4IBUA

Human p53 core domain with hot spot mutation r273c and second-site suppressor mutation t284r in sequence-specific complex with dna
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
197
structure length
197
Chain Sequence
b'SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVCVCACPGRDRRREEENLRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
molecule tags Dna binding protein/dna
source organism Homo sapiens
publication title Structural studies of p53 inactivation by DNA-contact mutations and its rescue by suppressor mutations via alternative protein-DNA interactions.
pubmed doi rcsb
total genus 51
structure length 197
sequence length 197
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ibuA00
1TUPA 2YBGA 5BUAA 4L0ZA 1EAOA 4IBWA 1GZHC 5G4NA 4GUOA 3D07A 2J1YA 5AOKA 3D09A 5ECGA 1HU8A 4QO1B 2X0VA 2J1WA 4IBQA 3Q01A 4KVPA 1CMOA 3WU1A 4L18A 2J1ZA 3WTWA 3KZ8A 1YCSA 1E50A 2XWCA 3WTXA 4AGMA 4GUQA 4MZIA 5AOJA 4IBZA 4AGQA 3D08A 5AB9A 4IBTA 4IBYA 3TS8A 4IBSA 3Q05A 3IGLA 5G4OA 3D0AA 2AC0A 1EAQA 5AOLA 2XWRA 4G83A 3D05A 3US0A 4XR8C 3QYNA 1H9DA 3WTUA 2FEJA 2H1LM 3US1A 2X0UA 5AOIA 2BIOA 1GZHA 3KMDA 1KZYA 1LJMA 3QYMA 1T4WA 3WTSA 4MZRA 2RMNA 4IJTA 2X0WA 1EANA 2IOOA 3VD0A 4G82A 3EXJA 2J21A 2AHIA 3ZMEA 2PCXA 5LGYA 3WTYA 4IBVA 1HJCA 5G4MA 4LO9A 2J20A 5ABAA 1CO1A 4LOFA 1UOLA 2IOMA 2BIQA 4A63A 1IO4C 2ATAA 2MEJB 3IGKA 2P52A 4AGLA 3EXLA 4AGOA 4LOEA 5AOMA 2J6WA 4AGPA 3WTVA 2GEQA 1TSRA 2BIPA 4IBUA 4AGNA 3WTTA 5LAPA 2J1XA 2ADYA 2BIMA 5A7BA 1HJBC 2BINA 2WGXA 5KBDA 3Q06A 2IOIA 2VUKA 4L0YA 3VD2A 4HJEA 3VD1A 2OCJA 3D06A
chains in the Genus database with same CATH superfamily
4BCZA 2CNZA 4L4VE 3TYFA 5C9JB 3VA2C 4QRFA 5TDOA 2YPLB 4UQ3B 4WNJA 3L3KB 5DRZA 3UTTB 4PG9B 2B2XL 3N43F 3S36L 2NX5D 3NTCH 5J6SA 1MKFA 2XQ0A 2IFFL 4DH2A 4JJOA 5AB0A 5C09E 3MJ7B 1KTDB 1GIGH 1GYAA 3EO0B 2EACA 2ZXWB 3L2LA 4KH2A 5JHDE 4RAUA 2D9QB 4XX1E 3SDXB 5EUKB 3V0EA 3QZMA 2W81C 2KZWA 3L4TA 4NKDB 1X7QB 4PGZA 4K3HA 4GUQA 3L48A 3SDCA 1OGPA 3NCXA 4OCYL 5CLXA 3TVMB 5IOKA 2ITCA 1GJIA 4FE9A 4JZNB 1A7BA 5IB5A 1DJIA 3VFTA 2X38A 2P48B 1SXSA 4WCYL 3BSGA 4KKCD 5L8LB 1MLBA 2FO1A 4XC1H 5AWNL 3UROR 1S9WA 1OAUH 3ARBA 3KPLA 4DZ8A 2ETWA 1ORSA 4X4KA 4OFVA 2F9BT 4NUJB 2P5EB 3QZBA 4H0LC 1SFHA 4LLDB 4PP2A 2EDEA 5FOBB 2HN7A 3KJ6L 1ASPA 3CZLA 4ZUUB 3N9GL 2R0LL 3WLWD 5LXVA 4LLWA 3WY2A 4KVNH 1HFUA 2OI9B 1I8MA 5KVDE 1R33A 1YNTA 3UTPD 4CILA 2DQCH 1YPZA 2UVEA 2ARWA 5LCVA 3TASA 1F00I 4JZJA 3IFNL 4JHAH 3PNRB 4EI5A 5F7KC 3WJJC 1BBJB 1C1EH 3DX2A 3EJQA 2W0FA 3AM8A 4FFWC 5D2NC 2X05A 1RJLB 3WFBH 4AUYA 2IPTL 4F7KA 4AUUA 3HS8A 5BXFB 2OL3A 3FRPA 4U1SA 2X4TA 1EEZA 1H6UA 3RAJH 1LK3H 4QRRB 3VQLA 2AVFA 1B2YA 2V5SA 4AYBA 3W56A 1U91A 4YDMA 3QJHB 2FHCA 3MV9E 3WFCL 5CLYA 3KPRA 4YXKH 1MPAL 1I31A 1U8KA 3GF8A 3GI9H 3LB6C 3OKLB 1OAQH 2EO7A 1CDCA 2BPBA 3HS9A 5AOZA 5I71B 5J8OA 2PYEB 1BVLB 4JUTA 4PD4J 5KVEH 1AIFB 4XMPH 4ZFQA 3SYCA 3FB5B 4QJ4B 2WWMD 4AKPA 4M1GL 4ZX6A 4OZIE 4DGVH 2FL5B 3B8SA 4YDIL 4PU2A 5L7XL 3QS2A 1G4MA 3QUKA 1AZRA 1JBJA 1LNUA 4QXGH 4ANUA 4PJGE 3P4LA 2BIMA 2NOYA 1NFDF 3PNWA 4HHAA 1C5CH 5IHWA 4WI7A 3SE6A 1RU9H 4ODHL 1JK9B 1QVOA 4OFDA 2VLKE 2EE0A 2XVKA 4FADA 5ETUB 4HLEA 2KUTA 2ED6A 3F01A 4KI5D 1KBGL 4PTUA 4M7LL 5TF1H 1PLGL 4PHZA 3FYIB 1LO5A 4LEOB 3EFFA 3WXWH 4NDMB 1KIQA 2NNFA 3D9AH 5IQ9A 4NI3A 1WZLA 3ZX1A 4ZQKB 3FT2A 3GSXB 1MVFA 4HEME 3VDBA 2F5BH 3IJ8A 1Q72L 2YPLE 4OLXL 3S2AA 1CDBA 4BZ2L 2FYYA 3WELA 2OMXB 2CBQA 3LN4B 4IOIA 1ZOXA 3WIHH 4HX1A 3HI1B 4JFHE 4XBPB 1C16A 5E8EB 3NIDE 5CEXA 5D1ZB 4ZMPA 3TT1H 3CSYB 4QWWC 4N85A 4OIIL 2I27N 1BWWA 2EH8L 2DTSA 3SDXE 4NS0A 5IQ9B 4XPGH 3DBXB 5D71L 4W6WB 3TJEL 2PCFB 4Y2DD 5B4MD 5DA0B 3QZNA 2XTLA 3HAEH 3HE6B 3QQ3A 5AW7B 1KXTA 3GM0A 1IVLA 4YLQT 1NC2B 1KLFA 3TEUA 2CM5A 4WHYG 3VI4E 1KYFA 1QQDA 4DSYA 3MGOB 4Y2DB 4LDOB 2LAAA 4UT7L 5INDB 3BD3A 1AR1D 3O3EB 3GSNA 1LO4L 1ZVSA 5HGDA 1H3UA 2F08A 4ONGH 1LNUB 3RHWF 1MCKA 1QG3A 1XB3A 4V33A 4WHYH 5AQ0A 2CSPA 4DN3L 5D72H 2FL5A 3G7TA 3UTOA 1Z0MA 3ZTEA 2X1QA 1OF0A 3LD8C 3IXTA 3HMXA 1GGTA 2FH8A 1JTOA 1KYOJ 2NNAB 4MMXB 4NZUL 4A2LA 3UZEA 1T7VA 2B08A 4FL4B 2NXZC 1DBML 3PPSA 3ZDYE 4C83A 4F8TA 4J27A 2Z35B 4XNUH 2UXGA 4MMXC 4I0PC 4I87A 5HGHA 2E7CA 3L8QA 1U0QA 2OR9L 2H3NB 3CHQA 1OXYA 2YD8A 43C9B 4YGAB 5I8EB 1X5AA 2CIKA 5F7UA 3ZMEA 2X4TB 4P5TC 1N26A 5CCHE 2EYTA 5DFVD 4WI9A 3HZ3A 2XWZA 1JL8A 4E9SA 1H3WM 1DLFL 4XXWA 4EDWH 1REIA 1Y0LB 4TRPH 4Z78A 4YLBA 3RIAK 3BX7C 3TBVA 3MC0A 1P84J 2M8XA 1NMAH 2X7LA 1PVHA 1GS6X 4N2IA 4KU1A 2RCSH 4XMLH 3F65A 1XD1A 4J2QA 3UCRA 1J1XH 5H37G 2Y2WA 3BH9B 1BDYA 4RGND 3SGDI 5IJVB 3AABA 1CVRA 2IPUG 3K72A 2D7TL 1F2QA 3U30B 1S7VA 1YEIL 2CIKB 1GYVA 1VEOA 2OSYA 2PYEE 1KCKA 5F1KC 1BF5A 4LMQI 5KS9E 2VQ1B 2G2RB 4PM1A 3QXAA 2NCMA 4PP2B 4NUGH 3VM7A 1UH2A 4X0KA 1ZGLB 4TUJA 4U3SA 1ORSB 4RMBA 3X11A 3OJMB 4WEMB 4PJGB 3QYCA 4YGVA 3K6IA 2AAVA 1HXKA 5H35B 3JWNE 3U6RB 4TLSA 3V4VL 3Q9QA 2MPVA 4QXUL 1AY1L 3RVUD 1DANU 3OG4B 2X4UA 4Y4FC 5AOKA 3MRKB 4ODBD 4F1SA 5DK0B 5EUKA 4ZD3H 1TFHA 1ZDSA 2K7QA 4F7PB 5JHMA 2DYPB 1SYVB 1UYWL 4YEFA 3V0HA 3Q2WA 1INDH 4HJJL 5TH2A 1DVSA 2VW7A 3R0MA 