4IBWA

Human p53 core domain with hot spot mutation r273h and second-site suppressor mutation t284r in sequence-specific complex with dna
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
200
structure length
197
Chain Sequence
SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVHVCACPGRDRRREEENLRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title Structural studies of p53 inactivation by DNA-contact mutations and its rescue by suppressor mutations via alternative protein-DNA interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 50
structure length 197
sequence length 200
ec nomenclature
pdb deposition date 2012-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ibwA00
2IOMA 3WTTA 5A7BA 4IBTA 2ATAA 3WTXA 1HJBC 3WU1A 4GUOA 1HJCA 5BUAA 3D06A 4AGQA 5AOJA 1HU8A 3D08A 5KBDA 4IJTA 5G4MA 1LJMA 1TUPA 2ADYA 2BIOA 1CO1A 2PCXA 3TS8A 5LAPA 5G4OA 3KZ8A 3VD0A 2X0VA 2AC0A 2IOIA 2RMNA 1E50A 1H9DA 1CMOA 5AOLA 4AGPA 1EAOA 1GZHA 3D05A 4IBQA 2OCJA 5AB9A 4IBWA 4MZIA 4G83A 4L18A 4LOFA 3VD2A 2AHIA 4IBUA 2XWCA 2BIPA 5G4NA 4AGMA 2WGXA 3D09A 1IO4C 2H1LM 4LOEA 1T4WA 2J1XA 1GZHC 3WTWA 4KVPA 2X0UA 2J1WA 4AGNA 4QO1B 3WTYA 2BINA 5LGYA 3IGKA 3WTVA 3IGLA 5AOIA 2GEQA 2J1ZA 5ABAA 2MEJB 3VD1A 2VUKA 5AOMA 4XR8C 3D07A 2IOOA 1EAQA 4G82A 4IBVA 4L0YA 4IBZA 3EXJA 2YBGA 2BIMA 3WTSA 5AOKA 1KZYA 4AGOA 4GUQA 4HJEA 4LO9A 3Q06A 3EXLA 4IBYA 1TSRA 2J1YA 2J20A 4IBSA 5ECGA 2BIQA 3US1A 4L0ZA 4A63A 4MZRA 3QYNA 3US0A 1EANA 2J6WA 3ZMEA 1YCSA 3QYMA 3Q05A 3D0AA 1UOLA 2XWRA 3KMDA 2FEJA 3WTUA 2J21A 4AGLA 2X0WA 3Q01A 2P52A
chains in the Genus database with same CATH superfamily
4UAOB 3LS4L 2AXJA 3C6LC 5C0FB 3TF7C 3C5ZD 3GTTA 1IC7H 4YSCA 2CDGB 4B60A 4OKDA 3CH1B 2E56A 2OJZH 3IRZA 4XXDA 3RA7L 2VDKL 2CCLA 2FT6A 2PYEE 3IPEA 4Z3IA 3NIFB 4O02B 3ULUF 1MRCH 1YEGL 1MLCB 2DQCH 4KKCD 4O2CA 3VE0A 1Z6JT 4F5CE 1ACYL 1HH6B 1NC4A 1DSFL 4QOKA 5AZUA 3QEGH 5L9DL 1MLBA 5MENB 3JZ7A 2VZ3A 2VOTA 1RQ5A 5ALCL 4F80A 3MYJA 3AXIA 4UUJB 1KV3A 5KYWB 1NCIA 4R5XA 1EIBA 2XWDA 1D6EB 5D1QB 2CO1A 2DDQL 1I8MB 3N41B 4ZPVA 1YY9C 1KG0A 1Z5LA 4YFLF 3INOA 2RMNA 4ODHH 4C4KT 3C08L 4MCYA 3CLEL 5D7IF 1BF2A 1DBMH 5LNDA 4J3OF 1S9VA 4PJDA 1LO4L 3EUDA 3U4BL 4D3CH 3TCLB 2YFNA 5J13B 1FL6A 1MELA 2CM6A 2ZUYA 3AW5A 4LBEA 4ZMAT 3FU8A 4JY5L 5IHHA 4DVBA 5AW8B 1ZD6A 3UPAA 4WWKC 4BJLA 2P44B 1AY1H 2P48B 1G7PA 1QLFB 2A83B 2VTFA 4L9LA 1IGJB 4XODA 1KLUB 3UTSB 5CJXA 3EOTL 3TFKC 3F8UB 3FN9A 3APFA 4GP5B 2VT0A 4IOSD 2XPZA 2IAMC 3AT9A 4MYWB 2EKSA 5GZND 4N85A 2XG4B 5ADOH 1DVZA 1CGSL 1SN0A 5I6XB 1EHXA 1ONQA 3FONA 4NZUH 1JWSB 1XIWB 4JM2C 1KIUA 4NSKB 4AQAB 2OR9L 3EGDB 1OGAE 1JYWA 4LLUA 3RNQB 1UB5B 3ZTCC 2X4UB 4M61A 5JHLL 3KDMA 5FB8B 4JAMB 5MEOB 4ZPTA 3RVWD 5D93B 2VUOA 4FN0A 2VLLA 3ARSA 5T3XH 4PJ7B 2IQAA 3GQFA 2EKJA 4PRPB 1S5IH 4ZMOA 3BPLC 4Y2DC 5FLUA 1XL6A 3GRBA 1MY7A 4WUKH 3OR7B 3RGVA 1R3IL 3SGDH 3WXVL 2B1HH 1JYVA 2LQRA 5FYLE 1CI3M 3ISWA 4N8UA 4N20A 2Q7AA 1HE8A 1P7KA 2AJZA 1TJHL 2Y7SA 3HA0A 4YHOL 1KV7A 3K1KC 4P4RA 3U7WH 3T4AC 1PKQE 4D0CB 4HX1B 5K1JA 1F8TL 3DSFH 3RHWK 4UTAA 1MAMH 2BDNH 1BMGA 4WGKA 1I8LA 3IPFA 2IWKA 2IOMA 4OZFG 5AVRB 2FBJH 1TQCC 3MUY1 4OJEH 4FHBD 2TSAA 5HVHB 4TNFA 5CMAA 4IBTA 1G94A 4PRBA 3W2DL 5GS0H 3W9DA 4OCSL 3QZPA 4Z3EA 1OW0A 1YJDH 3H0TA 1I9RL 1KJMA 4I18B 4RMTA 4YDNA 4YO0B 3KXFA 3VACA 4QWWC 3C5ZB 3IDMB 4YSRA 5DD0H 1IM3D 4X8JB 3UJJL 5KVFE 5EA0L 3CN4A 1AO7D 4RRPA 2VC2B 4MAZA 4YL9A 5CN3A 5E24E 3BN9C 1XSKA 3F58H 4OLYL 2RH0A 1PD0A 5C0IB 2XC8A 1NEZB 1OO2A 1EHKB 1S9XB 4FNLH 3TYGH 3BPCA 3FQRB 1QLEL 3LZRA 1B0GA 2CUMA 1P4UA 4JB9H 1ECZA 1KN4H 1GKOA 4A7TA 1PU0A 1RVFL 3G5WA 3M8OH 3AREC 4WWKA 5LJYH 4DEPB 1QA9B 3KGTA 1RUKH 2DIJA 4L18A 2P46B 5I76A 4XX5A 5IMLB 1LO3L 1PZAA 2LABA 12E8L 4FJYA 1AE6L 4L4VE 4XHJC 3WO4B 1T2JA 5FUOL 2CALA 2K6WA 2YXWA 5ETUA 5JW4R 1KCVL 1LNUB 2FAUA 5GZOA 5EF2A 5ESAB 3CG8A 5F6IC 1W16A 1QUNB 5CZXD 5E70A 1UT2A 2B59A 4KHXH 1J0YA 2HX7A 4JFDD 5IW1A 1UCBH 2YAOA 1RERA 4JHWH 4N5ED 2CNYA 4TTDC 3BVDB 4U6VH 3RJOA 4H5SA 2XICA 2QV4A 3DJTA 3L3GB 1L0XA 3LQMA 2A1WL 5AAMC 5LXGH 5A6IA 1QD0A 3T0XA 4K2UH 1XH3B 2EIBA 3DOIA 4ZD3H 4W9EC 2F7RA 1ACCA 1IQDA 1EBAA 3IT8D 1OARL 4Y2DA 4QJ5B 1ZS8B 2VR4A 5AQ0A 2OYPA 5LLIC 4QXGH 3RUGB 5C2UB 4HWZA 3C2AL 3ZYJA 3VFOB 5HHXH 3V0WL 3KPOB 2X87A 3HE6C 4B27A 3S5LB 3DYMA 1RK0A 2NY5C 2QBWA 2ORBL 1XD0A 1T5XB 4M8VA 3EYFB 5HHPA 4XNDA 2YA2A 3ZJAA 3M1BB 4JY6B 4HHGA 1EANA 4BFBD 3HPLA 4AYGA 3WYRA 3P9WB 3D12B 5D1XD 3VGHA 5F9DC 3TBYB 1XDTT 4HK3N 3VG0H 3MV9D 3O3DA 1MXDA 4L4TD 4ZO7A 3CFDA 3QQ4A 1MZYA 1PIGA 1YEWA 4LSSH 3VQMA 4AM0Q 5FO8A 3EBAA 2ZP0T 5C0RL 5KG9A 2FUQA 4QRFA 4TQHA 5F7LB 2FQFA 1U8JB 3VXRD 4H13C 4NJAH 1E27B 1W15A 3FTUA 4NUGH 1XCQB 2DEWX 5KSBF 2LFEA 4JQXC 4PRNB 4DFIA 1AGDB 4FGMA 4DO6A 5CIPH 4ZS6D 2VC2H 5JA8B 1RZIA 3E2HB 4UV7L 5CSZB 1U8NA 4DK5A 3S8GB 2CU9A 1BWMA 4ECNA 3ROLB 4ALAC 3SDAC 2DMKA 4R7DA 4OCYH 2A4EA 2BIOA 5CBAA 4Q97A 2VDNH 3LZOA 5DEJA 1WT5C 3VXOB 1PLCA 5KWYC 2VISB 3HOGA 1IM3B 4M7ZC 3UTZB 3ZE2E 2AC0A 5DFVD 2HP4A 1AO7B 5DMYA 5C0CE 4ADJA 4E0RB 3UJTL 3ZTNL 4K94H 2EE0A 1F5WA 1BYPA 1BZ8A 4ZDHB 2ESVD 1CFQA 4OZFH 4X6CF 2W9DL 2H9GA 