4IBUA

Human p53 core domain with hot spot mutation r273c and second-site suppressor mutation t284r in sequence-specific complex with dna
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
197
structure length
197
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVCVCACPGRDRRREEENLRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title Structural studies of p53 inactivation by DNA-contact mutations and its rescue by suppressor mutations via alternative protein-DNA interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 51
structure length 197
sequence length 197
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ibuA00
4AGPA 2IOOA 3WTVA 3VD2A 1GZHA 4MZRA 3D06A 2PCXA 3D0AA 2OCJA 5BUAA 4IBWA 2X0UA 4L0ZA 2XWRA 5AOKA 3QYNA 5KBDA 4L18A 2BIPA 2FEJA 3ZMEA 3D07A 2J1XA 4AGNA 4IBQA 3KMDA 5AOJA 3WTTA 2XWCA 5A7BA 2BIMA 3WTYA 3US1A 4G83A 3WU1A 1UOLA 2H1LM 1YCSA 5LGYA 2J20A 4AGOA 1TSRA 2ADYA 2J1WA 1HJCA 2YBGA 2BIQA 3Q06A 4XR8C 5AOMA 2J6WA 1GZHC 5G4NA 4IBVA 4IBYA 4GUOA 4AGMA 5ABAA 3Q05A 3WTSA 1IO4C 4L0YA 4A63A 1E50A 2J1ZA 4LOEA 1T4WA 2GEQA 4QO1B 4GUQA 5G4MA 1TUPA 2VUKA 2ATAA 5AOIA 4IBSA 1HJBC 4IBUA 1CO1A 5LAPA 3US0A 1LJMA 3IGLA 1EANA 2IOIA 2X0WA 5ECGA 5AB9A 2AC0A 1KZYA 3Q01A 2BINA 3D08A 3EXLA 5AOLA 4HJEA 4IJTA 2BIOA 4LO9A 2X0VA 3WTXA 1H9DA 1CMOA 4MZIA 2MEJB 4AGLA 3D05A 4IBZA 3EXJA 5G4OA 2P52A 2AHIA 4LOFA 3QYMA 1EAOA 3TS8A 1HU8A 2IOMA 1EAQA 3VD0A 2RMNA 3WTWA 3IGKA 3D09A 3WTUA 2WGXA 4KVPA 3VD1A 2J1YA 4G82A 4IBTA 4AGQA 3KZ8A 2J21A
chains in the Genus database with same CATH superfamily
4XN5A 1F41A 1G1OA 5CCJA 5EZOL 4K3EH 4AUYA 3LZRA 5DDHA 3FT9A 3CC1A 3KWXA 1X5GA 1JWSA 2OCJA 3NQKA 3DX6A 4JFQA 5FGCB 1QTSA 4ONFL 1B0GA 3TN0C 1NKRA 1DR9A 3GSXA 1TZGH 3BVNB 3MHZA 2K7PA 4KK8C 5ETUA 5IVXB 4XMZA 4JKPL 2ZSVB 5AZEH 2Y2YA 5T1MA 2ZUUA 5F1IA 3C60B 3H6JA 1OY3B 2ZP9A 4LLUA 1EIBA 4OZIB 3CFCH 3CSYA 3P77A 1U8PA 4GKLA 1WIUA 3D34A 1T5KA 4Y16A 3DJZA 1HILA 3FQ4A 2NCMA 3GC3A 3PWUB 1VCAA 2DLTA 3MRNB 5IBTL 2LU4A 1WFTA 3ZE2F 1U8NB 2YXWA 1QWUA 4ZX5A 4JDEA 2M26A 4AW4A 4JFTA 4Y2DC 4P4RB 1E3FA 3WFDH 5DQDH 3FCBA 3PWVA 4Y7MA 3U0WH 3FRPB 3NCJH 3KPRB 3LZFH 2BHYA 2BSDA 1BZEA 2A3TA 4MS6A 2WVVB 3HLAA 1I75A 3L95A 3NCWA 4M48L 4XPHL 2FVNA 4E2OA 1HH9B 1MJ7L 5KBPA 1ZJAA 1MELA 2VDRL 1PS3A 2VN7A 4L4JA 5AAPA 4UNVA 4P3CL 1TQVA 2ZKXA 3AXLB 3L4UA 1HSAA 4CN1A 4RIRA 3K6SB 1AIFA 1XH3A 4OF0A 4HF5L 2FBJH 1FFOA 4NYLA 4UNIA 4Y1AE 4RRPA 3PJSB 1DQJB 1SY6A 4Z5RA 4JG0H 5F6IC 1E4XI 4AK1A 4D94A 1PLGL 5KVDH 2D4DA 4EZMA 1RIVL 1C5BL 4HUVA 1D6EA 4P57B 3EDEA 4JM2A 4L4TA 3KLQA 4OZ4A 1SXBA 4JRXB 5I6LA 4Z3HA 2Z4QB 3CX5K 4M6NH 3RY4A 2CRIA 3UBXB 1NCDH 3W9DB 3AG1B 5BOJA 4BXSV 2JJSC 2ZXDA 3D39D 3T3PF 1FN4A 3OWEA 5T1DH 2H9GA 5JORA 5C0EA 4L4VE 3SDXA 1KGXA 3FQRA 1TCRA 4LMQE 2EIKB 4HIJA 1XF2A 1YY8A 2AK1H 1HNFA 1J1PL 1OCWL 2ZKWA 3B1UA 5FKPA 4H8QA 4M7KL 1IC5L 2X41A 2APBA 3CN4A 5DMIH 4GKZA 4XH2A 3ZZ1A 1HINL 1IKFH 4LVOC 1TLKA 4MD5B 3W39A 1I3VA 2BVTA 6PCYA 5IG7A 1CLYH 2HX8A 4OJFL 5JIKA 4P46C 3VD3A 3OKKA 3VFWA 4BM7A 4U6VH 4NWUH 2HG5A 4LPXA 4WDIB 2C4FU 3V9EA 5B38B 4BSWB 1KCLA 1WC7B 1EDYA 1XB8A 3O2DL 2Z92A 1JFQL 5B1AB 3ARDA 4J3VA 4NRZB 4MJ4A 1YN7A 4W93A 1RMFL 5CGBA 2P5EA 3VXOA 1MLCB 2OTUB 2Y7QB 4JRYB 2OCFD 5LWYL 1IU1A 2D0FA 4ODXA 5JHDA 3N85L 4OGXL 5GJSH 1FFPB 3P4MA 1M7XA 3QUYA 5EF2A 1ES0A 4EI5A 1E5BA 4GO6B 4C57C 4ZMWA 1YMMA 3DO3A 2YXFA 2A4CA 4OCMC 1BWMA 5E8OA 3LEYH 2JCCB 2UWEB 3MU3A 1WFUA 4JVPA 3RHWF 3C75A 5E6IA 4EEEA 2PYFB 1ZGLM 2D2OA 2F19L 3WTSA 4OLEA 3O41B 2A6DB 5C70A 3VFSA 3QEGL 3H3BC 1HC1A 2OW6A 2DIAA 4LOUC 5T1LB 4W9EC 1TTCA 3OLGA 4K7PH 4TSCL 5DUBB 3UTSE 4UTAH 1R34A 5JW5A 5D8JH 4NUMA 2IJ0C 1NIDA 5F8RC 3MLYH 5F7FA 3MJ8A 2PTUA 3KNBB 2DI9A 3FU7B 5D70L 5IW1A 2FX9L 3FYIB 2DQUH 5EDSA 5IMLA 3A21A 4PJGA 4YHLL 3AS2A 1NQBA 2DY2A 3PWNB 1E6OL 1T1WB 3PUUA 4FFYH 4ZNEA 1KACB 3KWUA 3T3MF 5JDJA 2NY2B 3L5XH 1OAZH 2OMYA 2ZCKH 3NFNB 4X98A 4FI6A 4JY6B 2AJYH 3RL2A 1FV1A 5C6TL 3II1A 1ZJBA 2GJJA 4KKQA 1LEKA 1LGVA 2BHUA 5D1XB 3D52A 4N2FA 1U41A 3MLZH 3X1GA 3LKNB 5C8JB 3IKKA 4TRPH 1VRSA 3KYMB 1QASA 1VB9A 2UYLA 2ZUTA 1CDUA 1IBHA 4K71C 1CQYA 4X7EC 4K9EC 2DQFB 3CLFL 4K73A 2WTRB 1FNSL 2QPDB 1LDPL 3BE1L 2G75B 3ROLB 1G7IB 1ET5A 2YQGA 5HHQB 4BFIA 5BRZB 1QLRA 3K72B 4JG1H 4YVUA 2QGCA 4S2SA 2GITA 1HL8A 5GGVH 4AQEA 5A6MA 1SJXA 2BVYA 1JV5A 3HHSA 2OL3B 5JNYB 2F1BA 4X5QA 1P5UC 5K9KB 4QYOA 5FYLH 1F42A 1UACH 2EJ1A 4WEEA 5HDLA 4ZMTA 3QXAB 1MREH 1ZVSA 1UADC 4NBXB 2FUTA 3APMA 4A7SA 1IM9D 1URIA 3ULVC 3GMPA 3ETBJ 4HS3B 1WAAE 3QISA 4JN1L 2D2CC 1DLFL 1WG3A 4WI2A 1UKQA 2SEBB 3FMGH 3TXAA 2EDEA 2JB5H 4FULA 2HTLD 1SF5A 2B16A 4X5WB 3SOTA 5I0YA 4Y16D 4QXGH 4H8WC 1YMME 3EH3B 4PWGA 4PRPA 4D2NA 1LNUA 1CPUA 6CGTA 2MOQA 1N19A 5LBSA 1KWGA 4CVXB 4OM0H 2GC4C 5T3XL 2VQ4A 3KPPB 5KW9L 3EFDL 5C08B 1AJ7L 5F89B 2BDNL 4H7VA 3P3RA 3X17A 3BWUC 3KM1A 3GRWA 5B3NA 5IBLD 1JI1A 1WZKA 3LIZH 1XT5A 1R24B 3O45B 3ZHLA 1A0QH 3K2UH 2X4PB 1PD1A 2YD6A 5DD3H 4L0YA 2WNKA 2OYKA 3QWQB 5J57B 3TA3C 2X4SA 3TV3L 2BH0A 4XAWL 4ZUSA 2ZKHH 2YN3A 3WD5H 2VXQL 4OFDA 1JF5A 1RZGA 1AO7A 2EZ0D 2LQRA 3NGBC 4R4FH 3POHA 5FOJA 2YEQA 