2JXMB 2VXTH 3QCTH 1HXYB 4ZOAA 1LO2L 1WP6A 5LQBL 3ARGC 3RU8L 1QFPA 3L3KA 1A1OA 2D7MA 3DUSB 4UNIA 4LSPH 3T0EC 1RSFA 1H5BC 1XEUA 1DL7L 1VRSA 2MQ0A 1DEEB 3ELQA 4CVWA 1I82A 4YHPA 3TF4A 1CE1L 1NGQH 2IH8A 4HBCL 3WKPA 1SXBA 5H37A 2XI9A 3A6CL 4JFDB 1KIPA 1T3FB 3BSHA 1QW9A 5KVGL 5J9PB 3MLTB 5GRUL 5HGBB 5FECA 2LTQB 3LRSA 1PFCA 2BY1A 5KSAD 4V1DB 3Q6FB 2PKDA 5F9AC 3GMNA 2F5AH 3PWLB 4AMWA 3U9UA 3BGMA 1JIBA 2P28B 1BJ1J 4XNYH 3PP4H 1T21B 1CZ8H 2XV2A 2EECA 4MZ2A 4UOZA 1CTNA 4CNIB 1CFNA 4Q9QH 1O75A 4RWYH 3KPQB 2GJPA 4HWZA 1KCLA 4ZODA 3ABMB 4H25B 8FABA 3T8XA 1JNHA 5I1EL 5I71C 4NZRH 2WZ5A 5EOCH 1MW1A 1OKEA 1UZ8B 4POZD 3GI8L 4LHUG 3QJFB 3RPBA 3V0DA 4KAQH 3Q0HA 3T0VA 3O2DH 2QQNH 4KNUA 5J1AA 1N12A 1G6VK 1TQCB 4OVUA 4B9JA 2V3FA 3MV9D 1J5OH 1FVDB 1RKRA 2V5MA 2NNRA 2VIRA 4NWUH 1TSRA 2CLRB 5IIEA 3CDYA 3D7PA 2WWKT 3QBTB 5CXPA 2XA3A 1HQ4A 4IRZL 5AZUA 5C09B 3RY6A 1I3VA 5JW5A 3RA7L 4MHHG 3GWJA 1S7QB 2B0SH 3O4LB 3IB4A 4WF7A 3I6LE 1XGRB 3C09B 4NYLB 5CN2A 1KCUH 3FU8A 2PWEA 1IBYA 5IB4B 1P4IL 4HJ1A 3B2VH 2WLKA 4ZUUA 1MFAL 2IGFH 1MCLA 5AYUL 4GBXA 4QHMA 4RMWA 3RDJA 1WIOA 5DD3L 2VYRE 1B0GA 3TU6A 4KO7A 4F2ME 4YHIA 1SLUA 3V4PB 4OGXL 2DLFL 3L95B 1CDHA 2ZX6A 5JXEC 4M5YH 1HWWA 2DH3A 2XRAL 3MA7B 3DOSA 3FO1A 3NCJL 2I85A 4GMSH 3L1OL 1EFXA 2OX5B 3BWAB 1F5WA 4PRNA 1TT6A 3CVHB 7FABL 5E6RB 1RUML 2WXFA 3NIFB 2CPCA 4XI5D 1MUJB 5JOFA 5FO7A 3LKOB 1CXLA 3EYVA 3L54A 5EZJB 3TN0C 3S7GA 1U3HD 3K0WA 5KANI 4FRWA 2FEEI 2VWEC 1BAFL 2MTPA 4OZIB 1NBYB 2X4OB 3W39A 3K71B 1QPKA 5BW7A 1MHHA 3ZPDA 2RAMA 4IIQA 3EH5B 5H4ZA 4MX7A 4EUPA 5HGGS 2WAHA 1D6VL 1O9VA 2XT1B 4EO5A 4O5LL 1G9NH 4JPVL 5DMKB 3CZEA 3OV6A 2B77A 5C9JA 1PX8A 5IMMA 1TJXA 2I7SA 1MF2H 2MQ3A 3IDNA 3L95A 4KKAC 3W9EA 5I6XB 4TUJB 4U3SB 3O9WA 4JFFE 1MCPH 1FBIH 1MREL 4V1DE 1QASA 2OJZL 1EZVX 1RUPL 3BP4A 3F83A 4Z9KB 1N8ZB 3K6DA 4M7LT 1P4BL 4KO5A 3WAKA 2APBA 3UX9B 4YSSA 3BYYA 2ZUWA 1I8LA 3EXJA 3VSQA 2J8UF 2EDFA 1OB1A 4R3SB 2GJZB 3AT9A 1CGXA 5LBVA 1X5HA 3LEXB 4CU8A 3EDFA 1JZ3A 1RHHB 2YD4A 5GHWL 3MRNB 3GMPB 3UDWC 3KPOA 5KEZA 1JPTL 5JHDB 3HZVA 5EU5A 4C47A 1W0WA 3D69B 2EDNA 4MAZA 4GW1B 2AK4A 4Y8DC 5B38A 3Q9PA 1TXKA 2QDWA 2OSLA 4HT1L 3MX0B 1O9ZA 3KLAB 4N6QA 1EWHA 3DK2A 5T3XH 1WBZB 1NIAA 2R51A 5GS3A 1C1EL 4GAJL 4HFWB 4AK1A 3FTUA 1IKFL 1BQKA 5GGSA 2QQNL 4PI2A 4K3JH 2ZYSA 2C3VB 3BI9X 2EVJA 1OP9A 1N68A 2VT0A 5A2IH 1XIWD 1RUKL 2WOBA 3ARTA 4CKQA 5D9SA 5BS0B 4HFUH 5AKSA 4PJ5A 3RWDA 4NP4L 1NAKL 3IU4L 1S7TB 3HMWH 4FXGA 4GSDL 5F1NB 3ZDYB 1GZQB 2GTWA 4OJAA 4PRHB 3CHRA 2BNQA 5DLML 5CM1A 3PE9A 2CPUA 5IB1A 3ROLA 1RK0B 1E4KC 1JMZA 4Y1SA 1HL8A 1NLDL 3V8CA 5JQHC 2DJMA 3D4GA 2VL5A 3VI4B 3ZE1B 2CGRL 1FYTA 1MFDL 5E0QA 3WHXB 3CU1A 4F7TB 4G72B 2ESVB 2QVFB 2YSSB 4L2LA 3J07A 4JL2A 1E4XL 2EEFA 2PPAA 4PJCB 2P5WE 4E9QA 1AMXA 3MMEA 3RYMA 2X89A 2YWZA 2DB8A 3TIDA 3QNZA 2H0FA 3ZTNL 5I1JL 1J9TA 5C0EB 1VAHA 3GXFA 1J12A 2EH7L 1DDHA 1R5WA 3QNXB 2CK0L 3LCYA 1UASA 4UB0L 1QBML 5CBAB 1FVEB 5C07D 3WUWG 3MJ9L 1BZOA 1Q9WA 2VDPL 3AAZA 5E6ZA 1H6TA 2X9XA 3GSXA 4TVUA 3EAKA 1N6VA 2VDNH 5C7XH 2J5LC 5JDSA 4D8PA 4CW1B 1F4WL 1FDLL 3CDGA 3DUUB 3QDGE 3D2UD 3B7YA 5HDBF 3X12B 2CRYA 4G9FA 4PBWD 4L4TA 4AK2A 3D3VD 1FPTL 1QVOB 1DE4A 5FC9A 5I26A 4KX7A 3QB7C 1FFNA 5DK0A 2ZYIA 4TQ8A 2VLKB 3APDA 2AJSH 2WCGA 3ZQWA 1F58H 5DHVH 4MS8C 3OAYK 5L6YH 4HG4K 1GKOA 1G1KA 3MNMA 5H2BA 3A4FA 4UINL 5D7SH 1J1OL 2QTVA 3SQBA 2HXAA 1COBA 3RAJL 2AI0H 4NPKA 2B1AL 2G9KA 3CXHK 3D33A 4JM2A 2OMWB 3FU3A 4PJXE 2MSPA 3CIAA 2DBJA 3BVDB 2WBJB 4HGWA 1L6ZA 2P8LB 1TJGL 1UWYA 3MZTA 1A6AA 1NCBL 1WBZA 2DJUA 4YVUA 4K8RD 2AJUL 2ZUXA 2ZXCA 1U58B 1G7LA 1QHPA 5I73B 3HBGA 4QRUB 3AACA 5AVTB 4HS3B 1TEGA 4X8CA 4OB5H 1H3PL 3VD4A 4EQ3A 4IBUA 1RH8A 2J4WH 5A2BA 5IW1A 5CR8A 2QGCA 3NBNA 3KH4A 1OD9A 2ADYA 3S3JA 5T3XE 3QRLA 1YPZB 2ZWLT 1HE8A 1ZJAA 3V5KA 1RZIA 4G8GE 4JDEB 4DN4H 4KUCF 2WTOA 4OCXH 4XBGB 4AYMC 3MNWA 4Y5YA 3FO9A 5L9DH 3V9FA 2O6FA 3E2HB 2O5YH 3N91A 4J7RA 5CP3H 4DTGL 1NFAA 2CDFB 1TFPA 3BKCL 1DVFC 5AW8B 3ZUNC 5JXED 4Z5RA 3DVGA 3KWWA 4K8RH 2V37A 2JLLA 4Y1TA 4DO5A 2X6VA 1MW3A 3OHXC 1NCJA 5CMAB 1CFVH 1GSKA 5MERB 3L3OA 1D9KB 2G0LA 1ZHNB 4WFGD 2ZF8A 3ZRSA 2E9JA 3GB7A 1ZK9A 3O3AA 1MHHB 2V3DA 3FB8B 1EO5A 4PR5B 5C92A 4YPGA 2NY1C 3DRQB 3ARQA 4MWFA 3X1EA 3PQYA 1NCWH 5CP3A 3F85A 5C0DA 2WLHA 1UT1A 2P46B 5D1QB 4FA7B 1Q0XL 3TLRA 1AKJB 3DC0A 1C5BH 3EH1A 3ZL1A 4HAFA 3DBXA 3OF6D 4DPAX 2Q76A 2GCYB 1GH7A 2E59A 2FGZA 5JPNA 4EN3B 3CFUA 1UD8A 2J7LA 1T80A 1P1ZB 3T0XA 1T7XA 2DJ4A 3G5YA 5SWZA 2ZSVB 4RIRB 4M03A 1JNNL 3MCKB 4LK4A 4E9TA 2A6KA 5C08A 4YHIB 2Y7LA 1BOGB 5KYYB 3QYMA 3MLXL 1E5UI 1J9CT 3CXHJ 5E24E 2F54A 4LCIH 4Z7VB 3UXFA 1QD0A 3B3IB 5CGYC 3UJTL 2D03L 5EIVA 3FFDB 3S8GB 4MXVE 5EMYA 1FH2A 1GGIH 1AQMA 3HG1E 3OGOE 4CDHA 3BISA 1R3KA 3C6LC 4MMYA 5EEXA 1TEFA 3QDME 3ELAT 4AXWA 4B96A 1SLXA 2A6JA 2P80D 2GT9B 2R2EB 3TH2T 3ORJA 3C5JA 2D2OA 3APCA 2Q3ZA 2HB0A 4ZYKA 3KYOA 4LLYA 3O45B 2BERA 1QEWA 5T3XL 5KVDH 1NDGA 3T0ED 4KK9C 4M6OH 2GEQA 2ZXBA 1JGDB 1H5BA 4TNWK 4W81A 3IJHB 1UT9A 2G75A 4Y19B 4CDGC 3N1MC 5D2LE 3C5ZB 2IQ9L 2JFCA 4FG4A 4GRWE 1KTLA 3SY6A 1B4LA 3MBWA 2KKQA 3O8XD 4X5WB 3VD1A 2OTUB 3CFIC 3O3DB 3UJJH 1SN5A 