4IBWA

Human p53 core domain with hot spot mutation r273h and second-site suppressor mutation t284r in sequence-specific complex with dna
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
200
structure length
197
Chain Sequence
b'SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVHVCACPGRDRRREEENLRKKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title Structural studies of p53 inactivation by DNA-contact mutations and its rescue by suppressor mutations via alternative protein-DNA interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 50
structure length 197
sequence length 200
ec nomenclature
pdb deposition date 2012-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ibwA00
4QO1B 3WTYA 4A63A 4HJEA 5ABAA 2AHIA 2ATAA 4AGOA 2VUKA 4XR8C 5LGYA 2X0VA 4LO9A 4MZIA 1GZHA 5AOIA 3WTXA 3QYNA 4IBTA 5LAPA 2GEQA 4AGLA 4AGMA 1EANA 2BIPA 2WGXA 3D06A 3ZMEA 4KVPA 2J1XA 2BIQA 2BIMA 2MEJB 3QYMA 5AOMA 4AGPA 2IOMA 3D07A 2J1ZA 3WTWA 4G82A 4G83A 2J20A 4IBUA 2BINA 1KZYA 1T4WA 2P52A 4IJTA 4MZRA 5G4NA 1IO4C 5AOKA 3Q05A 3EXJA 2J6WA 3WU1A 2XWCA 4LOEA 3D05A 2YBGA 2IOIA 1YCSA 3US0A 3VD2A 5AOJA 4AGNA 2OCJA 3VD0A 4L18A 1TUPA 1TSRA 1UOLA 2PCXA 3Q01A 1EAQA 5A7BA 3IGKA 3D0AA 1CO1A 3VD1A 4IBVA 5G4MA 2AC0A 4L0YA 1CMOA 2BIOA 4IBQA 3US1A 1HJBC 1EAOA 2ADYA 3TS8A 4L0ZA 3IGLA 2XWRA 4IBSA 4IBWA 1GZHC 4LOFA 5AOLA 4GUQA 3WTVA 4AGQA 3D08A 2H1LM 2RMNA 1LJMA 5BUAA 4IBYA 5G4OA 2J1WA 3KMDA 1H9DA 4IBZA 2X0UA 4GUOA 3WTTA 2IOOA 2J1YA 1HJCA 3D09A 5ECGA 2FEJA 3EXLA 2X0WA 3Q06A 3WTUA 5AB9A 1E50A 5KBDA 3KZ8A 3WTSA 2J21A 1HU8A
chains in the Genus database with same CATH superfamily
2EXWD 2CNYA 1VACA 4MB3A 1LP9F 4IKLA 4L4VD 2XJLA 4L4VE 5SWZD 4JZJA 1U8MB 5SWZE 3FQ4A 4N1HB 1PYWB 4HHWA 3K4ZA 4UILL 2ZXDA 5J1AB 3T65B 2H32H 2P44B 4N2GA 4X5RA 5D1QB 3SY6A 5IKCB 3PWUA 5D7LD 4XOAA 3FRUA 1N5YH 3VM5A 5D7LE 15C8L 3K2UL 5TK2A 1GL4B 2WNKA 3ESVF 3WGUB 5K1NA 1FO0B 1KIQB 2X2JA 3BVDB 4OCLC 5D2LB 1WAAE 5AYTA 5J6GB 3UBXA 3BUTA 3MSPA 3UTTB 3H7LA 4YHKH 3G5XB 4A39A 5C71A 5IF0A 3OMIB 3TA3D 3S48A 3I9AA 4KZDL 3BKMH 5F1IB 1F97A 1H19A 3M1BB 3VXNA 4DP5X 2QSVA 5AFAA 4N20A 3TJPA 4DGVL 5L6YH 1C5DA 4KJYA 1MIMH 4I3SL 4C83B 1NPUA 3DMMC 1Z2KA 3X1FA 4RA3A 4Y4KC 4JFUA 3Q0HA 1QBAA 1EBAA 5KBKA 3KWVA 4UIKH 5KOVC 1IQWH 4UINH 4B3VA 6PCYA 1MCBA 3ZMNA 4XCFH 1OAYH 4ODSL 2V4LA 5DZVA 3IMBA 2OI9B 1IAIL 4I77L 3WJLC 1Z9PA 1A22B 2X4SA 3TX4A 2MPVA 1DDHA 2B1OA 4OKVB 4OIBA 3CN1A 4AK1A 1JNHB 4OF0A 3U7WL 1UZ6E 1AGDA 1SZNA 5DCCA 4XP5H 3MLXL 3GYRA 4Y19D 4B53A 2BVOA 4Y19E 1IEAA 1ZA6A 1JPGA 2P5ED 2XSKA 3RL2A 4DQAA 2Y7OA 2P5EE 3G5ZB 1WIPA 3TBTB 3CFDB 5DJ8A 1I8UA 3BZDA 1EEUA 5AENA 2YN3A 2IFFH 3D7PA 5EEVA 2D0HA 5GZND 5GJSH 2BLFA 1E2ZA 4XPFL 1DR9A 1WZMA 2B4CH 2GTZB 3ZQWA 4EO5A 1XCQB 5AL0A 2P8MB 1TZIB 4PJ5B 3TJEH 1UZ8A 3JYCA 1H3UA 2MKWA 1EHXA 3HZKA 4QYOB 5DK0A 1L0QA 1FNHA 1JGIA 2FLRT 2PR4L 1SNRA 3S8FB 4YUEL 4N0UB 1E28B 2CBTA 4X5XB 4XWGL 2FNWA 1EEZB 3WFHB 4XH2A 1WBYB 4CA4A 5KUKA 1QFWM 1MCIA 5IMKA 2CQVA 4G3YL 1FNAA 2W8CA 4HJ0C 2PP8A 1AOHA 2OSWA 4XCNA 2ERJC 1T2JA 2UZXB 4FFZL 5KYUA 4EN3B 4HHGA 3UTSD 3UTSE 4YO0A 3X3GL 3ULAB 4BH8A 4J3OC 1CXKA 5DRXA 1T7VA 4K23H 1S9WA 1WFJA 3QXDA 1LO5B 3JV5A 3LH9A 3NZHH 2P46B 2XHNA 4BV1A 4ALAH 5E03A 3EJSA 4D9LH 5IROD 3KL0A 2GK0A 3UJJL 4XCYB 2BSED 1HYRC 2DD8H 1QRNB 1MFDH 2IWGA 3BKCL 4UIMA 2ZYIA 5INCB 4BKLA 1H3VA 2CXGA 3WTXA 3HZ3A 4NQXA 4CRPA 5CP7A 8FABA 1YQ2A 3U2JA 5IV2A 2C3VA 3WOVA 4KX9A 3A23A 5I1DA 3P9MB 1PFOA 1HHIB 4KK5C 1FWXA 2YD8A 2W0PA 3RWEA 4OV5B 3O3EA 1A3LL 1YY9C 3BRFA 1A1NA 2DWYA 4X6DA 2EVGA 5T5NG 3VXMA 2WQSA 1U91A 1KWKA 4KVNL 1ORQB 5J9PB 2WJ7A 1U8LA 3HZMB 4OGYH 2V0AA 2X9ZA 3SE3C 4G9FA 2JK5B 1IAMA 4YOKA 4Z76A 3P11H 5C0GA 2IV8A 1S7WA 1S9YA 4LVOC 1DO5A 1GIGH 2YRZA 4JFDB 4ZFOB 4UT7H 4JM4H 4K7FB 2OAAA 1HWGB 1EVUA 5LHDA 1LE9B 3MRRA 2XV3A 4S1DC 2IWFA 3E8VA 1RIHH 5I1LB 3GBMH 4ZQKA 3ZDYE 4BK4A 2VM9A 4D0CB 1PZAA 2D03H 1TVBB 5BOZG 4P2AA 4URKA 4M48H 3CG8A 4Q56A 2YRPA 1ZVHA 4Y5YB 2IDSA 1IAII 1QNZH 1WIUA 2WM0A 4AVIA 5C8JB 4PG2C 3IEAA 5FHAH 4PIRF 1MCJA 4BFBD 1XH0A 3TU6A 4UDTA 3ARFB 3WNKA 4HD5A 1IC0A 4JFOB 2F1BA 3CBJB 2Q10A 3MLYH 4QTIH 5IP4A 5L4MA 4DZBA 2C4FT 3MV7D 5KAQG 1HYSD 2QPEB 3MV7E 5CP3H 5C0DA 2WBKA 4ZSOA 3CJJA 4AH2B 1A14L 3MRCA 4LVHB 3QE5A 2X1QA 3DPDA 1MJUH 3PHOB 4QF1A 1EEYB 1GOHA 4FXGB 2O61B 2WTRB 1YZZA 2H1LM 2L8AA 3DX9B 1QZ1A 1PKQB 4HCGA 4JFPA 4KOCA 5FHBL 1AIFA 2XV2A 5DFVC 1RPKA 3RP1A 2ZZUT 3SDCB 4W9DC 5BUAA 3SE8L 1P5VA 5I23A 2BVPB 4TQEL 1MWAH 2VXUH 2AKRA 4D8OA 1AACA 4QJ4B 1T7ZA 3GZPA 4AE0A 4GAYB 3KH4A 1IE4A 4JO2L 3P9LA 4R26L 4WRLA 5F3BA 3VXUE 3O2DH 4R0LC 1OGAA 3RFZC 4W93A 3C6EA 2D2CC 1YG9A 3H9HA 4J12A 5I19L 4BZ1A 3L5IA 4P5TB 1ZHLA 2FIKB 3O81A 4BDVB 3CDYA 2Y25A 4ZX5A 4DCQB 1U8KB 3IKCB 2HN7B 1PG7X 4U1MA 2DTSA 3E80A 4H44C 5JIQA 3ASWA 3HFML 5EC2B 4PRAA 3WS3A 1ETA1 4MAYA 1I9RL 4C56A 1BIIA 4AQ1B 4KQ4H 2MH4A 4IBTA 1RUKL 4U1LB 3RU8H 2N59A 2DQJL 1GMEA 4Z7NB 4LHUD 3PGCA 4D9QE 4ONGH 3GB7A 5KSBB 5DJDB 1X9LA 4PJHB 5T3XH 3HJ0A 3E38A 1A7PL 1M7IB 4WO4C 3UJIH 3DROA 4GMSL 4F15B 2HRGA 3M86A 5GGUB 3RI5K 3IMRA 3OJDB 4DVRH 4L5FH 2EZ0D 3VXRB 5GGSB 