4IBWA

Human p53 core domain with hot spot mutation r273h and second-site suppressor mutation t284r in sequence-specific complex with dna
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
200
structure length
197
Chain Sequence
SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVHVCACPGRDRRREEENLRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title Structural studies of p53 inactivation by DNA-contact mutations and its rescue by suppressor mutations via alternative protein-DNA interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 50
structure length 197
sequence length 200
ec nomenclature
pdb deposition date 2012-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ibwA00
4HJEA 2XWCA 4LOFA 3WTTA 2J1WA 5LGYA 3US0A 3QYMA 4IBSA 3D0AA 3KZ8A 3VD2A 4LOEA 5AOIA 2BIMA 4IBQA 5ABAA 3EXLA 3Q06A 4AGPA 3ZMEA 1TUPA 5AOJA 4IBWA 4L0ZA 1GZHC 1E50A 4GUOA 1KZYA 1IO4C 2ATAA 1YCSA 2RMNA 3Q05A 1EAQA 2GEQA 4IBZA 2X0VA 3US1A 4IJTA 4QO1B 5ECGA 5A7BA 5KBDA 2J6WA 4AGLA 4L0YA 5BUAA 4G83A 2IOOA 4IBYA 4LO9A 4MZRA 4AGNA 3EXJA 3WTXA 1CO1A 3Q01A 2WGXA 2P52A 3WTWA 5AB9A 2VUKA 1GZHA 2J1YA 4KVPA 3VD1A 3D08A 2ADYA 3TS8A 1LJMA 4G82A 2BINA 2IOMA 3D07A 3WTYA 1TSRA 4AGQA 5AOMA 1EANA 2J1XA 4IBUA 1HU8A 3WTSA 1T4WA 2AC0A 1EAOA 2FEJA 4MZIA 4AGOA 3QYNA 2YBGA 2PCXA 3D09A 1UOLA 2OCJA 4L18A 3WU1A 5AOLA 3WTVA 4IBVA 4A63A 1CMOA 2BIQA 4IBTA 4XR8C 3D05A 1HJCA 2XWRA 3D06A 3WTUA 5G4NA 2X0WA 2H1LM 2J21A 2MEJB 2AHIA 4GUQA 2J1ZA 3KMDA 1H9DA 4AGMA 3IGLA 2BIOA 2BIPA 3IGKA 2X0UA 5AOKA 2IOIA 2J20A 5G4MA 3VD0A 1HJBC 5G4OA 5LAPA
chains in the Genus database with same CATH superfamily