5KBMA 4NWTH 5BZWA 4QLWA 1QFWL 5CZVL 4NOBA 2XA8L 4JE0A 1NLBL 4G11A 1IGTB 2CCWA 4NXKA 1MVYA 3EGSB 3GC3A 3HPJB 3HS0C 5F71A 4PJAB 5DD6B 5LWYL 2ZUVA 3I74A 5AVVB 5T3ZE 5IHUL 2EEAA 3BVUA 4HIJB 3NIGF 2OBGA 2EDQA 5IVXA 2NUTA 1E6JH 5FCUH 3IAPA 4QF1B 1QR4A 4C4KT 2PF6A 3UTTD 2BVOB 4EE2A 1VPOL 1E4HA 5FO9A 2C1OB 4JFOB 3P2TA 4PV9A 2AKRA 3M1BB 4J3VA 1IM9B 5HY9A 3FN0L 4NZJA 4YHPB 1FNLA 4WUUB 1W8NA 4Z0BH 3OWRA 1K2DB 1O6TA 1U8MA 1QBMH 3HEIB 4KMTL 1KPVA 4UF7C 1L7IL 5F7EL 4NNYB 4HBQA 5ABDE 2ROXA 3FKUS 5ENWA 3QHFL 2HT2D 5GPRA 4NT6A 2FWOB 3WDHA 3ZTCC 4GSXA 4IRZA 4LFHD 3KLHC 1CFSB 3N04A 4U7MA 1OAKH 2GJ6D 1EO8H 3CJJA 3MZGB 4U1MA 1IBGH 1P5UC 4R5TA 4UU9A 1CG9A 3U7YL 1AOZA 1VADB 4X5PA 7FABH 1SXAA 5LGHH 4RLDA 1DBKL 1BVKB 4WNSA 2NQCA 5EORL 3ZTDC 3KWUA 4JQVC 4XRCB 2F5AL 4M5SA 4JN1H 3I6SA 2Z31D 4TSBL 4YL9A 4JY5H 5ANMA 3ARYA 1KCVL 2TSBA 4JRFA 3EG9A 2VGLM 3KXFE 3P0VH 5DFAA 4IGBB 3U7WH 4LASH 2CRMA 1FYHB 3LRHA 5C0RL 4R96A 3EDDA 3TL5A 3FSOA 7TAAA 2PMZA 1DQLH 5DK3A 5F3BA 4WSJA 2HTKC 2B3RA 4OV6F 2NY1B 2X5PA 3EYQC 3T3PE 4ALAC 3QCVH 4MA1C 2XV6B 3A6BL 1KJ2A 3BP7B 2QVMA 3IDJA 4ZPVB 2DQFB 1ZSDA 5EC1A 2R2HA 4F93B 2W65B 2YA2A 4LIQH 5I16A 1PY9A 4JJ5A 2QLVB 2GTZA 1A6TA 5D1XC 4I5BA 1KYUA 1FNFA 2YAOA 1OCCB 4PLJD 4WV1A 2J1XA 3B2PA 5EZLA 1HCYA 5KAQG 1VGEH 1SBSL 1I9IL 2NYYC 1KG0B 4PJDE 2CJSA 3ZT6A 1BEXA 4J6IA 1WWWX 2CD0A 4YDJA 4JFZH 2H3NA 2NR6C 2LT9A 2E46A 3T0EE 1T04B 1DANT 5CJOH 4LHUB 4G6KL 4GAFB 3C6LA 3K3QA 1U3HA 4FTVE 3NDZE 4FQXD 1DVQA 4PH8A 5E08H 1A4KA 1LILA 1MFEL 4KXDA 5FDWB 1IEBB 3BDXA 4MDIA 2DWEB 1NAMB 3MNVB 3BAEH 5AAWA 2F0CA 3CBJB 4C58B 1BQLL 2F1EA 4B9PA 1A6UH 2J88L 3LV3B 1FAIL 1ZVNA 2FIRT 3LQZA 3MUUA 5MHSD 4LRNH 4R4NC 4C4UA 4Y5VB 3LKNB 5T3ZD 1JVOA 4K0OA 4ZFGH 1KN2L 4GP4B 2IWEA 1ZT4A 4P46A 4M1DL 4C4BA 5D93C 2ZG1A 3S3CB 4NQSB 1VERA 3SYPA 4UQBA 5DMYA 3LEVL 5I6OA 3RVTD 1MQ8A 2NQ3A 4F5CA 1BAFH 1KIRA 3MNZB 1D3CA 5D4QA 5FB8A 4J8RB 3FJTA 2UYLB 4QOKE 2VZ3A 2NR6A 4Z0XA 4XNBA 1AG6A 1MEXH 4KK9D 3RIKA 3VG9C 4MYPA 4AT6B 1OB0A 3MRGA 4J3OD 5MEQB 1HYRC 3GXIA 4JM2D 3ECUA 3MRDB 2BMKA 2ERJB 3ULUE 4AIXA 5CFAA 1MCCA 2EZ0D 3L3OB 1Z9NA 3LB6D 4K3EH 1B0IA 1Y1DA 3Q43A 5I5JA 4OD3L 4TNGA 3T3PF 1I1AD 3QNYB 5FUOL 4NDMA 1MIMH 2NY2B 3KWWB 4ZRGA 4BJLA 4EI5C 3OM3B 5HYQB 3K80A 4HVBA 1R3HB 2ZNWA 3FT4B 5TGBB 5ETUA 1KWKA 8PAZA 1UM5L 3GMOB 3W11D 3C6LB 4OU3A 1KYDA 3HUJF 1AYRA 1RIVL 1CLCA 1HJCA 3QULB 5DMGC 4G9FD 4XBGA 5EBLA 3CVIL 1UKQA 2E9BA 2VR5A 4AQ1B 5SWQB 4XCCH 4RSYA 2IOMA 4N0YL 3KDMB 2H9GB 3VFVA 1UB6B 5DJ8A 2XN9D 1GHFH 3FT9A 1JNLL 4JRXD 3QPQC 1AIFA 1KEMH 1L9SA 1N4XL 4PRIA 2YAEA 1EVUA 5CGBA 4L1LA 3V10A 25C8L 2XN9B 4BDVA 3FSVA 3RZCA 2W0KA 2D7QA 2R1XA 4P2OB 3R06B 1ZE3H 3BKYH 3DSFH 3RUGB 3F7VA 4LVOB 1A3ZA 4ORZC 5LBSA 1JVLA 5I1HL 3K46A 4ZTOL 2OL3B 3BPNB 4LASL 2A1WL 4QGYA 4U1SB 3F7VB 4HJEA 2KZBA 5GXBB 4LXFA 5K1VA 2AEPL 2COQA 2P24A 3IGUA 1BZ9B 1X3DA 3GS0A 1G1CA 1JVKA 4I1PA 1BM3H 5D1QE 1HZHH 1L9QA 1JRHI 4EVNB 1B88A 3EJSA 5ANMB 3RVUC 3LJ3A 2ICES 3QORA 1KT2A 3WXVL 5IJKC 1AD0A 4LLMB 1KEML 1VPOH 1XZ0A 4JY6A 4O5LH 1QSEB 3IF1A 3JV4B 3NZSA 4N20A 1I1AB 1JNNH 4F33B 4WTQA 1YY9C 3SE8L 1NEZA 3N1QC 2N56A 3H0TA 4XMVA 4H4NA 5K33A 1N6QL 1XCTB 4DZ8B 4R7NB 3WD5H 2XFXB 4MCYB 2Y6SC 3HE7B 1CD0A 1ETB1 3BIAX 1I8IB 3NP3A 4GT7A 2FWOA 4UTBH 4J6RL 3ARGB 5LNDA 4OAWA 1QA9B 3TVMA 1YEKL 3S5LA 5I8KH 3PHQA 1J9RA 3LPOA 4MD4A 3IJYB 5EG6C 4LCWB 2HSIA 5IEKA 1RP9A 3MRGB 4GSRA 5JPMB 2EAEA 3ARFC 1AP2B 4OM0L 4PW3A 2GY7B 4NZDA 1LP9A 5HHQA 1C7SA 5D7JC 1KIUB 2BIOA 3KMDA 3O6ML 4RGNE 4J3OG 2V7HA 2BOCB 1T2QL 3QAZB 1UYWH 5AVWB 3VXSA 1XZWA 1ZHLA 1OF2B 3X1NA 5DRZB 3UTTA 3EOTL 4OI8A 2HKFL 1WFUA 5IW3A 4X7SL 4RFOL 5JR1L 4Y89A 5C8JA 4AJVA 1ZTXL 3G04A 3T71A 3UACA 4HWUA 4YHKL 3GJFB 3VFGH 1MCQA 4X2UA 4ZUVB 5I1LA 1PY4A 1KPUB 4LIQE 1MRCL 3T8MA 4ANVA 2BNQB 3IRPX 3POCA 2Q8AH 3VSUA 4J4PC 4WHTB 1U8LB 3FUJA 2EEDA 3RBSA 2GFBA 4WUKL 5EO0A 2ZCKH 4JDTH 2CLZB 1IGYB 1URLA 3FT0A 3IKCA 5IVXE 2YRLA 4X6CB 3TWCH 4U2ZA 1TJHH 1AR1C 2G75B 4Y19A 3ZJAA 1HE7A 1QFWI 1ECZA 3LN5A 5AVZB 2AJZA 1N19A 3GFUA 4JO1L 1A8JH 1ADQA 4APQD 3B9KA 3SDAC 1FFQA 2FECL 2AQ3A 2WNGA 3B7RL 1QSED 4NN5C 4AQ8C 4NFCA 4FN0A 5I0WA 4YDJB 2I9TA 4A04A 4ZXBB 2AEOA 4JKMA 5HHMB 1IZKA 1J1XL 4Z7OF 4WW2A 1ZT1A 3EGDB 1TU2B 3GIZH 3EGDA 2FJFB 1KTBA 4QHLA 3DRTB 4MQ7B 3UAFA 1I75A 4Z7WF 3MJ6A 5JPNC 2CE6A 4IKNA 4ZUSB 4Q9QL 4M7LH 3QI9A 5IG7B 3UZEC 4D9LL 2N4IA 1XVSA 4Y9CA 2ZCHL 2XU9A 2GB2A 4LLVB 5L88L 4ZJ9A 1E67A 3U6XS 1F3DJ 1AQHA 1GZHC 3KJ4C 1ZLVK 3F58H 4BH7B 1NCGA 1K5NA 2O72A 3S8WA 4KI1A 1OHZA 1PKQA 4KDVA 4P59L 3S96B 3V95A 4XODA 2DM2A 4ZS7L 2XZQL 3U1SL 4ENED 5IQOA 3DARA 1CBVH 4RFNB 1MRFH 3VDAA 2YPLD 2FB4L 5I82A 3G04B 3GTVA 1EXUA 2C26A 3QZWA 2JE8A 3QA3A 3QIBD 3SDXF 1N5YL 1PNCA 1XXFC 3QJSB 2YK1H 3HG1B 1OTUD 4GKLA 3TN0A 2B0SL 4UNTA 2L8AA 3QXUA 4QXUH 3TA3C 3VMNA 2JJWA 1OO2A 4HW6A 1GS7A 3OKMA 2DJSA 2V5TA 4PUBH 5E99L 4RGOH 4BFGA 2ZUYA 4DPBX 3MJGX 4K5OA 4MVBC 3KNBB 3L5IA 4K71B 4H26A 5HXMA 4NEHB 2CALA 1F6LL 4IIQC 4BKLA 2YEZA 4P23A 1RL1A 2AANA 2JCCB 5CIPH 1ES0B 5BVJB 4L9LB 4FQXA 2CHXA 2C9AA 4UAOB 5D6CB 4OSUL 2WQXA 5DMIL 1KFAH 1UH3A 4PJ9C 3T3PB 2ENPA 3IDUA 1QFHA 2AMGA 