3SGDI 3MRBA 1XL4A 1DQQA 4P23D 4ODVH 1ZE3H 4OU3A 3RVTD 3VXME 1XB6A 3REVA 5HYJE 2IPKA 3MNWA 4MVBC 5IMKB 1IX2A 2YOCA 5AAMA 3ARFC 1FO0L 3LZNA 4N1EA 4O2EA 2OMUA 4MB4A 3FFCD 3GXIA 1MEXL 3HZYA 4LVEA 4FXKC 1VFUA 1TQBC 4MBRA 4IJ3B 2ZXEB 2NSXA 1CU4L 4DP4X 1Q72L 4PRAB 2UUDH 4KAQH 4M62H 4JFDB 1DR9A 4EN3D 4JHAL 1QFOA 4AIZB 1O0VA 2F15A 1KCUL 4ILDA 4JKLA 4X6EA 4PB9H 2CJ3A 4NZTH 2UZYB 1Y1UA 2HG5A 4FEIA 4HV8A 3L3IB 4WHTA 2EXSA 3KPPB 1MN4A 1OGTA 4B53A 4WI5A 4NWUH 3TJHC 5B22A 4NFDA 4E2OA 1L5GA 2OYKA 3LEXB 1H0DA 3ROOA 3COOA 1JV2B 1PGRB 1UT1A 2IBZX 1BAFH 4RA3A 1H6FA 1NUNB 4UU9A 5TPWH 2VWEC 3I6GB 5FGRA 1QKZL 3T0AA 2YA0A 4NYLB 3P4OB 5CXPA 3B2XA 1S7SA 1Q0EA 4A7GA 3L9RA 4OFIA 3LXCA 3K2UL 3K2KA 5IZ7A 1UWGL 2YD2A 3II3A 4HSCX 5E6YA 5IBTH 4YZFE 1C7TA 4NZ8A 3B6SA 1YUHB 3RX5A 3QR1A 2FECL 3VI3A 5D1XB 5LCVA 2VXSL 4LSRH 1NC4D 3MV9B 4L4TB 4QOKD 4BFJA 1X9RA 4TLUA 1HJCA 4GXUN 1T0MB 5C8JB 2ATKA 1W72B 5DXWA 5KEZA 1VFMA 4K55A 2KZWA 5AOJA 4R0LC 5IVXE 1S5HA 3VXRB 2EVFA 4XMPH 2NUTB 1R3JB 1O7SA 3JWOC 1X5XA 4PJBB 4OF5A 1GTNA 3BWZA 3OKNB 1Z7JA 3VQ2C 4ZZKA 5EEWA 1QHPA 4XVSH 1D6VH 4WF7A 2WYIA 4XNYH 1PYWA 4OZHF 3RB7A 5DS8B 1N0XL 3BC9A 2DEYX 3D33A 3LSOB 3NSDA 4G5ZL 2QHLA 4M7KH 5IEKB 2XN9A 3G5VA 1R46A 3HZVB 3KPLA 1NM9A 4AENA 4KVNH 1GPOL 2A6DB 3GM0A 5LAXA 5AB9A 1HTYA 4WJ5A 1CD0A 5EZLA 3N06B 2DJMA 4PB0L 4N0YH 1VZIA 4EMZA 3C5SA 6PAZA 2Q20A 1ERNA 3SGKA 3FO2A 4POZD 2N7BA 5I1KH 2ESVB 3W38A 4X4ZA 2EDTA 1DSYA 1XVSA 2HKHH 3MCKB 5E00B 2WHVA 3F12A 4P23B 1JOIA 2DOCA 4RGNB 5IB2A 3DGGA 2RGSA 4HIEA 3Q48A 3V6OE 3TT1H 1KBKA 1R19A 2XA3A 2I7OA 3DROB 3KLHD 1FG9C 3ECBA 3CN0A 2Q8BL 4HC1A 2EZ0C 5TDNA 3QDMD 3FFCB 1UD5A 3VD1A 3C8KA 2FB4L 5EOCL 1YMME 4Q89A 5D7KE 3FB7B 3QNZB 3L1EA 3PIQA 4KPHH 2F58L 3PHSA 5E2VH 3RGVD 1AOZA 3VCLA 2R0WH 3MJGX 4EN3B 4PD4J 4P9MH 4WTXA 5DSCA 5E99H 2EIZA 2ZUUA 4QRUB 5L88L 3FYIB 1OB0A 4ZQTA 1EBPA 2AJUH 2ZOLB 3O2DH 3H3KA 3OGOE 5CGYC 4Z9KB 3HVNA 3V5HB 1IT9L 3BDYH 3UOAB 5GSRB 3MX0B 1GY1A 4N2IA 5CZVL 1BOGA 2EEAA 3W39B 4A67A 2KZ1B 4GBXD 3GSOB 5ACZA 4TSAH 2R2EA 2JXMA 1J5CA 1F90L 3DIDA 2W1NA 2HJFB 4J8RA 1CICC 3K6SA 2WW8A 3MREA 3FSAA 4FKEA 5JHMA 2X5PA 2JLPA 3G04A 5KS9A 3KXFD 1W72H 2YGVA 1SDDA 4TSCH 5FGBC 1B2WH 4NUPA 1KGCE 2G60L 3NOIA 5I8OL 4S1DD 4XXDB 1YECH 2YPLA 4PRIA 3SY6A 1A8ZA 1JUFA 5J4MA 2K45A 2NX5E 5AAWC 4O2CB 2W95A 3VE0B 5I9QC 4MA8H 5E94B 3OAZK 1NC4B 2H1PL 3EOAA 4QOKB 5FS5A 3RRQA 4WI0A 1KXQA 1MLBB 4QCIA 1MFEL 1P9MA 4LE8A 5E6ZA 2YEQA 1IFHL 3BMVA 3SPCA 1ZTXL 2ZF8A 1PEZA 4OQTL 1LEGA 4E36A 1TZOA 2DQJL 1NDTA 2V7NA 4FMFA 4I3GA 1NFAA 4WWKD 5CD5D 3KWVA 1BVNT 1IL1A 1JHLL 4N26A 4QHNA 4ZPVB 1KG0B 1Z5LB 2XA8H 4JUTA 2CK0L 3UC0H 3LKPA 2D8KA 2JI2A 4MCYB 4UILH 3OZ9H 3R8BB 3HNTH 5GZOD 1CDJA 4A6YH 3CK0L 4PJDB 1NCCH 2WKGA 3S8FB 3B5HA 5C0AA 1DFXA 3ZKNC 4LBEB 5I6OA 4ZG1A 2VE6A 4NXSA 4DVBB 1EJOL 5E1QA 1WITA 2EDNA 2R56H 2Y2WA 3PJNA 4JX0A 3N41F 4ODBD 4M48H 5DK0A 1G7PB 1AGCA 1Q8MA 3U6RA 4M8UA 2J4WH 4L9LB 1NMBH 4TNVF 2FIRT 3WD5H 3RFRA 2JJSA 4Y2DD 2YARA 2NCMA 2GJ6E 1VRSA 3U25A 4IKKA 4UIKL 3RAJH 4FAAB 3QEHA 2EKSB 4HBCL 5GHWH 3DK0A 3CHPA 3E0GA 3CZGA 3DK2A 3GBEA 2DQUL 1ONQB 3BSGA 1V27A 4LCYA 3FONB 4FCHA 4MNGE 4OBRA 3P2BA 5B1JC 3B9KC 3V7AE 1KIUB 1AQMA 2MTAA 4BZ1A 4WZ9A 2OM5A 4LLUB 4K9EH 1VGKA 4CU6A 4M61B 1IAIL 3KDMB 4RRPG 2DZEA 4ZPTB 4YDIL 2VLLB 2XXFA 5E2TL 4YWGL 4W9IC 7FABH 2IQAB 3LIZA 4NHCL 2Y7NA 1MWAA 1MRFH 1URLA 2OL3H 4FFZL 3RGVB 1XGRA 2O26U 4W93A 5KBMA 1YCSA 3IAQA 5H2BA 3C6LB 1P7KB 2AJZB 2YKLL 1YYML 3GLEA 3T09A 3HZKA 3WN5C 1FHGA 4P4RB 5IQ9A 3GXDA 4CDHA 2XYCA 2X0WA 1S6NA 5J12B 4F2EA 1KLGA 3BRDA 3DX7A 4Y5YC 2F19H 4PJ7F 2HVJA 4GXFA 1QSZA 1VFBA 2Z0UA 3HG3A 5MI0B 3EO9H 4DQOL 2ZD0A 2D31A 4WY7H 5FGCB 3ASWA 2OZNA 4OLXL 5CMAB 2G5BA 2UX6A 4EBQL 3IDJA 4PRBB 4ZOAA 3W9DB 1M1XA 1KELH 4FL4B 4V1DA 3TVMC 1LO2L 4XVUC 2B5IC 1KJMB 3H0TB 1RZKH 3KXFB 5IV2B 3QG7L 4GQQA 3S4SG 5HI5C 1E5BA 1H19A 2L8AA 4KZDL 3OMAB 3MACH 3MNVA 4GEIA 4WO4A 1E5AA 1TJGL 3QDJE 4QY8A 4XO8A 4OF7A 2B2XH 2FJHA 1S7WA 3VD0A 1BM3L 2E7DA 1T83C 3H2PA 3BPCB 5BQDA 3VGBA 3U30B 1B0GB 1UURA 3CMOL 4XN8A 1FSKC 3ZDYE 3OKYA 1ZK9A 3VU1A 4FYRA 1EHLL 5EZOH 5GQBA 4M1CC 4JREC 4G8AC 4P5SA 4TTDD 5I19H 4WWKB 3BZDA 1GYUA 5EEUA 1NCJA 4JGMA 2FR4A 4LKXA 1NCBL 2GAZA 4P2YA 1A6WL 3DX6A 2GABA 3MLWL 1VB9A 3D7PA 5I76B 2KH2B 3GMRA 3CX2A 3GZKA 4C4KO 1BWWA 1CD8A 4S2SA 4LPCA 1NIBA 2B59B 1A3RH 2VMDA 5IW1B 4FQCH 2BXYA 1X9LA 3TT3L 3MLRH 1IEAB 5I8CA 1TQTA 2H6OA 3LH8A 4DO5A 2XZCH 4H5SB 3IJYA 4OGAC 4OJYA 4YXLL 3JSSA 3O0LA 3VGGA 1TMCB 1K8DA 4KU1A 3CWGA 1IQDB 1LK2A 2XSKA 4EKJA 3I9GH 4Y2DB 4OF6A 5IT2L 1FFQA 4P46C 3TA4D 1TXKA 3AMKA 4ZNEE 3TURA 3ZIMA 4HWZB 2CBTA 2JH2A 1KJ3H 1Z9OA 1YVLA 2IGTA 2X10A 3L5IA 1R5VB 3THMH 2JNZA 3JYBA 2CMRL 1RK0B 1SPDA 2AGJL 3A67L 2H2PD 4YDKL 1IM9A 5HHPB 1D5RA 2EXWD 3PXLA 2FLBT 3TNNA 4BFOA 1W0WA 1WAAF 2WQRA 5I74B 4WUUE 3RUGF 3O0RH 1IAOA 2FUTA 4JG1L 1WFIA 4NQUA 4KO5A 5DK3A 4RCAA 5DQDL 3V9FA 3ZX1A 1QHOA 3O3DB 4ISVA 1OAKH 2F1BA 3CFDB 3QQ4B 1AQ8A 5CP3A 5FYKL 4RIRA 1UKSA 1U3JA 5I6PA 5FO8B 5KG9B 5D7LA 1BXVA 4HJUA 4DP8X 5IGXL 4FNTA 1HJBC 1RPKA 1TTUA 2EADA 4PUBL 4DF9A 1W91A 3X17A 1QATA 1U4FA 1MHPH 1Z3RA 