4HUXA 3WIHH 4K8RL 5HP5A 2WLLA 2ICEB 1YUKB 1ESOA 3RFRA 2BSEA 2OP4H 3MQIA 2DQEL 4JM2D 4WHYG 4L4TD 2FX8H 3SJVA 3JWOL 3U82B 2DLFL 5DFVD 2WTPA 1AXTL 1I53A 1NPUA 2WMPA 3F7VA 1GYAA 3QZLA 3DGGB 5AD0A 4RFNC 2VXUH 5DVOA 4E9QA 4AQ1A 4QOKB 3VQMA 1J9QA 2DQGL 1XGUB 2CKBA 4AEIL 5CILH 3CSGA 3UZQB 1CD1A 3DLQR 4BQ9A 1YEKH 3ROOB 2R39A 4IMKC 3QAZB 4KRPB 3FQNA 1KLFA 2GJ6B 4OQTL 2BP0A 1CYGA 2NUPA 3MCLL 43C9A 3WE6B 4DVBB 4HOWA 1RPQA 4P9HL 1OL0A 1RZQA 3MNZB 1JE6A 4XHJC 5TDNB 4ELKB 2CKNA 4F8NA 1AZBA 3P2DA 1T0NB 2R2BB 3NCFB 3IDXH 1U3YA 4PSRA 5F7DB 4GH7B 1C12B 5AAMC 2HPTA 3IMBA 1JGVH 4X5XA 4PVLA 4BZ1A 1MFEL 2YD4A 1B9ZA 2VDRH 2VDOL 4HJJH 5C07B 3ARDD 5EZPA 3U4BH 4WW2C 3LD8C 1HE7A 3LKPA 1IGFL 4ZFFA 1A3ZA 2P5ED 1S9VB 5FKAA 1F00I 3BZEA 4EVNB 4PBVC 5J6GB 2DD8L 5JHDD 3PGFL 2PWDA 4JGJA 4OZHF 2PMZA 5HTSA 1ZSDA 3FHQA 2FHBA 1C5BH 4IMLA 3QUYD 4ABVA 3AGVA 5LGJA 3PWPA 5C0DB 4OCSL 4EI5D 5G55A 2MJWA 2ZUQB 1YMMD 4S10A 3OF6A 5AW8B 4PJEF 3RX8A 5E6ID 5FHBH 2YAOA 3FOMA 3HMXL 1E9QB 1MPAL 3EYUL 1VFAB 5TFSL 1PEWA 1FZMA 4KKRA 4WZ9A 4ZMVA 1AO7E 1MJ8H 2WM0A 1J1PH 1OCWH 4LRIA 5FPIA 5DO2C 1WD9A 1MW2A 1U8KB 2X44D 3SDYL 1BYPA 3ZYJA 1RPKA 1RURH 4M7KH 4TQEL 3VI4A 1XGPA 5BMFL 2VB5A 3QG6B 5ANME 1XF4B 3UTPE 1GCFA 2GIXA 2Q3ZA 5BRPA 4P0DA 5BW7A 2AVFA 3QC5X 3F00A 4G9FE 4KKCD 5H8DA 3KLSA 5DC0A 1IB5A 3G04B 4JDZB 3BWZA 1SGKA 3EYQD 2NY7L 4KHXL 1LJMA 2XXMB 4KXBA 4AV4A 4GW1A 1L0XA 5JW4N 43CAA 4G8IA 2O6EA 2F54B 2OMBA 4JG5A 4FQ1H 3CFDA 5CEZH 4RETB 4YNYB 1JFQH 5CCGE 1AKJA 4D0CB 1HI6B 5I17A 4J12A 1G9NL 2G4EA 1MY7A 3MXWH 3EOAB 1MCCA 2YRBA 1KT2B 4XRCA 2EDOA 3FFCB 1HHIA 4XB7A 3FCUB 4FI7A 4UWQB 1T89C 1G1KA 4OF8A 4XN4A 4TTDD 5TE7L 4Z7QE 1EAOA 3QPQD 5KOVC 1U8JB 2VERN 4QHPA 3CMGA 3WHXA 2UY7A 4MQ7A 3TYGL 2G3ZA 5I8EB 3IJHB 3K91A 2I5YH 3RLSA 3SODB 5AW4B 3EGXA 1GGIL 3ZGHA 2ITCA 4W9DC 2O5ZL 2CNYA 5B4MC 5I73B 1XWVA 4HD9A 1NDMA 3IDNA 4P2RB 1FE8L 3CE1A 3ESNA 4L3CB 3QEGH 1QLEB 1MDTA 4XC3L 1MVUA 2IAAC 2WNWA 4TSCH 4ICWA 2Q86B 2OSLB 2RCSH 3EO9L 2WBJB 1E7VA 4PCSA 4ATWA 2NXZB 3BH8A 5C3LD 4JFFB 1WIOA 3PJNA 4NAMA 3ORJA 4OW6A 4J4PA 4NQVB 2BNRB 3RWFB 5F96L 3WN5C 2OAAA 3PWPE 2DMCA 4FDWA 2FX9H 1ET8A 2OJEB 3BPOC 3DUUA 4YHLH 2RHEA 3HS9A 5DSCA 4DPRA 1E6OH 2CBQA 4PRPD 3TBVA 3ZZLA 4ANVA 2Y23A 3LMJH 3NESA 1WCBA 4UINL 2VDLB 1FJ1A 3LKQB 5K93A 4V2BA 2XWJB 2VMCA 1D5BA 5EEWA 2K4WA 3V4PA 1UENA 1SNRA 3HE6A 1T0MB 2PO6A 3IDIB 3LVEA 4YGAB 1WCQA 3B6SB 4YSUA 1Q94B 4BKTC 3MODL 3QQDA 1JS4A 1OPGL 3B5HA 4N0UB 5LGKA 1BMGA 4EE2A 5I5MA 1MQ8A 1R0AL 3CLFH 5CSZB 1V3LA 4KKBC 4M7ZC 1LO3L 1KPRB 1CFTA 5DQJA 1NCJA 1AO7D 4BH8A 3UGEA 5ENWA 3V55A 2BMKA 4JDVA 1CLZL 2YQBA 1TO4A 4JB9L 3APDA 3IDMA 3FPXA 3UTPD 4GSUA 1QW9A 4Q7DA 3TO4A 2FO4B 4Z3JA 2PTTA 1WICA 3SJVD 5IKCB 1PD0A 1XCWA 5TDPB 4PRDB 1Q8MA 3PIQA 4UT6H 3JTSB 3O3DA 4D9QE 4KMTH 4JANA 3UTTE 1NGWA 3GMLB 4H0IA 3IGUA 4PVBA 1CTOA 1DLFH 1RU9L 2XG5B 4H20L 1S9YB 4TLKA 3QJFA 2ZWYA 1YEJL 2KZBA 3WUWA 2ZWKA 1OE3A 2R0LL 4LDOB 1IGJB 4MA8L 3IFPA 2YAFA 2VRKA 3ABGA 1CS6A 3QXUA 4UV4H 3ZTJH 2ZX9A 4ZQKA 1BQLL 1FAIL 1DVFA 1WD8A 5SWZA 1UT9A 1ZA3B 4IHBA 2GB2A 3U48A 5IEHB 3JVFC 3ULVE 2DBJA 4LEOB 3OKLB 3M6DA 1ANUA 1KYFA 1RUQH 3WOVA 4Y5VA 3U0PB 1NGQL 3SGDI 4G2AA 5C0NC 2E9GA 5DZOA 3GIZL 1BFSA 3TCLB 1FNFA 2Q7YB 2B0SL 3D51A 4JM4L 2IQ9H 1ED3B 1QR4A 4L9LA 2LTQB 2BC4A 1BF5A 2IBZY 3RZCA 5J3HC 1A1MB 1X7TA 3VFUB 1MI5B 4OKVA 2ZWZA 3STLA 4YR6B 2VDQH 1AHWB 5DYOB 3BP6A 3V5HA 5JQHC 3VXTB 1SLWA 3I50H 2A83B 4U3XA 5EDXA 3U7YH 5AOJA 3PWPD 3O3BB 4I5BA 1X9QA 1N8ZB 1XGRB 2EXTA 3JWOH 5GGSB 5AVQB 2XLLA 2CHXA 4IOSA 1S5IL 4Q6IC 3MNDA 3BJ91 3ILPA 3OF6D 4ODSL 5IM7B 3RWEA 4NRYA 1HH6A 1I7ZB 1UH4A 3DVGA 1Z0MA 1RJYB 3CCHA 3L3JA 4FXLA 3GJFH 1MEXL 2DWTA 5HXMA 5I8CB 5A2IH 3SPHA 1J8KA 4XZUB 3LKRA 1BZ7B 1AD0A 5B21A 1UURA 2VC2L 1I8KB 2P5WE 4MNGE 3S3CB 4YO0B 5LCVA 3MA9H 3UERA 4Y4FC 5F0PB 1NM9A 1ZK5A 3BRDA 4NN5C 3L9BA 4WU7B 3BAYA 5F9OL 4OQTH 2NY1D 3U1QA 3W5NA 4YHNA 5EUKB 4U1GB 5HYQB 1P1ZB 1QA9A 1XZ0B 2XTLA 5D2LF 4P06A 4MQTB 4FQ2H 2XFGB 1FL3B 4JRFA 4MCZB 3UACA 4K7PX 4JHZA 3FU0A 1BWWA 3W11D 4FMVA 2VLLB 1U3HC 4MJ5A 2EECA 4TVPL 4NO2B 2VDOH 1RUKL 1D5RA 1AKJD 4A2EA 1G7JA 2JLPA 4LLAA 1QSFE 4XCYB 1WWCA 4YHML 2JB6A 2JH2A 4D9QD 4RAVA 3SE3A 5DEFB 3FH5A 1NEZB 2BVQA 1TYRA 4P4KA 1UWEH 3WJJA 2IAMA 4HH9A 5E08L 1J5CA 4K7PY 3PAUA 4OCSH 4Y1AB 3EJUA 1UD8A 5E9DA 4FMKA 2JKNA 3IM1A 2ZAHA 5EIVA 3KWTA 3X12A 1AGDA 3SDDC 2I7SA 2MRYA 2V5SA 1U91B 5JXAH 4R4ND 3HMXH 4DHLA 1XIWA 4P2OA 3REWA 4PBXA 3OKMA 5J13C 3PRZA 1IC4L 3B7SA 3NIGF 1QQDA 1CICA 4NHCL 1TQUA 4IIQC 4PP2B 2HKHH 5GGRY 3SDYH 1VFBB 4KZEL 3QCUL 2KPNA 1SBSL 4LSQH 1QWHA 3LQAC 2F8IA 2X0UA 4J4PD 4L4VB 4JO3H 5IROA 3UBHA 1A64A 3REVA 2WKOA 3KWWA 3ZL1A 1Z2KA 2NY7H 1GH7A 3EYOB 4NFDA 2FUQA 2ERJB 4N5ED 3GO1H 4L5FL 1HHHB 4JFQB 4UAOB 1T7YA 4YHYB 2FWOB 8FABA 4HLZH 1AS8A 4LNRA 1JWMA 2YD7A 4N9GA 4RMTA 4L8BA 4Q89A 4XCEB 3CDZA 3E9TA 1QNZH 3HE6D 3UYRH 1JWUA 1YCSA 2PO6D 3MYZA 1S7XB 4U6HA 1IM9B 1G9NH 4XWGL 4CC4C 5T1MB 2EVJA 5F1IB 3PWLA 2BHZA 2BIQA 3RIFF 1QO3A 3VXSE 3P77B 1YNKH 5IQ9A 3L7EB 2WVTA 5ESAB 4Y16B 3GHBH 5CJ8A 3HB3D 3S96A 3IU3A 1MFBH 5AW2B 4Z76B 4X7CC 5TQ2L 3TYGH 1OTSC 4ERSH 