1UT2A 2J6EH 2ZYHA 4TMPA 3CMGA 5FUOH 1O6SA 4R7LA 4NKQB 1AHWB 2AERT 4I48B 3OAZK 1KLFA 32C2A 4BYHA 1B4LA 1RJLA 1Q1PA 3D6GA 4OD1L 2F68X 4EQ3A 3RHWK 1OEZW 3RZCD 3WFBL 2Y7QA 2NNAA 3MFFB 3INUH 5DJXA 2GJZA 2QKSA 2NXYB 2UZIL 4U1KA 4Z8FH 4R4BA 4P3WA 3IVKA 4X9BA 2JVUA 2GFBA 4MJ4A 5IFJB 3AY2A 2BSTB 2HCZX 1RUML 2WBJA 2EDQA 4LPVA 3I6LD 3MRBB 4G1MA 2YAMA 1C08B 3I6LE 3NAAL 3K71B 1TQSA 2ZSWB 1NCBL 5EUOE 1DDTA 1GJIA 1ZA3A 4KJPD 1CFVH 3GKWH 3WNLA 1SY6H 5MENA 5KSAD 3IS1X 4BELD 3EOBB 2BW4A 3RWJA 3DXAA 3BPCA 4F33A 5DQJA 4FQJL 4XX1E 3AQYA 2DWXA 3HB3B 2GTWA 3OKYA 4P2QB 9PCYA 3VI3E 3ISWA 3WHE0 3EO1B 5CCKH 2CO6A 4PGCB 2NY0C 5D7SH 2DQUH 3VUAA 5ALBL 2VH5H 3SD5A 1MJ7L 4ADJA 1S8DB 3LKRA 5E8DH 1CFTB 1J8KA 4UQCA 4YSDA 2H47C 3WIFB 2W65A 3ZL4H 4A38A 1KELH 1HQ4A 2Z92A 4B97A 4A7GA 3MRMA 4KZEL 4FQIH 5K9OB 2AZUA 2F19H 2B7DT 2VW4A 2HKAA 2Y3NA 4PJAE 3DSNB 1BW8A 3S4SB 2MKLC 4APQD 2CRIA 4QT5B 4LSUL 1RJYA 5DD0L 1TIUA 3KR3H 1YEGL 3ZKXC 1T04A 4JFXA 5D1XA 4Q6YA 3ISRA 4M5TA 4MCMA 3VTAA 1IL1B 4Q9RL 4A37A 1O0VA 1T89A 3FTYA 4L2LA 5FOBB 4OIFA 3G3LA 1VPOH 1XO8A 1TVHB 4APXB 1LWHA 1Z5LB 1QSFA 2CA4A 1X9RA 2DWSA 4GW1A 3ZYOA 4GKNA 1HZKA 4AIOA 3N0AA 1R3KA 2B15A 4FQPA 4K7PL 4HCRA 4OZHA 3QZWA 3RA7L 4AE1A 3VRJB 5AVWB 4I7ZC 4B9FA 2FVNA 3JTTB 3RTQC 1I8KB 4U3SA 5F9DC 1NM4A 2CAKA 4S11A 4AYDC 3BP7B 1A4JB 1SRDA 2DLFL 3NACH 4Y4FA 5I73B 3OAUH 5DFAA 1DJZA 1DE4A 3PWVA 1V05A 2BZDA 4ONOA 3U9UB 5TE6L 5CZRA 2FHFA 5FB8B 1EFXA 3GSOA 3EXJA 4E2OA 4KTEH 3FC8A 3E6FA 4JRLA 5JLZA 3QO1B 1E9OA 3ZZSA 3CVDA 1QBML 3BWUF 2E7CA 3N40F 3R7QA 1I7TA 1TZ8A 4JY4B 2WY3B 4FP8L 5JQ6H 4KRMB 3D3VE 3G04A 2VZUA 1YMMA 3FCSA 3IJSB 2H4EA 4XHQA 2X4UA 4ODVL 1MVYA 1BCIA 3H3KA 3HMWL 1RJZB 4JFFA 5F3FA 5HVHC 2V9UA 2CLVA 1N59A 1BFTA 4HOXA 1JUFB 2FEEI 1OK0A 3A6CH 4G80B 3V95A 4Y5XB 4ZOCA 1WCBA 5AVZB 3SKNA 3FFDA 4ZMWA 3HG1B 1G6RB 4BZ2L 5IB3B 1XXFC 2W60B 5JXEA 2B5IC 1RL1A 2A74C 1IGFH 2ZICA 2MOQA 4NNPL 5BW7A 1ZPLA 5IMMA 2B9BA 4EOWH 2YD5A 4KY1L 1HX0A 4NAJA 4EQ2A 2VE6A 4ICXA 2CO1A 4S10A 5GISH 4M62L 3RWDB 3KNBA 4YLQT 4EE2A 3SKOB 1MHPH 3LXCA 1I3GL 1HN1A 2E59A 4HK3J 4R4NC 4RMTA 4B9ZA 1LO4L 3KYOB 2VXSH 3CHOA 3DGCR 5H2BB 4WW2F 4WWKD 1TDQA 4E68A 3Q2NA 4KKQA 4AQOA 4RMVA 2PWHA 3KS0H 4JZNA 5CJXC 3QG7H 1MY5A 3B7SA 4K2UH 1OB1A 5IEKB 4FLQA 2OJEA 4YZFE 3MRIB 4X6BA 3L9BA 2OYMA 2B4CC 4CSZA 4TUKL 1OAJA 2JI2A 3STBA 4MMYB 1CLYL 3LMJL 4LIQH 2A9CA 3PRZA 3WSQH 5DJ2A 3AGVA 5D2LF 3CZEA 4LEBA 1AGFB 3NCCB 4UZSA 2CIKA 4GSRA 3U9WA 3U46A 4GUCA 2DQGL 3BEVB 4QDGA 1JV5B 4HFUL 1OPGL 1U3YA 4LSQH 1QLEL 2DJUA 5ENWB 4G8IB 2X4NA 3H9SA 2DQHL 3CGTA 4TQ8A 1Y18A 1VF5C 1I9JL 4XNDA 1GGBH 3MODL 4OUOA 1T1WB 1UT9A 3VTTA 1ROCA 1KLUA 2BOBA 3DPBA 3H3PL 3PP4H 5B39G 3T4AC 2WXPA 4JRWA 3KJ6H 2J2ZB 2P9RA 4ALAC 3BZEB 1B0IA 3VAEA 4AIXA 1CFSB 4H1LG 4QD2E 2DIJA 4LCYA 1IKOP 1UB5B 3T8XA 2BPBA 5E7FA 1O7VA 3BP4B 1BQHB 3I85A 3F7YA 3LSOA 3MLUL 4YFLI 3BAWA 1EZSA 4TSCH 2EXYC 1BZEA 1I7RA 5K9QG 3NJFA 1FG2B 3QNXA 5F1KC 2V2XA 4JMNA 4M93B 3O3UN 3W11D 5C0BE 1YEJL 4PJDA 5KVGH 1QP1A 1SHSA 3LQAC 1J5IA 2DWEB 1A8JH 1A6UH 3OG6B 4OZFB 2NY1D 1MCWW 2LTQC 3NSFA 5HJ3A 4JLRB 4NWUL 4AV0A 1KN2H 4BA0A 4HETA 2C9XA 2H1XA 1HZLA 3L7FB 5AVQB 4OCRH 3MLSL 3HZVB 5TFSL 3IRZA 5CEXB 5F6IB 3QUYA 1IFRA 2ZUUA 4HUXB 1LK2A 3GINA 5IB4B 3CFBA 2B14A 4IGBB 3B2PA 4CU6A 1X5JA 2HFEA 4O02H 3LH2L 5ADPL 3WAJA 3EGXB 3R4RA 2EDJA 1BPLB 2F5AH 1EPFA 4BH7B 5CEZH 3U4BL 2IQ9L 2DQTL 5C3TA 1GTFA 4F8QA 4JM2B 4UWQB 3NQKA 1C1EH 5BMFL 1FH5L 2X10A 2QBWA 1EA9C 3MRJA 1UWXK 1GYVA 3RGVC 1DVSA 3ZTNH 1OTUD 3FB5A 3IF1A 5JW4Q 3SKJL 5GS1C 1OM3H 4XBGB 1EZLA 3FFOA 3PPSA 4IMLB 2ATKA 4WTXA 5GSRB 3QCTH 1IB5A 1KPUB 3QUKB 4DP1X 3VJ6A 4D2NA 2E47A 1KXQA 4I0PA 5FKAB 1BLIA 3X1EA 3PNRB 1S3RA 4RFOL 4ZPVA 3SQOH 1GAFL 3FN9A 5EA0H 1KCRH 3U6RA 1Q9OB 5IVXB 3GMLB 5EWIL 3V6FB 2ZAGA 4JY6B 3VXSB 4FX5A 4L9DA 3ARBC 4OSUH 1HL8A 2YO3A 3FN0H 4TQPA 1BVNT 4DTGH 1TF4A 3JWNE 3U30C 2ZKMX 4LLYA 1A9VA 5CEYB 4TUUA 4PP1C 4HZLA 4Y2DC 2FSDA 1HT6A 4A7UA 3B9DA 3QYMA 4HX1A 4BWWA 3UDWA 3K6OA 3WKNA 1OCWL 4FXKA 3HI6H 4XPAL 3ZKMD 3ATDA 2BHYA 2XVGA 3TO2B 5EO0A 2A77H 1NCOA 2VDOL 4ZNCD 5E1AB 1MFAL 5F7EL 1UUNA 4ELKB 2QSCL 5GGRY 5C6PB 1Q72L 5L8KB 1O7SA 1R24A 3DV4A 4PRDA 3MKKA 43CAB 1T03L 1CK0L 5EU6B 1T1YA 2PP7A 1F4XH 1XGUA 3CFEB 5F96H 2PKDA 4LKXB 4ACPA 2EEDA 2R2HA 3C5ZB 4XZUA 4AMWA 3O11A 3KLAB 1BQSA 1IKFH 3KDPB 5DWUH 5CCHE 5HHVH 2FK9A 4PD4K 5DZLA 1G9NL 4KXZH 2YBRA 3CX2A 3EFFB 4POYA 1ZVSB 3DJSA 4QTFA 4NN7C 1RLBA 2QKIA 2WBWB 1YEDA 2I7OA 3QEHB 3BE1H 3IDNA 4YMPA 1NC4A 2CM6A 3ABZA 2FHCA 5DF0A 1E7VA 2WSDA 4GMTL 3D39B 3ZE1B 1DCEA 3F00A 4K94L 1AXSB 4X8XA 1XB3A 4BQBA 5D7EA 3IJ8A 4N3TA 1R6VA 3QDAA 2VDNB 1TYJA 1OTTD 4DF9A 1A2YA 4JN2B 1UFUA 1X6LA 3OKKB 4I2XB 2W38A 3G5VB 2VN4A 5E5UB 1RAMA 5E8PA 2YPKA 4ZMAT 2H3XC 1PLGL 3NSXA 3A67L 3ESPA 3UBFA 3D34A 4YDKH 2G60L 2OS7A 1EZVY 1VSCA 2E8ZA 1T5WB 3N42B 4N8VG 4EUPG 4E42A 3QQNA 3DMMB 4YQXH 4Y4KB 1GY2A 4LL9A 4JRXD 5CILL 1I1RA 1E50A 4GG6A 2EDMA 1BM7A 4X6DE 1PDKB 5E6IC 2VR8A 4QRQA 3VXME 5HI3C 5AW6B 2ZOLA 3UTQA 3D48R 4IMKA 1RK1A 4TOYL 2HFGH 4G9FD 3VMOA 4G9FE 4QLWA 5D6CB 1FFNB 4A2GA 3PCYA 3W9EB 1N4XL 4YVNA 3ME0B 3X3FH 1JGUL 2IDFA 