2MHAA 4ZODA 1RZIB 1A6UH 1SBSL 1HC1A 1U8NB 2OYLA 1BQLL 1OSEA 4KK5D 1XGTA 3X3GL 1BMZA 2JI1A 3BQUC 4PD4K 1O9ZA 2XN9D 4R7DB 1M9SA 4M6ML 2PCXA 1HESA 3P3UA 3QDHA 5CBAB 5MHSE 5JQ6L 1UASA 4EIZC 5ECJE 4YDZA 3T0EC 3ME0A 5TH2A 1WS7A 4K7PL 1NEPA 3KLDA 1A0QH 2JKXA 5EOTA 3WFZA 3TX4A 3UG5A 4LRNL 3ARQA 5DS1A 2LLGA 4LP4A 3NT0A 1SYVA 3CIAA 4NHUA 5DMGD 1CFQB 2C9PA 1LM8V 3DVFA 2EDWA 2FO4A 5EFIA 2H9GB 2I60H 1G9NL 2AJYL 2DY2A 3MRBB 3SO3B 1K5NA 3X1FA 5J11B 3OJDA 1U2YA 1DQQB 4QGTA 1NAMH 3UAJC 4PSPA 5DEGA 2VR8A 4POYA 4BK8A 3QPQC 1VIWA 3REVB 1OD7A 2IPKB 3GSXA 5ESVA 3LIUA 3MNWB 1SOXA 1RZ7H 2OS7A 2V0AA 3S48A 4X50A 4K7FA 2DV6A 2NNFA 2OMUB 4M29A 4O2EB 4ONHA 1QFHA 4HFWA 3HZYB 5DGRA 1P53A 4Z7UF 2DLTA 4OLWL 1QFUH 4UQBA 4P46A 4XP9L 2W59A 4JRFA 4X4XA 4L8CA 1FRGH 4JPVL 5CJOL 1DTUA 3E38A 2GITA 4YSTA 4X6EB 4NPJA 2Q7YA 2HTLC 3CDFA 1QI3A 2HG5B 1SF3A 1A8JH 4HV8B 4WHTB 4NWTL 1HXYA 1OK0A 4FQ2H 1OGTB 2DF3A 3MODH 3DBXA 1L5GB 2X6MA 3T3PE 1GGIL 1H0DB 3P3RA 3ROOB 1GCFA 4IRSC 2X3AA 5ABDE 3MGOA 1BFOA 4TVPH 4HZ1A 5JIMA 2VLMD 3IEAA 3LQAC 3BZ5A 5DVNA 1DO6A 5BS0A 1G9MC 1S7SB 3GRGA 2GI0A 2R0KL 3L9RB 3BEVA 2OSLA 4S11A 4JANA 4ANWA 4MGXA 4GLRH 2FHBA 3VI4E 2OMXA 2JQZA 4Y1SA 2YPLD 1IGIH 4PRID 3A21A 3B6SB 3VA2C 1Z5HA 4JFOA 3DSNA 3VI3B 1RCYA 4JMNA 3VNZA 1F4WH 2IH1A 4XN7A 4PGDA 3HC4H 5HHVH 3ATAA 1P5UC 3BQUA 3TZVA 4PG2C 2YHGA 2ATKB 4JN1L 5LKNA 1N59A 3CFTA 2FZ3B 1FQ9C 1S5HB 1S4IA 3KYKH 4G11A 2NY0C 2YS4A 4KKBC 1MIML 4M7ZB 3V95A 3KLQA 4EXPX 5IK3A 4OZGE 4UDUA 2Q8AH 4U7KA 3SDDC 3O2VH 4YSQA 2JJTC 3IMVA 4WW2F 1JDAA 1TTRA 2XG5A 3KEDA 1A3QA 5JR1L 3WNOA 3CZJA 4LVNB 1ZVHA 4PR5A 1PYWB 3OKKA 1QUPA 3T1FA 5GISL 1JD9A 2BXZA 5JDSA 1FGVH 3GXTA 4DGWC 2WTPA 5C0AD 1CMOA 2XN9B 3G5VB 3OD3A 1J86A 5F2FA 3KPLB 4AENB 3MPCA 3V4VA 3GO1H 3HC2A 4JO3L 5LAXB 4UB0H 4AH2A 4WJ5B 4PJBF 1A9EA 2XJKA 5EZLB 2W8CA 4LAQL 1WHPA 1H3PH 3BYTA 4RFEA 4AGMA 1C1EL 4ALAL 2WBWB 3C5SB 4LOEA 2PPFA 3FO2B 1HHIA 2D9QB 4XN2A 3G6JA 4DVRH 2CCVA 2WN2A 2H0FA 4KVCH 3SDCC 1J88A 1KYFA 4MMXA 3Q2VA 3B9DA 3F12B 4XP4H 5IB2B 3DGGB 4HIEB 1KUMA 3WJJC 2EDHA 5KJ4A 5I0YA 1FVCA 4H1LA 4PWKA 4B0MB 2GEQA 4AK1A 1NCDH 1GMIA 3ECBB 5FXCH 4OI8A 4LNVA 1IC4L 5TDNB 4HEPA 1CLZH 2X41A 3FU0A 3C8KB 4KROC 4MZ2A 4F58L 1QFWH 1SM3H 3G5ZA 4IRSA 3V0DA 2KT6A 4G3YL 3FTXA 3PIQB 3INUL 2F54A 3QO1A 1TCRA 4ONFH 3TOPA 5A2JH 4I0PC 2D4FA 3RIFF 3VCLB 5DC9B 5DSCB 2VXTL 2Y5QA 2EIZB 4HD9A 4P5KA 3SQOL 1MRDL 2WKOA 3DOHA 2DAVA 2BOLA 1K2DA 4PWIA 4R83A 1RIVL 3UP1A 2APWA 3L3DA 3U9UA 1CF1A 2NR6C 2J5LC 2ENPA 3CZUB 3VD5A 3S97C 5C6TH 1BOGB 1MJ8L 5K9JH 4ZFQA 5LCVH 1XFPA 5ACZB 4XMVA 2R2EB 3HHRB 5L4IA 4HS8H 2JXMB 4PG2A 2QPUA 4V1DD 4J8RB 4WVRA 1RY7B 3K6SB 3MREB 4HF5L 1CGXA 3G04B 5ILTH 5KS9B 5BV7B 4N22A 4FXGA 1SDDB 5DHXB 4R97B 1OQXA 2X4SA 3CHRA 5KOMC 1X5AA 2JJTA 3S3BB 5CKAA 2YPLB 4PRIB 5SWZA 1BSIA 4I88A 4WO4D 1OP3H 1JUFB 2A0LC 3FULA 3QHTC 4W4NA 5J1TC 2VDLH 5AKTA 3CN3A 4KX9A 2LV4A 3IFOA 1RIHH 4M5ZH 2PN5A 5DJYA 3EOAB 3ZKND 4WI0B 1W8EA 1T6WA 4QCIB 4HALA 3QUYC 2SEBA 1CBVH 4ES8A 2WXRA 3AT0A 1BAWA 1LEGB 3ESUF 4JY4A 1ZA6A 2V7NB 5ISZA 3W11C 2W81C 3ZLQC 1IL1B 1FYTE 4G7VL 4JZOA 5C08A 1DJWA 4WO0A 4QHNB 2MOQA 4MD0A 1IGYA 3BPOB 3LKPB 3F3HA 4YHKL 3GMNA 4KXAA 4Y0GA 4PJAA 3MKKA 5E4IA 5EF0A 1QHQA 4F57L 4PJEE 3JWOL 5C0AB 1I7TA 3PGFL 2VE6B 4KJQD 3IDXH 4HWEH 2QV2A 1AACA 4HIJA 4KQ3H 4ZS7H 2ZWYA 3ZHKA 5DK0B 1AGCB 4GLRI 3U6RB 1JHKL 2OZ4L 3WIHL 3O6ML 3K3QA 4L5FH 1H3XA 4NN6B 3SJVE 3VTMA 3KPTA 4F33A 2FE0A 4TSBH 1W9XA 4PJDF 4JO2L 1LWRA 3PABA 4I0PA 4PJFE 2FYYA 1FO0A 2BNUA 3QEHB 4PN6A 4HCFA 4UQAA 3LKOB 2DTSA 2X4QA 4OFVA 3FO9A 3GINA 4U6TA 1BVOA 4L0YA 2LE9A 2NY7H 4JKPH 4M93C 1E9QA 3T0BA 1DL7H 5D8JL 2YBGA 5DD1L 1Q9LA 1VGKB 3B7TA 5D6DA 2EIKB 3ARGA 1WEJH 3TH4T 5INDB 4PJIA 3ZRSA 4FYQA 2D7TH 3WS6C 1CZ8L 1MWAB 2WUCH 4JM4H 4LDCA 4MJJA 1XGRB 1VESA 3MOAL 1MCRA 3JWDC 5B4MC 1CI5A 3Q05A 1UJ3C 2AQSA 4RA0C 4EUPA 3ZN6A 5H2BB 4UZUA 1VPOH 2D73A 1CTMA 3BRGC 3HZKB 3VFGL 2ITFA 5D7LD 3EYUL 5IQ9B 1JE6A 1FFPA 4OT1H 3K8LA 4LU5H 4RGOH 5BV7H 4JFSA 2EIJB 2YQGA 1D3CA 4AW4A 1KLGB 1V05A 3DX7B 3O41A 2HVJB 1VFBB 4HUKB 3QRGH 2B08A 4PLKD 2O93L 1OAXL 3QCUH 2D31B 4K4KA 5ALBH 5I9QB 4MWFA 1I7RB 1FJ1A 1U30A 1FFOA 1AFVL 2G5BB 3IDJB 3MLUH 3GLDA 5L0QB 1M1XB 3E6FA 4KDVA 4V1DB 3HE7C 1JRHL 4XCEA 2NDGA 2K8MA 1TZHA 4H2CA 2XKNA 2I69A 3U82B 3A6BL 3SE8H 4Q6KA 4H26B 5A2AA 5CLZA 4OLUL 2A73A 3TFBA 4BZYA 4HEME 4DKTA 3FYEB 2YPVL 3MNVB 4DCQA 4HJ0C 4WO4B 4PW3A 4QY8B 3WNPA 2FJHB 1S7WB 2GC4C 5C09A 3NQIA 4P5RA 3QI9A 5HVGB 4RBPH 1RZJL 4KGLA 1MFMA 2BOBA 4OZ4A 3SGJC 3KDPB 5HGHA 5MEPA 1HZLA 4NPYA 3C8DA 3OLDA 3EBIA 2HFEA 4ETQB 4OZIE 5D4QA 2FR4B 3CV5A 1RUQH 4HOMA 4LKXB 1QVOA 2GAZB 1ORQA 3DX6B 3L4TA 3FC8A 1MFCL 1CS6A 1XXDC 5DR5L 3GMRB 3CFCH 4BKSC 3CU7A 4LQ1A 4P46D 4S2SB 4OFKA 4QRSA 2YUVA 4IOFC 5HJGA 4XHQA 4I9WD 5H37A 2R7EA 4MA7L 4WCYH 4MD5A 4HSAC 3WY2A 4GOSA 5I8CB 1U95A 3TLRA 4HYTB 4I5BA 4ZW5A 4M4RA 2OP4L 4HAGA 4BE6A 3IJYB 1A9VA 3IJHA 1YNKH 2Z65C 2WQUA 1YC7A 3QG6A 5KYNA 1K8DB 3I6SA 4Z7QE 3ULVC 3VW3L 1LK2B 2VN3A 3NZSA 1OSZA 4LEOA 2AAAA 2OXGA 4Y88A 3ZE1B 3PAUA 4EXKA 3GSRA 2BIMA 5J6GA 3GXUB 2TSBA 1DVTA 3MZTA 4BWWA 2WK2A 4DN4H 4L1BA 4FZEL 