2Z0BA 5MEOB 4XTRD 1BVLA 1GGIH 4JDEB 4N6RA 2AKRA 1E9PB 1H3XA 2M8XA 3PWVB 4GMTL 3TO4D 4JFPB 4X6DF 4O2EA 1KTJA 4AM0B 3EYSH 5AOZA 4N24A 3HLAB 3FT2A 5E6RB 1IUZA 1YMHB 3L95B 4OV6F 4D9LL 2V17L 5DZVA 5A16A 5AB9A 4Y5YC 5I15H 4YXKL 2ZTBA 1WT5C 3FW6A 2HAZA 4W9FC 3HW7A 1I8IA 4YC2B 2J8UF 4JDTL 4PJ9C 1Z9NA 2BERA 1BZDA 1ZS8A 3PWJA 1IVTA 2W9DL 1FGNH 4ZPVA 2JJTA 3UTSB 4QI3A 2HT4C 2VN4A 1WK0A 4Z5RB 1I9JH 1TJHL 2VDPH 1EEZB 1NBZA 1SUHA 1SEQH 2G9HB 2L8AA 4H8UA 1BVKB 4PJFA 5CD5D 4HUVB 4P2CG 1DVFD 1OZUA 4WFEE 3ARSA 2VW6A 5EOTA 1X5IA 5I1AB 4OZ4B 5SWZD 3I2CH 3B2PA 4HCGA 4LDEB 2DAVA 2K8MA 3QO1B 3SQOL 2OMUB 1QOKA 3VD0A 4WV1C 1H3GA 2VXSH 1TCMA 4BFEA 5FX3A 1SJVA 1OPGH 3PUCA 2CO7B 2H9GB 1DUYA 1NKOA 3MFGB 4FC3E 5JORB 3FQRB 1TCRB 1Q38A 1VPOL 2UVFA 3VD2A 1XF2B 4L3EE 2APXA 3MN8A 1HXYA 3EUUA 4JZJA 3RZCD 2NLJA 2OR7A 3LRGA 5GIRB 3GSWA 3LN4A 3LAFA 5DD6B 4ZTOH 1CLZH 3CIQA 4JB9H 3IXAB 1CD9B 3G5VA 3L7FA 5ACLA 1RP8A 1J88A 1RK1A 4FZ8H 3S3SA 5IJDC 5IG7B 5I6XB 4IQHA 1I85C 3OG6B 2CO2A 4Q8BA 2V4LA 1A6TB 5I1KH 3S35L 3MRPB 2J5LC 4XNQA 1N8OE 1KF9B 3AROA 3DXAE 4IOSD 4JE4B 1JGEA 5B39A 5A6IA 1FVEA 1IQDA 4PJAF 5CF3A 4ZUWB 4KNSA 3G7TA 2DKSA 3ENEA 3TOPA 2OZ4L 5FYJU 2WQ8A 2FO8A 1T6BX 1XR9A 2AV7A 3H8NA 1SLUA 1DBJH 2JI3A 5E0FA 3SY6A 4NKMB 4TUOA 2R0ZL 5L4JA 3MTRA 4QHNB 4UT7L 1FSKC 2R0LH 3VXOB 4HWEL 4MA8H 4NCDA 1FZOB 3MACH 3LQMA 4M1CD 4NKOB 4BHUI 2AK4A 4NGHH 1BQLH 1FAIH 3C6LC 4KZ0A 3QUYB 2C3VB 2DPKA 3PLYA 4W9CC 1TZHA 1ES0B 5AL0A 2ZG1A 4LIQH 4EI5B 5JA9A 1TENA 4XVUD 3IJEA 4J7RA 1YMMB 4LOEA 2W9LA 2GJZA 3J07A 3E7JA 4ODHL 4CC1A 2GUYA 3V0VA 1BYNA 1IGCH 1NMAL 1MIEL 1K3IA 1GOHA 2Q3XA 1NGQH 5FHAL 1KV7A 4MAUH 2XX1A 3HBZA 2E27L 4X7SH 3HKFA 3EO0A 4PHXA 1HT6A 5F7EH 4APXA 2Z34A 1JN6A 5E1QA 4UT9H 5GQBA 3SE6A 4X8GA 1SOXA 3ZO0A 1F2QA 4P07A 3TU6A 1RLWA 4EXKA 4P04A 3MJ8B 4F7EB 2XKUA 4J5VA 4P4KD 1FZKB 2YA1A 5IW1B 5IMLB 2MCPH 4CVUA 5E2WH 4WI5A 1CDHA 3N42F 5E9DD 2YKLL 3GDBA 3IYLW 2XC8A 2YFOA 2OMYB 1KUMA 4X98B 3G6AA 4NXSA 3NZHL 3OR7A 3DMMC 5E7BA 2ATKA 1FV1B 3P4NA 3I6LE 4FXKC 1A9EB 1MEXH 3ECBA 3Q2NA 5JHAA 4P23B 4W4NA 1XIWD 4P2OD 4YXLL 4NNXA 5E2UL 2YRZA 2C9SA 2FLMA 4L8DB 5E1GA 4KDTA 4EBQH 1QFWM 1W9XA 1HQRA 2UYLB 2VC2H 32C2A 4Y5XB 4N20A 1CBJA 3JZYA 1D6VL 5ILTL 3IE9A 3IN2A 4KMLB 1ETJA 4IRSA 1ZD6A 3FUDA 3RWDA 3PHOA 1MCJA 1QYGL 5DHYB 5ALBL 1I1FA 1VEMA 3D0AA 5IROD 4L3ED 3H7LA 4S2SB 1KGCD 1SXZA 5SWSE 3D33A 3TN0B 3ZW3A 4Z0BL 5JIIA 5E6ZA 1A7RL 3RNKA 2X9YA 1BM7A 1YVLA 1T04A 5DWUH 2WB7A 3DPBB 1HZKA 4L1BA 3QGVA 2XVGA 1Q0YL 3WNIA 3LKOB 1JYVA 3OAZK 4BELD 3KLLA 3B83A 4W9KC 3HUJF 1GL4B 3OXRA 4GKNA 1Q72L 3ECQA 2FT7A 4NCC1 1FL6A 1YPZE 2VLKA 4J6RL 1ZLWH 4OD2B 1SJEA 3SB3A 4QRQA 4DUWA 3I75A 1MFMA 1GW0A 5G5DB 4FQHB 1HOCB 4ZFOL 5JW4M 1OW0C 4HD5A 3K1KC 2XKNB 4PRIE 2X6BA 4JFHD 4R7LA 2Y1AA 5CJ5A 1RZIA 3SBWA 1HXKA 5AVTB 2E8ZA 3IGFA 3L3HA 1O7VA 3EG9B 1ZPLA 2PPEA 3CZFB 3SE4A 1IC4H 4WQOA 1L3WA 3GSOB 1AAJA 1DBKH 4DGUA 1XSJA 2V9RA 3KPNA 3ATBA 3US0A 1IZKA 1KY6A 1NGXA 2YXMA 3BW9A 4U0QB 4FTVA 4QT5B 1GJIA 3HR6A 3UAFA 2WZ0A 5IJCC 1HCZA 3HBPA 3DSFH 4G6JL 5GGRA 1AO7B 2QQNH 1T22A 2DBLH 5J1TC 4MQSB 3AADB 3BQUC 4XNMB 4GW4B 4RMBA 3TA4D 1INQA 1U2CA 1YSOA 2V5RA 5ANMB 3RGVA 3CDCA 3MI6A 1KWKA 1KB5L 1MH5A 3BVVA 2AJXL 4G9FB 4ZAKA 4DEPC 1DQQA 1EFXA 3D9AL 3L08A 3DTUB 4JAMB 4MA1C 1UWXK 1ZT7B 3FT0A 1RCYA 4AZUA 4WFGD 3E1ZA 3MRBA 1IV8A 1WBYB 4B27A 2C8NA 1PSKH 3MLXL 3ESPA 4ODVH 3F7VB 1U8QA 4U1IB 1KTBA 2XZCH 2HTKD 3CFJB 3MNVB 5DWPA 3I6LD 4B0MB 3WDJA 2V7NA 1OGAE 1BX2A 1KJ2L 3QORC 4U1LA 1B3IA 5H4ZA 2CKBB 2R29A 3ASWA 4GIOA 3WTVA 2HT3C 4A66A 1I4FA 3RFZC 5TQ2H 5TD4A 4LVOB 3OR6A 3WY3A 1KB9K 2K45A 4X4ZA 1HEZB 1BF8A 2NDGA 3FQNB 1KLFB 2NDFA 3T1FA 2BP0B 2NUPB 2TRHA 4OIIL 4PYGA 2F6AA 4Z7QB 4EN3A 3TJEL 4FQCL 4IRZL 4IM8A 4GMTH 5IJBC 4IKIA 5KN5A 4PJ7F 4YFLI 3TFKD 3S4SG 3DTXB 5DJYA 3A3YB 2K9FB 4Q0XL 3VFVA 1A14L 1TYJA 3HVNA 4QGTA 2FWLB 3QDAA 4JL2A 4KITB 2WOBA 5DJAB 4X5XB 4P2AA 1A4JB 1A7QL 4YDZA 5CBEA 1C5CH 2H8PB 3BEWB 1BGXH 1SDAB 2IC2A 4RDQF 1NANI 2OMTA 3GGWA 1J05A 3B2VL 5DZJA 5JHLH 2W9DH 4CJ0A 2JELL 3WY1A 3BZEB 1JHKH 4LLMA 4H1LG 5DD0H 3AWEA 3LIZA 4KJQD 5EEVA 4FQQB 1U8LB 5IOPB 2AK4D 1ZPUA 4MTMA 1EV2E 4IMLB 1B3JA 1XD1A 4JZOB 4K23L 3PWPB 5LGJB 4Z3EA 2P42B 4MZ3A 1ACZA 3ZTDC 1FYHB 1F3JB 1OCZB 2F8OA 2CO3A 3A4FA 4U6TA 3SCMC 1DJXA 4BXVA 2BSTB 4MRCA 4NPJA 3W5MA 3VYNA 2J5WA 1T2QL 3CN3A 5A2AA 1SLXA 3BUQA 3WIHA 2ZE0A 3TEZA 2BX5A 1GW6A 3FOMB 4OZGA 4DSYA 4DKEL 4R9HA 5AOIA 1EEQA 1OSPH 4FLHA 1VPOH 1W8NA 4M8QB 1GPOL 4ESKA 2VDNB 2QMKA 1XGPB 2R1WB 3RTQC 4G8FA 1AGEB 2QADC 2J6EH 1L4IA 2YQ3A 1TITA 1H15A 4UIMA 1QMUA 2A9AA 4AV5A 4O51A 3DIDA 2MKLC 4FKHA 4N86A 4OT1L 4P5TA 3GSUB 3GMOA 5DK0A 3S35H 1MHHA 2L7QA 2GBTA 4UDUB 4MCMA 1WF5A 3WAJA 2P28B 1D7CA 4BJLA 3BUYA 4OGYH 2VLJA 3MBXL 2KH2B 2OZ4H 2EXWD 5INCA 4H4NA 4POZD 3IRZA 4FA7B 2Q2LA 2O30A 2E0PA 2ICCA 1NFDA 1AKJB 3G08A 3KEHA 4GBXC 4I18C 4R7VA 5I17B 2K0RA 2X2YA 1E4KC 1INDH 3JBG7 4WNQA 2RR3A 1F4YL 4UT7H 3VXNA 4HWEH 1X5LA 4EUPH 2IFFL 4DETA 1EHLH 1HHIB 4X6BA 1BJMA 3UTTB 3D85B 4IRSD 4CVZA 1IILE 3VDCA 3CUPA 3FBQA 1MCEA 1JCKA 4FG4A 2FJUB 4MCYA 3WHXB 1FIEA 1RIUH 4X0KB 2X2IA 3GMQA 