZFGH 1RP9A 4G72B 3GDBA 3C6LA 1OQXA 1JK9A 2Z92A 5ANMA 3OKMA 2HWZL 3SPVB 2Z1PA 5IJVB 2XPYA 3D34A 2BRRH 4FHBD 4MCYB 3OF6D 4HMEA 3KW7A 3VQ1C 1HKLH 4Y2LA 1XGRA 4EI5D 1T7VA 3JWOC 1QRNB 2J8OA 4IRJA 1OHQA 3IJYB 3BHBB 2VXTL 2IV8A 4OIBA 1A25A 3QJTB 4YC2C 2R23B 4TSBL 2VN3A 2PABA 4G11A 4CILA 1JXFA 2GHZA 3CSGA 5EZPA 2ARWA 3MV7E 1I1RA 4WDIB 1PNDA 4AQ8A 1MKFA 2IOOA 5IMLB 3RTLA 2NW3A 5C6TH 3DVNB 4MKTA 2OR9H 4Y4FB 4AG4L 2IXQB 4IDJH 3KWUA 5JUEH 1OGAD 1ZE3H 3UTZB 4PRPA 4XPGL 1J5OL 2XPGA 1A0QH 5GS1C 1N2RB 2NXYD 4MS6A 5HGAB 4AL8H 4ZK8A 6PAZA 1CE1H 3QUML 3IJHB 1AMYA 3G9VA 3N1MC 4YXKH 3UAEA 5E9DE 5ES4B 4TVSa 3G6AA 2F7PA 3TBYB 5KYYA 4YFLI 1MW0A 5CCKL 4ORGA 2FBJH 2AQ1A 2ORBH 3C5JA 4KXZI 1H3TA 4ANWA 3OLEA 4HUXA 2B1HL 4JRFA 4D9LL 3GNML 2XXFA 3QEQB 4M62L 1L9MA 2NW3B 3ZHFA 2VZOA 3P4OA 3F5WB 4OFYD 4PJHE 4FFYA 2F19H 3BH8B 3CC1A 1OKEA 4ZUUA 4PJ7A 5KTEL 3CFKB 4NQVB 2F7OA 4OBRA 3TPUA 4M03A 5DT1H 1CS6A 2VO8A 2QSCH 1RXLA 3O6MH 4KJYB 4ONOA 2NUTA 1HTYA 2FK9A 1LO0H 1QBML 3HG3A 5KAQF 1A64A 3LQZA 4HFWB 4TLKA 2BSRB 4APXB 4HS8L 1BECA 1N59B 2DWYA 2A0LD 5F7YC 4HUXB 2ZXEB 4Y19B 1V3LA 3T2NH 4XCCL 1TEYA 2W59A 4R6UA 1PZSA 5JO5A 4P57A 3FZUC 4WF7A 2HMIC 3R1GH 1BYOA 2NYKA 4Z7UF 5AAMC 4AMWA 1TQTA 4P59H 2YEZA 1GRWA 1HL4A 5EUOB 4OUUA 4FJYA 1Y1DA 3K81A 3LXCA 4I0KA 3L1OH 5L88L 3F58L 3S88L 3OLIA 4XBPA 5FKAA 1A3RL 4KZCA 5I0DA 3BUBA 2BNRE 2EH7L 3LEVH 2OMTB 1E4XL 4N0CD 3D30A 1KEML 4Y1SA 1U3HA 1SQ2N 3RWIA 5IR1A 4U1NA 3ZT7A 1AXSA 3KW8A 4PRPE 2IQ9H 4ZTPH 4BE5A 1YLBB 1WIUA 3DGGA 3WGVB 2IANA 2DLFH 2DQUH 2P47B 4L3FA 3UTPE 2IQAB 3KBFA 1UFUA 3KPRB 1UWEL 4Z7VB 3V5DB 5T1KA 3GMRA 3OWEA 6FABH 1OGTB 4XNQB 2CK0L 1YMMA 4RA3A 4OUUB 2XKNB 3NZHH 1PBYA 4OFQA 3T0AA 1WH0A 3WO4C 1YJDC 4NRZA 2PP8A 1JPFB 2MNWA 3QI9C 4FADA 1X7QA 5AW8B 3EH1A 5EEXA 2VZTA 4PJAE 3SE9L 2WWMD 4EN3B 1UEMA 4F8OA 1L7TL 3F58H 3BEVB 1T4WA 3QFJD 4PUBH 1SEBA 1VKXA 1KBKA 5EDXA 1MQ8A 1OAZL 1B4JL 1MCHA 3GMRB 3NEXA 3UIYA 1V05A 3LEVL 4RMVA 3QC5X 3LZLA 2X0WA 3MV11 3CVHA 3D0LB 1AHKA 2VSMB 4I3SH 4NNYA 5EC1B 3SDAC 1IJ9A 5B39G 1CIDA 1FNLA 1FZOB 3EDFA 1AGBB 4LCWE 2A74B 3IMVA 3RBGA 4LVNB 