1EIBA 1SVZA 1HC1A 5EULV 3AQZA 3T0EB 5JOFB 1F8TH 1YJDC 1VAHA 4Y2DC 2P9RA 1A3RL 3GJFK 2B1AL 3H42H 1MHHA 3LEYL 3PXJA 3MKGA 3OR6A 1NPNA 2JQZA 5FUOH 4P9HH 1G7LA 1SMOA 1SYVB 2K45A 2NY0B 3LZPA 2VYRE 2QPSA 4Y5VB 4K8RH 1XQ4A 4MMYB 4OGAC 5I1DA 1JPSH 1AD0A 2NTSP 5DD6A 3E2HC 3ZYOA 4GG6E 2KLSA 2XYBA 3NDYE 4NQCE 3DRQB 4YHNA 3G9AB 4NJ9H 1BIIB 1SEQL 4V2CB 1VESA 2NY6C 5HXMA 4OFDA 3CXHJ 4LB8A 4HF5L 4GPVA 2SODB 3B2UC 3IFOB 3U4EB 3K72B 3HBPA 3H4HA 4QRAA 1Z5LB 1PPIA 4ZW5A 3IM1A 1VGKA 1ZA6A 4GUCA 1C5BH 1QTYT 3L54A 4RMBA 5HYJB 1NCCH 4R90H 4F7EB 1IGTA 5T3XD 4S0SD 4QHNA 1F4YL 4OKDA 1HHJB 3WENA 1KLFA 3LS5L 3APCA 2ZUQC 5EORL 1DJYA 1ETB1 2EUZA 2FUQA 1MUJB 3LD8C 3PP4H 1FVDB 2CLZA 4FZEL 2RFXB 1OL0A 3GPSA 3ZKSD 5D8JL 4LAJH 4QF1B 3V0HA 3IVKA 5KVFE 4PJ7A 5L2KE 4KPHL 5FHBL 3SDYH 4AQOA 4AKOA 3NK4A 2LU4A 2DMHA 3EFOB 4X42A 3KWWA 4ONHB 1NBYA 4NLHA 2B1HL 3K5SA 2Z65C 2CDEB 4YDMA 1MPAL 1YYMH 2C3GA 3FONB 2UZIH 3EOTH 3OKMB 3GHEH 5CGTA 3QDJA 3G04B 2E9IA 3NRQA 2EKSA 4L8SA 4N28A 2ATKA 3LB6C 4WU7B 5DC2A 1RZGB 1HHKB 3MRGB 1EEZB 5L88L 4XWOD 3L6FA 4WW2F 4XNBA 5TFSL 4Y2OB 4MYWB 4X7DC 1HOEA 4H8QA 1WSST 3WIHH 2L04A 4FKHA 2ZUVA 3P3RA 3ULSA 2K9UA 2PTTA 4B50A 1I8MB 1G1KA 4MMZB 2H0PA 2YAMA 1X3DA 5EF1A 3B2VL 5K39A 1EHLH 2DKMA 3WEMA 1Y7VA 1KBKA 5GS1C 2Y5QA 3QUXC 5FGSA 2OJZL 1E9OB 4UTBA 1I1AA 1TYRA 4PJDE 4YR6A 2PPFA 3D0VB 1MW1A 4G1EB 3UO8B 1XCQA 3H7BA 4GAYA 4X50A 4UMGA 2WWMC 3S96A 5T3XE 1MY7A 2X44D 4LESA 1HQ4A 3WEOA 1R75A 2B08A 5F3HA 3NCBB 1IQDA 3F04A 5IR1B 1ZHLB 3BH9A 1EFXA 2ZP8A 4G7VL 2XA8H 1BLNB 4TLUA 2K3TA 5L7XH 4GRWE 3W9DA 1QMUA 1C5CL 4ORGB 3MLVL 3BGFB 1FYTD 5E9DA 2ESVB 4YSPA 5I1LB 4LCCA 2BVPA 4P2RD 1BF5A 1E90A 1YUHA 3J7HA 4X6DE 2ZCKH 3P4LA 1OAKH 1U8OB 1S5IH 1AGFA 3ML8A 2C3HA 4M62L 2WTRA 2CJUL 3OVUB 3SDAC 4OCRH 1T4KA 3PWLA 1RJLA 3GSNH 1CK0H 5AVVB 1QSFD 1URZA 2OJEA 4N2GA 1M7IA 5KJRH 2BVQB 2WCPA 1NCHA 2ZAGA 5K9QG 3DROB 5FAAA 1BQ5A 4JO2L 2A2QT 2J6EH 1CN4A 4RMWA 4BH7A 3PJLA 3BP5A 4JDVB 1YNTB 2IWFA 1T80A 1AMXA 1WV7T 1W9XA 4JM4H 1TZGL 2NY4D 4BEIA 2FBJL 3K2IA 5GJSL 1FNSL 2W60B 2WSKA 3BPNC 1AQ8A 1S9VB 1XB8A 4BDVA 5F9OL 3N42B 4Y4FB 5ILTL 4U1LB 1VFOA 2X2YA 5CR8A 2ZE0A 