4AMXA 5BS0D 1WS8A 4XXCA 3FTZA 1JPSL 4HQQL 4DOHE 4J7RA 5JNYA 1PZUB 1G43A 1BAGA 2PR9A 5MP6H 2NMSA 1IM9B 3HFML 5J56B 4HIXL 2FYVA 5BXFA 4C59B 1TQWA 2FX7L 3TNNB 2UUDK 4WWOA 5KVDE 1W0WB 3HI6H 3SCMC 1AMXA 3M7OA 5EDXA 3PP4H 4NC2B 3QJVB 3HZ3A 1IAOB 4HT1H 3S34L 2VDQB 3G6DH 3BQUD 4J6IA 4ISVB 1TPXC 3TZVD 3WTTA 5I0DA 3MQIA 3KPQA 2DMGA 4RIRB 1IQWL 5E95B 4M4PA 1JVOA 4Y5XC 1PLGH 5D7LB 1JNNH 1F11A 1KTBA 4FABL 4GUOA 3HRZA 1LP9E 1WJ3A 3U0WL 2HKFL 2WZ6A 1E6JL 2V6HA 3X1BA 1LHZA 2GB2A 3DURA 4S1RL 2XBTA 1D5IH 2MHAB 2EIMB 2C3HA 4M1GH 3QHFH 3FQUA 4MHHI 4QXUL 4GRWH 1XGTB 4ENZA 1GHFH 4P5TC 3M7FB 3HG0A 3I6LD 2VDKB 4JREB 3QUXA 1TU2A 5JOFA 1CQYA 2FEEL 2LLNA 2PKDA 4FLOA 1CXKA 2XBZA 4IW4C 1KGJA 5CEZH 1AS8A 1B0WA 2D0GA 4NNPH 5TH2B 3CHQA 3WKPA 4JPQA 5EOTB 3QUGA 4Z7NB 3NABH 3ETBJ 1SYVB 3IMBA 4J28A 4NHUB 5ES4B 2FO4B 3ZUCA 4DUVA 3BGFB 5EFIB 4KY2A 1K5NB 4BGLA 5I18L 3OJDB 2YJQA 5I1IH 2GKIA 3LPGA 5DEGB 4BUQA 3ATBA 3GIVA 1E4KA 2I32A 1WWWX 3U1SH 3GSXB 2HTLD 5ESVB 2EC9T 1EUTA 3ZPDA 4AQ8C 1BQUA 1F1AA 2BVOA 1F0LA 2ICCA 2B15A 4QHLA 4XO9A 5GS1A 4ONHB 1SEQH 1CE1H 4HFWB 1SQ2N 5L7XL 1C5DA 3QWQB 3UYRH 4TKWA 4BUGA 4IRSD 1TR7A 1YEIH 3CVHL 1WBXA 3Q2CA 4P46B 5JUEL 4GG6E 4L8CB 4X4XB 2F54D 5F96L 4LIQE 4XNUH 4NQXA 2BFGA 4MMYA 2YQBA 1KXVA 2GITB 2P8MA 5GRXG 2OAAA 4JFYA 4WAFA 2X6CA 2Q7YB 5CLWA 4XPAL 1UA6L 4LRIC 3HAEA 4FTVE 2VM3A 4S1SH 4OM1L 1HXYB 2Y06H 4K5OA 1YN7A 3ZQXA 4RAHA 4AI7A 5BMFH 3SCMA 3DBXB 1ZJBA 1JS4A 1Z0MA 2IADA 3LN5B 4IKJA 4NBXB 1AIFA 2F8VA 4XC1L 3ECVA 2LVCA 3MGOB 1BFOB 2VDQH 1NSNH 4UT7L 4CMHC 5BS0B 3N1QC 1KYAA 4F7TA 3SE3C 2C4FT 2X6VA 2R4SH 4Y5XA 3BEVB 3GHBH 3G9VA 2OSLB 2WOYA 4JANB 3UL4A 2KZBA 2DBJA 4Z78A 4LBAA 1L7IL 4TVUA 2WQVA 5KVGE 2KI6A 4EIUA 4F7PA 3WKQA 2OMXB 2JELL 3MLXH 5IOPA 1TF4A 2QGBA 3N2JA 3F01A 3KPMA 4JFOB 3DSNB 3IGFA 2BC4A 2ATAA 4DKEL 2NW2A 1TTGA 5FCSH 4OCRH 3LS4H 2IH1B 4X5XB 4PGDB 1GL4B 5HYQA 3L9YA 4O51A 4RFNC 3BQUB 3BAWA 2CHZA 4A7GF 1NPUA 1CURA 4H1LG 5B3JF 3RA7H 2VDKH 1N59B 3SDYL 5ISZD 1IKNA 5MERA 2OCFD 3LXAA 1YEGH 5IK3B 2V5RA 5C08D 4GT7A 4UDUB 3EO1A 3T2OA 2J55A 5F6HJ 4ATTA 2GJJA 3TCXA 3ZVVA 1ACYH 2X7LA 4CVUA 1DSFH 1ZHLA 3VI3F 3X12A 2XG5B 4AJVA 5BRPA 5L9DH 1N6UA 3ZKQD 5FYJD 4ZK8A 4PR5B 5ALCH 2WNGA 3OKKB 3T1FB 4MQ7A 2DIAA 3KE0A 3ZE0E 4FXTA 1QYGL 5EN2A 1F1GA 2A9NL 3UAFA 3MROA 2AEWA 4H7VA 5JDSB 5AW3B 2LAAA 1J0ZA 4FMKA 4U1KA 1E42A 2DDQH 3V4VB 4R2GD 3E6HA 3E9UA 1YEFL 2J57A 4AQ8A 3C08H 4AH2B 1JWMA 4JKKA 1QBML 3CLEH 1A9EB 4KKAC 4RFEB 3HPJA 3BH9A 4HSQA 4NGHL 4BK5C 4XBMA 3DETC 3V55A 1LO4H 2ZG1A 3U4BH 1HHIB 3X1EA 5FIEA 3G6JB 6FABL 4DGYL 1HCFX 3NA9L 4JY5H 5J5EA 1U33A 4MMXB 3WIAA 4TXVB 5C07E 1MQ8A 1TTBA 1XTLA 4XB3A 3CN2A 5KSAC 4HS3A 3CXHK 5EULV 5CFHA 2AMGA 1FVCB 4KKNA 4H1LB 2JCCF 3NJHA 1I85C 2XVGA 3EOTH 3ARGD 5HDRA 1YUKB 3G5ZB 4IRSB 4OUUB 2DJSA 3ELQA 1CGSH 4JW3A 3RIFK 2F54B 3QO1B 1TCRB 4OGQC 3SBWA 3C9NA 1EEYA 5KSVA 4FJZA 2OR9H 4RH4A 3QZNA 5JHLH 1OXYA 1SHMA 5CLTA 5J7CC 2XWTA 4TN9A 3AY4C 4P5KB 3L5JA 2VLJA 1K2DB 1RLWA 5EV7A 1JPFA 4U3SB 3IGUA 3L3DB 3WXVH 2YWYA 3U9UB 1Q90A 4Y4FA 4WQOA 3MJ6A 1TJHH 3R18A 1GY2A 3HNSL 4YHOH 3O9WC 2JJWA 2N7SA 4K5MA 1XAKA 5BQ7A 1F8TH 3WJMA 3KNBA 1UTDA 1TNNA 2WVSA 3MO1A 4RMVA 2GBAA 4FXGB 4HOZA 4G8IA 3NCJL 1S3KH 3QUML 4PCSA 2X4SB 3LQAL 1CDUA 3VXUA 5SWZB 1G9ML 3V7MA 3W2DH 4OCSH 5DFAA 1I9RH 2ZX5A 3IFOB 3CSYA 2OFQA 5C09D 5DJYB 4LPTA 2EE9A 3QI9D 4QRRE 3UJJH 5EA0H 4WI4A 1MDTA 2BS8A 1KTKE 4Z6AT 5KS9F 2SEBB 2X0VA 5EZPA 4YDVA 1NIFA 5ISZB 1ZA6B 3V4VH 4KXDA 3ZTEA 2EDEA 4JZOB 3AXHA 3D0VA 5C08B 1GSKA 4MD0B 1IGYB 1YQVL 4NC1C 1QLEH 1U8MA 2VJXA 2IAAC 4YPGA 3RWGA 3WJLC 3LV3A 2PYFA 3U0TA 3D0LA 2WPGA 5FYLL 2ZNXA 5E2JA 3GMNB 4PJAB 4PJCA 5CHNA 3EO0A 5E1AA 4I8DA 5DRNA 3SE6A 5IB1A 2E9GA 4EUPG 1I7TB 4AVIA 4WU7A 4AYDC 4R2GB 4HULB 4H1LH 1LO3H 2WB7A 12E8H 1AE6H 1QRNA 2JLLA 4HIJB 5FUOH 3BAJA 4N2OA 1KCVH 3SSGA 2MNUA 3ECUA 4WEBL 3ZDXE 3IK2A 3P40A 4PS4L 1Z2KA 2OV0A 3RX7A 4F33B 1I53A 5GRVL 4PVNA 4JDEA 2PW1B 3PABB 1OM9A 4I0PB 5B4MD 1OSPL 2FYYB 1KEGL 4OI7A 2BNUB 1OP9A 5BOZG 5IWLA 4ODTL 5KVFL 2A1WH 2X4QB 2XHNA 3FO9B 5BJTA 2E6QA 1Q38A 3WO3B 3AY4A 1E9QB 1OARH 1Q9LB 2CLZA 5I71B 1E5CA 3EW3B 3ARGB 1IBBA 2J5LB 5AKSA 3U1PA 3C2AH 4DQAA 4LSQL 5K9QI 4PJIB 1MAJA 5KJRL 3V0WH 1PFOA 3B34A 3ENEA 1BPLB 4FFVC 4P4KA 4OCXL 2RAMA 2NY3D 1JPTL 1XSOA 3O9WA 3WHE0 5T3ZL 1DQTA 1BD2E 2ORBH 3QR0A 4EUPB 1E4WL 4QHUA 2B1AL 3ABMB 3EYQC 2XZQL 4ELKB 3IDYC 2MKLC 1FBIL 3OC5A 5GGTA 3LNFA 5JA9A 1FFPB 2XWEA 3EADA 4F20A 5DZPA 3O41B 4MXVF 3HB3D 2P43B 3DA0A 1WWAX 5E6IA 3ZU8A 1HOCA 4MWFB 3OWEA 5C0RH 2HT2C 1MW1A 1FJ1B 1FFOB 4KK6C 5E6RB 1CYWA 5PCYA 3E6FB 3E3QE 5I0VA 4Z7OF 4XCEB 3VFSA 3QUXD 1TZHB 4F1SA 2XKNB 2X2IA 4QT5A 2FHCA 4Z18A 3SQRA 3RL1A 1MCCA 1QWHA 4HWBL 1LJMA 4N0FA 1JYXA 3DYPA 3C2SA 4UV7H 2A73B 4U1HA 3BJ91 4X6DE 3UABA 2EC9U 4FD0A 2DQHL 5BVPL 4X4ME 4Y4HC 4HGKC 1KPUA 4DCQB 1G6VK 3L3OC 4M43L 3WJLA 4F8PA 4OD3L 1FZMA 3P0GB 1WK0A 2CGYA 3UTTA 4U1GB 2HVKA 4OVUA 5C09B 1ZPLA 2V5TA 3QI9B 4QMEA 1KY6A 1WF5A 3NJLA 4MYPA 4KWUA 4ZFOA 1IIIA 2BOBB 2E7HA 4OZ4B 5MEPB 5HGHB 4NPYB 5FKAA 2HFEB 3UJTH 3ZTNH 5IROC 4JEGB 2A4CA 2W9DH 1QVOB 1IZKA 1ORQB 1PZ3A 5HBBA 4PW4A 