4MZRA 4G43B 2X40A 3AABA 1DQTA 3GI9L 3TJPA 1AP2A 3OAUL 5E6IC 3T0BA 4Y2NA 4R3SB 3QUMH 1I9RH 4XAKD 4YSCA 3K71B 4MMYA 3U1SL 1CJYA 4L48A 2CBTA 4QY8A 1GMEA 2AEQH 2XWRA 5FYJE 3ZXAC 1NDMB 5FHAH 4AQAA 2C7UA 3ZDWA 2PCFA 5LXGL 3IDNB 2WLJA 4MB1A 2Y0SA 2XN0A 1DJIA 2EDLA 3K5RA 3U6XS 3OAWA 4M4RA 3TIDA 3BH8B 2LV4A 4Y4KC 2VLKD 2ZUXA 3N3EA 5IQ7L 5DSCB 2YBRA 4OM1H 3OVUB 2YKLH 2ENQA 2A77L 3DGDA 5LNEA 1YYLL 4OCYL 2VJXA 2XZQL 5FCSH 5C6WH 4J3OH 4FTDA 4ORZC 1D5BB 1Y0LB 3IFLL 1PG7L 3V4PB 2YK1L 4W68A 4IOIB 5A2JH 2J1KA 1WZAA 2PO6B 2HRPL 1JVKA 2X4OB 3VFOB 1Y07A 1JPEA 3BSGA 1RUPH 4YLQT 5B3SB 2N0MA 5MEQB 3ZT5A 4K9EL 1FZJA 2AJ3A 4YUEL 1DSWA 3RVVC 4XMVA 4O02L 4FTVD 4F7CA 5J0BA 1UM6L 3AS1A 2CK0L 2X42A 2ISDA 4OJCA 1R9FA 5J1SC 1M7UA 3CFKA 4P49A 5HVFB 1J9CT 1XMEB 2HLAA 2AAAA 2P5WB 3LQZA 4JDVB 2CGRL 1OTUD 3IJ9A 4MNGB 3T6WA 2V3FA 3QA3A 4LHJB 4LKXB 1DP0A 3IDMB 3K8MA 1H6EA 1UEMA 3CPLA 4YHIA 3RGVD 1AG6A 3QAQA 1WFIA 4LO9A 3KL0A 1URZA 4MXQC 4XPAL 5C9JA 3S37H 4GAGL 3TO4B 1NFDE 4MXVF 4ZAKD 2ZOLB 1HCVA 2EDJA 1EFXD 1G4RA 3VVVA 4EN2A 1Q0YH 3I02A 2DWDA 1C1EH 3O3DB 2YQ2A 3QJSB 4RFNB 5EF3A 4PB9H 4B9CA 1QBBA 4G6MH 1E8XA 1CT8B 1EEYA 1TNNA 1XTMA 3QJFB 3ZQ9A 5KVEL 4HKJA 4G7YH 4MJ2A 3WDIA 4J6RH 2GAZA 4PGDB 2NXYD 5FYLD 1EH9A 1QSFB 4W6WB 5KSBA 1AS6A 3V0JA 3C9NA 5AVRB 3G9VA 5GSRB 3SKUD 1SYVA 4K4KA 3BKML 4WUKH 3ZMRA 4ZQKB 3KS0J 2MTAA 3BSZL 3HCVA 2R2EB 1P4BH 5BV7C 2O6PA 1QTYT 4EN3D 5SWZB 2IG2L 3OKOA 2ZAIA 3LZLA 5F7LB 3P3UA 3DA0A 1MWAA 4N1HB 2HVKA 1GAFH 1CFVH 3WJLA 4AVHA 2HMID 5C0IB 1QFWL 3LD8B 1S9XB 2CCVA 3VH8G 1PFCA 5FYJD 4KV5E 3QFGA 3IPEA 2XOTA 4WK0B 1T7VA 3MXVL 4JHVA 4ONOA 4U1SA 5HYJA 1IGIH 4GAJL 3Q8EA 1F4WL 1ZOXA 4GI9A 4AUJA 3V5HB 4AGOA 2BSSB 5EOQL 5ESVA 1CYXA 4HCRA 4PBWD 3A23A 5F3BB 2PTVA 2EIZB 4P5MB 4QCIB 4RMWA 4MDIA 3D9AH 4XPBL 4YDIL 1N67A 2OXGB 4WY7H 4N26A 5CGMA 5F7HA 1ECYA 1IAII 4PJBE 3RWEB 1HH6B 3TTSA 3DVGB 3BGAA 4Q97A 4NN6B 3L3JB 5CS7A 1IBFA 2PWFA 3V0FA 2IPKA 4PJHE 5D2NC 1JXJA 3BUTA 5KYUA 1A9VA 5F9JA 2ADJB 3WNPA 5T5FH 4TQIA 4ADGA 1KJ2H 1LYQA 3OJVC 4M5YH 5IHZB 1AD0B 1T1XB 2CMRH 3M1OA 3P2TA 2VN5A 1G7QA 1ZGLP 4ODTH 3IKCB 1EK3A 1JZHA 2JTDA 3B9VA 1XV8A 3QXDA 4UT6A 5IY5B 4P2QA 1TTRA 3FQUA 3VXSB 3WIAA 1U4FA 5F7BA 4YHNB 2JKWA 1QVOA 4ZZFA 1QA9B 3TJEH 2AI0L 2GCYB 5CLXA 4ODUB 2EDBA 5E00A 3CFNA 2Y3NA 4FQCH 4IRZH 4P5TD 5CHNB 4OGQC 1OKEA 4WO4D 3UTQB 1A14H 4PJXE 1JNLH 5D1QA 4TNWK 3BDXA 2VLJD 4RGOL 1DJGA 3CHXA 1NGZB 2IBBA 4XVTH 4X6CA 1L9OA 2KPWA 1TTGA 2KBGA 1G7JB 2BNUA 4HEME 4GQZA 1B6DA 3BGFB 4F91B 1U4EA 2JB6B 3B2VH 4FA6A 1FVCA 4S1QL 4YEFA 1YRKA 4ANXA 4HS6B 4AYDC 4XP4L 1RULH 2A9CA 2XDHA 3G9AB 4P4KB 1EERB 1R5WB 4HH9B 2NW2A 5AENA 1BM3H 4IRJA 1TZIA 1F4AA 4FHJA 5E9DB 4NC1C 3PL6B 2YO3A 5I6KA 1IJNA 1AGDB 3H0TA 2HFFA 3FHAA 3U4EB 3UZEA 4GS7B 3CH1A 3QRGL 1K4DA 2V5MA 1E8YA 1XIWB 1AR1C 3N40P 3T6ZA 4XBEH 1N68A 4Z7NE 5E70A 1AZCA 3I84A 4FX5A 4DF9A 2NY1C 4GSQA 1JYXA 2FT6A 1GGBH 2YARA 3BUPA 5DZ9A 3MA7A 2DMBA 3BPOB 4WJG3 1HYSD 3NJNA 4N2IA 1BXVA 4ELMA 4QXUL 3S5YA 4L3EB 1SDDA 3GJFA 1RZ7H 2ZUYA 2VWEE 4OT1H 1KYOK 3KLAA 1N6QL 3BUBA 3O0LA 2WUCL 1KBVA 3PP3K 2BOBA 3CVHL 5GRYA 5KSVA 8FABB 3MBXH 2YD5A 1JWMB 3UBFA 4TLTA 4LARH 1JWUB 1PEZA 1OAYH 2X4TA 4YGVB 3GSQA 3HI1A 3IDGA 4ZW5A 1ECZA 3DXAB 3IMTA 1FO0H 5GGTL 2EVGA 3KXFA 4NOFA 5DHVH 3PWLB 3P9MB 1QO3B 4LVEA 1WHOA 1AGCA 3AXHA 4M7ZB 5IQ9B 1JGIA 1CB4A 4PGEA 1HSBA 4YSDA 3R7QA 3N04A 4LAQH 3L6FB 2VAAB 2VZVA 5DA4A 3TYFB 2KLTA 1XEUA 1XSOA 4HT1L 4WI0B 1LWJA 5DI8A 3QWRA 4N6RB 2AKRB 2IFGA 3M1BB 3BEVA 1PQZA 2UXGA 3D4GA 4KK6C 3OB0K 1TQCC 2P80A 3M86A 4HHAA 4GG8A 3LRSB 4X6CE 4L9DA 4LP8A 1B90A 4R5VA 4WWID 1SM3H 4MJIE 4I9WD 1R75A 3CD4A 1WBXA 4LGRB 3SKNB 3NCYS 1WZ1L 4PLOB 3RILA 1I8IB 2AHIA 4LOFA 4KPHL 3SDAC 3AUVA 3S5LA 5HHXL 1ZS8B 2KZ1B 2YUWA 4AT6B 2OTPA 4RGMB 4R2GD 3LZQA 3G5XB 3WEOA 2V5TA 4PJDF 1R3HA 3EGDA 4JR9H 5JPNA 2BSCA 1NGYB 3BWUF 4JO8A 1OK0A 4KFMA 5E5MA 1N10A 1NBZB 2XWBB 5FM5O 3G5YA 2KHAA 1YYLH 2Y1ZA 2FCBA 3U30C 2XZQH 2NY3D 3LN5B 1I1YB 3HE6C 5TDOA 1PL3A 2IMMA 3BT2H 1PG7H 2YK1H 2EDWA 4M3JA 1Q1JH 3KPSE 2HRPH 4XI5D 1INEL 5E4EB 1FWXA 2HN7B 3MV8E 3X11B 3ZVVA 4YUEH 3ZRSA 5C2UB 4ELME 3BUDA 5EU6A 5EBLA 1UM6H 4HUUA 4XPFL 4L18A 1HXYB 5D6DC 2OL3L 2YD2A 2NLJB 3N44B 1K72A 3NRFA 2A6JB 5HHPB 4DW2L 3ZRCC 3V0AC 1KGWA 5HYJD 1E40A 2M2DA 5DF0A 4H25B 4HK0B 4KJWD 3BLPX 3SPJA 2EDXA 3G5VB 3SD2A 1FIGL 3CZJA 5KAQF 1RK1B 1OQOA 3X3GL 3WU1A 3OHXA 2F53A 1UJ3A 3ET9F 1CZ8L 4Y1TA 4Q6IB 2V8LA 5E24E 4QIRA 4XNQB 3ULUL 3NIDE 3AY4A 3LNEA 4UNTA 5B22A 3TBCA 5B39B 3SHSA 3H7BB 5E5LA 1IQDB 3FB7B 3DYMA 1UFUA 3ARFD 2IALB 1XR8A 3VWJA 5ABZA 4PGBA 2J88L 2DV6A 1XR9B 1AOZA 5I1EL 2ARWA 3GPSA 5ABAA 3CVDA 4TTGA 2WC7A 1MHCA 1YNLH 4TUOB 5KVEH 4OFVA 5HY9A 2DOCA 4ZUTB 3U9UB 4Y4FB 4F33A 4NC0B 3H6AA 4NN5B 2X3BA 1J5DA 3X2QB 2H0JA 1H3VA 3AM8C 3EYFA 5C7XH 1OP9A 4BWWA 1TVHA 4LK4A 3E6FB 4BFGA 1YPZB 4PWEA 2WWMC 4FZEL 4Y19E 2R1YA 3RA7L 4Q56A 2VZUA 1W72A 2Z93B 2GJZB 3L5IA 2GSGA 1KJVB 3WMPA 2I9TA 3FCGA 1U3HB 2GHWB 2R51A 3L3DA 4NQTA 5FGSA 5D1QD 2XU9A 5D93C 5DS1A 1QFWH 2ZF9A 2DL9A 4U4IA 2W88A 4XCNA 3FU3A 1ZHBA 2R9HC 4F9PA 3S35X 1JN6B 1S46A 1JXKA 5I26A 1NCWL 1NWOA 