5IQOA 3A4EA 3UBXI 4JFQA 5BCAA 2Z7WA 4Z7NF 2WWOA 4O4YH 4FG6C 1PAZA 1TO4A 3SPJA 2NUPB 4MXQC 3CZKA 4GSQA 5ESVA 5KSBF 3TBSB 4PJHF 2XUWA 3HHSB 1E8XA 1P6WA 3BT2L 4M9OA 3DBXB 1EANA 1A6VL 3PXLA 5DRWA 2DLEA 3N43B 1J87A 5I30L 1BZDA 1CDUA 3CE1A 5DO2D 3L7EB 4Y9FA 1NCWL 4QXUH 3HW7A 1OHQA 5IHLB 5JW4N 4AQEB 4M1CC 5EC1A 2I5YH 2V7HB 4KJWD 1ACXA 4QRAA 4NPYA 4ZXBA 1OTSC 4HUUB 4ZMOA 2DQCL 4ZSOE 3CDFA 2A3TA 3QQDA 2CDEB 4WVRA 1D6VH 2FIRT 1QI4A 5IMOB 1KXVC 1UXMA 5G5DB 2OL3B 3QPKA 2OMZB 3NABH 3S37H 1YVLA 1DL7H 1N8ZA 3D1MC 3Q8EA 3QJVB 1ZLSL 4HBCH 4RISL 5ACZA 4CVXA 3FU0A 2XWTA 2XFXB 3EFDH 4PVNA 5C3LD 1A6WH 3O6LH 1E9QA 5D9SA 1IM3B 4AYFA 1OGAD 1QFUL 1OGAE 3EADA 4RGMC 4BIKA 1F4YL 2Y69B 5IK3A 3OKEA 5JXAH 4QWWD 2PF6A 5C0NC 2DQDL 1C8PA 1ZKAA 4R7XA 2IBZY 2XN9B 3KEDA 5D1ZA 4BWTA 1V7ML 5C09B 4ELMF 5IJVA 3REWA 3AAZB 1ZXKA 3PWLB 1EHKB 4ERSL 4IRSD 1MEXL 4BZ1L 4HYTB 4C56D 4NHCH 4F7PA 4C56E 3QK0A 1XCXA 1AFVL 1IGIL 4MJIB 5HHOA 4PJ8C 4E9XA 1CICC 4FLRA 2FO8A 3VRIA 5IJKC 2CM5A 4GW5B 3AU0A 1J88A 3HR5B 5DZJA 2QGDA 1J9TA 1TFHA 5DGRA 5K1VA 2JSFA 4YDIL 1UZGA 4LVOB 5JORB 4CDGC 1LP9A 1PJ9A 3D30A 2NW2A 1XH1A 4P2RA 2ZPKL 3W37A 1ZLVH 3WY2A 4N0RA 2K4AA 3WE1A 4NDMB 1XHHA 4P5KA 7PCYA 1KGCD 1F86A 2YQBA 1KGCE 1AXTL 3KPMA 5AKVA 2PWGA 2B0SH 3BKJL 5M95B 3K6IA 1AKPA 2YFNA 1CZ8L 1GZHA 1U8IB 2FJGA 5DEGA 2DICA 3BVXA 1KULA 4J2QA 5FO9B 1Q0YL 1ZHBB 3GFUA 3B8SA 3O4OC 1S7UA 2NX5B 3D18B 2X4TB 1D9KC 4HAFA 2X6CA 3BZFB 1U93B 5JUEL 3BP6B 5BZWB 1YN6B 2XZCH 3B2VL 1NGPL 5J5EA 2OK0H 2WINB 3GXFA 4IS6B 5AZUA 2YD4A 1A66A 3MR9A 1BAFL 3L4VA 2DYSB 3PL6C 3WN5A 5LXGL 2EUVA 3C08L 2WBJD 1F13A 4JFHD 5KWYC 4MMZC 4JFHE 3WXVH 1ACYH 3BUYB 4DQOL 4EDWL 1KYOJ 5IIEB 3BJLA 1FGNH 1MI5D 4JNXA 1MFCL 2HJFA 5MEND 1XAUA 1FAIH 3FT3A 5MENE 3GBLA 5DMKB 4R0LB 3RFZB 1TR7A 2X9YA 4UYPA 3TF7C 3DXAE 2CCWA 3B37A 2ZD0A 4XTRC 1V10A 2YPVH 1IAOA 3UP6A 4U6YB 4K5MA 2C1OA 5D8JL 2QEJA 4XRCA 1UOLA 3P73B 2ZKWA 4MA8L 1KTLA 2A0LD 3HI1B 5LBGA 2VR4A 4P57B 4GIAA 3V9EA 1P4IL 1AE6L 2NR6A 2YAPA 3QAZC 4XP4L 3BAIA 1AG0A 4ZMVA 1HZHL 1V3MA 5EIVA 3TXAA 5H35B 2FECL 5DK2A 4HW6A 1FNSH 1DLFH 4F3FA 1HHJB 1LK3L 4XPGL 5D1XD 4DZ8A 1A6AB 5D1XE 4WO4B 4CW1A 4HLJA 4H20L 1F8TL 1M42A 4JQVA 1AZBA 1R5IB 4CC1A 4EXKA 2IV9A 1QSFD 4HGKC 4AYEC 1NC2B 1QSFE 2F54B 4QO1A 5EZJA 1ZT7B 4KRLB 4KUCD 1EERB 2AV1B 5CGMA 1AXIB 4PJ6A 3NJXA 4OZHE 1JXJA 2DQ6A 4TQHA 3GSQA 2X0WA 2OJZH 5ICUA 2HLAA 5BVJA 5EOTB 3UJTL 1OAXL 1WFNA 1OE3A 1G7HB 2LGNA 1X5LA 3RNKB 3T0DA 4X9GA 4MNGB 4Y4FD 1IFHL 4LAQL 5FA3A 3PGDB 4HCRL 3FKUS 4EI5A 1KIRB 2FWSA 1T5KA 3CIAA 5IR1B 5EN2A 4HS6A 2OV0A 3VI4F 4XBPB 4HH9B 1FIGL 4XMPH 3W1ZA 1EFXD 5F0MB 2R56L 4PRHB 7FABL 2JXMA 3OAYK 4MAUL 3A21A 3BQVA 3TT3L 3H2WA 2HUHA 1LYQA 1ZVYA 1NIDA 1U4FA 3L3OA 4BRVA 3G08A 1QQDB 1FL3B 1WUZA 3NZSA 5I66B 3K6SB 3FK3A 4I3GA 4N8CH 1FH2A 2H2PC 3TPKA 3PWJA 1DSFL 1FVCA 4OCWH 1JHTB 4FG0A 4XP9L 5TE7L 4Y2OA 3U0TB 4ANXA 1YMMD 4L9LA 1YMME 1IX2A 4FE9A 1KXHA 3OXRB 4MMXC 5LGJA 5JHLA 3I74A 2D73A 4JFFE 1SPDA 2R23B 1KY7A 4RDQG 3ZR5A 1WJ3A 4DGIL 1XDTT 2VXTL 4O2EA 4ZMTA 4RIRA 5KS9B 1E6JH 5ES4B 3GMOB 2EE0A 3BD4A 5E4EC 4YSAA 4C4BA 1E9PB 1JGDA 2AF2A 3LQMA 1XGRA 1F3JA 1VGEL 2HX8A 3VCLA 3FQWB 3ZR6A 5JXED 2HMID 2NY0B 3D5OF 3ET9F 1PZUB 3DETD 1UCBL 1JI1A 2J88L 3TN0A 3CFJB 3IDMA 4KI1A 5DMJB 5HPMA 2IOIA 2ZP0T 2ARWA 3EHBC 3GK8L 4OLVH 4KMQA 3NIGB 4LCVA 4C4UA 3HI5L 1FGVH 1RZKH 1LO2H 2BDNL 2C7UA 2WXOA 1PNDA 1RURL 4UDUB 1MF2L 3TASA 2JJSA 3WLWD 2RH0A 3JTSB 1BZ9A 3BDYH 1IGMH 5J6HB 1L6ZA 2D31A 2JTYA 5JIKA 3ZKXB 2GC7C 1ZT1A 5D4HA 3O3DA 3CK0H 2A1WH 1WWWX 4I4WA 2MQCA 2AK4A 4K3JL 4XT1C 2VWEC 4BFNA 2DW5A 1HDMB 4TVSa 2R8SH 3S96B 5SV3A 1T20A 4U6VL 4X6EA 1JS4A 5FO7B 3TV3H 1MJJB 5C3IA 5BZZA 3KWXA 1BVLB 3SE4A 4ZX4A 1GC1H 3I75B 2FECI 3RTQB 1KUMA 3WL9A 1FYHB 4YXKL 1G7LB 1OIOA 5DR5H 1EO8L 2AV7B 3UGUA 3H9SD 5EFIA 3H9SE 1UD3A 1WZ1L 4P5MB 2H32B 3FRPB 2G30A 5GS3A 1MUJA 3V4UH 3G6AA 4XP1L 3KPLB 2QVTA 2Y2YA 4M7KL 4XMUA 1K8DB 2CCVA 4XMVA 3AXLB 2F53B 1SJEB 1CBVH 1ZLWK 5IVXF 1JNLH 5JR1L 2NY4D 2MHAB 1S3KL 1RY7B 1KCSL 1S5HB 4LU5L 4HIQA 5LQBL 1H3GA 5TF0A 1IEBA 3CDGA 4HS8L 4JRYB 4IYKA 4G8GA 5I0VA 1SDDA 2P5WB 4QHLA 2YR3A 3TT1H 2WLZA 4HXBL 5HVHB 1AO7B 2WXQA 4QCIA 4NJAH 1SJMA 2XQYG 1DEEB 4GI9A 2X53A 4PJDE 1FC1A 2W07B 4PV9B 2KERA 4FFYA 4PCSA 4Q0XL 1A1MA 1CG9A 3S8WA 4HISA 1SBSL 1CFQB 3P3YA 2A74B 1RUPL 1KJ2H 4L8SC 5E8OA 3KPSD 4W9CC 1CD9B 2RBLA 2W91A 3KPSE 4IHBA 3EYQC 1EJOL 4Y2NA 1PMYA 3QUYD 5F88B 2OZ4A 4LSRL 3AVEA 3OLIA 1HCVA 1U8PB 1T66D 2FH8A 1YRKA 3P0VL 5FV2A 4JR9L 3U83A 1WRFA 2JKIS 4MDJB 4Q52A 5GJTH 3UROR 3PFUA 2H26A 4NSKB 3FT2B 4LOEA 1E5UI 3PPEA 3ALPA 3QWQB 1GTNA 4NAMA 2DIAA 4KK9D 1D2PA 4ZUUA 3APNA 5MEQB 2JB5H 1KTDB 4K8RC 3QHFH 1YDPA 4OLZH 2EH7L 4UQBA 2V5RA 1JVOA 1XGTA 4ZUWB 2AJZB 1G7JB 1ADQA 4PGDB 1I1CA 3HG0A 1QPXA 4AL8H 3ULSB 3U6XS 3OL2A 2EDLA 2EYSA 2VDRB 3LEYH 3O9WC 4YHML 2ADFH 4I0PD 4U1SA 4NIKB 1I7UB 1KXQE 1I85A 4UQDA 5DQDH 2Y7SA 3FZUD 4Q6IA 4WI3A 5MP6H 3CBRA 5DQ9B 1VEOA 3KPQB 4DKFL 1DVQA 3ULVH 3PNWA 5JDSA 3LHPH 4FNQA 2RACA 2DJSA 4HUKB 5TDPA 4CKQA 4HMDA 4P5SA 2GKIA 3B83A 2BP0B 1AQKL 4UNTA 3M07A 3V5HA 3ZHNA 2GW5A 2CHNA 1MY7A 3N42F 4MASA 