3DOSB 3FO1B 3LQAC 3NT0A 3S4SG 1G43A 4O02A 1X5LA 2B1AH 2VMJA 3GGWB 3KPTA 4GRWH 1IGFH 1WFMA 4UOW1 1QEXA 1KJ2H 2A9NH 5EU6D 3S3PA 1XF3B 4H8VA 5BNXD 4ENZA 2GIMA 4OBSA 3H42L 3DJ9A 5FYKE 5B1AB 4TLUA 5FGRA 3HE7C 1AGEB 3HC0B 5KAQF 3TIEA 5KZCB 3N40F 1T1WB 4MJ6B 2G4EA 1BWMA 1KELL 2CUIA 3CV5A 2K45A 2VQTA 1RZGB 1KFGA 1VFAA 1A3LL 4R97C 4GOSA 3MYZA 4JRXE 2R2CA 4FFZA 3ULSB 3K2KA 4YBQD 1BJ8A 1IAII 3T0AA 1I9JH 4RZCB 5HI3C 4HU8A 4LPWA 4YN3A 4FQ1L 1U8CA 3CUPB 2M1KA 2AXWA 4M93C 4KJWD 4PJGF 2P8LA 4HHGA 3TXAA 2FCBA 2IQ9H 4L0YA 5CZKA 4NLHA 3KLDA 2OJEA 1HNYA 3L9YA 2WXOA 4N25A 1JNHB 1NC4A 1GC1H 2A83A 3MVSA 2Q7YA 4N2DA 3QRGL 3KPQA 2EYRB 2FJGB 2C7UA 4JFYA 5I75B 2PLTA 4R7VA 4AW7A 4E42B 3N85H 5DR5L 4GG6F 5I8OH 3FPYA 2P4AB 1LE9A 3ILPA 3MU3A 5EH1A 1CICB 3MLRL 3O6LH 3NAAL 5DYOB 5KUKA 2W92A 4AEIH 1IC5H 4FEIA 2HRGA 3HMXL 1YCSA 4PWFA 3PV6B 1OOAA 1NA8A 3MV7E 4TNVK 3LRGA 2Q6WB 2CJTA 2NY5L 5DUPH 2H3KA 5DZJA 2JB5H 1YEFH 2CHNA 4TF4A 4AL8H 3NEEA 4LPUA 4MA8H 4UT9A 4XN7A 4R83A 2FVNA 5CCJA 5GRXG 5HYQA 2MMXA 5GGUB 1GW0A 3P11H 1T66C 1M6OA 1E8WA 4QJ3B 4WK2B 2X10A 1IBBA 3FUIA 4P2RD 5AEAA 1M56B 5C3TA 3O4OC 4NP4H 3O0LA 3Q5TA 5HP5A 4DQOL 3MACH 4N0RA 1EAQA 5HHOE 4KUZL 3O2WL 2PW2B 4U6XA 1GZPB 4FNLL 4ZOBA 1AXTH 3QNXA 4XAWH 4GRLD 4KC3B 1T5XA 1V5JA 2CO1A 4MQXD 3US0A 3ILEA 1W91A 4M48H 5DHVB 2A4ZA 2N59A 3DROB 3RPIA 4Z7QE 2CBTA 3EH3B 1OF2A 3RGVA 1ZXQA 2GCYA 2NDGA 4RGMC 5FFOA 1JP5A 4N1EA 3HIZA 1S7UB 4X9IA 4ES8A 4XH2B 4XO3A 3V6ZA 4CU7A 4NHCH 4YSCA 1KUMA 4FZEL 1EMTL 1N5AA 4HJGA 3S34L 3WHXA 4AUJA 1S3KH 3VYOA 1EZUA 1FGVH 2JKLA 2NTFA 5CAYB 2VL5B 2EO1A 3IJYA 2BS71 4NKMA 5GGVY 3VNYA 4RSVA 3IWVA 5KS9B 1RK0A 4FQQA 5FWQA 5TDNB 5CD3A 3JV6A 1X5KA 2W80C 2IDUA 2NPLX 1I8IA 4M7ZC 4DVBB 4Z77B 1D2OA 4BZ1A 4HWEH 4LLQB 5HYSA 5A3IC 2HPTA 4P23C 4WDIA 2IWKA 5FIEA 1MF2L 5FX3A 2DWDA 5ABZA 1I1AA 5C3IA 4H8HA 2G2RA 3SE3C 1TKWB 1FBIL 2BSRA 3P3YA 3QQ4B 1L9RA 3N9GH 3WO4B 1MQKH 3CHPA 3FO9B 1JDCA 2HFEB 4PVMA 3P3UA 3WXVH 4U1KA 5EOCJ 3BPCB 3JSSA 4KROD 1DUZA 4L9DA 3CE1A 3NIGE 1G9HA 1JXDA 3KPNA 1LM8V 4LKCA 3EW3B 2GUOB 4HD9A 4Y4KB 3S34H 1LE5A 3CNKA 1BX2A 1GTFA 5C71A 5GHWH 2GTZB 3VGGA 4XOCA 2XN0A 4WJ5B 2WBWB 1G5GA 5ACMA 4LPVA 4XXCA 4F7EA 5KG9B 2GJZA 3S48A 4TS6A 1HHIB 1N18A 2C9PA 2DM4A 4IIZA 2HKHH 3G5VB 4GKSA 5AW1B 3V5DA 4B5EA 4EQ2A 1Y07A 4DKAA 2WVTA 4S11A 3FULA 3HS0A 4FKHA 4R96B 3SO5A 2XRAH 1HXMB 3CH1A 3CU7A 5EU6A 4I7ZC 4Y2OB 3ME0A 2PWHA 4MNGE 4CSSA 2G2PA 2BHUA 3L1OH 4OFPA 3LZPA 2WB1A 3D51A 3OAUH 1IV8A 3AXIA 1UB6A 1B9KA 4Z7UF 2VZUA 3KGRA 1A6ZB 2XIDA 4AQZA 3P4MB 1GRWA 1I7RA 2HKFH 3HR5A 2XWBB 4OH2A 2UWEA 1P7KB 4RFOH 3NH7H 3L6FA 4FGMA 2CU9A 5AFAA 4KNTA 5F93C 2PP8A 1WCQA 4L9LC 2OA9A 1DLHB 4QGTA 1WYJA 1KXTB 1KY7A 5TGBA 1K6QH 4DOHE 2BNQE 4K5PA 4X6BB 3GKWH 3S5YA 3ZE1E 1JFHA 5JQIB 4FXKA 2XVLA 4WWKB 1MPAH 2K7PA 2F8VA 3CCHB 5DZPA 1EHKB 4G8FA 2J5WA 1TNNA 1ITCA 3VFMA 4E9RA 5DO2C 4A7VA 4HX1B 1TZIA 1ZANL 5TJWK 4YSRA 3LKPA 2MFNA 5IR1A 2AKRB 3MJ9H 4DPCX 3K81A 3K2UL 1H8NA 2PETA 3FPXA 4GBXB 4GPVA 1R5IA 3PCYA 2PCPB 4N68A 4P5TA 4QHMB 1YLBB 4Y16C 5AAWC 4YFEA 4U3XA 5IROC 5BRZE 3NPZB 5GGUA 4JM0A 2MNJB 4K9EL 2QEJA 5JZ7D 5CUSH 3H7BA 1TYJA 2Y4SA 3BD5A 1GGBH 3LZFL 3CHOA 1NGYA 3W5MA 2ZX7A 3KEDA 3WEMA 4RVBA 2ENSA 3A3YB 4OCWH 1UCBL 1Y6NR 4HA1A 5F6HJ 2P5EE 3V4LA 2YS4A 3FC8A 2H1PL 2DD8H 3LQZB 4OTXH 5L2KA 2W88A 4RMVA 1PQZA 1YEIH 4JQXC 4FABL 3CVHH 2J5LB 3HBPA 1S7TA 1NBQA 2UXTA 1XCQB 5GS1A 4P2YA 1A4KB 4JG0H 1EJFA 4Y8AA 5TFSH 1A14L 5K9OB 3RPKA 3NCFB 3RVWC 1WE5A 1Z6JT 2E3VA 1M4KA 3JVGA 4ZTOH 2QKIA 4ACTA 1DUYB 4LOUD 4WIQA 4LPCA 3GNML 3U9WA 1EIBA 1BD2A 3FUNA 3Q6GH 2QTEA 2F1BA 2OMVB 4ODVH 4Z7UE 3AWFA 3ZXAC 3FB7A 1S78D 4KK6D 3F7KA 4GI8A 1RAMA 5EULV 1MQKL 3NJGA 1RI8A 1OVZA 1RUMH 4ODTL 3TC9A 2WQSA 4JR9L 3U4AA 1H3XA 1GOHA 1TTAA 3L5JA 1ECYA 4AKOA 4D3CH 1BMZA 1B0RB 2R7EA 3BJLA 3GS4A 3HZVB 3O6FB 5J6GA 5DJ0B 3KYNA 1I7ZB 1R9FA 1RHHA 3HC0A 3B9DA 3LKQB 1QSZA 5AG8A 2CCVA 4KTDL 1MHEA 3GDCA 4BHUI 2OL3H 5IJKA 2RGSA 2JKSA 3PL6A 2CO4A 1CC3A 4JFDA 3TS8A 3CN1A 5DRNA 3VWKC 1FAKT 3VSVA 2DMKA 4AEFA 5DRWB 4ZUWA 4JZOB 3ZKMD 1MH5B 1OAZL 5FYLL 2AJVL 1IVTA 3KPLB 4W4OC 4X4MA 3ZE2E 1HWHB 4JFFD 3VM5A 3FO0H 3HI5H 3SE4A 1RHFA 1E42A 1RZJC 3R7QA 3WG7B 1EHXA 4IJ3C 2GVYA 1QFUH 3DXAD 1KJMA 4RQQB 1UTDA 4P3CH 5FLUA 4DP6X 3UTQA 4IK6A 1EZSA 2ZAGA 3GZPA 5F3FA 4PRPB 1CI5A 5CWSA 3BVTA 5F0JB 2D7OA 2YFOA 3GXDA 4CKVX 3CVCA 1MWAH 2IVFC 4K2UH 2BRQA 1HOCB 4MMZB 3AT8A 1ZLEA 4R26H 3PGFL 4AZ8B 1XWVA 3S5LG 3EHBC 5I18H 4LP4A 1EJ6A 3BDBA 1NFIB 5I6NA 1FVCA 4HZ1A 4AYGA 4GIAA 4NUPA 4Z7UA 3FU0A 2PCXA 4Y1AA 5TF1L 5EOQH 5GRJH 2BSSA 4KY2A 2J2ZA 5H35A 2IJ0C 3DX1A 4R4BA 3QA3B 4IS6B 5L2KD 1PYWB 4W9KC 25C8H 1MH5A 4L48A 1A7OL 2QHRH 4DKEL 1M2VA 3VFRA 4O2EB 5EIQA 4HKXA 4XOEA 3NZHH 3VFPA 3LZFH 2AV7A 4M1CC 4K5MA 5LVEA 4Y4KC 4PVLA 4PBDA 3HJEA 5F9JB 4XNZC 1RZIB 3MXWH 3PDGA 4Z7OB 2KZKA 3BH9A 3B83A 5DMJB 3E9UA 2VXUL 1H6EA 4F57L 2DWYA 4FQLH 5FM8A 4G6FD 1K85A 4EIBA 4G1EB 2HT3C 2WGXA 3C2AH 3IDIA 3VQ2C 4XCEB 2P5WB 5BZZA 1KENL 4RCAA 5EEWA 2P26A 3MGTB 4TVPE 1F4AA 3E2HC 1UG9A 1OSZB 2CQVA 3K6SB 2XYCA 5T33H 5BZWB 4UBDC 5IJDC 1M05B 2F7QA 2O5ZH 3QC5X 3H85A 4JKNA 3TBWA 1MW0A 