3EJYD 1JCVA 1ZVHA 3IMVA 4HIPA 5G4OA 2WCGA 1F4WH 1LVEA 2HSIA 4KVCH 3D12B 3DJRA 2FO1A 4WWKA 4HV8A 3DRTB 4F9LA 4I7ZC 4IRJD 5E8PA 3ABKB 4FNQA 3K2MC 2FYYB 3QIUC 1Q0XL 1KIQA 5IHUH 1TG8A 1YNTB 5I0WA 3SDDB 4FJZA 4XHQA 2BSRB 2JXMB 2UY6B 1UATA 3FFOA 5LQBH 3C8KB 3BAEL 1G84A 5TE4L 5FYKL 3X3FH 1N0XH 4UZSA 1OSZA 2JQZA 3X14A 5DHMC 3TESA 5J13B 3CK0H 3PHQA 5HYSA 2FNBA 4DCQA 4IIQB 5GS1A 5EEUA 3K4ZA 2G2NA 1KN4L 4QRRA 4D7BA 5CJQH 5HGAB 1KTLA 3F7YA 3GBNL 5GSVB 5CD3A 2CLVA 1YEHH 3QHZL 4E42A 5ES4B 4IRSB 3DVIA 3K7UA 3PHOB 4NM8L 2FD6L 1ACXA 5AQ0A 3U0TB 5L6YL 2F53E 1OGAB 4WFHE 2AI0H 2E75C 3WNKA 4ALAL 5IW6A 4GP5B 4NC2B 5FW7A 2PP8A 3RVTC 4DTGL 2W07A 3EGSB 1JZ2A 4DGVH 1T04B 1E2ZA 1DE4A 1YY9D 3V4UH 4AITA 3V0IA 2XACC 3KGSA 2E86A 3MX0A 5E4IA 2O5YH 5F0MB 1OAUL 2RB8A 3MGAA 4EPSA 4LLQA 4LLDA 1HQ4A 2NX5E 3SIKA 3IK2A 3KXFD 2EC9T 3CQFA 4XNXL 4WFFD 4ZRGA 1JPTL 4X6EA 4GUOA 2IAMC 3FN0H 2UWEF 2LE9A 4HYTB 5FCUL 4XP4H 4JREB 4G7QB 4KJPD 5EHFA 1FL6B 4ES8A 4N8VA 3FO2A 2GW5A 3MJ7A 1SJEB 4JFEE 3BIKA 4IKNA 2EABA 5SX4I 1NMCB 1QRNA 4HC1L 2CIKA 1DZ0A 2FR4B 3SGKC 1R19A 4CNIB 2B3IA 2V2XB 4EDXA 3QWRD 2I27N 3TL5A 4AY0A 4QWWC 1BQSA 2D3LA 2R1XA 3GEWB 2P80D 4NZFA 5K1VA 3W38A 3IJYB 1CICC 1QX1A 4Y19D 2LU5A 2GSMB 2YLHA 3Q8CA 1ZLEA 4Y5YB 3MRDA 1SHXA 3CBJB 4ORGB 3LQAL 4X42A 5K69A 1PX3A 1UH3A 1MHPL 3OTTA 4IU3A 4EQ3A 2APVA 2DQMA 3S37X 1J1OH 4H8PA 4XO8A 3UJTL 4AGLA 1M53A 2E3VA 2YIHA 1M42A 3Q2LA 5GGRB 1T83C 4XO3A 1W15A 1H5BA 3DJTA 1S7SB 5E8NA 4XVSL 3O6FC 3IMSA 4QHLB 4F8TA 4Z7OE 2P24A 3TS8A 3NAAL 4QHKI 4POUB 3CVHH 1WUZA 2NY6C 1G7PB 1Y18A 3WLWD 4ZAKB 2ZWSA 1DQQB 2WGXA 1AE6L 1HL5A 1KPUA 3ZHDA 4AGQA 3DOSA 2A74A 1OAQH 5IWLC 1HHJA 2MPAH 4DPAX 4OLUH 3ZL4L 5I1CH 1R3JA 5GGTH 1U8QB 1JRHL 1HKLH 2RAMA 3SGEI 4YDVA 2OJZL 1PY4A 1RVFL 1B0RB 2GHZA 1BX2B 1OTTD 5EU6D 2A73A 4MVBD 4PVNA 4U1LB 5JDSA 5CN3A 5DEGA 5D1ZI 1TQTA 1JNNL 2VQUA 2VISB 1OAJA 2BW4A 1HXMB 2AJSL 4JGUA 3NCYP 4MKTA 3U6XA 2CUHA 3GEFA 2W1NA 3T1FB 2QV4A 4LPWA 4JM0A 3GM0A 3KAAA 1O9ZA 5IHHA 2J5LB 1PZ3A 3QO0B 1PYWA 3ULUF 2F53D 5D7LA 1ML0A 5KN5B 4NXKA 3ZTNL 5DJYB 4JJ5A 3VFVB 4WF7A 4KX8A 2QVIA 4ZW6A 4CU7A 5CLZA 4QNPE 1O6TA 3VGBA 1YO4A 2YEVB 3HBGA 3VWJD 1CL7I 5CBEB 5ALCH 4KY2A 3OB8A 1B0IA 1E2WA 3SDCC 1FSKB 4KPHH 2WN3A 4LKCB 1F97A 4RBPH 3DUSB 4JPVL 1J05B 1OVZA 2J7LA 1QHOA 1QRNE 3VQ2C 3CAFA 3TASA 1V54B 4JFVA 3B7TA 3MYJB 3C6LB 4MLSA 3CFIC 3LXBA 2OMWA 4TULH 2VDKB 2DLIA 3JV4A 2ICWA 2ADIB 4MQXC 3IBOA 3IS0X 2LT9A 3FU9A 4JFED 1EO7A 2AGJL 1DYZA 2BP3A 4I0KA 1INEH 5E2JA 5DUMH 2X89A 1GGYA 1U8MA 4WW1B 5IMOB 4JZJC 5DLLA 3FRUB 5D7IF 3FTGB 1M2VB 3CC5A 4L37A 4YSTA 4DQOH 4GLRI 1BAWA 4F8LA 4XPFH 3CWGA 1HWHB 4JN2A 3WG7B 5KVGE 2OL3H 3HNSH 1NGPL 2AP2A 3WS6C 4GI8A 4K5LA 4BQBA 3KLHD 4KI5F 4RDQG 1NAKL 2MQCA 4G8FB 4A67A 4EUPG 3VG0H 4WWKD 5BJTB 2CHWA 1QATA 4OCNC 1H15B 1ZE3H 4UIMB 3X3GH 4HZ1A 4O51B 1VGEH 3MFFB 4WTXA 3I9GH 4NZUL 1B2YA 2C34A 4P5TB 2ALWA 3GMOB 1FHNA 1MHHB 3S36L 4HJ0C 4J8RA 4WO4B 2X9ZA 3DMMB 1VZIA 5DZNA 5MENE 4RCAA 5K1NA 3U7AA 3D09A 3VXME 4FD0A 3GPEA 1ADQA 3L2NA 5AVUB 1KXTA 2PUQT 4GAYA 2J88H 2NQDA 3CQQA 4UQ9A 4JFYA 1NFDB 3G08B 1A22B 2Z64C 1X6NA 2D7TL 4KJQC 3ESMA 4Z7VA 5ADOL 1R5VA 4WEUD 4RQQA 2GTZA 1A6ZA 2MTPA 1CXIA 1CIUA 4D3CH 2NTFB 3CUPB 1AXSB 2XN2A 1DBML 4L0ZA 3WO4B 5D7LE 2Q2EB 1W91A 4OD3L 1G87A 1ZKAA 5EMYA 1D5ZA 3RA7H 4K5MA 4ZS7L 3FQXA 3SGEH 2DQIL 1RP9A 4RESB 4M1DH 1LE5B 4EMZA 3M17B 4UTBL 3TJHC 4OUUB 4O9HL 4YL9A 2Y07H 3HN8A 2XWZA 3RVXC 2V9TA 5FUZL 1TEFA 2J4WL 4U49A 5BXFB 3JWNG 4HJSA 5IV2B 2WLNA 3QP3A 5FECA 3AFLA 1NSNL 3OX8A 3RQ3A 2BOCA 2FE0A 3C12A 1K2DA 2YRLA 3MJ6A 2WUBL 2ZNXA 2WQSA 1FL5A 3BYYA 4WKZA 3V4VL 3E9UA 2IVFC 1ZTXL 1J12A 2X70A 3BPLC 1EWHA 2WQXA 5DFAA 3BD5A 5EOCH 4EI0A 4ZG1A 5KS9F 1ZXKA 1CF8H 1QRND 4RMUA 4M7LT 1CL7H 2XY1A 4ETYA 2B1HH 5DJ2B 1TUPA 3MLSH 4HHWA 4CADA 3VMPA 4ZTEA 5CEYB 5TE4H 5FYKH 3VJ6A 4MJ6A 1IEAA 5AZ2L 4TUUA 1J0JA 3F12A 5I82A 4Z7UE 1CI5A 4RGNC 4PJ5E 2J6EA 4J6IA 4HK3J 1O75A 1OEZW 3KPOA 3PREA 2UXFA 4OFPA 3IGLA 3GXTA 1KN4H 1TEYA 4PJBB 1D5XB 1FZJB 4LPTA 4NWTH 2H45A 1ZRUA 1XF5B 4M9OA 3HE7A 4ECNA 3CVBA 1VJSA 2HJFA 4PJHB 2F58L 3C2SA 1L7TL 3BQUB 4UQBA 5AEAA 1ZY9A 3N6YA 3ALXA 1URLA 3S88H 1X9LA 1HESA 2HLAB 2WIIA 3LQZB 4QTHB 4M61B 1T20B 2IH1B 4DEPB 3SE9H 5HGDB 3IVKA 4N0YH 3MROA 5EUOE 1NIEA 2H6PA 4B0MM 4N6QA 4J8QA 2DWDB 3PG2A 4UZGA 2X4NB 4AQ8A 1JL8A 4Z7VE 2XIDA 2FL5B 1MW1A 1CF1A 4KO7A 3MRRA 4E9LA 3KZ8A 3WE1A 4NZ8A 5E4AA 2P8LA 4NFCA 1NBVL 1A3RL 4GRLA 3ZR5A 3QUMA 1PGRB 3ZUCA 1PG7X 1SHSA 4ZTPH 3L4CA 2ZWNA 4UTCA 5GZOC 4AK2A 5IJVB 3MRLA 12E8H 4R2GB 4CDGC 4FCAA 5DVMA 2X2UA 5KSBB 2ZX5A 5I1DB 3C9NB 4GKSA 3UROR 3NJGA 1LP9A 2N7SA 4PLKC 4I3SH 2WAHA 4J27A 4AH2A 3O4OB 5EO0A 1P53A 4HIEA 2FEJA 5D7LD 2FEDD 2QSQA 2VMDA 3D0VB 3AT0A 4OIFA 2IO5A 1NAML 5B7FA 2XNAB 4DGIH 1P4UA 1ZDSA 1YQVL 2BVUA 1ZV9A 4FXGA 1GGUA 2HLFD 3AZUA 1XXFC 5L4IA 4D0DB 4QRSB 4RH4A 5JPMB 1RHFA 4M3HA 1AZVA 4AYSA 1SJHA 3W0WE 2XIBA 4LQ1A 4Z7NB 3FQTA 1MN4A 4PWHA 2DMKA 3WJMB 3HFML 4NLHA 2ADFL 1ZLVH 3TPUB 1W80A 3NAAH 4NENB 1G5AA 1A25A 1IE5A 4S11A 3ABMB 3VQ1C 3R1GH 1NJ9A 4MDIB 3QUZA 2NYKA 3DURA 1MZYA 4GSDH 1TFHA 4LEBA 2NY5H 2CQVA 