4YDKL 3N50A 1QTPA 1HKLL 1HSAB 2VDPH 2ZPKH 5C07A 1BFVL 4AYGA 5BMFL 1ZGLM 5KJ4A 3U83A 5LNDA 1JOIA 4I13B 3V5HB 4JPIA 5AWNL 5ANME 4L1TA 3JWNG 1FYTE 3KWXA 5JO5A 2H4EA 4Q2ZA 4NKIL 4P2RE 4M61B 4X9YA 5KTEL 3QUYC 2UY7B 2PYEA 2HFFB 4QOKD 1EEYA 1J1XH 3MLYH 2X6CA 5SWSD 2F1AA 4IMLB 5DU7A 1AP2A 2WYZA 4OCNC 4PBWD 3RI5K 3LN5A 5DZ9A 1QSFE 1WLHA 3H3KA 4N9GB 1K3ZA 4IRJC 4P23A 4UINL 3UTSA 4K7PX 2DWTA 3QIUD 3O4OB 1FN4A 2PR4H 4KITB 1GJWA 3WU1A 1R1CA 5IF0A 1V10A 4N0UE 5JOEA 4O2FB 2PW2B 3AXLB 3T8VA 5HI5C 4RMSA 4M00A 3RHWF 1JF6A 4IDLA 1I1YB 1WFOA 2QLYA 1NUDA 2AXFA 2BX5A 2DQIH 2WLJA 1XGPB 3MLSH 4U1IA 2X10A 5GRUH 4MLIA 4AE0A 2GCYA 5MHSD 2CBMA 3PJSB 4FLOA 1SBSH 1FNEA 3K81A 4JG9A 3ZDZF 1EEUA 2Y0SA 4LPXA 4NZ8A 3FPYA 3GBEA 4V33A 2FWLB 5DMJB 4D0BB 1ACYL 2GITB 1K85A 5I8EA 1JZHA 2WHVA 2MKWA 1WF5A 1MCOL 4OM1H 3RVTC 2QADD 5M7QA 3VTTA 4NJAH 2FB4L 5C8JB 1PFOA 3WAKA 1OAUH 4XBPA 3V52L 5GRVK 1Y6KR 2JKIS 4G9FB 4NFDA 2JTYA 2NYZA 1A66A 3ETBJ 4IIQB 4TSCH 4BZ2H 5F3BB 3FO0L 4MNHB 4QOKE 3QJHA 4W4NA 4TUJA 1R0AH 3U6XS 2GHZA 3A6BL 3JBG7 2HTKD 1DQMH 3IE9A 1MHEA 1ZLSL 1I8LC 1VKXA 5EOCJ 3DJ9A 2VW6A 1WDAA 2ALWA 1IJNA 3NPSC 3OV6A 1RUMH 3MFGB 1AKJD 5KN5A 3VDCA 1HEZB 4UQ9A 3QO0A 3LPFA 3Q5TA 1D5ZB 1OHZA 2NZ9D 2B2XL 4QPEA 1JS4A 2FZ3A 3ABGA 4X80L 1JZ3A 1ADQL 2WVUA 4QCIB 3QUMB 4S1RL 1O75A 1AR1B 1ITBB 3EIFA 1I7RB 4IBYA 5SWZB 5I6NA 5JXED 2D31A 4PRPD 2NLJB 3MC0A 3UG4A 4DZ8A 3H4FA 2N3JA 2BSSB 4XXWA 2XBDA 1EJOH 4BJLA 1JGVL 1RK1A 2P52A 3A6OA 2CAKA 4RVBA 3KYOA 2AK4A 3LKNA 3NIDE 1R46A 2XQ0A 2FL5B 4IGBB 4NB7A 4GQ9L 3D9AH 1INQA 3ESVF 4YC2C 5B7FA 2ADGA 2EDLA 3O3DB 3VAEA 4J8RA 3DO3A 4XZ4A 5CZXD 3SE6A 4KZEH 4OVVA 1NLDL 3T9WA 43CAB 2FJFB 4EKJA 2ZXBA 2EICA 2H5UA 1XH2A 3O11A 5TJWK 4M8VA 3RJDA 4ZMNA 1WZMA 2Y07H 1OSZB 4XB8A 3H2PA 5J3HD 3KLAB 3GPEA 4P59H 4F33B 5ICXA 1UA3A 5HVWA 4OAWB 2OV0A 4PCKA 3FTZA 1BFOA 2B20A 3QNYA 4JZNA 3M6DA 2ZUSA 2P49B 3S6CA 