1YQ2A 3L5WB 2HJLA 3QJSB 1QI4A 3ULVD 2RHEA 4OIIL 3UJIL 3TJEH 2WP3O 1ECYA 2FDBP 3BIKA 5CJ8A 4OCMC 1A4JA 3MOQA 4KKRA 2B0SH 4PLOB 1S78C 4JG0L 2R7EB 1FO0H 2XZZA 4MD5B 2CA3A 1MEXH 2N1KA 3NYKA 1RK7A 1U95B 1GH7A 3K80A 4I5BB 2VDML 4M4RB 1NMAL 1CU4H 5T5FA 5L2KE 1VF5C 3IJHB 1KJ2L 1Q72H 3OHXA 2G2RA 3QG6B 4JHAH 1OTTC 3SCMD 3Q8FA 1TO5A 4LEOB 1OSZB 2OXGB 1M7IA 2PWGA 1KCUH 3BSZA 3GSRB 4JFFA 4R90L 3UERA 1E2ZA 2FJUB 2G4GA 5J6GB 2VMCA 3R1GL 5LDSA 3QAQA 3UAEA 4U1NA 2E6PA 3NG5A 3QE5A 4UQIM 2J20A 4H4NA 4WHCA 2QEJA 4EUPH 4C56E 5JNYB 4N28A 4RLDA 1KGYE 4KRPD 5IHBA 3FB5A 2DL2A 3E9TA 2NZIA 5BXFB 1YNTA 2CHXA 3LPOA 1QKZH 1MCPL 2FWSA 3PP3H 2EDFA 4XN5A 2NY3B 1KCBA 4NOFA 4ZFZA 3K2UH 4XWOC 4NLHA 1I31A 4HD5A 4ESKA 4BQ8A 2WLZA 3KPQB 4G9FA 1UWGH 3VTAA 4HGWA 4Z7AA 4G6KL 1IVLA 4JL1A 5F9WB 1F11B 4FKKA 4PRHE 4CC4C 3HRZB 2VXSH 1L0PA 3K72A 4WFHE 2O5ZL 4WTZA 4QRPE 1VFOA 5JZ7C 3TXAA 3DURB 3F00A 3HB3B 2RCSL 3TJPA 1BJMA 1AJ7H 3SPHA 5SWSE 3FQUB 3DRQA 5BZDA 5D2NE 3QUXB 4CL7A 1TU2B 5JOFB 3PREA 5ACMA 2X38A 1MW0A 4GRWE 1FIGL 3S36L 1GS6X 4F27A 1N0XH 5K9OA 3MLPA 4W9CC 4N3UA 4G5ZH 4X7CC 1K9TA 4JN2B 5F9OL 3UGUA 4IGBC 1LEKA 3WUWG 2XWCA 3KH4A 4H8PA 4I0CC 4MDJA 5JHDE 5AVQB 2YXFA 1GPOH 5DMIL 2I26N 4RDBA 5JXAL 4L48A 3UAAA 2A5UA 3KWUA 3BUTA 2H0EA 1PLBA 1EGJA 3PG2A 3GIVB 4PB0H 4EIGB 3WBDA 5FO7A 2ADFL 2ZXBA 1UXLA 5E5UB 2BVOB 5CWSA 4QHLB 3UZEA 5GS1B 4QYAA 5GGVY 4Z7NF 1N7ML 1C5DB 4K5PA 1TO4A 1SRDA 4ZUSA 1SOSA 3I02B 4PGEA 1WBXB 4FC3E 4P2CG 2FVNA 3I3DA 3LY6A 4JFHD 1P4BL 5A1AA 1QSFE 4MDIA 4NQXB 2V2TA 4MMYB 2YAQA 2Q8BH 3ARDD 3MHZA 2OZ4A 1NBCA 4GINA 2PR4H 2P8MB 2HFFA 2Y2YA 2FB4H 5EOCH 4JFYB 2YLHA 5EUOE 5ICYA 3HAEB 1OHQA 4LVOB 2VLJD 3FDWA 1MVYA 1PMYA 2F58H 1YN7B 1HWWA 3SCMB 2IADB 5FAAA 5HY9A 4Y4FD 1AIFB 5L88H 4N0RA 4HKJA 4BFNA 3UZVA 1TPXB 4H8VA 5K59F 4RISL 5IEHA 5IF0A 4F7TB 4JVWA 4IK6A 5GIRA 4EQ3A 2DI7A 1VZGA 2OXHA 1IT9H 4Y5XB 1P69B 1MOEA 4KRPB 3UMNA 3W3BA 4Z78B 3VWKC 2B4CC 1G9HA 4F7PB 1Y6KR 2Q5BA 3WDJA 5IOPB 3VXUD 5DC4B 1F90H 3KPMB 3ZHFA 2BC4B 4GP8B 2NW2B 3PL6A 3UYPA 3CFBA 4D9RE 4XMKL 1T21A 3ZMNA 3I74A 4O51B 5HYQB 3LX9A 3DO7A 2Q2LA 4UV4L 1ESOA 3GNML 2G60H 3JWNE 1A4BA 4NCDA 5I8OH 1XR9A 4LMQE 1A7QL 1NFIA 5MERB 4HAKA 4MLSA 2EVJA 4KI5C 1TUPA 1EX0A 3SGEH 3EO1B 3HJ0A 3DETD 2X7LB 1SXZA 2H1PH 1ZHLB 2WZAA 3EYOA 1VA9A 3NCXA 2CRMA 2GK2A 1MFEH 4PG9A 1IFHH 4PWHA 1V7NL 1ZTXH 4MQ7B 2Q10A 5DRXA 4JVUA 3ETTA 4OQTH 5EN2B 2DQJH 3CCHA 1H8SA 3MROB 4IOIA 5CEXA 1JHLH 2MOVA 4I0KA 4U1KB 4GIPD 3E6HB 2CK0H 4N2LA 4WLCA 5F97E 1JWMB 1QRND 1TJIL 2W94A 2ADIA 3GZPA 1OOWA 3K6DA 1MCOL 1BEXA 3NCYP 4P2QA 1E2WA 3HPJB 3ZO0A 1T3FA 2HRGA 3BH9B 3CK0H 5KBNC 2E86A 3ABLB 4XPHL 3KPSE 1UT9A 5DYFA 4Z0BL 1D9KC 3FT4A 4OF0A 4W9JC 3EH2A 5AOIA 1EJOH 4ZNCD 1Z9PA 4BKTC 5I75B 4HS3B 1AXIB 2XXMB 4PJXE 2J1ZA 4A37A 1RJCA 2O4EA 2X88A 2VUKA 3JVGA 3NIFE 3QORD 4YVUA 1OOAA 5GXBB 3ZO9A 3HAEH 2HLFC 4UIKH 4XP1L 1R6VA 3G6JF 2E8ZA 5B39A 5A3IC 4HBCH 1JP5A 5ENWA 4BA8A 4PBWD 3MXWL 2DQUH 4P4KD 1KWKA 1DCEA 5DWUL 1SJEA 2IH3A 3C9NB 1EEYB 3O9WD 5DJAA 4IBSA 5KSVB 3IDIA 3KL0A 1JPGA 3US1A 1TCMA 2O6FA 1GGUA 1IAIH 2SODB 3US0A 4AQEA 2PCFA 4YDIH 2XWTB 5FUCC 1TQVA 4YWGH 5E2TH 5HDQL 5F3HA 3AS3A 3MBEC 2VLJB 4NHCH 1BQSA 3NK4A 5DJ8A 1JPFB 4X98A 1DDTA 4FFZH 3PQYA 1JZJA 4FQIL 4R4NC 2L4OA 4X4KA 4DERA 1HL5A 2YMXL 5AKVA 2DQTL 4Y4FB 5E6ID 1JGLL 4AQZA 5IJKC 2YKLH 1SLXA 1YYMH 3RY6C 4KQ4L 4LHQB 3Q1SL 5BQ7B 3WJMB 2C7UA 1DLFL 3ZKSD 2IWGA 2RD0A 2E7BA 3KNBB 4MAUL 2VN4A 3MO1B 3S3PA 1DVYA 2WKOF 1MHCA 2IGLA 3V0JA 1JZEA 4OJFL 4DGVH 1XMWA 3ALWA 4G8IB 4DQOH 1ZGLP 5KW9L 1G1CA 1YYCA 4EBQH 4KJPC 3D51A 3UIYA 1LO2H 5D2LE 3UTTD 4LOUC 3CSYB 5IQNA 4D0BA 3DVNA 1CLVA 3QG7H 4WFGD 4A2EA 5DD6A 3V4LA 3BCFA 3DDGA 2V2XA 3L2NA 3MLZL 4KZDH 2ICWA 1Q0XL 4YDVB 1T80A 4JR9L 1TJGH 3CFEA 4JMXA 3CLWA 4PJ7E 3D0VB 1COBA 1EO5A 4PRPE 2AJVL 1BM3H 4FQQA 4JPSA 2HUEA 2BSBA 1U8MB 4B95C 5DZVA 4YPGB 4UI2A 3CMOH 3RWGB 3LV3B 2PYFB 3U0TB 3D0LB 3TEYA 4KJWC 3PF2A 1EHLH 1AH1A 5LQBL 1IO4C 5D7JC 1ZGLM 5CHNB 4PJCB 5E1AB 3EO0B 4KKZA 5DRNB 5IB1B 1G1KA 1NCBH 1DBKL 1A6WH 4WU7B 3VFWA 3WTYA 3MLWH 4N90D 1E3XA 2OI9C 3QZOA 1DQDL 4TQIA 1HFUA 3ZL1A 2GK0A 1QRNB 2WJ5A 4AQOA 4ZT1A 4AG4H 4BZ2A 5AB0A 3M1OA 4NZJA 2WSPA 2TRYA 1MXGA 4X0KA 4Y1AE 1BBDL 4H0GA 4RBPK 1O7VA 2DQMA 2HWZL 3TT3H 1SXCA 3P9LA 4PJAF 4JDEB 4JFFD 4P99A 4LLQA 1J0JA 1K5WA 2I07A 3KBHE 3QP3A 4AUJA 4YXLH 4D9QE 5JHAA 4HCRL 4ZW7A 5BJTB 2YD1A 3MBEA 2W65A 4XZ4A 1T89A 3ARXA 1WZ1L 3FU6A 4FX5A 2MKWA 4NP4H 5TK4A 1MPAL 4QXTA 5EUKA 5IT2H 1F18A 2PNDA 4G7YL 2CLZB 3SGEI 4P2AA 2A38A 4BWTA 4AL8L 4E9RA 3TA3C 5I15L 3MV7A 4P4KB 3MJWA 3NH7L 2CMRH 2AGJH 4HAFA 4KK6D 4DTGL 5AG9A 3O9WB 4KDWA 3A67H 4YDKH 4FQLL 4GMSL 1SUHA 2AV7A 4QHUB 1U9KA 1T4KA 2UVFA 4X42A 3T65A 4CVWA 1D5ZA 4G9FD 1PZBA 1TETL 3Q01A 1AMYA 5J1AA 3UG4A 4OF3A 4XAKE 3WNIA 2G3MA 1SOQA 2G75A 2H41A 3QQNA 4QLWA 4PLJD 2DPKA 2J43A 4I1NB 2X4PA 1GIGL 5DQDH 4JG1H 3NJNA 5HDBE 4PJIF 2BZ7A 1P6WA 3RE0A 3GF8A 4YXKH 2A9CA 1VDGA 4RMUA 5E6IB 1U8QA 3HS9A 1HOCB 5FYKH 5KANG 4L1HA 3MI6A 1GKEA 2N59A 4J3SA 3QW9A 4PJHA 1F86A 3VRLF 5IGXH 2DQEL 3Q8AA 1L9TA 3TU6A 4JQIL 3VFSB 1HWHB 3LN4A 2ZX8A 5G4MA 1I75A 4QT5B 2FSEA 