2DI7A 4U6YA 1FNGB 3ARFB 3L54A 2E7LA 3MV11 2OFQA 2X89D 1JRHH 2WQUA 3GSNB 1XGTB 3W57A 2QPUA 4KY1H 1HJBC 3B9AA 1YLBB 4DNLA 2IPKB 1DFBH 1RVFH 5F9JB 5IHLB 3U1PA 2PPAA 1I31A 3Q01A 4JPKL 4O2CA 3RTQB 3VWKC 2FQFA 3HAEA 1JNNH 2D7PA 3GXPA 2QADB 3DPDA 3MV7E 4R5XA 5LBVA 1IZJA 2AQTA 5DK2B 1JVOA 3D4CA 1YUHA 2OMZB 1QUNB 4EN3C 5L2KA 3WTXA 3FQUB 5IVZB 5KYYB 1QLEH 1BIIA 5F97E 3UDWC 4AENA 1X5FA 1I8LC 1TZOA 2A9MH 1F5WA 2WY3B 2FLBT 4QHMA 1OB0A 5HHNA 3A24A 3LS4H 5GS2D 3LRMA 2K8QA 4K3HA 2VXTL 5FM4A 4LF3B 2WYTA 2CBOA 4HWZB 4O5LL 1U30A 1PZ5A 3J27A 2OS7A 2YPLE 5C2BL 1O6VA 1SY6L 3RWGB 5IB3A 2X1QA 4X6CB 4X80L 4MNHB 3GS0A 3K4AA 4BFBD 1C08B 5BZDB 5CN2A 1QI3A 2VDLH 3BPCB 5DJZB 4IBTA 3MBWA 1ZV2A 1FVCB 4MJIB 1LP9E 1T1ZA 3LJ3A 1T03H 1G4MA 1RUML 2QHRH 5G2NA 3VRLE 3CSTA 2Y06L 3APNA 3P1VA 2IWEA 4L05A 1ZVNA 3T2OA 3AQXA 4EKJA 2NW2B 3F7LA 1H3WM 1JPGA 3NA4A 1X5YA 4IRJB 4RWYL 3B2UD 3ZE0F 1UQSA 2MCMA 1IC7H 3BVTA 4QRPE 2DWEB 1AGFB 1NKGA 3H0TB 3FSOA 3VG9C 4U1MA 3OJDA 1JZ5A 1NICA 2WXMA 1K4DB 2VR9A 3NACL 1KNOA 3N9GL 2AXGA 3BI9X 3GIVB 3F6IA 3STBA 1JFHA 3PJLA 1KFGA 3KPSB 4PR5B 2ICES 1E42A 1NUFA 1OAXL 3LPWA 1H19A 3VACA 2OSXA 2ZT9C 4PJIE 4R96A 1GTNA 2RJMA 2NY0C 2KL6A 1EX0A 1AGBA 2BZ7A 4ENED 4F57L 3ZK0A 5B8CA 2H3KA 1EZVY 4LP5A 5DUPL 4ELMB 4GNKB 1JXDA 2KI6A 1W0VB 3FYEB 4YIQB 1SHWA 4DWHA 2QKIA 1OSYA 1K3ZA 2ZF8A 4OB5L 5T5FA 3UC0L 3KLAB 4PY8I 4Z3GA 4E9WA 4AE0A 4FYQA 1GYUA 5CINH 2E7CA 1QBLL 2EIBA 5DRNB 3ARGB 3H85A 1LD9A 1BP3B 4QO1B 3ABZA 2X4TB 3V5KB 3NIDB 3GSQB 3C5ZA 3TONA 4BZ2H 4JY4A 4AE1A 5JYLA 3G6JA 4BGLA 3CFMA 4HG4J 4U7MA 4HUWA 3T8XB 2EO9A 3B9KC 2Z0UA 5F0LB 3HE7D 3WFHA 3OAZH 4V2CB 1DJWA 3PFUA 4PCYA 1HSBB 4HGWB 4GQ9L 3EOYG 2A6KA 3UTZA 3NABL 4RFOL 2NUTB 1LLAA 4YS4A 1XX9C 3BIBX 15C8L 1EVUA 2CDEA 5BZWB 2Y7SA 3V8OA 5HI4C 3MV7D 3WXWL 3BGMA 2F2HA 4HJ1A 1FRGH 5I30L 3L4TA 2AVGA 5GGQL 1FH5H 2LHAA 4I0PA 4EQ2A 2J4WH 4Y19B 5CGYD 5KANG 3LNDA 4MJHA 5SWQA 4CSTA 5GZNC 4KUCD 5I1LA 4OY9A 1T0PB 1UB6B 1WBXB 4EIBA 1KFAL 3T2NL 4GG6F 4O4YL 4U3SB 4G5ZL 4GRLD 3QDGE 4KVPA 5K9JH 1PKQE 4LVNC 2YPLD 5D5MF 2EO1A 3V4VH 1FCCA 3S5LB 4OVUA 2H5UA 4A6YB 1YYCA 2NPLX 4KZDL 4PTTB 3PQYE 1HYRC 1TYEB 3ILQD 3PNWA 3ZDXE 5BV7B 4I3GA 4EJ1C 2ILLA 1B4JH 3MV9A 3G5YB 4XN7A 5FO8A 3LKSA 1Q1PA 3MREA 4MYPA 4UNUA 4HA1A 2Q10A 2PCPA 2EC9U 4NNYB 2BWIA 3P4OA 3GXMA 5C0FB 5KBDA 4AJYV 2X88A 3RIAF 3NJJA 1LO0H 4KUZL 3TVMA 3P73A 3FO0L 4HLEA 3F05A 3FQWB 1ZEAL 2R15A 4BWUA 5TGBA 5IT2H 5JOEA 2V2WA 4HUUB 4J3OD 3QG7L 3AB0C 3BAKA 4Y2LA 3CG8A 1GOFA 1BD2A 1TQBB 3IGAA 1JPSH 2HP4A 5D7JA 3ZE2E 5KEZA 1FO0A 4WU5A 5I76A 3OHXB 1ACYL 1AANA 1Z9OA 4K2UH 2F53B 3EJQA 1UJ3B 2IXQB 5H35A 1F6AB 4NUJA 5DZAA 1A4KA 3QUZD 4P3DA 5EU7E 2YD3A 4G7RB 4G5AA 4P2YA 4KQ4L 1XR8B 1D7BA 2FZ3A 4PGBB 5G4MA 4AXWA 1QPXA 1NBVH 1A3RH 2JMRA 3MRJB 5DURD 1EZLA 5LBSL 3LH8A 1H0DA 1JPST 3D2UA 3HVDA 1B4TA 4C4BA 2NX5B 5ISZA 1NMBL 1HNYA 3ARUA 4LOVA 1BFVL 3L1OH 3GRWL 3Q8BA 3OKYA 3U7WH 4WTZG 4YFEA 3FO1A 3VFMB 1PZAA 4YDLC 5L0QC 4TVUA 5C09E 3SPVB 5L2KD 1XH2A 1TVHB 3FB8A 3LZPA 5M94B 4Y2OA 3UJIH 2QPEB 5IQMA 1UXLA 3IDJB 5EBWB 5KAQG 4JFEB 5KG9A 1W72B 4AZ8A 3EH2A 3BRGC 2I9TB 1VADA 4GB9A 3L2LA 4XMPL 3L3DB 3D05A 1AFVL 4WEBL 3T2PA 1ODUA 2FJFA 2XWDA 1LQSR 4XCNB 2Z1PA 4KDWA 3T3PE 3SPCA 4I88A 1QZ1A 4JCLA 4G72B 6PAZA 1Q9LA 1ZHBB 4R0LA 4JM2F 4FQIL 2CALA 5LO7A 1MUJA 2FK9A 3BP5B 3MRCB 4ZS6C 5EEXA 5LUMA 4X8CA 3S6CA 2YLKA 3QIWA 1W0WA 3VGEA 2ADFH 2B9AA 2J21A 3W82A 2NW3B 4DVRL 3T0EA 3SDXF 3ARYA 5FV1L 1KIQB 4RNRA 4YLCA 1BA9A 2W60A 4TLUA 4Z7OB 4JGNA 1DQKA 3MRFB 2CKBL 1NCBH 2ZUVA 5FOBA 3X14B 5HJBA 4UDTA 3H9HA 3PHQB 3M45A 1RK0B 2MOVA 2WXHA 4L3AA 3C09B 2F5AL 3ZMEA 3CQPA 1WUNT 1I7TA 4R26H 1BD2E 1P4LA 3N2JA 1KTLB 3F7YB 2ZSWA 2FJGA 4PJ6A 1HDMA 5INDA 2EH7H 4AEHH 3HBQA 1J5HA 1OGTA 1TMCB 1OP5K 2VSDA 1AHKA 2BXZA 3DX8A 2IWKA 4BZ1L 3X1EA 4NRXB 4RZCA 3MTXA 4Z77B 3L3IB 4F8QA 4UYPA 1GZHC 4PUBL 2W07B 3GRGA 2B59A 2HT2D 4APQA 1P84K 2N0KA 3HG1A 1O0VA 2J72A 3QNYB 4IOFC 1DE4B 1PD6A 5GRUL 2IEPA 3RUGA 1X4ZA 2QDVA 5JW3L 3QHFL 3F7RA 3TBSA 5JA8B 3EJYC 2R4SH 3IXTB 2CO1A 4LLDB 1HQ4B 3C5ZD 1V3JA 5E8DH 3MUGB 4TPRH 1N4XL 1SQMA 1J5IA 1L6ZA 3O2WL 5DD1L 1ASPA 1FUNA 5HJGA 5HGBB 4JEGB 3CFBA 4ZOBA 3BN3B 4MMXC 5IB4B 4MAYD 4Z8FL 5JIHA 4DGWC 5H94B 1L3NA 4N8VB 4KTEL 4WJ5A 4C4KO 1UT2A 3OPZL 1TT6A 4GY4A 4U1KB 1KEGL 3BD4A 3QQ9D 5IIEB 1QRNB 3L1EA 4K8RC 1F02I 4M93C 3FQYA 4HOXA 4KGLA 3T3ME 4Y8DC 1TQCB 2A9BA 4ZXBC 2J8OA 1R4XA 1TJXA 3EDFA 3WN6A 4I0PD 3S4SA 4R7XA 5IVXA 4YHPB 3N9GH 5D7SL 1C16A 2LLLA 2ZSVA 4IBZA 4PJGF 3JWOC 3VI3F 2A0LC 3MRDB 3QJZA 4M6OH 4NKIH 2DQDL 3BWAB 3IBEA 4ZO8A 5IR1B 3C60A 2AXHA 3VDBA 3SDAB 4XMKL 4JPQA 4CSSA 1A02N 1Y1DA 4OZIA 1RV6X 3G5ZB 1EAQA 1O9VA 4OGZA 4X9YA 4OJYA 4ODBD 1OPOA 2DM7A 1OQXA 3MRNA 3M88A 3H9SA 5EIIG 3EADA 4XP1L 2W8CA 5EZIL 3MV9D 2P24B 4HPHA 2CJUL 1G9HA 1QBLH 3LH2H 2EDRA 3CDGB 4P4RA 3W2DH 3KPLB 4F5CA 2WOYA 1KPUB 3FRPA 5T5NG 3KPRA 3VTAA 4OZFG 3AITA 1DDHB 3DOSB 4P9HC 1LQBC 1MQKL 2WVVA 2OYLA 3TVMD 4F24A 5MENB 4Q4EA 4WGKA 2ZKYA 3RKDC 4DUVA 3VXMB 2XRAL 3O2DA 3NRQA 5EU4B 3VA2C 3D30A 4KROC 2Q8AH 1KCBA 5F7MC 2Y7LA 1Z3RA 1KCVL 2WSPA 3EOTH 3PJSA 1DQJA 4F20A 3ZY7A 