3T4AB 1UQSB 3DI3B 5IWLC 3F5WA 3VG9C 4B6ZA 3C6LC 3MMEA 4ZFFA 4YDJA 5DC9B 5AAWC 2IPTH 3VFVA 1OZTG 4A7TA 1KZQA 3P30H 1MAJA 2R0KH 3RVUC 3AXIA 3H0TB 4G6JL 4NFBA 4GXVL 4Z7OB 2PYEB 2ZKHH 4X5QA 1OALA 5B38A 4G8EA 1ECZA 4GRMB 2QADC 1QR1A 2CDGB 2ODHA 4DFIA 1OT4A 4OAWA 4GB9A 2RQEA 1NGWA 3ZTEA 3V4PB 1CL7H 3MYJB 3GS4A 5HYJB 2WW8A 2WO2B 3QGVA 5AVRB 3ZIMA 1MCNA 2WLHA 4HUMB 1ED3A 3FU7A 5JQIB 4PVLA 4FLHA 3QH3B 2BP5M 2PPFA 3LPOA 2XCMC 2XTJD 3FAWA 4MA1C 2XTJE 1QYGH 4ADGA 1SLXA 2JELL 2LTQB 2WXJA 4K7PY 4WEEA 4W9ZA 3S5LB 5KJRL 4GNKB 3N43F 3BWZA 3HBGA 1YNLL 1DVFA 1N64H 2EIKB 1H15A 4OKDA 3GSWB 2GJRA 3QWOB 3N1PC 4R97C 3EDKA 2H0JA 3V6BR 1IIKA 2ITDA 3BPLC 3HS9A 5I1CH 3QSKB 3DJ9A 1NC4D 2DMBA 1OSZB 3T2LA 5C70A 3HLAA 3PS6A 1AR1C 3U1QA 3RWFA 2XG5A 3Q1SH 3D0VA 3VFOA 5AW1B 3FO9A 3LN4B 5I18H 2A9DA 3RGVB 2BP8B 3IPEA 4HIIB 4PRNA 4X7FC 4AQAA 5GS1B 4HIXL 4M43L 4DVBB 4RWYH 4N0FB 4ZUTB 4NRYA 2PO6A 4HDIA 1DJIA 4JL1A 5HYIA 1E4WH 3E8UL 3PHSA 3AZUA 2A83B 4PRIA 1JPFA 1ASQA 4HV8A 2E8YA 3FQNB 4JJOA 4O51B 2X70B 5HVFB 5CIPA 1KSRA 3V0GA 4JN1H 1A7QH 1G0XA 2E6QA 2EKJA 4Z3GA 3ULUH 3QHZH 3BWAB 4YHIB 2RJMA 5CSZA 5E4IA 3TCLB 1D3CA 1NUGA 1U42A 5C0FA 4GG6E 3FF8A 1RU9L 1C12B 1MWAB 2BIOA 3ARBB 4KXDA 5LAXA 4CSPA 3IAGC 2AJ3A 3U30B 1CIDA 5DYOB 2BRRH 5GS2D 2BZ7A 1UWGH 5BS0D 3FCTB 2D3LA 3LS4L 1A3RH 5SX5H 2X3AA 1MQKL 4TXVB 5DS8B 5DZ9A 1M2VB 3D08A 1YNTF 3A4FA 1MCPL 5K9QI 2NZ1A 1OAKH 3L6FA 4P9HL 5KVMC 2X2YA 5K1JA 1PIFA 3LPWA 4G7YL 1CGWA 4OH2A 4WW2A 3L4UA 4NO0B 3RVTD 2V7NB 3WDHA 1PJWA 4OJFH 1WGVA 3QT2A 4L1TA 4LEXH 3QWRA 3TH3T 4OLUL 3V52L 2CJUL 4JE4B 2HXAA 3FAXA 3PJSB 3T2QA 1U8MA 3NFSH 1YAZA 1PYWA 3RY6C 4J8QA 3BN9C 3T65A 4CN1A 4LASL 1J1OL 4J23A 5D1QA 5IKCA 5E95B 3TH2T 1P4UA 4NUGH 4PHZA 4A63A 2VN6A 4ZXBD 4JUTA 2AHIA 1KIQA 2H3KA 1FJ1B 4LDCA 4Y1TA 5D2LA 1TTBA 3LNGA 1B4JH 5J6GA 3BQUC 3UTTA 3G5XA 4NN7B 3HNTH 2AABH 2IIJA 5E99H 5HHXL 4R90H 2YOCA 5CZXC 5F1IA 5C0IB 3EJJX 2HWZH 1MCOH 3SPCA 1K2DB 3VRLE 2IDCA 3BMVA 3KCPB 3VDCA 5AAMC 3OX8B 4GP5B 4OV6F 4DUXA 8CGTA 1F1AA 2DQFB 4C83A 5JO5B 2XYBA 5KN5B 3D07A 2CJTA 2CK0L 3CSTA 4WTZA 3ESUF 3UC0L 3VXTB 1ZEAL 3QJQB 6FABL 3CLFL 4PIBA 4IRZA 4YC2C 3N40P 4N2FA 5EF3A 2BINA 1SXCA 1X3DA 4J3XA 5D1ZD 3OR6B 1QR4A 3C5SB 3MLTB 1ZGLB 2ODIA 2VLKB 2AEQL 2G4GA 4OKVA 2HG5A 1X7QB 1EZUA 3GJFH 1JNHA 3FDWA 1DLHB 4XE0A 3ARGD 4M1GH 4OFDA 1PBYA 2Q7YA 3L3IB 5E6IB 5HHOD 4H7VA 1S9XB 4PPTA 3ZN6A 3G5ZA 1VCAA 5HHOE 4K3EH 3INOA 4JFEB 2AQPA 3TBTA 2ZXQA 3CFDA 2BWIA 3OMAB 1OP5K 1BYOA 2NTSP 3VYOA 3EO0B 3NK4A 4UI2A 1M1SA 4XNXH 1DQLH 4JUSA 5IGXH 4IOFC 1LP9E 4P2RD 2GTZA 4F2EA 4EDXB 1XCQA 4P2RE 2P8MA 1TZIA 2W81C 4PJ5A 3L3GB 1N2RB 2BJML 2R1XB 3EOAB 4OM0L 4P59H 3UAJD 4QYOA 3F58L 4JQIA 2NZIA 3HG3A 3ETBJ 3O45A 2WUCH 3GMMB 2AVFA 2XQBH 3HEIB 4AV5A 1E28A 4X5XA 1EEZA 3UIZA 3WFHA 1WBYA 4HEPA 2Y22A 4GG8B 3OR7B 1OARL 3CHPA 4PSPA 3RGBA 2PMZA 1RZKC 2UZXA 1G9EA 2AQNA 1QBBA 4EN3A 4FJYA 4G7VH 5LGHH 5I15L 2YHGA 3LZOA 4UMSA 3MNWB 1Y07A 3UAFA 1BM3H 3D09A 1OAQL 3L4CA 1LO5A 8PAZA 3IAQA 1SDYA 1SOXA 4XC3H 4PW3A 2IG2L 3QQ3A 4KUZH 3FL7A 4N4YB 4XCYA 3FQXA 1ZLUH 3VD7A 3LPPA 5INCA 1MNUH 4LP4A 2CGRH 1ZS8A 4LF3B 4LSPH 1WHPA 3PDOB 2WCPA 3FUFA 5HDWA 1D5XB 3NCXA 4MRCA 1REIA 1CGSL 4GJTB 2YK1H 4YLBA 4DP7X 3P9MA 1HHIA 1NICA 5CD5D 2ED8A 3S9DB 3VDAA 3MLPA 2YAHA 4ZFQA 4FFVD 4NOFA 4OV5A 4RGMB 3PQYB 4WIQA 1JTTA 1CXFA 1ORQA 2XRAL 4GKOA 5CCGE 3HZMA 3LXUX 4XO9A 2FQEA 5GS0C 5J9PA 3KYMB 4RX4A 3GSRB 4F7TB 2JK5A 2F74B 3BSHA 3Q8AA 2HFFB 2WQ8A 5IW3A 5FWQA 2DF3A 3LRHA 1W0YT 3K2KA 2ZIDA 4E9RA 5IESL 4JFDA 5AZ2L 3SBWA 4ZFOA 3WTWA 2F5BH 3FW6A 3GXIA 2NR6D 4K7FA 2VO8A 3ILDA 2YWYA 2C1PB 3LZPA 1LE9A 1SOSA 1CICB 1I3UA 4XI5D 5I1LA 4D0CA 1R75A 1TVBA 2JLPA 2IDUA 3H9YA 3DLQR 3WIAA 3PAUA 4Y5YA 1HCFX 1NBVH 3HE7C 3KBFA 3NIGF 4JPVL 5GHWL 5C8JA 2K9FB 4YGAB 3EH2A 3ARFA 2FX8L 3EYVB 4JFOA 4GRWH 1X5XA 1LTXA 3RX5A 5MERB 1JNNL 1M7DB 3FUMA 3QJTB 4OCYH 3LRKA 5A6IA 3HN3A 3DX4A 4Z0BH 5D1ZI 2EE2A 2DAVA 1UADC 4AH2A 5CJOH 2DYPB 4MHHI 4Z9KB 3QXWA 5CLWA 3MV8D 4FHJA 4HEMA 1DQMH 2RQ8A 3PHOA 2E7LA 1EEYA 4KROD 2Q1EA 4G59C 1A21A 3DX9A 1PKQA 2IPKA 2QMKA 2Y06L 3FPXA 2FZ3B 2AEPL 1YEFH 3SDCA 1EJ8A 2DI8A 2BVPA 3O4OB 4CSTA 3DO7B 5AOLA 3REVB 1D9KB 2NNXA 1IKNA 1UM5L 4WCYL 1DJHA 3ZDXB 4Z7UB 3VDBA 2WNWA 3HNVL 4JPKL 4GAYA 3HKFA 3GZKA 4NZUL 1W6LA 1XR8B 4M1DL 3BI9X 3HLKA 3L9RB 4AQZA 4I13B 4LCWB 3PL6B 3POHA 1SDAB 4OFIA 4ACTA 2EEAA 4P5TA 3V6OA 4MMZB 1OSPH 1SHMA 2FIKA 2VM3A 2IMNA 3IJYB 4BDVA 4DCQA 1U8KA 2CDFB 2HN7A 2R0ZL 3IKCA 3K2UH 2A9NL 1U3NA 3EGSB 5H37A 2IC2A 4EKJA 5AB9A 3TWYA 1BP3B 5F9WC 2E9IA 3U1SL 3SQRA 5EC2A 3JVGA 4OM1L 1A4KB 3BT0A 2CHZA 3ULVC 1II4E 4JVPA 2YOAA 4IDJH 4U1LA 3AS3A 4X4KA 3FO2B 1BEXA 1SEBB 1O6VA 1M05B 5JHLL 1INDL 3RBSA 3UO8B 3BGFC 4KZDH 4FC3E 4IK7A 5KSBA 5DJDA 4OW6A 4PJHA 3UGXA 5C08B 3TN0D 2Y36H 1JDAA 1M7IA 5TGBB 5IHUL 1CE6B 4I3SH 4YH6A 5FA4B 4PTTB 1NINA 1RFDH 1KCVH 3MACL 3QAZB 5GGUA 5J06A 2WAHA 5J0BA 4LMQE 3APMA 3OJDA 3L5WB 1W2KT 3VXRA 2ETWA 2I24N 1EDYA 3IU4L 1EAJA 5GGSA 1MVFA 1TETH 1WYJA 4FMFA 1J5OL 1IAIH 3EIFA 1URIA 4DAGH 1INQA 4JJ5B 5GRZA 3LIUA 4ZTOL 1AHWA 4I48A 4X4XB 3GMPB 1J18A 4WFFD 2XKSA 2AK4D 4H5SB 4YGVB 