3BYTA 4AZUA 3EOBB 1XV8A 4FYTA 5HTSA 1GL4B 4P5SA 4GFXA 3DXAB 3Q6GL 2HVJB 4XAWL 1USZA 3FHEA 4XBMA 1UD2A 2JNZA 3TBTB 5J6HB 2ZZUT 2X28A 4X6EA 4PSRA 5F9OL 3CZSA 3AXLB 5DS1A 4NJAL 4B0MM 5JOPD 1B6DA 4WTWA 4O51A 3KYOB 2VR4A 4WHTA 4PJ6A 4PYGA 3PS6A 3OAUL 3SQOL 1K72A 4LRIC 2IQAB 1SQ2N 1UWFA 4U4BA 4X7TA 3FZUD 2WOYA 4HUCA 2OW6A 4ANWA 5JQ6L 4GRWB 5DGRA 2DQGH 3NN8B 3GMNB 4HOZA 1X5YA 1QQDB 2QZ5A 1QHQA 3STZB 2DEWX 1KGCE 3CFTA 3DKHA 3HZYA 3NJIA 4Y4HD 2A9MH 1PY0A 5F7YC 3C5ZC 3EOYG 4WWKC 3HW7A 2Q2LA 3NAAH 2QPSA 1Q9OA 1FHNA 1QNZL 5DHYB 3SO3B 3PXHA 2HX7A 4IM8A 4KK6C 3RNKB 1QSFD 4I0PB 5GGRY 1NWPA 3MA9H 4Z3HA 1WEJL 1TETL 3IFPA 1PW3A 1U4EA 3ILQD 1BP3B 3NJFA 2SEBB 4DKDC 3UEQA 4N2MA 5FO8A 1KDIA 1L7IH 4TYUA 4NCDA 1DQMH 2MOVA 4PB9L 5MEND 5TE7H 1Q9OB 4G7RB 1KIQB 1WT5A 5DWPA 1LO5B 2ESVA 2EZ0C 2JJTC 2QGEA 3PQYD 3JYCA 3UAJD 2BM3A 1JWUA 2FATL 4JHWL 3M17B 1GAFH 4FFTA 2C3XA 2IALA 1HEZA 3QE5A 4PJXF 4K55A 1J5HA 1LO0L 3UPCA 1NCCH 1KGUA 1NGZB 2A6DA 4NN6C 1RZQA 3B9VA 5D2NA 3WI9A 1R19A 2LFEA 1I7RB 4DN3H 2RA1A 1XIWB 4LBAA 4TQHA 3OHMB 2C9VA 4BCXA 5MI0B 5B3JE 5GZOD 3VRJB 2C5DC 4D0DA 1SVCP 1F41A 1Q94B 3QEGH 3D3VA 1OAQL 2XIIA 4I8DA 1HQRA 1NKOA 4OI9A 4C56B 3NFPA 2Z3FA 1LTXA 3MFFB 5DZAA 3KPRB 3RFZC 3AS2A 3EOAA 1C5DB 3OR6A 1QW8A 2EXYD 1S5IH 3JQOB 4XTRC 1OP4A 1PD6A 4NBZB 1SJHA 3VGHA 4M8UA 1PZ5A 3MJ8A 1DZ0A 2R23A 5BCAA 2XIBA 4P2OA 2X4NB 3KPPB 2X4SB 2DEXX 3ALPA 4EI5B 2BIHA 3GMLA 5EN2A 3KCWA 4JQIL 4AEHH 4OD1H 1B0RA 4YC2C 1T0PB 1GIGL 4S10A 2J1WA 1M71A 4IDJL 1QR1B 4OGYH 3KPPA 5IKCB 3WU1A 4BH8B 2VM9A 4BZ2A 1FNEB 1Z32X 2HLAA 3ROOA 4F58H 4KGLA 4TTGA 1U58A 5HD8D 1NPJA 2OMYA 3LKSB 3VB8A 4Z0BL 1A6AB 1UWXK 1AO7D 4RMQA 3QISA 1VCBC 2BK8A 2IAMB 1Q38A 4YFDB 4LLDA 4NUJA 3ZYOA 5IEHA 4YS4A 5AWNH 5C0AB 4NGHH 4WCYH 1BVNP 3ARBB 4ZT1A 2J71A 1JWSA 5IUSA 4HEMA 1U8QA 3BLBA 2BHZA 4D9RE 4P2QA 4EEEA 1Q1JH 2UZIL 2G3ZA 1QHOA 2EVFA 1SDDA 4G6JL 1TQSA 2FEJA 2Y22A 2BMKB 5I2IB 3HC4H 4KI5E 3W3BA 1ITBB 4A6YH 1R3JB 1R3LB 4KFMA 3MRQA 1NBYA 4RMTA 1SVZA 1L6XA 5HYSG 2DWSA 1Y18B 1YY9D 4L4TB 4NQCE 4CC1A 2ZQKA 3QIUB 2IDSA 2K6ZA 2XY2A 2V5RA 2ARJQ 2FR4B 4LL4A 1YC8A 4RBPH 4BCYA 4U1NB 3RU8H 2P7TA 4NBYB 4OZ4A 3WNLA 3UTSD 2OXGB 4IU3A 3RIAF 2QZQA 1YEWA 4WEEA 1IM3A 1QP1A 1AZBA 3MN8A 1NEUA 1R5WB 3IFPB 5HDLA 3LN4A 4IOIB 3FQ1A 4G42A 4JM2F 1ACZA 1TMCB 1MRDL 3RI5K 3G5ZA 5E7FA 4HETA 1KACB 1MIEH 2V2TA 3PL6B 3D87B 2BXZA 1JZIA 3OZLA 1HT6A 3X1FA 4UIKH 3F6IA 1E9PA 4I18A 3I6KB 4Q9RL 1WRFA 3QR0A 4LOEA 1CFTA 1NL0L 3QUMB 2Y7SA 1FYTD 3CFJB 3FU9A 5LBSL 3IE4A 3U9PL 4U7SA 2H2PC 3HTLX 1JK9A 1SOSA 2A74B 2UXFA 5E56A 3NN8A 2XN9E 4R5VA 2Z0UA 5A6IA 5IV2B 4P5MB 5C0FA 1C5CL 2CG9X 3OSKA 2EEXA 3QRFM 5AB1A 4ODHH 5SX5H 4DGWC 2LVEA 4NHUB 1QSVA 4Q8BA 4JHVA 3VCLB 5ACLA 3QXTA 3JWOC 5IQMA 3FMGH 3O6LL 1B2WH 1TSHA 2ZONA 3AXLA 4QIRA 2V2XB 1IB5A 3HAEB 2WM0A 3B7SA 3ILQC 4LSRH 4YX2H 2QSCL 2XETA 3OKDA 4XMXA 3FO0L 4JG9A 2XQYG 2GSIB 1D5ZA 2DF3A 2V9UA 3MOAL 3MFGB 3RWFB 3TWYA 4KPHL 3WEXA 3ZT7A 4Z7QF 3SBWC 1X4XA 2UY7A 3ARPA 1ZLSH 2NY5C 5T1KD 1D6EA 3MRLA 4PJBF 2G5RA 1R6VA 5FKAA 4NHCL 5FYJE 3MRNA 4EN3D 3QEQB 4DESA 3IFNH 4X5XB 3UGEA 3AGWA 3I9PA 2B16A 1A7PL 2VZTA 2QPUA 4WY7H 1CF1A 1I8MB 3NQKA 4H0IA 1WV7T 4L8SC 2AV7B 1Z9SB 1B3JA 3ATFA 3D0VB 4JQIA 4XNMB 4XO8A 4JFEB 4PG2C 4FL4C 4AC4A 4Z3JA 2JI3A 2P5EA 3WNPA 2V8LA 3QI9D 1IGCH 1T1ZA 1EHLL 2Z6FA 3SKNB 3RJDA 4JGUA 4KKQA 1EX0A 2GITB 3J8F7 3L5XH 4XVUC 3RVXC 3TNMB 3PRZA 2ICWI 4U4IA 1IE5A 1CYXA 3NSCA 2OTPA 1G9MH 1FO0A 1IT9L 2OYKA 4PJCE 1DFXA 4YC2B 3BP6B 4FI6A 3PHSA 4LNRA 2B1OA 1INQA 5DUML 4HOMA 4XP5H 3WMQA 3Q8CA 4APQA 1JD9A 3VXOB 4JFXB 4DWHA 3AQDA 2E9WA 4P3CL 5J4MA 4F15C 2IH9A 5IMOB 5E1AA 2BVPA 4L37A 3T0EB 3VFWA 3OVUB 5CJXA 4CC4C 1IO4C 3P4MA 3PUCA 1MFDH 1BW8A 3TA4D 3TN0B 3MBEA 3CVHA 2NUPA 4B0MB 3QUYB 1XMWA 5E08L 5TDOB 3CXFA 3RKDC 1WZ1H 3L9EA 1FE8L 5ILTH 1U3NA 2WNXA 2ID5A 3CPUA 4JANB 1HI6A 1JN6B 3O3BA 4NO0D 1DSWA 3BPOC 3TYGH 2HH0L 3N0PB 3QZOA 3F8UB 2AK1L 2WVVA 2YXFA 3ZGIA 4G3YL 1VCAA 3L4WA 1QLFB 4NFBA 2FAUA 3JWNH 1D5BB 5IB4A 4IRZH 1MSPA 3C5ZA 1C12B 1JXFA 1SRDA 2OMZA 3LRKA 5D1ZD 3ASWA 5DD0L 1I7ZA 3JWNG 4XWGH 3H42H 4WJ5A 5AW0B 2F53B 5IQ7L 3L08A 1HZKA 1I3UA 1L4IA 2WN3A 4NWUL 4D0CA 3HN8A 4XP9H 4QO1B 3U0PB 4YZFE 3NMEA 1I8KB 3EDKA 5CJ8A 5MENE 1E9OA 2DW5A 1IBFA 3EUDA 3UPAA 4LHUD 4QNPF 1NGWA 4ZXBA 4S1SH 4MD0B 4UDUA 2MCAA 1U93B 4M6MH 1VLXA 1ZLVH 3SE8H 4MCNA 4MJIE 4XNQB 3RJOA 3BKMH 5J0BA 2Y06L 1TQCC 5HHME 2H2SC 1CU4L 1SZNA 3GMRA 4AQEB 2C9RA 3AREC 1CD8A 3B3IA 2CLZA 4ZW8A 1NIDA 4M62L 2DKSA 3KLHD 4Q0XH 4XPAL 2DMGA 4UTAL 3TV8A 5I1CL 3Q3GA 1HHGA 2D4DA 3GHPA 2VDRH 1NKGA 4I89A 1UQSB 2QVTA 1XH0A 2ENQA 3K7UA 4PUBL 3WTUA 3CVIH 3U4EB 5INDA 1NUFA 4M3JA 1O0VA 4L3EB 5C0GA 5IMKA 4YXHL 3UABA 2ZD0A 3TFBA 3COOA 2XQBL 1WCBA 2DOCA 1ZA6A 2XN1A 4X5LA 3EOTH 3MROB 2Q1EA 1JPEA 2PTTA 3CBKB 3M07A 3O0RL 2J56A 1UM4H 3JWOL 2AEQH 2ZOTA 1CICC 4AEEA 2WJ7A 4PR5A 2H3XC 4FEMA 1OGTB 4CSTA 3OBAA 3RVWD 1ED3A 1AR1B 4PJ8B 3DO7B 4ETQB 2AXGB 4FFYA 2EIDA 2GI0A 3HHSB 2OXGA 3KCPA 1KLGA 1A1OB 2MKLC 3BSZL 4IU3B 5E2WL 2A73B 5C7XL 7PAZA 3CN0A 3VRLE 3DX7A 3NFSL 5ECJE 1ADQH 3ECWA 3GZQA 3WENA 3IDYC 2MCG1 1AG0A 1SHSA 2E7HA 4YSDA 