1IAMA 1BD2D 1DBAH 5DU7A 4LCIH 2K4AA 3V0DA 2IDUA 35C8L 5D7JD 1N64L 3WXWH 2E6QA 3ZHFA 5I30H 4P57A 7PCYA 3VM7A 1PYWB 5GGQH 1J8RA 3MRGB 1NOFA 2UX6A 5D7LB 3WFEH 1G1YA 1IIIA 2DQTL 1J0HA 2Z4QA 3DI2B 3WFZA 2Z7ZA 3UBXA 1LEIA 1CTNA 1CBVL 1CWVA 3W9DA 4AGMA 5AYQA 4CGUB 3T2NH 1S4IA 4Y89A 1XQ4A 2ZCLL 4M5TA 4TNWF 1VKXB 3WKYA 2C3WA 5JPNC 3L9YA 4UB0H 5I5IA 3PFQA 3D2UD 1KY7A 4BRJA 3KJ6L 5ISZD 1V7NL 3ARRA 5IMKA 4OCXL 2BVPA 1OGSA 1S9WA 3CXDH 1A2YB 2OMWB 1Z32X 4RA0C 2CE6A 4MD5A 1GXEA 3K0WA 2IDTA 3UC2A 4ANKA 3A47A 3F7QA 3GJFK 3UO1L 2XUWA 2EO7A 3QR0A 4UBDD 4XCFL 3V6ZA 1CGUA 5HVWA 2CZNA 5KSAA 2OA9A 5D93B 1K6QH 3WS3B 5B38A 4JPIB 4BSWA 1WC7A 5DS2A 4J28A 1U8MB 2X28A 5CLTA 2EDNA 2AJUH 3U36B 3P30L 4CW1A 1CLOL 3I9IA 2FWSA 5IB5B 1NCAL 5TQ0L 1QFUH 4OD1H 4L37B 3CC5B 5CZVL 4Z7UB 4PJ5B 3MJ9A 4JO1L 5LNGA 4GP8B 1WEJH 1MLCA 2Y7QA 4JRYA 5DJ8B 3H9SE 4KNTA 1G9NC 5HDQH 5JQ6L 4KXAA 4G7VL 3UZVA 3CLEL 3QIWD 3FF8A 3HRZC 1AQDB 4W4OC 5E5RB 5C0BA 1EAPA 4HPYH 5JQIB 2B15A 2WCPA 3QUGA 5K5YA 1S7WA 4LCVA 3T0ED 1C5DB 1JNJA 3BT0A 4MA7H 4DP5X 2HFEB 2WYZA 4PY8J 3VX1A 3DIFB 4W6YB 2L4OA 4YAQB 4KNUA 4ANWA 1LK2B 4N22A 2C9VA 2KKQA 3MRHA 5EUOB 1KELL 2A6DA 2W0LA 4JFYB 5LBSH 4DOHE 4GEIA 4JQVA 3S48A 3F2LA 3RKPA 3VFNA 2LFEA 4FMFA 2WO2B 5DUBA 4Z7VB 1IFGA 4FQXC 1UC6A 5KSUB 1IC1A 1FFRA 2GTZB 3GRWH 3HN5A 4RMRA 4U0RC 4OLVL 1MCOL 1J5OL 4QXWA 2PABA 3TNNA 3NTCL 2R4RH 4OZHE 5D9SA 2K6ZA 1FAKT 2B2XL 3V6BR 1ULVA 3PWNA 1YEFL 1LO4L 2OMVB 1KCRH 3A67L 1CR9H 2JKSA 1II4E 5J1AB 5HHVH 1MW3A 1AFVH 4JY6A 4APQD 5DLML 3VGAC 4BRVA 2KZKA 4K5PA 4PJEE 3RAJL 1JPFA 3RY5A 5C3IA 4YX2L 1U8HA 2XVBA 4PW3A 5D1XA 3B5GA 5DMKB 1OCRB 4HKBB 2JNZA 2BRQA 3LKNA 1TKWA 5C8JA 5BZXA 3KYMA 2QR0B 1F1AA 4YLBA 1K2DB 4NQCE 4OJDH 4YSAA 2VL4A 3QVAA 2WTRA 4E5XG 4NCC2 3UADA 2EYTA 2G75A 1G7IA 2ZIDA 4LSUL 2D7QA 1KXVC 4OJAA 3ROLA 3W0WB 5HHQA 1UD2A 1UJTA 1KBKA 4HQQL 5BRZA 1IFRA 3K72A 3KVQA 5AW7B 5LAPA 4K3DL 4UF7C 1A3QA 4MAZA 4XPGH 3LPPA 4KKAC 4YBQD 4CGTA 1CE1L 1GSKA 3EO1A 3VI4F 5K9KA 1UZ6F 3DX3A 5LGHL 1CXKA 4AQZA 2CKBH 3VJ6B 1QI4A 4XP9L 2DIEA 5GS1C 5LCVL 3BKCL 3P0VH 2XETA 3F12B 3QXAA 4YHZL 3ES6B 3S3PA 2CO6B 2F5AH 5AVYB 3PP3H 5FEBA 4NUQA 1ONQB 4HS3A 3BN9C 3C60D 3E80A 4LHUG 2WKGA 5C0BE 5T3ZL 1D9KC 5CR1A 3KDMA 2CPCA 1UCTA 4X5WA 3RVUC 2MQ0A 1V3MA 4OLXL 1CGVA 4DZBB 3O6FB 4BZ1H 4DGYL 2R0KH 2WIIB 2LU3A 3IDYC 1PW3A 1RIHL 3UPAA 3QI9C 3H9SD 3H42H 3MV7B 2NY6B 3CDFA 3NJLA 1XFPA 4OSUH 5C08A 5JMRA 1MRFH 5F89A 4Z3IA 3CHRA 2R8SH 4N8CH 4OBSA 2XVLA 4F2EA 3GZQA 3KPRD 4B9IA 1CXHA 3CVCA 3T0AA 3O45A 2I69A 1ZANL 2X4PA 2EKSB 4NNPH 4U7KA 4X99A 4Z7WF 3VQLA 1I3UA 2DKUA 3MJWA 1JP5A 3MO1B 3OB0H 4XNAA 4CMHC 2P8LB 1UWGL 4GRLB 3KR3L 4TN9A 1JK9A 1MNUL 5D7KD 2YPLB 3RPBA 5HJDA 4C83B 4Z8FH 1DANU 3OL2A 3MRLB 4PAZA 4ZMLA 1CURA 3TNMA 1MW0A 2NR6A 4GKSB 1R6VA 4XBGB 1SFHA 1LP9B 5T3XE 4WAFA 2ICEA 3O9WA 4YZFF 3LB6D 5IQOA 4EIGB 4DZ8B 1WZLA 1RFDL 3ATFA 2EXSA 5FGBA 3L16A 5M95B 4HIEB 2XSKA 4O58L 2J20A 2VDNH 2ARJQ 4TSBL 1TSRA 4Z7IA 3GKWL 3NJVA 2X10A 3RIFK 2YBGA 4HDIB 2YA2A 4PQXA 4QRPB 3VXUA 5I1HH 1BXUA 4ONGL 1CXLA 2COVD 1BBJA 4X7TA 3CSPA 4N0CD 3SDCB 2EVIA 1I9IH 4QOKA 4AYGA 1DL7L 1H5BC 4KH9A 1SJHB 3ZKNC 1PCSA 1BOYA 1KIUB 1XGUA 1ZDQA 1UA6H 3NDZE 2NRDA 3LRLA 4OGAC 1RI8A 1WV7T 4ZOEA 4ZD3H 4XWOD 3GXIA 3MNWA 3Q3GB 4JHWH 3NK3A 4PJIB 1QHPA 4M03A 2ATAA 1KXQA 1UOWA 3NBNA 2GJ6A 5KBLA 1T66C 1U6AL 4PYHA 2CJUH 4DO4A 3WE6A 4DVBA 4JK0D 3F64A 3WEXA 3MNZA 3RDTC 4ELKA 5TDNA 3DURB 3QJQB 3QEQE 2A9NL 4PREA 4KK5D 3QJXA 1MQKH 2R2BA 5KSAD 4M4PA 1UM5L 3E2HB 4RLDA 1TJGH 3B7RL 4RA3A 5F7DA 1C12A 1QLFA 3EXLA 2XJKA 5I19H 3HZMA 4JX0A 3I85A 2XRAH 3F7PC 3QHTC 2X0VA 4ZFGH 5C07A 4FLRA 1H9DA 5L8KB 1J18A 1Q9WA 4F58L 3TM6A 3QZWG 1S9VA 1YEIL 1BAFH 4N2HA 1VA9A 2CR3A 2ENYA 1EHAA 3ZSTA 4GP4B 4JRYD 4LSSL 3GBML 4EVNA 5IFHL 4HW6A 4BA8A 5J6GA 4ZMOA 4M43L 2PF6A 3QUXC 5C0BD 3ULVH 1BIIB 4KTDL 3KCWA 4XNZB 1OSEA 4LSTH 2E7DA 2NT1A 4YPJA 1EXGA 2ZXCA 2DQTH 5EA0H 5JZ7C 3E3QE 2ENPA 1XBDA 2E56A 1ZLSH 5A3ID 4BEIA 3IN0A 4MSWA 3H9YA 2VOTA 2MCG1 1M57B 2XICA 1N5YH 1VFAA 1IKNC 3CVIL 1EZUA 4YZWA 2IADB 3NCMA 4AC4A 3BQVA 2PYEE 5FDYA 2JKJA 1U8KA 3MZTA 2HKFL 1T1ZB 3IT8D 3KJ6H 3LCYA 4G6AC 4G1MB 2R0WL 2UZIL 3V4PH 1V7NH 3CX5J 3FUEA 3QG6A 1YJDH 1XF4A 4ZK8A 2G3XA 3K6DA 2H2SD 3QDGB 5GJTL 1PKQB 1N6VA 2RALA 5CKGA 5CZRA 4K3EL 1OO2A 3G04A 3UO1H 1UB5B 3FUMA 3T08A 3U2IA 1N2RB 1UQSB 2GK2A 4J3BA 3PQYB 4G83A 3VXUE 3ZDXB 5CJXC 2C9AA 3OMNB 3CHQA 5HGHB 2IGLA 4Z23A 2XWXA 3BWSA 1EUTA 2ADYA 3DUHA 4JQIA 5TQ0H 3JSSA 4YNYA 3EHBC 2CDGB 1S7TA 5DMGD 3VGHA 1KBPA 5D1XD 5AZEL 3CXHK 4R90H 4BCYA 1KDIA 4JO1H 3EOAA 1KT2A 2GFBB 1E9OA 1B0WA 1JZEA 3FFCA 2R7EA 2I24N 3ZYOA 4G7VH 3CFCL 3CLEH 3KYKL 4PP1D 3NRPA 1UG9A 3SO3C 1LDSA 2AZUA 4MZ2A 1U8JA 2JCWA 1COBA 4MA3A 5JOPD 1G6RA 5BRZD 2X1XR 2QKIB 3GM8A 3IJHA 5D2LE 5MP6L 4DN3H 3PY9A 4ONHA 4LPCA 3ZE2B 4OI9A 1W0YT 1H8LA 5LNDA 1MKFA 3U0WL 1IAKB 1KELH 1LD9B 3LZFL 4N2BA 2K7QA 4P2RA 4L3CA 3C5ZB 1U42A 4HIHA 3IJ8A 1ZLWK 4JY4B 4PG9A 2Q86A 2CCWA 2OSLA 3UAAA 4YK4C 1NPNA 2ZAGA 1MF2L 3HC0B 4JFFA 4MAYB 3WFHB 4NQVA 1MCOH 3L9RB 4KO5A 3V6OA 3FTUA 1J5OH 1WZMA 4Y4HC 2FBJL 1FLRH 4JG0L 2G5BB 3MKGA 