3T09A 2AK4E 2E86A 3VH8B 3ZL2A 4BFOA 5E6YA 4XC1L 1CTMA 1IBFA 2KC0A 5E9NA 5HGGS 3HC3H 3KW8A 3I6SA 4ZFGL 3NEOA 2QPSA 1DFBL 3GSUB 5D7KD 4NRZB 5D7KE 3QJRB 2WIMA 4HF5H 4NFCA 5DJAA 2A4EA 2W9LA 1MHEA 2EDXA 5B7EA 3PGFH 1UXSB 4WI2A 1XSIA 3VD2A 1LL1A 5IFJA 4HJ1A 1NEPA 2BSTA 3U4AA 1PD6A 4H4NA 3ML8A 2Q8AL 1F1GA 5IUSA 3MRBA 1C08A 2NRDA 1T1ZB 5IT2L 3K71A 4YNYB 2ZSWA 4CL7A 2V9TA 3NZUA 3ARQA 4JO5A 3NCFB 1Y7VA 2DBLL 2QZ5A 3SE9L 3EOBA 4IBQA 4B0MB 3B43A 2F0CA 3CSFA 3NIDF 4P3CL 4ADIA 3VU2A 2SODB 3AABA 4P2QA 3RIKA 1UXLA 1TQUA 4OLXL 4TYUA 5B1JC 3RVWD 2WNGA 3X3GH 2Z64C 3EO1A 3OPZH 4PGCA 4G8GD 5HBBA 1KB5H 4MMXB 4G8GE 4I3RH 4NM8L 3DX6B 3FSAA 5CR1A 3CUPB 1S8DA 5DA0B 1CFTA 1Z66A 4H8QA 4AWJC 3IXAB 1V3JA 3ULUC 4ZAKC 4Z7OF 3WIFA 2Z3FA 4HPOH 4XVOA 1KIPA 3MJGX 5E4EB 4NC0B 5E7BA 2BHFA 4C54A 3JWOL 2CO4A 3IYLW 3DSNA 2B16A 2VXVH 2D7QA 3S4SA 3KE0A 1AZNA 4QT5A 4PJGF 4DW2H 3WTSA 3TBBA 3T3MF 4JHUA 4YL4A 1X5KA 1IL1A 3EHBB 5FOBA 5KYNA 4FFYL 3VFPB 2R7EB 1LDPL 1TVHA 1Z5LA 3SDXB 1GH7A 2QZQA 5LGYA 3SPIA 1EHLL 4H26B 1YY8A 4AENB 3WKQA 4QRUB 3VRJA 3W81A 2CGZA 5JHAA 3MOAL 5TE4H 1TCMA 5IMLB 1KFAL 3JTTA 1I8KA 3LCYA 5DZNA 1WQVT 2J8HA 4JKNA 2CJSA 3BP7A 1A4JA 3DDFA 4JZOB 2BVYA 2VSDA 4UMGA 3U9UA 4HHAB 4P23C 1KLGB 3ZGHA 1UYWH 2VAAA 4X0NA 2QGCA 4XVUD 5CN1A 5FB8A 2JJWA 2HH0H 3LEXB 4IK6A 4JG0L 3QO1A 4HT1L 4ZZKA 4EIUA 5C9KA 4YSRA 4NNYA 5C0EB 3VFUB 2WB7A 2UX7A 2PTUA 4LARH 2IADB 1FVEB 1ADQL 3E9TA 4IJTA 4JY4A 4LMQI 2QHLA 2NYYD 3IPFA 3OAWA 1OW0A 1JK8B 3IJSA 3CLEL 1F1DA 3S3JA 5DVKA 2Y9RT 1OWWA 1FDLL 3GEFA 3KYKL 5T1KB 1RJZA 4B9PA 2VR5A 5I6OA 3RB7A 4H25A 2DM4A 4MNHB 1JUFA 1I7ZB 3FOLB 1JZDC 4G80A 4D3CL 4Y5XA 1BJ1H 2ZQKA 3GIZL 3KPOB 3JQOB 1UG9A 2CUIA 2PCXA 3V7MA 4AK2A 4M5ZL 3HG1A 1G6RA 1B3JA 5IB3A 2W60A 3DK2A 4PLNC 3ZE0F 1NCNA 3K5SA 3BKYL 1P2CB 3RWDA 3L16A 1WV7T 3SKOA 1SYSB 2UY6B 3CDCA 2R2BB 1OF2B 3I9GH 1ZPUA 3KYOA 1KCUH 4FZEL 1ADWA 5H2BA 5I19H 4BQCA 5CINL 1TQBC 5L8JB 2ZWZA 2QQKH 4ODXB 3ZRSA 2WC7A 5ILTL 4L8SB 5IEKA 1DVFD 3MRIA 3UX9B 2OA9A 3HFMH 2CR0A 4K3DL 4TTGA 3AGWA 1WD9A 4NQCB 3TBWB 1S7VB 12E8L 1RUKH 5JW3L 3I02B 3ARYA 4MMYA 1NMAH 1J5HA 3TURA 3FBQA 3EW3B 2CKBH 5B8CC 1AGFA 2NY6C 3VGEA 2GHWB 3EUUA 1HFUA 3BEVA 4OJEH 1JV5A 1YUHB 2C9SA 2CCLA 2XA8L 4WI4A 5ENWA 3VWKC 4G8IA 3NCWA 3P0YL 4WHYG 3B9KC 5C0AB 3ELQA 4NNXB 5I0XA 1E30A 4HXAH 4KKZA 5IBTL 1T1WA 4N5EC 1R19A 5JZ7C 4PRID 5A1AA 3O9WB 4FXTA 1FBIH 4PRIE 5BZDB 2XOTA 3L81A 2J2ZA 1WCQA 3BZEA 3IBOA 2MQ0A 2J1XA 1IJ9A 2ZAIA 5DWPA 1OP3H 1QLEB 1CFSA 1MFNA 2AJYL 1OLZA 2YXMA 4AGPA 1UB5A 4BHUA 1BQRA 3FB7B 7PAZA 2WUBH 1ET8A 3WD5L 3BP4A 1BQHA 3WNJA 3A47A 3EOTL 3FBKA 4OCMC 2OTPA 3O0RL 5GPRA 3EDDA 3VG9B 3C6LB 1FG2A 2UZIH 2X4PB 3CLWA 2YAQA 4Z95L 2K8MA 4NP9A 4PV8A 3N2JA 4NAQA 2DWEA 4IW4C 1M9SA 4OZFA 1BEYL 3D05A 3JWDL 4G6FB 5LCVA 3FUEA 2YIHA 1T83C 3FQUB 2QADB 5KW9L 1YCSA 3DX7B 4JLRA 5IBUB 4MA3B 1NCBH 5LO7A 1OCCB 4HFWA 3L7FA 4CDHA 4WI7A 1OSYA 5PCYA 3QWRD 4JDTH 5ICZA 2TSBA 5IFAH 3LXAA 4K5PA 5CEXA 4HUXA 2WXMA 5IB4A 4FQJH 4MA7L 4IGBA 4N0CD 1GYUA 5D1QD 5EOQL 5JHMA 4MA1B 2XQ0A 5D1QE 1U8JB 3EGXA 5E08L 1J11A 4BH7A 2K1MA 3N44B 4JM2A 2G0LA 2WVVB 2QQLH 5C0JB 1MJ7H 2DYRB 3LAFA 3T2NL 3VFGL 4EN2A 3WUWG 4QXGL 4R97B 5D2LE 1A7NL 4JJHA 3OM3B 4L1LA 2C9QA 1U2CA 3UTTE 4KZEH 2DQEL 3BPLB 4XBEL 1IC1A 2D7OA 1FO0L 4GAFB 2HT2C 3IFNH 4IMLA 3MVSA 4W9LC 5GSRA 5ADOL 3OJVC 1VENA 3BOVA 2DH3A 2E6JA 1KPUA 3QUKA 5DD0H 2PN5A 5EZPA 3KMDA 3AW5A 3CFKB 1AR1B 3NJLA 5FKAA 1F0LA 4L23A 4F57H 3WAKA 3KL3A 4PJIB 4D94A 4Q9RH 1JHLL 2VUYA 3RWHB 5LNGA 2G5UA 5K69A 5EU3A 1Q9OA 4I89A 4W9FC 5F6HI 5FGBC 3GMLA 4JRFA 3V6FA 4JY6A 3R06B 2NY7H 5E6SB 1EGJA 3W2DL 2XPZA 4K7PH 4NENB 2A73B 1GKEA 4KTDH 4LGSB 5B22A 1OWRM 3ARTA 4LCIL 4RLDA 2EDYA 5L4FA 5LGKA 4L1BA 4F7MB 1NLBH 5CEYA 3EYUH 3HS8A 4GKZB 4MZIA 4MKMA 4UQEA 2JCCB 5HDQH 3BESR 4JQXC 3B3IB 4O00A 3B7UX 4P48A 1SBBA 3QYNA 2HTLD 4W4OA 1K3IA 1TJGH 4WFGE 1D7FA 4P46C 2EXWC 3TO2A 5E1AA 1LQSR 1TZOA 4ISVB 5IOPB 4ELKA 1DUZB 1GS8A 1QKZH 4DN3L 1J9SA 3MROB 3PP3H 2X6BA 5FDYA 43CAA 3RYMA 3ZX1A 5EU6A 4KNSA 4UM8B 3CFEA 4GQPH 1H6FA 5I1IH 1B88A 1XR9B 4LKXA 5GSVB 4PJ5D 3C5ZA 4PJ5E 4Y9CA 2OW7A 3GLDA 4ZUSB 1ZOXA 3WNIA 5DZAA 3KLAA 2OXGB 3OWEA 4ODVH 3QIUC 5DD1L 3EDFA 4ABUA 2P52A 2GSMB 1OK8A 3K6DA 4QR7A 1ZV2A 3K4DA 3I84A 4NQDB 4XGZB 4F7CB 5C0RL 3Q05A 4PGBB 5AD0B 2EO9A 1HQRB 3LH8A 3EFFA 1ZVSA 4UQ3B 4JQIL 1CD0A 5LBSH 4UNIA 3QEHA 2GEEA 2Z0BA 4NNPH 4P9ML 3D39A 3HHRB 4QIRA 3L48A 4A66A 1AXSA 2F9BT 5HYEA 5DMIH 1U8NB 2X2IA 1FRGH 4KKAD 4LEEA 3EAKA 1S2EA 2XYCA 4M62H 3EO9L 4JN2A 3N41B 2H0FA 1T80A 3OKKA 4I2XA 4FZ8L 3G5VA 5BO1H 1LO4H 4FJ6A 4Q97A 2XV6B 3IN2A 2DIEA 4AOFA 3ZDXF 3QIWC 4UTCA 4Z7UF 4X7EC 5I24A 1M3JA 1VJSA 1NBYB 4XOCA 5L7XH 3ABKB 3QNYB 4N2AA 2J12B 3LB6D 3X1GA 4AUUA 1HILB 5E2UL 4NZTL 1XEDA 2ZOUA 1T5WA 3ALWA 3WDIA 2B1AL 3DMMA 4Y4KA 1D2OA 1MSPA 3UP1A 1O7DC 3TEZA 4YDZA 2B1HH 1UATA 2ARJQ 1NIAA 1PDKA 2N3JA 4N0YH 4YC2B 5B1AB 3RAJH 3ROOB 3FQTB 3GXNA 1CLYH 4HC1L 3LMJH 4N1CA 4RX4D 5GZNC 5EBWB 2WN2A 3WJLA 3TEYA 4UTBL 2JJVA 2WLNA 5D6CA 1FFNA 1G9ML 2XZZA 4LSSL 1VFAB 3BAYA 3W9EA 1BIHA 4RESB 4ABWA 3ME0A 2FQGA 4JFDD 4XPBH 4YX2L 3LRLA 3PAVA 4H13C 3LZFL 