3S97C 2BFVH 1EEQA 2WQUA 3BO8A 3TCTA 2ZKHL 4EZKA 2A9AA 5J13B 5KVFE 4WI5A 4P49A 3DUHA 2WXHA 2BNRB 2VDLL 5DWUH 4JRXB 1TCRA 2ARJA 2AXFA 2H8PA 1IBHA 2VXUH 4J3XA 4X4ME 3TO4D 4F57H 1M7IA 4TSBH 5JUEL 1CXIA 4AWJC 5JZ7C 5D70H 2ZXQA 4NQDD 1WFTA 5SX4H 4NQVB 4RX4A 3V5KB 1PG7W 3PP3H 1UXWA 1G7QB 2V0AA 5DJXB 4NENB 5CU9A 43CAB 3RRQA 5JDJA 2MWCA 1LXMA 3VD7A 3I02B 1X9QA 3B1UA 5JIDA 4TQEH 3LDBC 2ZUQB 4MZ3A 3NUKA 2B14A 2ZP0T 4OLZL 5I8CA 1DBAL 1PKQB 3EHBB 1EEUA 1JZHA 1RJCA 3LKSA 5D2LF 3VXTA 1T1XB 2O5XH 1OAKL 1SDAB 5SWZE 3SGKC 3VTTA 3JWDH 3HNSH 5I15H 3JVFC 3AG3B 3HC2A 4F15B 2BP0A 5E2VL 3CX2A 4F8LA 3MYJA 1T2QH 3FZUC 4X9HA 5HDWA 3SSGA 4OLWH 2RJMA 1CZ8L 3SDAA 5GGTH 1RU9L 4KNQA 4F9PC 2Q7NA 1BYOA 3AWEA 3MLWH 4JCMA 4KDWA 5KYXA 2ENJA 4GO9A 4UYQA 2XPYA 1UCBH 2GY5A 4PBVC 3H9SE 3MLRH 3PY9A 3TV3H 1Q0YL 2FBOJ 2HN7B 3IBOA 4ACPA 1EO7A 1BMWA 4LT7A 4N8PA 2WHVA 1E3FA 2Z35A 3BO8B 1UJ3A 4CADA 1O7DE 4G71B 1T66D 1Q0EA 5FW8A 1YQ2A 4E9XA 5HHOD 3FCUB 1A22B 3P0YL 3DUUA 1CD1A 3H7LA 4HJ0C 3WD5L 1X5XA 3PAUA 4D0DB 3ZHLA 4LP5A 3NA4A 5HJGA 4DETA 4P9HC 3IDGB 5AUMA 4KXAA 4OR1A 1O5PA 3WNJA 3F3HA 4XMTA 4NKDA 1IC7L 2LVCA 3FFCA 1CLOH 1YAZA 1L3NA 3ZYIA 3NCMA 2AQNA 3ATDA 4H0HB 4HS8H 2BP8A 4GG8A 3T3MB 5KN5A 3QQ3B 2C9SA 4J39A 3V6ZB 2MH4A 3CFBA 3TTYA 2ZF9A 3MNZA 2YSSA 3OMIB 4HEPA 1JZ2A 4DNLA 1GY2A 3O4LD 1YY8A 5IMKB 3I6LD 5DHVA 1A6WL 3HI6H 1X9RA 5I0DA 2J6WA 2WLJA 4XBPA 4P57A 1D5XA 1MFCH 3SPVB 3N1GC 2FLBT 3UTSA 3ECBB 1GJUA 3RNKA 5LUMA 1KGWA 1E3ZA 4PJXA 4LCIL 1YA5A 5E1QA 1DVZA 1Z7JA 4JAMA 4ZFGL 3RJQB 2CHZA 2P3YA 3FUKA 4UTCA 2GC4C 2CO7A 4DZBB 1F11B 1GYUA 2JCCF 3C5SA 5LB1A 5ACZA 4M5YL 5IZ7A 1LDPH 3L4UA 4UV7H 3QAQA 1KC5L 5EU4A 1HHJA 2DYPD 5DYOA 2XDHA 3VSTA 5F72S 4M9PA 1THCA 3SKOB 4I2XA 1JZ7A 4FQHA 4WI6A 2FIKB 2PYFB 3U1QA 3V0IA 1E9OB 1PCXA 1YYLL 1ZWIB 2C7UB 3L2NA 4Z7VF 4F5CE 2I9TB 3LOWA 1OQOA 2NXYB 3U36A 5B1KA 3FOMB 2F68X 4NIYE 3MREA 4GEIA 4PLNC 5A2KH 2QADD 1ZT7A 4EBQL 2XWTA 2ZOOA 3VXQB 3P30H 5I1DB 3EFOB 1KB5L 1T4KA 3UL4A 2YGOA 1IILE 4LSPL 4MJ4A 1DJYA 4DCQA 3DYOA 2V2WA 5I74C 2BWDA 4BGDA 1NCNA 3RGVD 1YVLA 2IAAC 4IJ3B 5DCCA 4BBWA 3FH7A 5AW3B 4YX2L 5C07A 3ULSA 1E27A 1AJ7L 1OK0A 1CFQA 1BBJA 3FUEA 1QLEB 4EMZA 4MDJB 3RWHA 3DGGB 1E4WL 1AY1H 1U8NA 3DIFA 5D7JA 1FPTH 4H88L 2VE6B 3P9WB 2UXVA 1YC7A 3GJFH 4LSDA 4B27A 4BXVA 4P2AA 4TN9A 5F6IB 4JKKA 2VR3A 1F3DH 1TF4A 3FFCD 4K73A 2XZCH 4PJDA 1IL1A 3EBHA 3QJVB 4ELMF 1ASOA 5HPMB 2J1KA 4H44C 3T1FB 3VFRB 4JFXA 1UA6H 3ULVD 4J3SA 5H4YA 1MCNA 5C0JA 3GMOA 2ADIB 2NSMA 1LVEA 1R3HA 3EYVB 3T4AC 3ILDA 2K9FB 3PU7A 2B39A 5BRZB 1KLGB 3ZO0A 1VZGA 3SCMA 3IFOB 4P2QD 5IK3A 3HE7A 3WIHL 5GRVL 5AW4B 4HS8L 1T0MA 4ZXBD 3WE1A 1K2DA 1VB9A 4K94H 4ZTEA 4JMXA 4QXWA 5AZ2L 1CGTA 2QLYA 1NEZB 4CGUB 1IEAA 1Z5LA 3T4AA 4CSPA 5G5DA 5ID0B 2XOTA 3KNBA 2NXYD 4PLKD 5IHHA 5JTWA 1XZ0B 5IROD 2NW2A 4TXVB 2VLRA 2TRHA 2ZX8A 5A7BA 3RGVC 3HZKB 5JW4R 1FRGH 3Q06A 2VXTL 2F7PA 3SJVD 2YPLA 3D85B 4I48A 4UQ3A 4W6XB 4Y7MA 2B1HH 4JG1H 3VXRE 1K9TA 4EUPH 1R5VA 2G4GA 3L13A 5K9QG 1EXUB 4WRLA 1X44A 3OJVC 3DGGA 4QR7A 1E5ZA 1EJOH 3R4RA 1KGIA 2P24B 3HLKA 3ZSTA 1XF4B 1KYOK 1UACH 2NY3B 1W16A 3Q3GB 1CE1H 1NGQL 1OTTD 4HS6B 4FF9A 3MNVA 4GSUA 2B7DT 3GBNL 4YHML 4A6YB 3WN6A 1YNTF 4JL1A 3HKZA 2NY3C 4PRDA 2HT2C 3LIZH 3T08A 1OZTG 1W8OA 2GABA 4BQBA 4UAHA 1WTLA 3NIFE 3PJSA 3UMNA 3VXMA 1XGTA 2EE6A 5IREA 1KCRH 2Y7MA 2P8MB 1MI5E 3EYSL 3ZDZF 4BQ6A 3G08A 1ZK5A 3GIZL 3IBEA 3Q8AA 2XKNA 1V27A 3GPEA 1TU2A 3NESA 4WW2B 2JSFA 1CCZA 1ET8A 4GKNB 3G6JF 2AS5M 2BNRE 1J88A 2VUYA 1VKXB 3HAEG 1OAYH 2KYIA 3V4PH 4YSQA 4OV5A 4PS4H 5DJZB 4PJBA 5ESQB 4WSGA 4R6UA 4HCRH 4TUKL 5EC1B 1JYNA 1MRCH 1JXKA 4DP5X 5F7EH 1W72A 3ESVF 4YUEH 4Y2LA 4XMKH 4M9OA 4OLXH 4TPRL 1MJ8H 5FECB 2F7IA 3VXMD 1XCQA 1D5BA 1O6VA 4TUOA 4GH7B 1YEFL 3UO8B 1PDKB 4A66A 1U36A 2WP3O 3WV0A 1EFXD 3KLKA 3VGAB 3M86A 5SV4A 3G5ZB 3L2MA 3LZLA 2L7QA 1K4DA 3GIVB 4NO2B 4XC1L 4I0PD 4OQTA 3ARDC 3UOAB 1JZGA 2Y2TA 3D85D 4K5LA 1HHHB 3H6AA 5C0CE 5DD1L 1GC1C 2IBZX 2E0PA 4EDXA 2AJUH 3EZ8A 3NFSH 3ESUF 4UM8B 3DPDA 3RFRA 3I75A 1T0NA 1YN7A 1ET7A 4HSCX 4P46D 3NJJA 4P5TB 3JT2A 2X44D 5DZLA 1AKJA 1I85C 3MODH 3Q1SH 5E0FA 4D9LH 3VD9A 2YD3A 3FRUB 4ZFFB 2BSCA 5G5DB 5M94B 4NQSA 3PQYB 4KZEH 1UJTA 4KZDH 2W38A 3DRQA 1X7SA 2XQYK 2FO4B 3MPCA 1VDGA 5IEKB 1WAAA 2APWA 2J6EA 1SUHA 3K6NA 4NNPH 3QPXH 4BWWA 4LCYB 1WUZA 3EFDH 1TETH 1G9EA 4P3DA 1USQA 4Y2DC 2LV4A 3SDCD 4IW4C 5ID1B 4I3SL 3CDFA 3QXWA 1UB5A 1A14H 1CD1B 2QQLL 5BS0E 1CGSL 5E2TL 2QFPA 4F9PA 4PG2A 4PJGA 2J55A 4H8QA 2P44B 5DTFA 2NY7L 3RL2B 2XCMC 3CPLA 4FA6A 2A4EA 1O7DC 5CS7A 4CA4A 4F33A 1K8IB 1DQDL 1KEGL 3DJRA 3FQ2A 3ZDZE 2K6YA 1S78C 1KTCA 1UJ3C 4D7PA 1OPGL 3WNIA 2VISA 2YAQA 3KW8A 4X99B 5IB2A 4BKTC 1UD3A 4HUKB 2IXQB 4IGBC 3G6JE 1PLGH 3ETTA 3VFSB 3EZJB 1QR1A 4LOUC 3QIWA 1QKZH 1A6TB 2Z92A 1M3IA 4N4YB 1E50A 4Q6IA 1VJSA 4X9GA 4X7SH 1F13A 3QK0A 1Y0LA 4PI0A 1YNLH 4WU7B 3VTMA 2VAJA 3DSFL 2DQDH 4JRYA 4HUWB 5AAMC 1SY6L 5C07B 3EYFA 2FNWA 5BPPA 3BP7A 1G7LB 5KSAC 3FUDA 5DS8A 2VDQL 5F3BB 4CN6A 1IEHA 3E8UL 3MCYA 5DLLA 1IM9D 3ZKND 3BCFA 4HIHB 4MAYD 1H5BB 4BFEA 4YDVB 2NZ9D 5KYWA 1X4ZA 4RDQF 3BAEL 1HQRB 3MREB 4PRIB 3WAJA 2CCLA 