2C3HA 3ZX1A 3DHMA 3A67H 5KVDL 3BMVA 5DGRA 3LKQA 5C09B 5DC9B 5C08D 1MXGA 2IIJA 2XWJA 3E6HB 4I0PB 2AXFB 1OB1B 4KXZI 4OFIA 2AQQA 4FKEA 4Q58C 5AB1A 3BAWA 4AYID 5IHWA 4M6NL 2VZSA 3GWJA 3B6SA 1Q94A 1NCDL 3L4WA 5FUOH 3FB6B 4NQDE 1HK6A 3NIGE 1FBIH 2HJLB 4U3CA 4B3EA 5T1DL 4IS6B 4YSQA 4FGMA 5CSZA 3DGCR 2UUDH 3NJKA 3T3PB 3QS2A 2LABA 4N2EA 5EC2A 2AK1L 1J0ZA 4LLWA 3O6KL 5DUJA 1UT1A 4P5KB 5FR3A 5DMIL 1JZ8A 2NR6D 4PMEA 3FT3A 1IKFL 4Z1PA 2P8MB 3O9WD 3RRQA 2H1XA 3LKSB 3FN3A 1CE1H 2QSTA 2AERT 2BP8A 2PCPB 2FO4A 4WHDA 4U6VL 3BKCH 3US1A 3P4OB 1XAUA 4PRDA 1FPTL 5H37H 3JTSA 5ESQA 1BMZA 2AANA 5DHXB 1GZQB 4MB3A 1L5GB 3TVMB 2WKOF 3VXUD 3GMLA 2W0KA 3LSOA 4PJAA 1S9YA 1N18A 2EYRB 1PNDA 1WA2X 2V2WB 4QOKD 4TLSA 1UH2A 4GRWF 4OLXH 2A5UA 1IGJA 2CBMA 2QBWA 5B7EA 3UBGA 1BD2B 3QBTB 2B9BA 3IGAB 1HHGB 1PY0A 2GTWA 2HKAA 3F3HA 3B4NA 4LCCC 1AXIB 1G43A 3HRPA 3HS0C 5CBAB 1LWHA 2GJ6D 3CZUB 5ERWB 4BZ2A 2XY2A 2ZYSA 5ACZB 3QIBA 2JKTM 2XT1B 1HZHH 5T33H 5H35B 2WIMA 3KM2A 1ERNA 4JO4H 5CIPA 2EKJA 4MLIA 4X6DE 3MBEC 1A7PH 2GIYA 3OC8A 1D5MB 2MQGA 3U0PA 3V0GA 1EBPA 1KSRA 3FONA 1NLDH 4AXWB 5EZJA 5F6HI 2Q7YA 3KR3H 5C07D 4N9OB 4TMPA 1N12A 1MSPA 1ED3A 3T8MA 3VWKB 3RWHB 3FAXA 5L4MA 2W9EH 5AWNH 2Y6SC 2X6MA 3D2UB 1A1MA 2N56A 4K7PL 4LB8A 4OF5A 3II3A 3IDUA 5D8JL 3VFUA 1MI5A 4BQCA 3APCA 3WNMA 2W0FA 1BQUA 2DJMA 2CR6A 5DYOA 3ZT7A 1K8IB 4MS8C 3BVDB 4JCWA 4KRNA 2A83A 4XN1A 4Y2OB 1YEGH 3V7MA 1EPFA 3GQFA 5C92A 3Q48A 4L1HA 4O58H 1N8ZA 4EF3A 1XGRA 2Y22A 4FXGC 4WI9A 1JZDC 2VR8A 5I8OH 3T4YA 5AAWC 1OAZL 2ZCKL 1R3KB 3MCKB 5E2VH 1BF2A 1KGUA 3TCXA 1TF4A 4UQCA 3T3MB 2B5IC 4ONGH 4J3OC 3PP4L 2QQKH 3C6EA 5J8OA 4PJFF 4OR1A 5MERA 3WUZA 4F7CB 1E4XL 1U93B 4XZUA 4QRTB 1BZ7A 2EH8H 2AITA 5GPRA 4TRPL 4HGKC 3JVGA 4B7IA 4YO0A 5GXBB 3ARBC 5D7EA 4GRWH 4B9YA 1F6FB 1MFCH 3O8XC 3ASOB 5DJ0B 2D3VA 5E8EB 1U3ZA 4CMMB 2P5PA 1U6AH 5FLUA 1U2HA 5EUKA 1U36A 1D5IL 4HJGB 4C47A 5HYQA 2UVEA 1XZ0A 1FL3A 4MCZA 4JVUA 1DN0A 3SPIA 3QE5A 3B56A 5LVEA 5IQNA 1KCSH 3KEDA 2LFGA 4JLRA 4PJAE 5FYLL 1Z7JA 2XQBH 2VLLA 1UACL 1O5DT 5FOBB 1LK3L 4NO2A 3NN8B 5HI3C 4RRPG 3DK0A 5H4YA 3T04D 3QH3B 4CL7A 4WHTB 2XN9E 3EJZC 2YPKB 4XCYA 1E67A 1KB3A 1YEIH 3F58H 4LGPB 2ZSWB 4BK4A 4YBLB 1EGJH 3GBMH 4FFWD 5DEFA 2XTJE 2Q0ZX 1NEZA 4D0BB 2YD9A 1A4AA 1TJIH 4JFOB 1OGTB 4FYSA 1LWRA 2JB5L 3NCEB 2RGSA 3FT1A 3FUFA 2YJQA 3MOBL 4JQXA 4L8SC 3S2AA 4Y1AA 1MFVA 4X4ME 1TETH 5F21B 3LXAA 2QJDA 1F8TL 4OM0L 5FYJL 1ZXQA 3ARPA 1OF2A 2W92A 4APQB 4TVPE 1NLBH 3B3IA 1U91A 1E27B 2Z9TA 3DROB 2B39A 3LIZL 4I1NB 2CM6A 4P2RD 3PHAA 3P3TA 4NBYB 4CN4A 3B9KB 5FFGA 4PP2A 3FZUC 4QF1B 4XMUA 2XA3A 4NPKA 5DD3L 2VDRB 1MJUH 1VFBA 3RY6A 2UZIH 3GLZA 5LJYH 1L0PA 2NXZD 3QJTB 1HL9A 4JFFD 2ED6A 3ARVA 4PI2A 3T4AB 5I16B 2ZKHL 4L4VA 5GJTH 3WD5L 2Q6WA 4R4FL 5E23A 4WJ5B 2UZXB 3WIHL 3DDGA 3EJPA 3EYOA 2NT0A 4F7TA 3OGCA 5JOFB 4OCWH 1QEXA 1HHHA 1BIHA 2OP4L 3NSDA 4ZNCD 2FWOA 4R5TA 4FABH 4L2YA 2FX8L 2DEXX 3TZVC 3S4SB 4XCEA 3AQYA 3O4LE 1KPVA 4ZDHA 1J9TA 1FC1A 1ODAA 2DMGA 1C16B 3AG4B 1S7XA 4OFYA 4IBLT 1IM9A 3S3BB 1PX8A 1EA9C 2BY2A 2NY4C 4F7PB 4RAHA 4WI4A 4BFFA 3CFTA 4LVNB 4NO0B 4BINA 2DIBA 2VXUL 4JO5A 4FFVD 5AW3B 3OWRA 1T5WA 3KYKH 3L7EA 1S78C 4RISH 1ND0B 5ESAA 1TMQA 2EXYC 2ITDB 2Z8WC 4TUKH 3WFCH 5F3HB 4HMEA 4X7DC 4Z76A 2J55A 5CILL 5MERB 4H1LB 4K5NA 4IBWA 1YEKL 2B7DT 3FL7A 3H9SB 3RPKA 1UXMA 5MP6H 5MEOA 4L5FE 1JTPA 1VZHA 5J12B 2R56H 3D87B 3G5WA 3K6NA 1E9PA 1GOGA 2XXFA 5C97A 2IPTL 2ATPA 2MMXA 4JFPA 3L17A 4N1EA 1MLBB 1A65A 4AM0A 2YZ8A 3IDXL 4OH2A 3UAJC 2XQ0A 1YMHA 2OYMA 4PRNA 4LP4A 1JGVL 5DZLA 3HUJE 3LPGA 4M7JL 2QGBA 1MF2H 2WXRA 2DQHL 4HJJL 1O6SB 5I6MA 3U4BL 4DPBX 2W38A 4C55A 2M83A 3AB0B 4MXWH 4IHOB 4DOHB 3QXWA 5I5JA 5TH2A 1I82A 2BS9A 2IMNA 2IPUK 4FJYA 3UTSA 4X9GA 4ZMAT 4YDMA 1EEZA 3QXVA 2P26A 4PS8A 2G9HA 1MFNA 1GA2A 2XTJD 1BVKA 3P9LB 2WZ5A 3DETD 4WNJA 5HYFA 2AEPL 3EZJB 3HG0A 4R7NA 3QIBD 1L9SA 4OZHB 5I1AA 1VCBC 5BVPH 3C87A 3QO1A 3NDYE 2OMUA 2GEQA 2YR3A 5F7KC 1LEIB 2WHVA 2E9BA 4J1UB 3P02A 3AWFA 1XGYH 2I85A 3NJMA 2CO7A 4LSVL 2ZOOA 2WINB 1JF1B 3ZKSD 5FHBL 1DQDH 5E1HB 4UQ3B 3B2MA 4PJEB 4BKSC 4EIZC 3DNKA 3EDKA 3Q1SL 1MJ8L 2IOIA 4Z95H 3F6LA 2ZJSL 3O0RL 3IMRA 4FQJL 3O6KH 1RURL 2GC7C 4WK4B 1MI5D 5GIRA 5DRWA 5IMKB 5DD6A 4NQCB 2BVPB 1S9WB 1TVBB 3G3LA 3IXAA 3HC3H 1WA0X 1A6UL 1N59B 5HDWA 1E30A 1JGLH 4KOBA 1A6TA 1RHHB 3L3KB 2L04A 3MRPA 3PV6B 5E9AA 3V6ZB 1EVTC 5KSAB 1FPTH 3BKYH 4LLYA 3LRKA 4FFZA 3KLDA 2YS4A 2WAQA 4HEPA 3VDAA 4ZMXA 4ZUWA 4UZUA 4FQ1L 4IW4C 5CEZL 4CW1B 1FNLA 1IBYA 2K9UA 4MDRA 1MHEB 4NKMA 3OMIB 2YUVA 3MXWL 4QHNA 1P7BA 1CG9B 3P11L 5FXCH 1FZOA 1THCA 1BQHA 3VGGA 1WAAA 4N2DA 1IGTA 4NKOA 3NSJA 3UZVB 5C0BB 1EAPB 4BKLA 5IJKA 2VR3A 3P0YL 2C3VA 3BPNC 1RZJL 3R4RA 3DX4A 1S7WB 4GUPA 4J2QA 2IGFH 4KKLD 1S3RA 2O6CA 5EH1A 2I5YL 3LRHA 3LPOA 1KTKE 1A66A 1BEYL 3RJDA 3QZBA 2JIXD 2X05A 3RX5A 4PS7A 1OD7A 2E9WA 3GBEA 1ITBB 4PY7B 2FH8A 3MRHB 1E6JH 2DZEA 1WVZA 2XPGA 3HZVA 4PU2A 1QTPA 4ZSOA 2BIMA 4XBMA 3VFNB 1QBAA 3AREC 2HLEB 2RCSL 3GZPA 3QB7C 3N41B 3QRLA 4GQPH 4F7EA 3O6LH 1FZKA 1MWAL 3TNNB 3Q06A 1NBYA 5D9SB 3L3OB 1KIPB 4IBYA 1AYOA 1OGPA 4X5RA 3OD3A 4NQEA 4Y1AD 5DEJA 5SV4A