3RL1B 4N0FB 1I9JL 2YRPA 1SBSH 1ZDSA 4LCCC 4U1HB 1W2KT 5FK9A 4BQ9A 1BQLH 1R3HA 2V7HB 1KPUB 4GAYA 3ZY7A 3X3GH 2VO8A 4QHKJ 1G4MA 1WFNA 1FZMB 4MA1B 3EJJX 4BE5A 3VGAC 4M6MH 3UTTB 2RJMA 3SBPA 2IPTL 3KL5A 2HVKB 4TV3A 3ARVA 2WXIA 1I9IL 5JQ6H 1QR1A 5IJBC 2QQQA 4ZFOB 1XQ4A 1AGEA 1DVFC 4L8DA 3K0WA 4EZLA 4K7PH 1FH5L 2ZXWB 2VNCA 5FKAB 4ZMXA 2J73A 4LRNH 3OPZL 1GSMA 1TQSA 2DWEA 4BUHA 4LEEA 4J23A 3DJRA 5L8KB 1MCWW 4LVHC 1G9NH 2AJYH 2HJLB 2J1WA 3QQ9D 3VGDA 2ITDA 2LVEA 2YAFA 5FM5M 2XN1A 1GGYA 4CU7A 2XV2A 3BIKB 1AQHA 1A4JB 3T04D 1VEOA 3B9VA 4Y9GA 3GDBA 3AG2B 3NIGE 2J8UA 1XZ0A 4P06A 3LB6D 5H94A 4EKXA 2EVGA 1WZMA 4MCMA 3BCDA 4JO8A 4OLWH 2IOOA 4PWFA 4H8WC 4XP9H 4YJZL 5TE7L 3OHXB 2G2RB 4UCFA 3HG2A 3ULUC 4KNQA 3OXRB 3TA3A 4JPVH 1ADWA 3B1UA 3ARWA 3FQYA 1M7IB 3HW7A 4ONGL 5CJOH 5CP7A 4JFFB 2KKQA 3HNVL 5HXMA 2JB6A 4DEWA 3SE4A 1PZ5A 4U1NB 2EUWA 3IDYB 4NWTH 1MFUA 5GGSA 1AO7E 3TEUA 4F7MA 4HUWA 2VXQL 2EDBA 2ZICA 3UTPD 1GGIH 4X80L 2VDOB 1CLCA 5IM7A 5L8LB 3FB5B 2DQDL 1JFQL 1YNTB 2A74C 3V0AC 3C5JA 5HHME 3TEWA 1G87A 4CKQA 1PY0A 4N1CA 4J3OC 2QZQA 1PX3A 3PL6D 4QGYA 1P2CA 4ZFZB 5C0BA 5HGAA 3ARZA 1E8YA 4TS6A 5GRJL 4PMFA 2VL5A 4G9FB 4JZJC 4HGWB 2HJKA 2XN2A 5CLXA 1OP4A 5BUAA 4AJWA 2V5SA 5F7EL 3EJSA 2V9QA 3Q9QA 4ABWA 5D5MF 4G1EA 3K72B 1NANI 2K1MA 3BIBX 2VDRB 2VO5A 1T66D 2O5XL 4OGZA 1EO8L 1J9RA 3E7JA 5T1DL 3GBLA 2NNXA 4JN1H 4W6YB 3AACA 3DRQB 1MIMH 1QACA 1T1ZA 3BVTA 3W37A 5BZDB 3PLYA 2Z1KA 4NZFA 4QJ3B 2MOGA 3EYVA 2DL9A 4QHPA 1C5CL 4B7IA 1G5GA 4Z7VE 5JR1H 1LWHA 4P2QD 4TQ8A 5GISH 5K9OB 5KBLA 3D85A 3MLYL 1S9WA 1LEKB 2R0LL 1RHHA 4MX7A 2V3FA 4MDJB 2DWTA 4L9DA 1IRAY 3HKFA 4JO3H 4XC3L 5I16A 4DO4A 4KXZI 5T33L 4LAQH 4X7FC 3PAZA 5CN2A 3RL2A 1C1EH 5EU7E 3A6OA 3DWTA 1I8UA 5E0FA 5FO7B 2ZPKL 5BOJA 1FLTX 4R9HA 3L48A 4LGSB 5CWSB 4N1HB 3FQXA 2XTJE 1UEYA 3L81A 3TM6A 3IMRA 1PKQA 4ZUSB 5KTEL 1IBHA 4PGEB 2NY2D 2IDQA 5GGVL 4YVNA 4LPYA 1JD7A 4PRDA 3LZLA 2FNWA 3RKDC 2HLAA 2QVTA 5F7WC 1IBFA 2XWBA 4MDIB 3VXRE 4A2FA 4YHLL 2V2TB 2QL1A 3EH4B 1IC4H 4N2NA 2VH5H 4YQXL 4FLQA 2HFFB 1M2VA 1L9NA 1UOVA 3WHXA 4F58H 1J8SA 3OQRA 3EHBC 3U6XA 3UEZA 5ICYB 1GTFA 4KY1L 4G3YH 4XTRC 4HZLA 3INUH 4PVMA 3O4LA 3ULVF 5T1MB 5D7IA 2L7EA 4PHXA 1CPUA 2GIYA 3ZHLA 5HY9B 3FFOA 3PU7A 2VXTH 1E8XA 4N6QA 3QSKB 4HKJB 3GB7A 1RZFL 4GW4A 4TOYL 1VENA 3SQOH 1MRDH 3LN9A 5IEHB 5IF0B 1RIVH 3QVAA 5GIRB 2OXHB 2JI3A 4Q56A 3EDDA 2ESVE 2FX9L 2YKKA 3TC9A 1UD2A 1L6XA 4GIAA 5TFSL 5F72S 1MJ8H 2QVFB 2KBGA 8CGTA 1HHHA 4JFXA 4XCNA 2ZXGA 3HG1E 4RGNE 4C4UA 2VDRH 3KL3A 1CGUA 3PL6B 3UYPB 4XP5L 5IVOA 4HF5H 1MSPA 4EI5A 3A23A 1T21B 3D08A 4R26L 1WYJA 1FNSL 1XR9B 2V3DA 4HCIA 2A6IA 3EDKA 1NFIB 3S7GA 2HFGH 5JIKA 2F8OA 2EACA 4R96A 1HL4A 2X1OA 2XY2A 3EYOB 4K3JL 1XGUA 4PIBA 4PG9B 4ZX3A 5DRXB 4HWBA 3CCHB 2QADC 3QCVL 3K46A 4IOIB 5CEXB 1G6RA 1V3LA 5JPNA 4MCZA 4IU2A 1X9UA 2OR7A 1TYEB 5I5MA 4KX8A 4JUSA 3GBNL 3ILPA 1MI5E 2WWKO 3RKPA 1PCSA 2ADIB 4YHKH 3F7VA 1OPOA 4P2QB 2HLFD 3H9ZA 1T3FB 2BVYA 4EOWL 1CL7L 3FAWA 4MJIA 5E7FA 1HK6A 2CO4A 5CJBA 4F57H 3JWOH 3QUKA 4X9BA 3T3MB 5IUCA 5ICZA 3PGFH 3FT4B 1DEDA 5EOCJ 3MRGA 1QBLL 1UGNA 3AGWA 2H32A 3OXSA 2OW6A 4LCWE 2P7TA 1KDJA 2B8OT 4LPWA 1JHKH 2OZ4H 4JJOA 3O6MH 3VMOA 3WIHH 3CDGB 2O6EA 5FM5O 3MBED 3CFKA 4KK8D 2QJDA 2NNRA 4JO2H 5EIIA 1HXKA 3F6LA 1INQA 2AXFA 4QOKE 3VG9B 4AZUA 5B39B 2YR3A 2NY2B 1B2YA 5ENWB 3GMPA 4ACTA 2QSCL 5IUSA 3WELA 2QQKL 2Y1VA 3MV8A 4XNXL 1MFNA 3MV7D 1TEGA 3FQ1A 4XB8A 1SJEB 2IH3B 1RI8A 5D8JH 5DJAB 4B5ZA 5DD1H 3IDIB 4U1JA 1JPGB 4NM4L 4HK0B 3T77A 4A55A 4YHNA 2E75C 4OFYA 3F62A 1ML0A 4AQEB 2PCFB 1N5YL 5F3HB 1CZ8H 5TQ0L 3KLLA 5DJ8B 4X98B 3VD4A 2GSMB 3PQYB 1VJSA 4PJDE 3MOAH 3TBSA 4AXWA 3J7HA 2D7MA 1IVTA 1E4XI 3B7RL 5AB2A 5C0CA 4BYHA 3D6GA 4GEJA 4EAEA 2EEXA 2JMRA 2BSTA 2XFXA 4NO3A 3U9PH 3IU3A 3VFGH 3GMQA 2Y6SD 4YLCA 1FNGA 2JKJA 5K1VA 1FH2A 4QRTA 4JHZA 2C7UB 4P3WA 4KC3B 1MHCB 3SYOA 2Z64C 3X14A 3VFRB 2UYLA 2Q87A 3VXMA 1OAYL 3ZT5A 3V0IA 3KWXA 5HYJA 4A2GA 1OAXH 3D4YA 3CVCA 3NZ8A 4M3HA 3E1F1 2EDLA 1AFVH 1Z9MA 4DGIL 1JRHH 5IKCA 1F02I 1U3ZA 3B3BA 3H6AA 4BCXA 2ATPA 5DVOA 4D0BB 3A6BH 1U42A 3DVNB 2B4CL 4BRVA 3J27A 5DD6B 2K3HA 4J8QA 4OLUH 4F92B 2V2XB 2EDYA 1KSRA 2ICWB 2YPVH 3FU3A 4XPFL 1AHMA 5DU7A 3CFEB 1GW0A 2ADGA 3ABGA 1ZHBA 2NNAA 4FTDA 3B8SA 4KUCD 1RZJH 2C9QA 3DMMA 1HAUA 3AU1A 2Y3AA 2H1LM 2AZAA 4XX1G 4DH2A 3GK8L 4YSSA 3GC3A 2IDUA 4HLEA 1WTGT 2XQYG 3K2MC 3BPNC 3VFWB 1MFCH 3I75A 5AW6B 3QNYA 4JHBA 3S3CB 4CJ1A 4U3CA 4YS4A 4Q9RL 2GK0B 4E5XA 1JERA 2IANA 4B9JA 3RURA 3ZZSA 3FQ2A 3QAZC 4X0KB 4DK3A 5BPPA 5E5MA 5HHNA 4PS8A 3HZMA 1TYJA 3CFIC 3TA3D 4MA7H 5CEYA 3D07A 4MD4B 3P9LB 4PJCF 2J71A 4LLQB 1JZGA 3ZHDA 2OP4H 2Z6FA 1OLZA 3QFJE 2I07B 4FZ8L 5A2FA 2F1EA 3LRGA 2V2WA 3VSTA 2TRHA 1UACL 5TF0A 9PCYA 3VW3H 3EJTA 2W65B 1MQKL 3L4UA 3MBEB 1KGIA 4MJ5B 4Y5VA 4APQA 4QXTB 2CR6A 5EUKB 5IVXA 2VMJA 1FORL 2M26A 3RPBA 4XO5A 2ROYA 4L2YA 1WFJA 3F6IA 5F93C 4G7RB 2IH8A 4FZEH 5JOEA 3WKNA 3MV7B 5HYIA 4TUUA 1JPSH 5C0BD 5DZLA 5E8PA 4UANA 4X4YA 2AV7B 3HFMH 4HIXH 2R0ZL 5EEYA 3T65B 1D5ZB 1NDGA 5HDOA 2FX7H 5J1AB 3DECA 3WEAA 2G75B 1FGNL 5F71A 3ZDZE 1M3IA 3HR5A 3PGCA 5ICXA 2YD5A 4F8NA 2X4PB 5CGBA 1QFPA 