4JFDE 4AMKL 5ID1B 1ZXQA 2NUPA 2YJQA 3TBSA 5L2JB 3HHSA 2GUOB 3DBXA 1A5FH 4ZFOL 4QXVA 4XPHL 4G8AC 4WEBL 5C6TL 3L7EA 3ARFD 1BGXL 4AQEA 4NZRL 2VISB 3JXAA 2V7HA 2VDKH 3IBEA 5LB1A 3NSJA 1KV7A 2EXSA 1ND0B 4HUUA 1WA0X 2YARA 1WEJL 2WXIA 2CDEA 2HRHA 4Y7OC 5IMOA 2E7MA 4HEME 1QTPA 1A3QA 5G5DA 1IZKA 2OL3A 1TJIL 2OMZA 2WCSA 4NQQA 3T08A 5C0CD 2JH2A 3HAEH 4F93B 1PKQE 3AADB 2YKLL 3KXFB 2CHDA 3SDCD 1JZ8A 2BNRD 3S8GB 1DVTA 4FA8A 3W0WB 4NWUH 5IJBC 1I1FB 1CVSC 2XFXA 1SF3A 3U6XA 1IAIM 2ZYRA 3SDDC 1ZY9A 1TTGA 1IM3A 4H2AA 3EJPA 3MLSH 1DBKH 1KTJA 2H0EA 3O41B 5I16B 3HMXA 5BV7H 2QLYA 4AW4A 3N9GH 4P5TD 3R0MA 3V6OE 1JDDA 3FUDA 1MCCA 2XN9A 5C09A 1ZWIB 3K80A 1GJUA 3WCYA 3AAZA 3WENA 3PWLA 5BMFH 1XGYL 1RPUA 5I1HH 4DPBX 4G6ML 1R3HB 5F7NC 1E5CA 4JPSA 3NVQA 2I60L 4MJIA 3HE6C 1FZOB 1F02I 3ARZA 2Z93B 4GW5A 1KYOK 5KYYB 3HR5A 2Q9OA 1BMGA 3SE3A 4Z7NE 4K0OA 2E46A 5KSBE 3UPCA 4PJHE 4YL9A 5GXBB 3HOGA 3IT8D 5JORA 4RFOH 1SHWA 1XX9C 5L88L 5CJQL 1GAFH 2AITA 4S1SL 5HGAB 4TNVK 2J56A 4MBOA 1HYSC 1N19A 1WT5C 6CGTA 4BEIA 5BPPA 2Q2EB 4NUJB 3TFKD 5HY9B 1U3JA 2HUEA 4KO5A 1NDTA 1CDYA 1Z3GL 3B8YA 3VXRE 4PR5B 4WO0A 1NGZB 2WKOA 4ZODA 5EF0A 2ITEA 3HE7B 1N18A 4PG2A 2R9HD 5HGBB 3SDXF 3CX5J 1U8IA 3EH4B 4RGOH 5KJ7E 2PETA 5FO9A 1ZHBA 4XPAH 3RZWA 3JWNH 2NX5A 1O75A 3D18A 2X4TA 1JWMB 5F7BA 2JI3A 1E90A 1MFAH 1BAWA 1U93A 3BZFA 4MXVF 2NXYD 3BP6A 5BZWA 1YN6A 3QUHA 2WINA 1VRSA 3AWEA 3FXIC 4IS6A 4JB9L 4TN9A 5C07B 1PIGA 1N6QH 1VA9A 1FPTL 2YC1B 1XT5A 5IREA 1KMGA 3H4HA 1Z6JT 3BUYA 4ZW8A 5IIEA 1C7TA 1KBBA 5HI4D 3DIFB 3KWWB 1B2WL 4RDBA 5I5JA 4G43B 1J8HB 2BY3A 1O5DT 5C9JB 4MJHA 1CXIA 3N5AA 1G9NH 2K3HA 5DMKA 4R0LA 3HG4A 3RFZA 5D71L 4WHTB 3OKNB 3U25A 3HB3D 4IHOA 4U6YA 3QPXL 2P7TB 5FM4A 4F80A 4P2QE 3UMNA 1N5AB 1R3JA 4GMTH 4YE0A 3QXAB 3P73A 5F9WB 3HI1A 1CDJA 2Q7NA 4POUB 5FCUH 1A4CA 1F4AA 4P57A 3FF7A 3UOAB 1MJ8H 2NDGA 3O3BB 1U6AH 3M8OL 2CLRB 4IKJA 1DBML 1XMWA 5H35A 4F20A 3BGFB 5G4MA 4PLOB 4XXWC 3A67H 1GS7A 5F89B 1HHJA 2CJ3A 2G60H 2GY5A 4KK6D 1A6AA 4WO4A 2K6ZA 4ETYA 1JGVH 2KPWA 1R5IA 4XNQB 4NQUA 5CILH 2Y23A 1VEPA 1NC2A 2F54A 1ZT7A 2AV1A 2AEOA 3MCLL 5IHZB 2YUWA 4TOYH 3U0WL 2WKGA 2FB4H 4PJEB 5EOTA 2MCAA 4MJ6B 4HKJB 1G7HA 1KFGA 1U9KA 2GTQA 3V0VB 1WC7B 3RNKA 3Q2VA 2P8PA 5DC4B 3VA2C 4MNGA 5A7EA 3PGDA 2QMJA 4KMTH 1KIRA 5ECGA 3TIEB 5IR1A 4KJPC 2J3SA 2VKWA 4EBQH 5T3ZE 1OOAA 2ZX7A 4XBPA 1TNNA 4HH9A 3QDMB 2E27L 4PRHA 3SJVB 2H9GB 1HU8A 4LNRB 4NO5A 3RQ3A 1K4CB 1KPRB 4M9PA 2Q7AA 1QQDA 1FL3A 4ONFL 4ZQTA 5I66A 3K6SA 1LE5B 3VW3L 2LT9A 4XMLH 4QEGA 4N2BA 5T3ZL 3FQ1A 5CU9A 2DLHA 3GHPA 4KTYA 2ZXEB 4M6NH 2VJ0A 5I1GL 2W0FB 1JHTA 4NC1E 5F44A 3U0TA 2NY5C 1B9KA 3K5RA 2AQ3A 3WI9A 4M61B 3OXRA 1VFOA 1WH0A 1J8RA 1SM3L 2R23A 1RH8A 2BFGA 1NGYB 4K4KA 2BIPA 4RVBA 5KS9A 5D55A 1JZ2A 1GS6X 3BUIA 3GMOA 4KVCL 1E9PA 2P8LB 4FD0A 3LYRA 5DYFA 3HG1D 1XIWC 4RAUB 3Q5TA 3CHRA 3HG1E 1ZLSH 3FQWA 4YXHL 3TV8A 1V27A 4IEFA 3S34H 5IM7B 1PF3A 3QPQC 4M8QB 5GRWA 4WUKL 2W88A 1FE8H 1YC7A 3CFJA 3WIHH 1UGNA 1KBPA 1JFQH 4DN4L 4ZAKB 1M71B 1A7OH 1G6RL 4FABH 5KVDE 4CVZB 4UDUA 3FSOA 2VMCA 1YECH 2WAQA 4JANB 4M03A 2ICWI 1W16A 3JTSA 4JO3H 4BUGA 3LKOB 4XHJD 5J6HA 2ENSA 2OR9H 2YA0A 3QG6B 5EOCH 1PEWA 1A64A 35C8L 3VYPA 1N7ML 2VC2L 3QAQA 4K9EL 4UTAA 4N85A 1TUPA 3WGVB 4J27A 3OLGA 4Z3IA 4OI8A 3S36X 2PYFA 1HDMA 4L1DA 3FO1B 3S96A 1AFVH 1IGIH 5FO7A 3N44F 3KL5A 1MJJA 4CGTA 1BVLA 3QQ4A 2PTVA 3I75A 3QORC 1RULL 1FA4A 4NKMB 3ETTA 1M6OB 5B4MC 1EXHA 2AV7A 3NRFA 1X7SA 4P5MA 2H32A 3FRPA 3MXWL 4N2CA 4EKXA 4OY9A 2XLLA 4P23B 3KPLA 2KT6A 3NCJL 5KEZA 4ZS7L 1K8DA 2AJXL 4PJIF 3RY5A 2ZG1A 3PAZA 4FS0A 3VGDA 1AXTH 2F53A 1SJEA 3AXLA 4HWEH 5HHQB 1B4RA 1QMUA 1CZ8H 3T2OA 2MHAA 1L9QA 3ML9A 2DRUA 2HYMA 3CCHB 1S5HA 4PQXA 3MRLB 4JRYA 2P5WA 3B2XA 2A9MH 4FFWD 1BMZA 4NQEB 1AO7A 1NIBA 2JCCF 3N6YA 4AGOA 5JOFB 2AQQA 2CBMA 1DEEA 5DA4A 2NPLX 4ZW6A 1BAFH 4S1QL 5AWNH 2NLJB 2W07A 4PV9A 1CFQA 1QACA 4DPAX 2Y7NA 4LRIC 4B95C 2XKUA 2DS4A 1X44A 1MFCH 5DHVH 2F7IA 3MLRH 3QQ9D 2DMKA 4YE4L 5LVEA 2P80A 4R3SB 2GK2A 5F88A 1AY1H 3RIFK 3EYSL 1U8PA 1MRFL 1Z9NA 4IGBD 3FH8A 1IU1A 5FR3A 3DO3A 1TQBB 4MDJA 4NSKA 1COBA 1UWEL 3FT2A 5CJXA 4XP6L 2D4FA 1UCTA 3K72B 4JM2D 1CVRA 3HHMA 5AVVB 5MEQA 1GGCL 4AJWA 3Q6GH 2FGWH 1KTDA 3NA9L 4IRJD 4GW4B 4E0RB 3GDCA 2CNZA 1P4IH 3WMSA 3ARUA 4HGMA 2CO3A 4XP4H 2C9UA 4OFKA 5E70A 2AJZA 4ZUWA 3ZHKA 1HZHH 4J2XA 4PGDA 5AVUB 1ITCA 4XVJL 3TP4A 3ULSA 3DJTA 3MRFB 4G5ZL 5EBMB 3U79A 5AOJA 4P2OD 1NAMA 3L1GA 5B8CB 2XPYA 4EJ1C 3ES6B 2NY6B 4FLOA 2VDPB 3N41F 1I7UA 4XPGH 3DVGB 2C34A 2DLGA 2YAOA 5DQ9A 3OZKA 4FQ2L 4NKIL 3VWKB 4H20H 3KPQA 3U7YH 4WHCA 3FPYA 2WO3B 3V6ZB 4Q9QL 1R0AL 2YEZB 2UWEB 3B9KB 3PUUA 4HJGB 3SDAD 4JKPL 1N68A 2XVBA 1UA6L 4N2EA 4ZUVB 2BP0A 1ODAA 3GZQA 3MLZL 2Y5TB 3KW7A 3QFJB 3T4AA 1UQSA 3S5ZA 4BBWA 3F85A 3UJTH 3B9VA 3ILEA 3BWUC 3H0TA 4XWOC 1EGJL 2NY1C 2WCGA 2IH9A 3V4VH 4P04A 3ZHFA 5BV7C 2PYEA 1TZHB 2E56A 4U3CA 2EDBA 3C2SA 4LOUD 1RP9A 4GRMA 4EVNB 4ZTPL 2CDGA 1A9EB 4L05A 1FIGH 7FABH 3V4PA 2DWDB 2IOOA 2J1YA 2JV6A 3MYJA 2HFTA 3NESA 3RPKA 4CVWA 5HYJA 2V8MA 3H6JA 5FWRA 2W9EH 5EU6D 2OTWA 1HXYB 3EG9B 1NTDA 2PWEA 4ODTH 4MB4A 5EU6E 3RG1C 3QH3A 3UCQA 