4PS4L 2XZQL 4L4TD 3P9MB 2V2TB 1IKNA 1KLGB 4HIQA 1SOXA 1I8MB 4NI3A 3CHPA 1HXMA 3COOA 4L4JA 1CL7L 3VXNB 2KZKA 3PXLA 4LGRB 2IWGA 4A7QA 1PFOA 7FABH 4KK5D 4GFTB 1LO2H 4HJJL 1U8CB 3GBNH 3KDPB 1W16A 5J1TC 4ONGL 4L4VD 4FXGC 5FFOA 3F3HA 1NGXA 3EF4A 3GBEA 1AGCA 1U91B 2DQMA 3TBVB 4ABUA 5FGCE 3FB8A 4JO2H 4APQC 1JF5A 2FATL 1RZKC 1EEYB 1OM3H 1COBA 3FUNA 4G80A 4MAYC 4AOFA 1NQBA 5L4JA 1L0PA 3QIWB 4N2FA 3FFOA 3CBJB 1CDIA 4TV3A 4QRSB 4YDMA 1XBRA 2EVJA 3KPOA 3ARBC 5C08E 1L9OA 3OZ9H 2UZXA 3QORA 2X12A 4XNMA 1F11A 3B9EA 3RGVD 5I82A 4PBDA 1DQKA 4O00A 3VI3B 2JKXA 1T4KA 3ZO9A 4URTB 1AZBA 4R90H 4KMTL 3MJWA 4XX5A 3ZKSD 4DKDC 4WEMB 1ET7A 4HAGA 1U8IB 1SVCP 5K69A 5ADPH 3P30H 3FTSA 3ISYA 3VFVB 4O2EA 2NOYA 3AJ7A 1DUYB 2CJUL 3B1TA 4PYGA 4B96A 1WZMA 2ATPA 3FS9A 4DVRL 4FP8L 2QV4A 1PIGA 1DJWA 3RKDC 1GCFA 3JWDC 4ANUA 1MJ8H 4OFYA 4LQ1A 5DK3A 5DEGB 3ZJAA 5BVPL 5E1GA 1RPKA 1WHPA 4X99B 1TVBB 2DBLL 2BSTB 1T5XB 2H6PB 5C0DA 3DKHA 3D85B 5DHMC 3W11D 3NIDF 3O6KL 4PWEA 4YFLF 5FS5A 4K73A 4NPKA 4L0YA 4ILDA 2K7QA 1KT2B 4JFXB 3QR1A 2WXOA 3ZDXB 4CL7A 3U0PA 2WBJA 3II3A 4YBLC 3L5HA 4KQ3L 3TYGL 4ATWA 3KPSD 3F12A 1A4JB 2IBBA 4DVBB 2OK0H 3AITA 3FW6A 4MJ5A 3VCLA 2BY0A 3NAAH 3T0XA 1FSKB 1XCQA 1K85A 4X7DC 5EFIA 1BJ1H 4YX2L 2BP8B 1YQVH 3QEUA 4JHWL 2PMZA 1W0VB 3RVVC 3PDDA 4KVCL 4OKDA 1Q1JL 2EDLA 3DX9A 3WKYA 1FAKT 3L3KA 2ZPKL 2C3WA 4FYSA 4QRUA 3EBGA 5C09E 5T5FH 1JI1A 1HJBC 4K7PL 4PJEE 1EO8L 2DQJH 2GAZB 1JN6A 4JFXA 4YLBA 3UPRB 4DTGH 4LLWB 1HKFA 5FWQA 1ADQH 3BVNA 2PKDA 3JTBA 3GBMH 5IW1B 1IQDB 3EJUA 3LQMA 5CJXA 4BSVB 5HJBA 2FX9L 4L29B 4P46C 4MA8H 4HLEA 3MGOB 4WTXA 5CIPB 1E0OB 2Z0UA 1EXUB 2LAGB 4GUOA 4YXKL 3MA7B 4YH6A 2J12B 1CXIA 2AERT 5EDSA 3JVFC 2HTLC 3TX4A 4YHPB 3NJFA 1MY5A 4H1LB 3LN4A 4K7FA 4OIIH 4BGLA 4GQ9H 2EIDA 3I6LE 4XVUD 1PG7H 2APXA 2H0PA 3ARTA 3MAWA 3C5SB 1Y18A 4LLWA 2BWDA 2A5UA 1PZ2A 3VXMB 5FUZL 2DW5A 3K5SA 3QDJA 3JYBA 4HSAC 4ETYA 3MVSA 3WNMA 5DYOB 3DBXA 3WS6A 3FQUB 1HWHB 1T5WB 5DO8A 4KKZA 3BW9B 4GO8A 2VLMD 2GC7C 1D2OA 2DMBA 1A2YA 4YE4L 3V6ZB 2PCFB 2NY6D 2DWDB 4PRBA 4J5VA 3CQQA 2DEYX 5ESAA 2RH0A 2RHEA 4MNGA 1E4JA 3SZ6A 5DS8B