2CLVA 3LZFL 3S34H 2F5AL 3WTXA 4K8RC 3L4ZA 2VLKA 4V33A 1U8QB 3APDA 4NQCE 4GUPB 3KR3L 4X2UA 1IQWH 4FQXC 4PJHB 2XV6B 5CLYA 1AD0A 4ZXBA 4LL4A 3D8MA 4AVJA 4FABH 1UATA 4JE0A 4B3EA 5J6HA 4F24A 2HKFH 3U0WH 1E6JH 3LN4B 1OWWA 3FRUA 2FSEB 3J8F7 4S1RH 1ZLVH 3BVVA 1UD6A 1CLOL 3BVNA 3V6OA 3LD8C 5D1ZA 4Q4IA 5HHQA 3PP3K 5FK9B 4GMTL 4QXUH 1R3HB 4GAYB 2XVLA 3IDNA 3BH4A 5E1HB 4C58B 4OB5L 1QR1B 4IHOA 4HXBL 4KFZC 2WBXA 3OZLA 1AGEB 2PMZA 4L8DB 4ZBJA 2XX0A 2OI9B 3VB9A 3SKUD 1NLDL 5SWQA 4QLRA 3JWNC 3MFFB 5T1KA 4W70A 1F3JA 2NYZA 5FYLD 2B9BA 5KVDL 5JTWA 2DWEB 1CXIA 2R83A 4BZ2H 3S96A 3V6FA 2ED7A 4LK4A 4OCWL 2WYHA 1CDCA 2AQNA 2ITDB 1Y7VA 4WHDA 1Y6MR 2Z8VC 4ABQA 4WEUD 2R29A 5BRZA 4GH7B 2AVGA 3UBXG 2WANA 4KMQA 4Z3HA 2CBMA 2IF7A 4UT6A 3ETSA 2J8UB 5FX3A 3IXTA 4M9OA 4K71B 2EXYC 4XGZA 1QMUA 5F7AA 5L7XH 1IFRA 1VFAA 1T0NA 1TZAA 3CVHH 5JUEH 1I3GL 3C6EA 5F96H 3FRPA 2HLEB 2ODIA 3H6JA 4CDGC 2H2SD 2C1OA 1T5KA 4OZHA 2BRQA 3TA3B 1PLAA 5CP7B 3GEFA 3VXQB 4U3XA 3OLGA 1WTLA 5ECGA 1GMEA 1M71A 2JB6B 4XPAH 1UA6H 1YNLL 3K4AA 1PZ5B 2NX5A 1OKEA 4UAOC 5D7HA 2GBVA 5LBSL 4OM1H 5IQLA 2OPCA 2B77A 5GGSB 4F7MB 1QRKA 3BISA 1OVZA 2IXQA 4HUWB 2BVQA 4PWGA 5L6YL 4XC1H 3HMXL 1DUYA 1YEHL 4W9DC 2WV3A 4MKMA 2C3WA 3C5JB 5H4YA 4PTUA 5GS0C 4UT7H 3UH8A 1OPGL 4YE4L 4RQQA 4EI5D 3IS1X 1P2CB 5C0BB 3EBHA 5HGAB 3TO2A 1L7IH 4YSPA 1IGFL 2VL5B 3WU1A 1HSAA 1I3RA 5D1QC 3QXTA 1TFPA 2HJKB 2ENYA 1FN4A 3MUUA 1V7ML 3CSPA 2AMUA 4DKEH 1S9KC 1YNTF 3E80A 1RUPL 4G1EB 5E2WL 5EO0A 2YN3A 3PRZA 3GSNL 5GRWA 4LIQL 3VGAB 3ASNB 1KTRL 3WLWC 1KYOJ 2FWUA 4WU5A 4FFYL 3AB0B 3D50A 3HUJA 3B2PA 4HWUA 3SDYH 1LGVA 5DO2C 4JRLA 3ZIYA 2GJ6A 1T1ZB 3ARBA 3D39E 3RDTA 3EYVB 4OD1H 1IUZA 4WRLA 5AOLA 4AGPA 2R2HA 4N8VA 5GGRY 4LVHB 2Y0SA 1A6VL 4MNGA 3MNDA 1YY8B 1QYGH 2A9NH 3D85B 5HYEA 4Q74A 3OM3B 1S9WB 1RHHB 4MX7B 3WHE1 3JBG7 5MEQA 3VGFA 4ATWA 1PD6A 1BZQK 3RKDD 1YEFH 1HHKA 5I16B 1QBMH 1AZNA 1JWUA 1QR4A 5KVGL 3RL2B 5E6SB 1HL9A 2YGOA 2XLLA 4I2XE 4NGHH 3ZQWA 3WTVA 3BFWA 3FN3A 5K9KA 5EZJA 1KGUA 3KM2A 4DGYH 6FABH 3NA9H 1GAFL 15C8L 4WW1A 5D93C 3FQXB 4XPTL 5F9AC 4POUB 5FHBL 3IGAA 4FFWC 2XQ0A 5J3HC 3K4ZA 2IDFA 4A2HA 3BVWA 3MV8D 2LR4A 4K07A 4YSEA 1A21A 1CK0L 5J1SC 1ZV9A 1FP5A 1M2OA 3LS5L 4KTEL 4LASL 4PRDB 7CGTA 2HLAB 2XWBB 2BWDA 5I1DB 5BW7A 4OFYD 3F7YA 1M2VB 2KERA 3WHXB 3V0VA 1AHKA 3KPNA 2QSQA 1UFUA 3BLKA 3ZKMD 3QHZL 5AAPA 4HZLB 3PWJA 4LQFL 3HHSA 3O4LB 3I2CL 2FRGP 1U8IA 5D7IB 4FJ6A 1AI1L 3DNKA 2K78A 3P02A 4WSGA 5HVHC 1QW9A 5IESL 3GTNA 3PUCA 5C0CD 5DFWH 3QDJA 3GB7B 5L4FA 4GW4B 4I18C 1L7TL 4H8WL 3HLKA 3ET9F 1HZHL 3C5ZC 5DVMA 2HKAA 3WKML 3ULUL 4UDTA 3O6FA 2P5EB 5F7YC 4AJYV 2ZCHL 4PGZA 5EO9A 3VXMD 5HYJD 2Q1EA 4FKHA 1HHHB 1RUML 3VYOA 4K5LA 1TZGL 3HNSH 4XCNB 1EZLA 3LJ3A 1ZVSA 4NZDA 3FQNA 2QADD 4EI5B 1KFGA 3G5XA 4CVZA 3NCJH 2BHZA 3QUMH 3LQAH 2A6IB 4EF3A 5HYSG 5DUPL 1G9MH 4WKXA 4U49A 5CZRA 4K94C 1C7SA 3E1ZA 4R96B 3WO4C 2VWEE 3X11A 3HS0C 1NJ9A 3NIDF 2CJSA 4ANVA 1XSIA 3DMMD 1XGUB 1ZE3C 2ZKWA 1N8OE 4B6ZA 2DJ4A 1KB5L 2BFVL 2D7OA 1UC6A 1OP5H 3DJSA 4OFPA 1V3JA 5HSFA 1G6RB 1SHXA 3NZUA 4DSYA 3GBML 3W0WE 1C8PA 5JPNB 1RPQA 4MCZB 4ZNEA 5B8CA 4IU2B 4S0TD 1YQVH 2TAAA 2OTUA 5IBLD 3ILPB 2BJML 3OMNB 1UVQA 3F7VB 5CU5A 5FYLH 5T5NF 4N8CL 2JSFA 4KRMB 4MJIB 1S7XA 2CA4A 4HJGA 3QUKB 5ICZB 2P5PA 2AF2A 4YXHL 5GZNC 3MRGB 3ZZ1A 3SE9L 5KS9E 1AC6A 3S35L 3FUFA 4WUUA 2H32B 3GKZA 3OXSB 3SY0A 4ANKA 3DX4A 2P7TB 3CMGA 2OBGA 3DJZA 4WEBH 3DARA 5CJQL 2BMKA 2RQEA 3FFDA 1I82A 3EHBB 1FC2D 5E9DE 2D7PA 5ANME 4PS4H 3RHWF 5HVWA 35C8L 3CFKB 3V79C 4APQD 3S88L 1DQVA 4HW6A 4PJ8D 5EIIB 3QXDA 1FWXA 1DBBL 3DYOA 1AS7A 1OSPH 1INQB 2AXFB 3T3MF 3WL9A 1KEGH 2A9DA 5AKRA 4P2RE 4ODTH 3GMPB 5KVFH 3MV8B 4PBXA 2J1YA 2OMZA 2JKRM 2PP9A 1HNYA 3AM8C 3BE1L 3HN5A 4NT6A 4U1JB 3T77B 5B21A 4YHNB 1OF0A 5CIPA 2H6UA 2IPUG 3B7UX 2ICEA 1FLRL 3A4AA 4GQRA 3BT2L 4LSQH 1TLMA 4PJ6A 2V37A 5KJRH 1R3LB 3GYRA 4DIXA 4OCXH 1JPTH 3E2HC 3TBSB 3BWAA 4AXWB 5T3ZH 5C0GA 4XI5D 4YSOA 3ZE2B 1E4WH 2WLMA 2B1AH 2XZQH 1FDLL 2YAPA 5C0CB 4AVKA 5IBUB 1FBIH 2XFXB 2BSTB 3MRIA 3MUZ1 1AZCA 3IU3B 4NO3B 5DHMC 3GMQB 1FNGB 4MJHA 4NQQA 4ZXBD 1J9QA 2XUWA 4QRTB 4XPBL 1JSYA 1J05A 4AEIL 1EA9C 1JV5A 3U4EA 2VW4A 3X14B 4CN1A 3D30A 2UYLB 3VXMB 5HYJB 4AIXA 3EZJB 4OZFA 5D1ZD 3T2LA 3NZ8B 3OV6A 2COQA 3HS0A 4JG9A 4X5PA 2EDRA 4F3FA 1JNHA 2AJSL 2HN7A 2NOYA 2XPGA 5DRZA 43CAA 4PJGA 1JGUL 5IKCB 4H44C 4PV8A 4X7TB 3S8WA 2QADB 2ATPB 1YMMD 3VO0A 1BYOA 5A43C 1EAPA 2JTDA 4HWBH 1XGYL 5C0NC 1Y0LA 3QK0A 1UEMA 3QEQE 3B83A 4K3HA 2DQHH 3VU2A 5BVPH 2W5PA 2CUAA 1ET5A 1XF1A 2XYBA 1LL1A 4M43H 5T1KD 2QMJA 5SV3A 4OD3H 3F64A 4MXVE 2ADGB 1ZHBB 5HD8D 1YEEL 2QPEB 2YD0A 4BKLA 2NNAB 5L8JB 1H8OA 2OJ1A 1AG6A 3DMMB 3AU1B 4IOSA 2AAVA 4UNTA 5BRZD 5IB5A 1VHPA 1BDYA 4PYHA 2P8LA 2FWOA 1TLKA 4N5EC 2E9WA 3CJJA 3FQTB 4FG2A 2H32H 1OD9A 3QNYB 5FYJU 1X4YA 3T08A 2OMNA 4NKMA 4OIIH 1F56A 3UJIH 4E5XB 4ZMNA 2IANB 1NCUA 1NGPL 1OT2A 3L1OL 4K15A 4NENA 2V9UA 2D2CC 2RFXA 5JW4Q 4RDQG 5E5MB 5HHNB 3HZMB 1KGCD 4JG0H 3SN6N 4JO1L 4V1DE 4B5EA 3MBXL 5CEYB 2ZWKA 2Q7NA 1K8IA 3VI4A 5C97A 4X6FA 2WYZA 1ID5I 1HIML 5JHBA 1UD3A 3MJ7A 5C6PB 2NX5D 2JCWA 1NMAH 3SQBA 4HKXA 1E3ZA 