2D3NA 3H9ZA 5KVEE 4Z7VA 5HSFA 4KKLC 4ZPTB 3C5ZD 4M4PA 1YYMH 3QUXC 1SLUA 4X7SL 3VWJD 4OGXL 4NWTL 4NIYE 4I0KA 3S5LA 1DBAH 2HKHL 1K5WA 4FQ1H 2EJ1A 3ESNA 2WYIA 3VD3A 3AUVA 3GSWA 5KVEL 3QWOA 5L9DL 1GVIA 4DGIH 2J1KA 3IXTB 1PL3A 3BH8B 3OWRA 4BHUI 3TLRA 1T6VN 4U7KA 1OE2A 1WE5A 2A5UA 1OSZA 1JXFA 1QFWL 1XBRA 1VGEH 3D39D 1NCCL 1B6DA 3WEAA 3D39E 3ZE1E 5EZOH 3F7VA 2A9AA 1P7QD 2ZX9A 2ZJSL 4DUVA 3NMEA 5AG9A 3LN4A 3U4EB 4MQXD 1UM6H 4RFNC 5J1SC 3RGVA 2BP8A 4HIIA 4QGYA 5H94B 4I2XE 1W9XA 3CVHH 4U0RC 4GRWB 1NFDB 5GS1A 2N1KA 2FUQA 4PB0L 2BDNH 4DVBA 3MLWL 1ESOA 3JWNC 3X1BA 1GMIA 4N0FA 4ZUTA 2VKXA 1P84J 5CP3A 2MMXA 5E23A 2VDNL 2A83A 5HXMA 2H2SC 5FYKL 3FQNA 3CN0A 4O51A 4X7TB 5I1KL 3MRGB 1HH9B 1RIVL 2M26A 2WNXA 1E3FA 2DL2A 4Y4KD 2VDLB 1IGCL 3BWAA 5I0YA 2JB6B 1YEHH 4LRNL 4MVBC 4TL4A 3TCLA 2XWJB 3DOSB 3JVFC 4MX7B 4C57C 1DSWA 3MRPB 4U6VH 2WZPA 1C12A 1MWAA 3ARBA 3L4ZA 2X2UA 4R8WL 1FL6B 2RR3A 3FO0H 3VQMA 1FNFA 1UEMA 1TENA 2QSQA 3O2DA 2PW2B 1N0XH 2AC0A 5DS8A 3I3DA 3LKNB 1AR2A 1M2VA 4N6QA 1WZ1H 3ASOB 4KKBC 1GPOL 2JCWA 4Z7QB 3HNSL 4KI5C 4NZDA 4P46B 5E2VH 2V7NA 1DJWA 4JK0D 1O5PA 2F8IA 2Y07H 2JKWA 3O2VL 5IB5B 2HPOA 4I9WD 3PJSA 4XCCL 3MUGB 4L8BB 2C5DC 4H88L 1XF5B 1L3NA 2Q8BL 1KCSH 4OLWH 4AW7A 3O8XC 3ZKNC 5LQBH 1ZJBA 5L4IA 2ICCA 1IGYB 3J8F7 1WZLA 4UNUA 3QIUB 5C7XH 3EXLA 1OTTC 4NQVB 3B2UC 1LEKB 1FJ1A 4HOMA 3Q06A 3L45A 3DYPA 1F6LL 4TQIA 3MJ7B 4HJ0D 3NIFB 4JVWA 4V1DB 4W9EC 4RRPG 3MJ6A 4MLIA 5GRVL 5FKPB 4XMKH 4FFTA 4Q0XH 3CXFA 1MCKA 3WKML 3FU8A 2N0KA 4J3OD 5DJZB 1E0OB 1QBLH 2XTSA 1RUPH 4N9OB 5C0IA 3ZTDC 5B3SB 1LLAA 5IW1B 2P4AB 4JHAL 1K2DA 2OL3L 3L13A 2Z4TA 3KCPA 4JO4H 3OX8A 1KTCA 1IM3D 2O93L 3AS0A 4IIQC 2DQFA 5JO5A 4U7SA 4PWEA 5KN5A 5DUPL 4K5NA 4NM4L 4M7JH 3VE0B 3VXTA 2WK2A 1BZ7B 2GBTA 4FHKA 4PBXA 2OR8A 2UYLB 3QIWB 3D25B 2YQGA 5E9AA 3FHEA 5IOKA 5KTEL 1MRDH 2BS8A 2TRYA 1UWYA 4AC4A 5C09D 3TYFB 2XN9E 3OR6A 3C5SA 2ZUYA 5C09E 3MLTA 1T7WA 1ZGLA 1PY9A 1SFHA 1JGLH 2VLKA 4KK5D 1X7QA 1HNYA 2ZSVB 4PG9B 5AVXB 3WNMA 1DLHA 3HMXL 5KG9B 4FNRA 1EMTH 4EIBA 3L3IA 1WBZB 1KACB 2AJSL 5FDWB 5G55A 2APWA 4MJID 4H1LH 1S9XA 5E6IA 4MJIE 2XZQL 3EFOB 3GQFA 3MPCA 4Z77B 1TPXC 4JFEA 5AOZA 2BXZA 3GPEA 2I9LB 3BO8B 5I6MA 3EO0A 3APFA 1FFOA 2GJPA 3EKCA 2PTTB 2XWBB 1TKWB 3ULVF 1JCVA 4S0HA 4PS4H 3SQBB 4EDXA 4QKXB 4KJWC 5CWSB 4PGZA 3RDTC 1A7RL 1FUNA 1WBXB 1AD9B 3VFSB 4AGNA 3L3GA 1N2RA 2R1XA 1SEQL 3EOAA 2Z1PA 3NTCL 1BDYA 3MRKB 4M6AA 2H6OA 1JN6B 4X5PA 5TQ2H 1KG0B 3PAYA 1OAUH 1FVDB 1DBBH 3TIDB 2NY2D 3GJEB 1WTGT 4CC0A 2R1YA 3SYAA 4GG8A 2FLBT 3OR7A 2APFA 3PUCA 4IJ3B 5DHYB 1T0PB 5ISZB 1UOKA 2FH6A 2L3BA 1J05B 2NX5D 4RBPK 2IFGA 3VSVA 3EJYD 1OOWA 1PG7L 1NGXB 2NX5E 3MNWA 3NK3A 2EIEA 5DHMC 4CMMB 3SZ6A 1MCWM 3VU1A 3UO1H 4XPTL 1KXVA 4IBYA 3GSNH 4TPRL 4EI6B 4MS8C 4PRBB 4IBZA 1IBGL 3GXUB 3X2QB 1FYTB 5DFVD 2WN3A 5C7ZA 2R69H 2XC8A 4LF3A 1F3DJ 5DDHB 5KZCB 2J55A 2JELH 5FC9A 3O2WL 1YMHB 3F7PC 5KJRH 1D5XA 1RUQL 5FYJD 5LWYL 1AZVA 1Q1JH 4HSCX 4JFVA 5FYJE 2E0PA 1YNLH 4IRSC 3SDDB 2GBVA 4TRPL 2D9QB 2XVKA 5D2NC 4B9IA 5KSUB 3PQYA 4ANWA 2Q3AA 3LKSB 2BRQA 5FYJL 5ESAB 5ID0A 3WFEH 2NUTB 1OZUA 3KYMA 5CLTA 1KCLA 3GSRA 4FLSA 4F7TA 1RIUH 3CV5A 2DTMH 1ZJAA 2F74A 2VDQH 2BHZA 2YWZA 3KGRA 4WI0B 2PNDA 4BZYA 1ZGLP 1OXYA 1P4BH 3H3BC 1KENH 4DOHB 5ACMA 3A6BH 1A0QL 2ITCB 4L3AA 1YQVL 3VQLA 3ZDYB 4DETA 4LBAA 4P4KD 4HVBA 4XVSL 3ZMEA 2C1PA 3CZUB 4KITB 2MEJB 1CICA 3HE6B 2B9AA 3D9AL 4FQQB 4XBMA 4BSJA 1AI1L 3AM8C 4Y4HD 5GRJL 5LN8A 4ODUB 2Z4QB 2Z31D 3NCYS 2EO1A 3ULUF 4LSTH 1JWUA 1TMQA 1NL0L 1BQUA 2Q3XA 4WO4D 2FSEB 3L2LA 5BUGA 1J0IA 2O6CA 3EYVA 5EV7A 1NC2D 2F54D 3K4AA 1EJFA 3E2HC 5MERA 4JREC 2F54E 4F9PC 5C2BL 1M7DA 1WA1X 2J6WA 4Z5RB 1ZD6A 1MFMA 3A22A 3GRBA 5A2AA 2KHAA 3L4YA 2DYPA 4QNPF 5AZEL 1DQJB 1OAZH 4EF3A 5FEBA 5CFHA 3APDA 1B90A 2OMYB 3E6HB 3MJ9H 5CS7A 4PBWD 2E74C 3UG3A 4A55A 3GO1L 4MNGE 3U1PA 2FZ3A 3Q01A 5DHXB 1G7IB 3LIZH 4C55A 4Z23A 2MPAL 3CZJA 3LZQA 3PY9A 3DO7A 4M6ML 2XWZA 3LY6A 4KPHL 4OLYH 1D9KA 3REVA 5GS2H 5IVOA 4Z7UA 1CMOA 1T4KB 4PRHE 2AMGA 1YYLH 5I1EH 5CJ8A 1J12A 1XR8A 2K70A 1QX1A 4O2CB 4U1NB 3L9RA 4LCWA 1NUFA 3GIVB 4LASH 3CFCL 1IC4H 4OJYA 4MMZA 3EOYG 3IJYA 2CDFA 1JRHL 2A0LC 3RKDC 3OKDB 5AUMB 1LEGB 3EGSA 2EKSB 3EJUA 2LQRA 3BC9A 3I50L 5AALA 2R0WH 3SCMC 1JF5A 3T4YB 1A4KA 4WI6A 4LHUG 3OZLA 3ZT7A 2FWOB 2HKFL 5EIIG 1BF2A 3R8QA 5KS9E 4XMXA 3TTYA 2IQAB 4EUPH 2MCPL 1SLWA 3OBAA 3FO2A 1SEBA 3BAJA 3MGTB 5HHXH 1M05A 5L0QC 4LLUB 2NY0D 2DEWX 4MZ3A 4JPWL 5C08A 5BQ7B 3C6SB 5TGBA 1PFCA 1CE6A 1WTLA 4LSVL 5FA4A 2VZTA 4PTTA 3NDZE 1KEMH 1J5DA 1W91A 2EDEA 3GI8H 3L08A 3NIGE 3QXTA 1FHNA 4ODHL 4PLJD 3MI6A 4JCLA 3UC0H 1OGTB 3L5WA 1XV8A 6FABH 1KJ3L 2NCEA 3Q8FA 4GAGL 3FQ2A 2ZUTA 5HD8D 3W9DB 4B9GA 1NGQH 2UV3A 4DP6X 3Q1EA 4UU9B 5CGTA 4C58B 4MD4B 4JJ5A 2X09A 1KYFA 3II1A 4AGMA 4X4XA 4OGZA 4BCZA 1VERA 4H5SA 3A24A 4HP5A 4YGVA 1TQCC 3VH8A 5BOJA 2FX7L 3BVUA 2EDWA 4FQLH 5D7IB 3OAZH 5BVPH 3ABGA 2HRPH 1ANUA 3GSUA 3ATEA 1F58L 5IQ9B 4NRZA 2I26N 1BVOA 2CMRL 3P3RA 5D4QA 4UTAL 2YS4A 5DJCB 1YEKL 3O6MH 3KLKA 1F41A 1UXSA 3MA7B 4WGWB 3WNNA 4X8JB 3QJSB 1NSNH 4M7ZC 1S5IH 3KLHC 2ED6A 4KK8C 1TXKA 1ZT4B 4AXWB 5DZPA 1T1ZA 4OTXH 