4NQDE 4LPYA 2VLME 3FRPG 3C87A 4KQ4H 3WFEL 4WO0A 1YNKL 1BEYL 4ANKA 4NKOB 4NQEB 4Y1AD 3DHUA 3K2UH 3SKJL 4ALAL 3UZQB 4V2CB 4YBLC 4I4WB 3VXUA 3P3TA 1RZFH 1AHWB 4PS8A 1UC6A 1D7BA 1OCZB 4NN7C 3OJDB 4JVWA 4LAJH 5I1KH 3LS4L 3EBGA 4FQJH 4LLQA 2ALWA 3OKYA 1U6AH 3DIDA 3KG5A 5MHSE 3BWSA 3H4HA 4UT9H 4YHNA 1RVFL 3DX7B 4NGHL 3AU1A 2VN3A 1KV7A 5TE4L 4EOWH 2NX5A 5L4FA 3TEWA 1Z1WA 2V8MA 3KGSA 4FNQA 2AXGA 1KPVB 2VUOA 4JVUA 3AROA 5LNGA 5D1ZA 4KROB 4IMKC 3ZYZA 3MRDA 1AI1H 4OLUH 1MFBH 5ERWB 1IM9A 5HY9B 4S1DC 2D3JA 5C08D 2BY2A 2EDRA 3H9SD 4PLJC 4DPRA 3WSQL 4Z6AT 5D1XD 1S7UA 2AK4E 2X2UA 1FNSH 4KK8D 5GS2H 3ZZSA 2XPZA 1E4XH 4L1DA 4OGZA 2G60H 3MRFB 1TENA 3HZYB 1E5YA 3HBZA 1QBLL 1ICTA 1WIUA 1XH3A 3ZW3A 2F19L 3VI3E 3N3EA 4FG6D 3F04A 3DURA 1ND0B 2F2HA 1M3JA 1ZPLA 5HYJD 2CO2A 5EU3B 4GQQA 2HKHL 1GW6A 2DWEA 3N43B 1JF5A 5I5MA 1FJ1A 3AUWB 3MLYL 4HXBH 4IKKA 1FNGA 3BCDA 4J1UA 4WI0B 1BQRA 4NQED 3KZ8A 2NW3A 3CDCA 4WO4B 1TEYA 2IAMA 1WAAF 1Q9LA 3QJHA 5D7LD 4M7KH 5IESL 2F7RA 3W37A 4CMHB 3S3DB 3CDZB 4PRPE 2R1WA 3U82B 4QRRA 5KYXB 3AU0A 4FHBD 4HHWA 1OTUC 1IFHL 3RTQD 3QO0B 3LAFA 1V3LA 2ZX5A 4XBEL 5GZNC 2R4SH 3C75A 2HJLA 3QW9A 4QO1A 1WIPA 2E6QA 3L3GA 1MI5D 2C3HA 5CHNB 2DIBA 3RDTD 3SN6N 1G7JA 1S9YB 3HE6C 4ZD3L 5LNEA 2X4SA 5I1GL 5IHZA 1CK0L 4RNRB 1B4JL 4DGIL 5IJBC 1NOFA 2OMZB 3IMRA 5DJCA 5BQ7A 2K0RA 4AY0A 1DQLL 3BUBA 2IANA 1WEJH 3EJTA 1N6QH 4HKXB 3LKRB 2GSGA 1IMHC 2CZNA 3BZEA 3HN5A 3QDMA 4N1CA 1WICA 2VTFA 1O5DT 3CLEL 1CGWA 2FWUA 4HIQA 3K4DA 1QSEE 1PSKL 2PP9A 2A6KB 3WIFA 2CKBH 1JZDC 3EGXB 4F37F 3IPEA 4R4BB 3KYMA 4L4TE 4NQCB 3RDTA 3V2AR 4L5FL 3W2DL 1B3IA 4G7YL 1DBJH 1THAA 3QUXC 5C97A 4AIZA 2NYYD 1X7QA 2LABA 1WHOA 2ARJB 1UH4A 1KGJA 4QT5A 5GRUH 3S37H 1HEZB 1KJVA 4GRLC 4MQXC 3UAEA 4KI5C 2ADGA 2GJ6B 3VFGL 1E5CA 1QLEL 1O6SA 1RZKH 1QAWA 3EF4A 1N2RB 3N2JA 3QDJB 1PZUB 3GGWA 2DV6A 2DL9A 5JNYA 4PRPA 3BEWB 3VRLF 5K93A 2YUXA 1CFSA 4NNPL 4LNRB 4NZRL 4RBPK 5GZOC 4K9JA 3SCMB 1RXLA 4WO4D 4LAQH 3T65A 5CMAA 2NY4C 1HHKB 3BIKB 4OKVB 3P02A 1CB4A 3D18A 1XDTT 5GS0D 3G9AB 3L5WB 4PJ8A 4H20H 5FA3A 3BESR 1RVFH 3ALWA 3FTYA 3P73B 4TQEL 2RBLA 3K5RA 4JCWA 1MJUL 2WLLB 2EJ1A 2YRBA 2VC2L 2H45A 4PV9B 4JFEA 4UUJB 5A16A 4AYID 4N90E 2E8ZA 2ZJSL 1JPTH 1Z9OA 2I24N 4GXVH 5L2JB 2WYIA 2XTSA 5IVXB 4KKBC 1U41A 2PWDA 1JTTA 3S88L 5DJ0A 4BD4A 1YDPB 2J1ZA 4LSSH 3CZKA 4TULL 3PHOB 1HQ4B 4YNYA 1CFQB 1IAMA 4S0SD 1V8HA 2N7SA 3SJVA 4GW5A 2YD0A 4OFYD 1FGVL 1UXSB 4B3VA 4CVXA 2VDNB 2FJHB 3PL6C 4N2AA 2JELL 1JAEA 4WUUE 5TK2A 3BN3B 1TZOA 2Y6SD 3IMSA 1ZHBA 3SBRA 1I3RB 1BZ7B 3AQXA 3FMGL 3FUMA 3WLWC 4DCQB 2EDLA 3IMVA 3OMNB 4LLVA 15C8L 2XWTB 3EO9L 4LU5L 4HPHA 1JGDA 5DDHB 1XSOA 3MBEC 3ZZ1A 2CDEB 4ABVA 4HFWA 1KPRB 1F2XK 3QFGA 4WFHE 2ZKYA 3MUHL 4XMZA 4DEWA 4FP8H 3ARGD 4YDZA 1LP9F 3X1BA 2EICA 3VH8B 1PQZB 1AC0A 4AMKH 3P54A 3WLBB 2AABL 4YPJA 1NC4D 2VDKL 3KE0A 4PP1D 1VFUA 4MMYB 4DQAA 1ADWA 4OUUB 1MOEA 3WL9A 5E00B 4XNYL 1J9QA 3KPSD 3RY5A 3EADA 2XBDA 2X0WA 1NGXB 1AZUA 3MV8D 4QAMB 4QLRA 2XVGA 3F5WA 4XP6L 3ZDXE 4DHLA 5HHVH 2GFBB 4X7EC 4Z3TA 4KKNA 2F54B 3B3BA 4N6RB 4W9FC 1CGSH 5E2TH 2V2TB 3UBXG 4O2EA 3NJNA 4LSVL 3UZVB 3T5WA 2NY7H 1HOEA 4GAYA 1IJNA 3QUZB 1BOYA 4ELMA 1WAEA 3ABGA 1M57B 4G2AA 3VWJD 2HMIC 1RUAL 2CO6A 4AC2A 1U42A 3EFDL 3DV4B 3LNEA 4XC3L 3VUAA 1OSPH 2ROYA 4MB3A 1UWEL 3MBED 3NEXA 3IGKA 1R34A 3D18B 3N40P 5CEZL 3PWNB 2QSQA 5E5RB 2H32B 2X87A 3OHXA 4DOHB 5LDUA 2UY6B 3MLVL 2Y0SA 1DJXA 3CK0L 4PRIE 3BFOA 1FC1A 3C08H 4FFZL 2VLLB 1LWRA 1JOIA 3UBFA 3V6FB 2E74C 4BYHA 1MVUB 5B22A 5JHLL 2BZ7A 4NM8L 5CZXC 5E6IC 4MD4B 5F0MB 3PWVB 5E23A 4D9QE 3BP6A 4X8JB 1B2WL 2HH0H 2Z34A 3L3JB 2LQRA 3KPMB 5B3SB 4W9GC 4CVUA 3KBHE 4G3YH 4A7TA 5T1LD 4W9CC 1P53A 3E6FA 2GITA 3EBIA 2QVKA 2JI1A 5JIIA 3ASOB 4HKBB 5D9SB 3CHSA 2DQEL 1TCMA 3QC6X 4JZOA 1TQUA 5DFTA 5IFJA 4H40A 4JGMA 2EKJA 3B43A 4QYOA 1S7WB 4EIGB 2CBMA 4JY6B 2WTPA 1KXVC 2VW4A 3MNWB 3SY0B 2ZKMX 3JYBA 4HK0A 3KWXA 1OAUL 1AD0B 4PJ8C 1HHIA 1R75A 4BWUA 2WNKA 3KWTA 2DQ6A 2NY4D 1IAIH 4UT6H 2A4CA 2IWFA 3HNVH 5B1JA 5IHZB 4LEXL 4NM8H 5I9QB 4K9EH 3S36X 2J6EL 5T1MB 2JTDA 1XGUB 2XWRA 1SHXA 5DFWH 3VWJB 4FFYH 1KN4H 3FCGA 5JXAL 2XZCL 1BZDA 1VZHA 3BKJL 1RIUH 4PJ9A 5LG6A 4WFED 4O4YL 2JKJA 2LE9A 1NQBA 4N2EA 1U30A 3NPSC 3L5XL 5MENB 3W0WA 1CD9B 2KLRA 3OQRA 5CD5D 1A7RL 1MCHA 2B15A 2Z91B 1EGJL 4OQTL 2MPAH 3CGTA 3INUH 3RZWA 4XNUL 5D7IE 4YDLC 4H25A 1WFJA 2Q3AA 3QWRA 5ISZD 3VCLA 5EZOH 3BUYB 4FTVA 3R0NA 3T6ZA 2VSMB 1NEZG 5B1CA 4LSUH 1PZDA 4DP8X 4HLZH 4ICWA 4WGWB 2O6CA 4L4TD 4JG5A 4Q89A 1OAXH 3QCUL 5DRXB 3ZU8A 3MLWL 2F54E 4EAEA 3DETC 3TCXA 2X4OA 4MLSA 2ZCHH 4OJYA 5B39B 3GMQB 5M7QA 4FZEH 4KX9A 1AGBA 1PMYA 1R0AH 2CHWA 4UANA 4U1IA 5LHDA 2BCKA 1CL7L 4MRCA 3VG0L 4PRNB 3RWCA 3X3GL 3Q13A 1PF3A 4DK5A 3VXSE 5C0IB 2BW4A 3VFMB 4NPJA 2X6MA 4N8VB 1BG1A 3QPKA 2HLFC 5HPOA 3KBFA 3RWCB 32C2B 2GYSA 2NX5B 5FM5M 1FLTX 4P05A 3SDDB 3KXFB 1NCBH 3U48A 5DC4B 3TFKC 1NLDH 2CDGB 5B21A 2UUDH 4XXDB 4Y2NA 3VXRA 4NYLA 1HZLA 3OC5A 1KB5B 4OJCA 1NL0H 2WD0A 3HHMA 3SQOH 4C54A 1KSRA 5I1AA 3S88H 2WSKA 3LXBA 1I8LC 3HCVB 3HMXH 3QH3B 2WXNA 4AEIL 4KQ3L 5BZXA 3OKNA 3GO1H 4OQ1A 4P4RA 5EIIG 3L4ZA 4S1DD 4XPTH 1CQKA 5EN3A 