5GRZA 4GUQA 3NCMA 2V2WB 4N2FA 1KJ2H 1XF4A 5I1CL 4L3EA 1MCEA 3T2PA 4APQB 3BO8A 1ND0A 4Y5VB 5IVXB 3RYMA 4R90H 3VA6A 4FYSA 3P4MA 4WW2C 3JV6A 3R1GH 5D1XC 1KBPA 4OZGA 1T20A 1UADC 1J9CT 3ZQ9A 2C4XA 5JIQA 1UWFA 5E8PB 2MCG1 3WNMA 4X4YB 4P49A 4EDWL 3KG5A 3IU4L 4FYTA 1NDGB 3O4OC 1WUNT 3IDUA 5A7BA 2ZOWA 3BAEL 5KAQF 1MCPH 2J3SA 4ZS6C 1OZTG 2QKSA 3HR5B 1J9TA 1RP9A 3PGCB 5ICXB 4Z7UA 2CLVB 2Z31C 1T03L 2VLKB 1YEJL 3TIDA 2YPKA 4UT9L 1E8WA 1ZV5A 2EDQA 4G6KH 3L2MA 3M6DA 1AD0B 5AVWB 4ZXBB 2GJ6D 3VMNA 3GD1C 3ARBD 5J6HB 1N67A 3RDTD 2O5ZH 4EZKA 3BD4A 5DFVC 3FRUB 5FECA 2ZAIA 1ZLEA 3EJYD 1PF3A 2RCSH 3ZE1E 3BVNB 3MLSL 5D1ZB 3EUUA 1HEHC 2I9LA 4I87A 1MFDL 5HHQB 2V33A 3ILEA 3K81A 3QXAA 3FRPG 4B3VA 1NIAA 4WTQA 3FCSA 3IDNB 3DHUA 4P23C 3IE4A 4YIQA 4U1MA 4PJHF 5D71L 1OEZW 5DEZA 5FA4A 4IHOB 3S36H 1FIGH 2Q3ZA 1SJHA 1RV6X 4HP5A 3T0VA 5SWQB 4JFQA 4YK4C 5T1KB 1QSEE 1F3JB 5F9OH 5IMOA 3K6FA 4LGRB 4BH8A 3A47A 4EQ2A 2BINA 5FOBA 3S96B 3V6FB 4DWHA 5DMIH 5AW0B 5JXAH 2VERN 2KLSA 3BKCL 3BUYA 3ZRFC 4EN3C 4URKA 1CDYA 2VR3A 1UYWL 5BRZB 1UWYA 2ADFH 3HI5L 3GHPA 5D7LE 1V5JA 5E1IA 4AYFA 3UPRA 2Q0ZX 3IXTB 4K9EC 5I8EA 1N7MH 1AZRA 4XGZB 1I8IA 2JQAA 5IJDC 4MS8D 1VFAB 3FHEA 1T0NB 5H8DA 4WW2A 4KUCF 1L9MA 4W4OA 4BH7A 3LPWA 3FRPB 4GKOA 1P4BH 2WIMA 2C1OB 3BP5B 4OZHB 3TO4A 4GIOA 1HOEA 1KWGA 5D9SA 1I1AA 3N9GL 4F8OA 4ZW6A 1M71B 3H56A 3QDJD 4YC2C 3AS0A 5HI4D 2NX5B 1J5OL 2J8UF 4KITB 3T8MA 3KW8A 2DLEA 2IFFL 2HRLA 5LGJA 1RAMA 3KVDD 3O6FD 2IXQB 2BVQB 5E7BA 4JRYE 4N8VG 1PW3A 1WC7A 4L37A 5EU6A 2Z31A 5DK2A 2OSWA 2GBUA 1FYTA 4NQTA 5D70L 5I1EL 4PTUB 3L4WA 4RISH 2YRLA 3W9EA 1FVDA 1E9OA 4YH6A 4ZOBA 4RQQB 4AYMC 3D3VA 2J5WA 2ZXDA 3TO2B 3GXMA 5E6UB 1N26A 3BGAA 5FFGA 3QNXA 3N04A 1HSAB 1I3RB 2LHAA 1NGZA 2IDCA 1FN4B 3H9SA 2CKBL 5F1NA 1J1OL 1JN6A 1R5WB 4C47A 4A6YA 5EO0B 4XMKH 4YHZH 5B7FA 4I77L 4LKCA 3WFBL 4I9WE 4AMKL 4UV4H 4PY7A 4CUCA 1T2XA 3GNMH 3GS4A 4E9WA 2ITEA 4WU5B 3U83A 2A77L 3HUJB 1J1XL 3CXDH 4MMZA 1I1RA 3SJVA 2PTUA 4ELME 1A7QH 3QS3A 3CTTA 2GJ6B 3KYMA 1F97A 1AQKL 3ARBB 4ES9A 2NPLX 3RDTB 4K8RL 3EF7A 3VFNA 2QVKA 1AVAA 4GI6A 3QRLA 2R2HB 4P59L 2YAHA 1KMGA 5C71A 4N8VB 4POZC 4M5SA 1V7NH 1UWEL 4MNGB 1ASPA 3QUZA 5CJXC 2BIPA 1U8LA 2GPZA 2WLLA 3L9EA 1WGOA 3D2TA 3EOBA 5E51A 5DHYA 5MEQB 2GTZA 4N0UB 5IIEA 1HHKB 5HI3D 1TJIH 4WUUD 2DQIL 2WNWA 1JWUB 1MCOH 2WJ7A 2X53A 3KLHC 1OGSA 2KQNA 5I66A 6TAAA 5K9KB 5IVNA 5J6SA 4XPHH 5EZJB 5F9JA 4NX0A 2IMNA 4WW1B 4Z0BH 2OL3A 3P4LA 1NGWA 2Q3XA 3ESVF 2AW2A 4PAZA 2EUVA 4FQ1L 3IGAB 2B9AA 3RGVC 4PCYA 4APXA 4E9VA 1YPZE 4XOEA 1DJIA 3ZK0A 3VDCA 3CSTA 3LCYA 4NQSA 2EH8L 3T0EE 3POHA 3A0OA 4H40A 1KYUA 5ANHA 3F7YB 4NB7A 4XP1H 1Q1PA 3V0VB 4DZBA 3K8MA 2NDFA 4M7LT 5J12C 2ILLA 3KPNB 2BVUA 3U48A 2J8HA 3MXWH 1I8LC 1WA1X 3ZOAA 3IJ7A 1EXUA 3PWJB 2ALWA 3HHSB 5MHSD 5MI0C 1J8KA 1U8IB 5DWUH 5F7FA 1EZUA 5DVPA 1DQLL 5DZ9A 4GBXC 1H3GA 4HEMA 2QKIA 3I6LE 3MLVL 3ABZA 4FL4C 1OW0C 2WC7A 3QDJB 4NQEE 5T3XL 4AUUA 1OM3H 5HDQH 2Z3FA 1X6NA 3MRPA 4BFRA 2OR8A 1U8CA 2LU5A 1ZT4A 3S35X 1CQKA 4UDTB 1PDKA 4Z3JA 3O6FB 3ZDYB 1AYOA 3L5HA 4FQIH 4S1DC 5TDPA 2YMXH 5EO9B 1LEIA 2DQTH 1JGLH 1KCWA 4AYBA 1ZK5A 3LDBC 3K4DA 4KQ4H 3Q1SH 5F7HA 1NOFA 5DMKA 3U30C 1DLFH 4X5QA 3ZSSA 1ZVSB 4MAUH 3FL7A 3FQNB 1DLHA 4Q9CA 2AP2A 4B97A 4Z8FL 2I25N 3G5XB 2Z34A 4O02L 3E8UL 4OJFH 2OK0L 4CVZB 3HCVA 4P5MA 5CD5C 5KW9H 2X2HA 1MCQA 4K23L 3F5WA 3N40F 1EZVY 3W5NA 4G8FA 1NJ9B 5GZOC 3R8QA 2RB8A 25C8L 3OC8A 4AOFA 4QHMA 3MLZH 2CUIA 4IKLA 1Q0XH 4UF7C 2OMVA 2LFGA 4JR9H 4X7SL 1RKRA 3FOLA 4NNXA 1IEBA 5B8CB 2AJVH 4NQDE 3QDMA 1GZHC 2BM3A 4RNRA 1HEJC 1DDHA 4JB9L 3TBBA 1JXFA 3A24A 2OTUB 3NK3A 5CKGA 2G3ZA 3DI2B 4XXWC 1UVQB 5LQBH 2QQNL 1S7XB 2ZUWA 5DA0B 2QTEA 2ZOKA 4HJGB 1P7QA 1XD1A 2X6UA 3QZWG 3S2CA 5K93A 1BX2A 2K7QA 2QT6A 1DBKH 2GHZA 1DQDH 3JTSA 1T7XA 2CLRA 2X28A 2FEDD 4WUUB 3SY0B 1S3RA 3FF7A 2BMKB 2WQ8A 3FFDB 1JI1A 1BBDH 4L3ED 5SWZE 4GRMA 3VYNA 2IDSA 2HWZH 3GSQA 3TPUA 3QXDB 4NM8L 1M6OA 5I74C 5D1ZI 3WL9B 4GBXA 1A14L 1M7UA 5CU9A 1T0PB 1LP9A 5B1BB 4YEFA 2WCSA 2J6EL 4K2UL 4HCRH 9CGTA 5BOPA 4KNUA 2PWDA 4CBZA 5G2NA 1PQZA 1ZCRA 2OMZB 5ISZE 1EWHA 1WZ1H 4NT6B 1HCZA 1MPAH 2L7JA 4WJKB 4G7YH 5CIPB 4GKNA 2HT3D 2ICEB 2V17L 3LRHA 5HHXL 5KSUA 5AWNL 4AL8H 1LMKA 3UZQA 5I15H 5B3SB 3NH7H 3C6SB 3L3HA 4DTGH 4G6JL 4PJAE 1GYVA 2XJLA 3BWAB 5LBSA 1SXSA 5C0GB 4L1TA 3KEHA 4OAWA 5LUMA 4FQLH 4GMSH 1P1ZA 1GGCL 1U2HA 3PWUA 4JGUA 5EC2A 3WOVA 1UZ6E 1TETH 2VDNB 3MRIB 1M9WA 3S37L 4PS3A 3X1GA 1PX4A 3FW6A 1TSHA 5C0ND 5T3ZE 2JQMA 5T1LA 1CIUA 2DBLL 1J05B 1GIGH 1JV5B 3U4EB 4OUOA 1NCWL 3DPDA 3H8NA 4XNMA 3CHOA 7TAAA 4LCIL 2YLKA 4OZFB 5DVLA 2WSKA 1JZ6A 3LHPL 3UX9B 3HS0B 3ZKXC 4F3FB 3CBRA 1JNHB 2HN7B 3ZE2F 1BIIA 2XPGB 1NAMA 4XOBA 1P84K 2IG2L 4PJGB 5DRZB 43CAB 3SO3C 5J11C 2DQEH 2NXYC 1G7QA 4JQIH 3CVIL 3ZL4L 4A68A 4PV8B 4FA8A 5ITBL 2F7QA 1CG9B 1IJNA 1EAPB 3N85H 1I9JH 4ENED 3TH2T 4GG6A 1Y0LB 3ILQD 3S4SA 3GSNA 1GZHA 5I1LA 5F0JB 3VUAA 2NRDA 1CFMA 1S7VA 3AG1B 4XXWA 2BSRA 3BW9A 4AITA 1SMAA 1ICTA 1RH8A 1I9IH 2WQSA 4BKLB 4FTVA 3EH1A 5JQHC 2BSEA 2FTAA 1KGXA 2B7DT 2DYPA 5HP5A 3BWUF 1FH5H 1R24A 1X4ZA 4I1RA 3MOBL 1CD1A 5IB5B 5CN1A 3Q6FA 3P0YL 2DM2A 3KVP