4XX1G 3F58H 4YNYA 5J7CC 3T8MA 1JL8A 1CLOL 3VFNB 3ZXAC 5B3NA 3V9FA 5EZIH 4ANUA 1DQDL 1M7UA 2F53D 4XO8A 2UZYB 3C60D 2F53E 4B5EA 4E5XG 4N28A 2UWEF 1RHHB 1N5YL 3DVIA 5B3JF 5JXEC 5I26A 1JAEA 3JV4B 4YDVB 1BECA 2P42B 3AREC 4F91B 1XVSA 1MIEH 1UD8A 3B9EA 5I15H 3S0PA 1OCZB 3DETC 1U95B 4JRYD 4Q74A 3SD2A 2P5WD 4JRYE 2IH3B 4MMXA 2P5WE 3DX6A 5EU7C 2EDKA 1OAQH 2RB8A 3CUPA 1XAKA 1AO7D 1BZQK 4NBZB 4TV3A 4XE5B 1AO7E 3IXAA 3H7BB 1Q0EA 1BWMA 2IG2H 3WTVA 2Q86B 2FNBA 3OVUB 1BBDL 3BKML 3DJRA 4M56A 2GAZB 5CAYB 1XIWB 1JF1B 3CFMA 5L6YL 1UVQB 3CVBA 1MIML 3P4MB 4F5CA 5F0PB 4DEUA 2P80D 4UV4H 2ZWYA 1USQA 3MCKB 3VFPA 4R4ND 1IQWL 1JZJA 2R7EA 4Z3FA 3WJMB 3SDXA 4XCFL 5F7YC 1OAYL 4RSVA 4H26A 4Y89A 4AENA 3LZLA 2K8QA 4QRUA 4BFGA 3MXVL 4TLUA 4TULL 5GGSY 4W9IC 1D5BB 3QNZB 5IMLA 2QTEA 3SBPA 4XP5L 3F01A 1WGOA 4LLQA 2B59B 1BF5A 1DEDA 4AZUA 4FQXD 5AZ2H 5IESH 1JNJA 4JZOA 3ZE2B 4S2SB 1T0NB 4J6IA 2F2HA 4HHAA 5DJ6B 1KLGA 2XX0A 4WUUB 1CLZH 5E6RB 1JPST 3BUPA 2IFFL 3VNZA 4WU5B 5GJSL 3AQDA 3X14B 3ARRA 3LEXA 5IVZB 3QORB 2F7PA 5DMGC 5A2FA 2B4CL 3DVFA 4WK4B 4DGWC 2N0MA 4KWUA 5C0EA 4GRWF 1NFDF 3QEUB 5AQ0A 3VFUA 4ZNEA 3TJEL 2IADA 2ADIB 1FVEA 2PW1B 4X9HA 4LAJH 1F4HA 4H8UA 3QP3A 2WBXA 1U8HB 1S7TB 5IY5B 1JK8A 2VDRL 3AG4B 2F08A 3MA9L 4PN6A 3H42H 3QRGL 4D7BA 3OZ9H 5T1KA 4MNHA 1I7ZA 3FOLA 1HHGB 4DHLA 3KPOA 3SPHA 1G7QB 4DKEH 5DHEA 3KJ4C 2XN2A 3GLZA 4AKPA 4K23L 4Z7OE 1ES0B 2PYEE 2VRAA 1H5BC 3UTOA 3NZHL 3Q13A 4ALAL 4D9LL 4WCYH 2EXYD 1UH4A 1FIEA 3HNVH 5HYJD 2ZUWA 1P2CA 2MRYA 2DD8L 2ZXWB 4AZ8B 5HYJE 2Q76B 4X80H 1MFDL 1SYSA 3B9AA 2RFXB 2UY6A 3SYQA 2R2BA 3QJHB 2EE6A 4A6YB 3QZBA 5JIMA 2ZX8A 4Z7VE 2YPLB 2BX5A 4X2UA 1SFDA 5EORH 3FTVA 2ALWA 1DYZA 4E41B 3V4PL 3FCUB 4ODXA 1IZJA 1RUAL 4L8SA 2A9NH 1OCOB 1OO2A 3JT0A 3QO0B 4QHKJ 4BKTC 1JJUA 1NCIA 4EZLA 2GABA 3HBPA 3LQAL 4IIZA 1JP5A 2AJUH 5ERWB 4ENZA 4AITA 1R5WB 4GLRI 4H40A 4NQCA 3TBWA 5FUCC 2X7LB 1S7VA 4R7DB 4OGYL 3HTLX 2RMNA 4CAGA 5IQMA 3PXJA 3I02A 2EDFA 2CXKA 3OMNB 3H1ZA 3VFWB 5JHLH 4I0PC 1Y6NR 3WFCH 4ETQB 3RUGB 1GIGL 2X42A 4JM4L 2NT1A 2XFGB 3NIFF 4PY8J 1RZ7L 1YUHA 4XNMB 2ZUQC 5DVMA 3ASNB 3QYCA 5DHDA 3RGVD 5TDOB 3AWFA 1RIHL 3SKUD 4GI8A 2D03L 5C0AA 2VDKB 4NNXA 2Z35B 4JHWH 2QT6A 1QNZL 4G6KL 1J5OH 4EAEA 3F8UB 3O9WA 1YEWA 3N1QC 4LXFA 5BZDA 2Q0ZX 1NCUA 3AU1B 4HUVB 1NWPA 3K6FA 3UADA 4UQAA 5LG6A 3HAEB 3MLYL 4QTIL 1VLXA 3IM1A 1MN4A 3FB7A 2VW7A 5GRYA 1JPSH 1F4WH 2NSQA 2WZPD 4A2LA 4AI7A 4ZFGH 3ARBD 5DU7A 4ZW5A 2HTKC 1JZGA 3LRGA 4PWHA 1MJUL 2BMKB 3T04D 5SWQB 3L3JB 2WVUA 3ILQC 4J1UA 3AXHA 5IWLA 3C6LA 3V4LA 1K6QH 2X4PA 1I31A 5AAWA 4F58H 2JJTC 2IAMB 3I9PA 3MUZ1 4MS6A 5KUMA 3GTTA 2I9TB 2NY1B 1FORH 5BV7B 1VB9A 3LVTA 1MWAL 5EULV 3PWPB 2VXUL 6TAAA 5DEJA 3FQUA 1JMZA 3DX7A 5IT2H 4MA3A 1RK7A 4X8CA 4PJCA 3O2DL 5GGTH 2DBLH 3FULA 1I9IH 4NGHH 1B3IA 1L7IH 2DB8A 1Q9KB 4B9CA 3TF4A 3P2DA 3CMOL 3QUXB 4TSBH 5AB0A 1U8JA 3UBXG 4LL4A 2OCJA 1W0WB 3PREA 2L04A 1JSYA 1BD2B 1A65A 3WFDH 2WVVA 5C0JA 2FQFA 4PJFB 3D2UD 2L7QA 3RU8L 1RMFH 4LQFL 4HD9A 3G5YB 1UWXH 1KGYE 4OF6A 4ZG1A 2VMFA 2DWTA 4O58L 5HGHB 1BVNP 1PD1A 2COVD 3CFKA 2N01B 2XWEA 2AJVL 2M8XA 2Y72A 4PJIA 2Q5BA 4RFNB 1ACZA 3RWHA 1KTRL 3JWNG 1O9VA 4F9LC 3QULB 4DVRL 4K5LA 1LDPH 4L5FL 4U0RB 3R06A 1EHLH 2J6EL 4R7NB 2X0UA 4G1EB 4RMUA 4BFJA 4YEFA 5FUOL 3QJZA 4NENA 2A73A 4QRPB 3KPTA 4P06A 3TEXA 3RIAF 3WTUA 2OM5A 2VLKD 2KI6A 4F7MA 2OZ4H 2L0DA 2VLKE 4BSVB 1UXWA 4GKZA 1OD9A 2BERA 5HI5C 3O4LB 2JCCA 2JKLA 3QUMH 3B3IA 3KPNB 1XTLA 1PTZA 1W6WA 1D5IH 4NJ9H 5DJ8B 3BW9B 4YVUA 5HI3D 1HIML 4JFED 4Z8FL 4ISVA 4JFEE 5IOPA 1DUZA 3R7RA 1MCQA 2P43B 4QLRA 3MROA 4D9RD 4GAJH 2HVBA 3QC6X 4D9RE 1D7BA 3ISYA 2UVFA 4MQ7B 4BCYA 3ZDYF 1JVLA 4GS7B 5IQLA 1U3HC 3Q8BA 1OQXA 4UM8A 2JKXA 1ADQH 5GSVA 1ROWA 1D5RA 3HC4H 4FG6D 1CFVL 3VMPA 3AFLA 4ZUSA 1SY6L 5M7QA 1Q38A 2MJWA 2EDRA 2OXGA 4OFVA 3ZLQC 4WJ5B 3KYKH 2YMXH 4NQDA 4XGZA 4F7CA 5F7DB 1NKOA 4PGBA 5AD0A 4G83A 4LT7A 2ZNWA 3RNQB 1HQRA 2MSPA 4YDLC 4FDWA 4PGEB 3RY6A 4D3CH 4UQ3A 3O8XB 4M1CD 3NDYE 1EJ6A 1S9WB 3MLVH 2RD0A 3SPVB 2VH5L 3H2QA 2ZWNA 3TWCL 3VNYA 5FOJA 5E8DL 1OTSD 4HS3B 2QDWA 1J1PH 1X5ZA 1I1AC 4CC4C 1U8NA 3PABB 1QHPA 2FBRA 1T22B 1KELL 2A4CA 1MCEA 2R4RH 2YGVA 3IJHA 2F19L 3QQXA 2R83A 4FQIL 3L3KB 3V79C 2J8UB 4A2HA 2A6IB 2DIBA 4FZEH 2YXVA 1YYCA 2XBTA 1H0DB 3KR3L 3L3DB 1IC5L 2X4OB 4E9QA 1LO3L 4NLHA 1WUNT 1I8LC 1NBYA 3QNYA 1NCGA 1HILA 3I3EA 3ARGC 1VPOL 5AAMA 4JRXB 4IIQB 1P1ZB 4OVVA 1QNIA 2HVKB 3PDGA 3PQYD 3PQYE 5C0ND 4DP9X 3NBNA 4N2MA 3ROOA 3FQTA 4OFYA 2BCMA 3MX0B 3L3HB 2R1WB 2PCPB 4XB8A 5T1LB 4BFIB 3CU1A 4LLWB 1YAIA 5HVGB 3NACL 1VFAA 4WSKA 2F15A 4WQOA 2X6MA 5JW5B 2AXGB 4ZTEA 3UAJC 5JIHA 4QI3A 4W1TA 5ID1A 3KBPA 1CICD 4KTEL 2DMGA 5L2JA 4F8OA 2B3RA 5IBTH 2GUOA 2XWXA 2RIKA 3VMNA 5D70H 3WG7B 4H8WC 2J21A 4DKTA 3C5XA 4UDTB 1MKFA 4FKEA 4OD2B 2WLLB 2WIIB 5FFLA 4FI7A 3UZVB 5JQ6L 3S88H 3RDTB 2PXYC 3UYRL 2VISA 5C0DB 3JT2A 3CH8A 4BK5C 4GFTB 1ND0A 4LLVB 3MOBH 2EVIA 4QYAA 3AB0C 3A6CL 5CIPH 2DYPD 5EEZA 1LWRA 2FJHB 2IBGA 1AIFB 1C16B 4HGWB 5D7IF 3DKHA 5GGVY 2EE3A 1MREH 3I2CL 1IGFL 1F6AB 2GC4C 3KXFA 4KRNA 5LDUA 5EEXA 1BEYH 4TKWA 4LEOB 5CJ5A 3W0WA 3DTXB 1N70A 1F11B 1D9KD </