4CC4A 1EPFA 4AYFB 4WY7L 4UDTB 5DQJA 2O26U 3QORC 5CLWA 3VFOB 4N8CL 1CK0H 1MIML 3H9HA 4NM4L 4DGIH 4M00A 3VU1A 1ZGLA 4FOMA 2JQZA 5D72L 3PP3K 2QHLA 3RNQA 3S4SA 2QQKL 3QJUB 3TZVC 3ES6A 4L1HA 8FABB 3WFCH 3A22A 4UV4L 4JFTA 5DJYA 2K9UA 5BW7C 3CZJA 4NRZB 5AZ2H 2VOTA 5KOMC 5E94B 2H1XA 3Q1SL 1NBZB 5JOPE 3F6LA 3LS5L 2FTAA 3K74B 1PS3A 4IK7A 4Z78B 4A2FA 1RZPA 4MXQD 1SMOA 4M7JH 4XPFH 3OJ2C 4LQFH 3LEXA 3VFSA 2R8SL 2YD9A 3O8XC 4LEXH 4QUOA 2EDBA 3Q2CA 1C12A 2YRPA 4N22A 5F9DC 2BVYA 4XP6H 2UZYA 3RE0A 3ZUCA 3MUY1 2EIKB 1C5DA 3LXAA 1NSNL 3CFCL 3ESMA 4XXWC 1UFUA 1GXEA 2DWDB 1NPUA 1YHPA 3G9VA 3V7AG 1UD5A 4ICXA 4OT1H 1DEEA 1FFPB 4N24A 4XO9A 1TZ8A 3LZNA 3DTDA 3FQTA 2H6PB 2X41A 2J2ZB 3CIQA 4BK4A 5CJXC 3JV6B 4GRMA 4P5KA 3NABL 4WEUD 5F2FA 4QCIB 4A37A 4A2DA 3CLFH 5E70A 4EUPB 1FVCB 3QXDB 2BSED 4HFUL 5ICZA 4EI0A 2F74B 5E1AB 3T0EA 1XXDC 2RIKA 3T04D 3II2A 1ZD6A 2ALAA 4AMXA 4IDJH 4E0RB 2NTFB 1LEKA 4PGDA 1XTMA 1UUSA 4XGZA 3IGFA 3UO1H 1KLFB 3WDIA 4FFWD 3O4LE 4XPHH 1A6VL 2Y1ZA 2NYKA 2FLRT 4LEBA 4BSVA 1H0DA 1WBXB 4N8UA 1P6FA 2H32A 1OP3K 1XL6A 2B9BA 1ETJA 3D50A 1TZHB 2NNCA 4FQXC 1IU1A 5FKPA 3U2JA 1YEKH 1XSIA 5I8KL 2YD6A 1WQVT 2ZXAA 1XGPA 4XVSL 5AVRB 2NR6D 3ML9A 1Z3RA 4ELMB 4L3AA 2KDGA 3L1EA 1VESA 1CLZL 1VZIA 4N6RA 4X6DF 1YNKH 5I30L 3EUUA 3KM2A 1MHEB 4JREB 4ONHB 1E4JA 3MRCA 1GSMA 4HPYL 1XX9C 5GRZA 5CLTA 3LKQA 3PDOB 2G5BA 1E65A 4IBYA 5JOEA 1WTGT 4OV5B 5JW5B 2NCEA 5E8OA 2YPVH 1J8SA 2R4SL 3MV9A 1H8LA 4W93A 3IM1A 4F1ZA 3FQNA 2NY6B 3C60D 2Q10A 4NN5B 2A5UA 1ZT1B 3B2XA 1DBBH 1NMCB 3MQIA 2AJYH 3RTQA 3FU5A 43C9A 1KLUB 4O2FB 1CT8B 1S6NA 2XWDA 3ETBF 4HH8A 3LHAA 4D0BB 1BVOA 2Y7NA 4HIEB 4HQQL 4OLVL 3OB0K 4NC2B 2CDEA 3QHFH 1DUYA 4L29B 4ZTPH 1Z3GH 2X4RB 1OZUA 5FYKU 3BKYL 1S8DA 1DVUA 3F6JA 4C83B 3BDYH 2XV3A 3MRMB 2XZAH 3QXVA 4CJ1A 4RWYL 1OPOA 3P2BA 3I2CH 5TE4H 4X0NA 1M05A 3V5HA 1IBZA 4I9WD 2A6JB 2ZUTA 3H2PA 4Z76B 5EO1B 1SHMA 3HI5L 3PHOA 4XN8A 2B8OT 1LO3H 2FHFA 3JV0A 2VDMB 4ZSOB 3T2NH 3FQRA 2E7DA 1UOLA 2OULB 1JV2B 5F9JA 5AYTA 2PCFA 1S9VA 1RK7A 1RZ7H 2WLIB 2WXGA 2VDLH 4GW4B 1N3NA 5DWUL 5G55A 2P52A 2VWEE 1JGEA 4ERSH 1XB6A 5ID0A 1LP9B 4G6MH 4JM4L 1J8KA 3E7JA 3WO3B 4RGNB 3CFKB 3TBCA 5FUOH 1MHCB 5FA3B 4GI9A 1BF2A 4P2OC 3DMMB 1QA9A 2VDQH 3VD2A 4OKVA 3T65B 4LSRL 5E4AA 3L4YA 2JXMA 3W5NA 3MRRB 3PHAA 2OR7A 3A6BH 3SGEH 2JQMA 4NXSA 4Z7WA 1MFUA 1HOCA 3CLFL 3FCSB 4IRSA 2VMCA 1FCGA 1CDJA 1R3LA 1R3JA 1QSEA 3IF1B 3WS6C 3IMBA 1RPQA 4IBQA 5HPMA 3FT1A 4X6CE 1QFWM 1BREA 3ETSA 5ALCL 2FX8L 5D4HA 2QJDA 2XWCA 4QCIA 4X98A 1ETZA 2NNXA 2JB5L 4LSTH 4Z5RB 4OI7A 4NUGL 1PAZA 3KLLA 1ETA1 4GB9A 4LPTA 4MVBD 3GBML 4JFDD 4HSQA 4P9HL 1OP3H 1FQ9C 3I84A 1SF5A 3QUYC 5DK2B 5GS0C 1MFEH 5GGSY 2YUVA 2V6HA 5LJYH 1L9PA 4YOKA 1OM9A 4B7IA 4FQ2H 3LYRA 3CLEH 4QRAA 3P40A 4YE4L 1JDAA 4NJAH 3QIBC 3ZVVA 3QIUC 1XR8B 1XR9B 3CVBA 4OF0A 5B4MC 5JIHA 4M5ZL 3FOMA 5F3HB 5BJTA 2D03H 4PGEB 3HZMA 1MCBA 4AQ8A 1HS6A 1RP8A 2DTML 3P77B 4E41D 1AGFA 5JW3H 2XG5B 4OCRL 5E2UH 1CGVA 2WWNA 1SXZA 3CD4A 2YPVL 1SJHB 4HAGA 5DJYB 1ZLUH 5SX4I 3WE6A 4FERA 3HFMH 2XACC 5TE6L 2EUXA 1F90L 1TG8A 5CEYB 1KELH 2ZXGA 1OLZA 4J2XA 1IC1A 1RSYA 2OP4L 4V11A 1AGCB 3H9HB 3MLUL 1E8ZA 4KMLB 2Z1PA 2OZ4A 2ATPA 3NSDA 1JXGA 2VR8A 1XIWA 4ZQTA 2F6AA 1QPPA 2QPEB 3TO4B 4PMEA 1EXGA 1KGCD 4JFQB 4Y2DA 3MO1B 2WNWA 1NC2A 4Z0XB 1JDDA 3CZGA 3CXDL 1ZHLB 1O7SA 2IMMA 1QYGH 2HVKB 2DYRB 3KGUA 3OLGA 4OW6A 1CTOA 4XNAA 3SKMB 3QQ9D 4J28A 2YR3A 1L9MA 4XVOA 5E8DL 5E9DB 1UM4L 5C0CB 4CN4A 5IR1B 1JHTA 2Y5TA 4X80L 2IV9A 4B5ZA 2YA1A 1AP2A 3T2QA 4N8VA 5HJBA 2J44A 4HSAC 4DQOH 5FF6A 2F5BL 1TJGH 4H8WC 4M6ML 2UWEE 4OLZH 3UZVA 4YHMH 2X0VA 3LNIA 3PQYE 4YWGL 3P0GB 3TJPA 1MFBL 4FXKB 3LIZL 5DJ6B 3BH4A 1BQLH 4OGQC 4M6NL 2BH0A 5FDWA 3GMQA 4UQ2A 1OW0A 1XCTA 2WTRB 3VYPA 4ODXB 2EKSA 4IBZA 1ZV5A 2M2DA 4BFBD 3STZA 2YMTA 3PV6A 1T7YA 3L3DB 3OXRB 4MCZB 3VI4A 4YHZH 3U30C 3ZQ9A 1A5FL 5EFIB 5KYUB 4WHCA 4MKTA 1F02I 1GS8A 4ZOEA 2XUWA 2JJSC 4GKNA 4FLOA 4OCLC 5IFHH 1BFTA 1P4IH 4YAQA 5LN8A 4S0TD 5CJQH 1UWXH 3FB5A 4Q6YA 4WNQB 1M7UA 5F3HA 2A83B 3BUQA 5ADOH 4JJ5B 5DO8A 2Z91A 4HISA 4X6EB 2VERN 4F58L 3UBGA 4F8PA 3EJCA 4Y16A 1JWMB 2WBXA 3JUYA 2YAPA 4K3EL 5AOIA 2XBTA 3WFBL 3FQUA 4F9LC 3HS0B 1BPLB 4N3UA 2ZUUA 3BVWA 3SPJA 1CFVL 4GBXD 2NX5E 2H5UA 4N8CH 2E7LA 3FHAA 5DUBA 4LF3B 4GW1A 2X4QA 5I8CB 1L5GA 4GW5B 1SDYA 4NQQA 2W0FB 2FT8A 4FMFA 5IHBA 5JHDD 1RZ8B 3QDMD 2W9EL 1K8DA 2P5WA 2DN7A 4PJ7F 2BP5M 1R5VB 2VRAA 4L1SA 1UOKA 4EI6A 4KXBA 4Q6IC 3GHEL 4Y4KA 4ABWA 1YO4A 1HKLH 5FGSA 4E9LA 2BVQA 3KYKH 1OM3L 4NKQB 3GTNA 2CGRH 12E8H 1PG7H 3KR3L 1VFMA 5I6KA 3D8MA 3BAWA 3SCMC 4MSWA 4UWQB 1C9SA 5AVXB 3JT0A 2NW2B 3FQYA 2QDVA 2W95A 4U3HA 4POZC 1NIFA 4FNUA 5CKGA 5F1IA 5FOBA 3V0GA 3W9DA 2IFGA 1JXJA 1MWAA 2PPCA 4AJ0A 3HR6A 1T0MB 1FNAA 1KBBA 4H1LG 4DVBA 4Z77A 4WFGE 3HLAA 1UB5B 3CN3A 3RP1A 2VB5A 2H26B 2C1PA 2VH5H 2QQLH 5I30H 2AEIT 3WNKA 3BE1H 3F05A 3V6OA 4GQ9H 3ZN6A 4QRPD 2OQJA 3JZYA 1H19A 4XP4H 3O9WC 4EUPG 5HYIA 3H2QA 3ULUD 1ES0A 4MMZC 2Z7WA 2JCCA 2L3BA 1RZJH 2ADIA 2VR6A 3BUPA 3LRLA 4PQXA 3UADA 3HG2A 4JDVB 4XO4A 2VNCA 2VSKB 1I1AC 1YN7B 4PGJA 3SODB 3U4BL 4KRPC 4ZMTA 5JOFB 4LESA 2OZ4H 4QPEA 2WXQA 2NUT