3N1GC 3PV7A 3ARDA 4QRSA 2Y7NA 4GXUN 5AQ0A 4A7SA 3S35X 1S9XB 2AK1H 5JXAH 4GUQA 2IH3A 1A14L 1PMYA 1UD4A 3KNBA 4O9HL 4S10A 5B7EA 3OX8A 3QDHA 4L29B 4LAQL 1ZVNA 1IBYA 3V9CA 5D70H 4AW7A 4UIKH 3L5XL 1K4DA 2XN2A 2DL2A 1KC5H 5DRXB 4PRPE 3QCTH 5BRZB 4CC4C 1VPOH 5F9AC 3HUJA 3D39A 1Z0NA 1NUGA 2YPKA 4NHUA 1U3HD 3TA3C 1M7DA 4HEPG 4BXSV 5E4IA 3LKSA 5F8QC 1P7BA 4OGYH 4Y5YC 1ROCA 3SCMB 3AM8A 3HS0C 4XTRD 4BQ9A 4F2FA 5JHLL 1UEMA 4LLUB 4TPRL 1P5UA 4MQSB 1E5AA 2VO8A 2XN9D 3U36A 2AGJL 4TQ8A 4Z7WE 1P1VA 4UQDA 3T3MF 3QARA 3T4YB 2CLRB 3TBWB 1CDYA 3FU6A 1FAIH 4JFYB 5T5FH 2H9GA 4CNIB 3F58L 2OR8A 3WEXA 2MFNA 4FEMA 1J18A 4KUCF 1F97A 5I1AA 4IOFC 5F9JA 4FXKA 1D5XB 1G7QB 4RNRA 3BPLC 1DJGA 1T04A 3QQNA 2WUBL 3VYOA 1IV8A 4D8OA 3AROA 3HPJA 4JLRB 3ARRA 4DPRA 1I3RB 1RZFH 3FO9A 1HZHH 3VGEA 4PGBA 2X09A 2NY2C 4JL1A 4HIJB 2BSTA 1H0DB 5ADOH 3CLFL 3RL2B 1E7UA 1N7ML 2DICA 4H44C 3EJTA 4NZTL 2E5EA 3F12A 1AIFB 1E8WA 4KHXH 2CR0A 4MBRA 3N43F 1LO3L 2YEVB 5FKAB 4HUXA 4DF9A 3TF7C 2E4FA 2DTMH 1H5BC 1PBYA 4IHOB 1I9RL 1XDTT 3GJFH 4FYTA 4HALA 3O2DL 3X3GH 1EDHA 4WW1B 1JMZA 4AGOA 1XGTB 1DBBH 2XN9E 1VGKB 1UXWB 2EEFA 1PX4A 1SHXA 3QPKA 3O9WD 3P1VA 2I85A 1IGTB 4NBYB 3OQRA 3IMTA 1LGVA 2CKBA 2APWA 3MOAL 1KLFB 1KJ3L 2Q7YB 5D2NE 1OOWA 2QHRH 4HAGA 2Y6SD 4N2CA 3TPUB 3SGEI 5LN8A 4ZFZB 4PJ7B 2IBBA 1RUKH 2ED8A 2DQ6A 4YE4L 5I8CA 4X7CC 4KKBD 2BIOA 4HISA 5BXFB 4PJCF 3UGXA 3B3IB 3QQ3B 1IBFA 1DLHA 1MRFL 4YSOA 4XE0A 5CS7A 4MD0A 2VAAA 2FUTA 2ATKB 3HJEA 4GIPD 4RWHA 2NY5C 4X5QA 3V10A 3OGOE 2C4XA 3BXNA 2G2NA 2EUWA 1ID5I 3QQXA 4HIPA 1P4UA 1F00I 3DOHA 3MX0A 2Y25A 1ZANH 2HVKA 4HKBB 3DWTA 4P4KA 1XGUB 3MLZH 5JIQA 1GGUA 4JGNA 2W91A 3GKWL 3QIUC 4JRLA 3T3PB 3DK0A 4WO4D 5IM7A 3T2NL 4U6XA 5EZOL 2B4CH 3P9WB 5IFJB 1BVZA 2F19H 4PM1A 3HKZA 3JWNH 1B2WH 3H9SD 2BRRH 3OMAB 3P3SA 3UYRH 2DMBA 1A5FH 1I1AB 4R7VA 3SGJA 1IKFL 4AEHL 5CJBA 3WNOA 3QFDB 5EEYA 5EOTA 4XMKH 1XCQB 4KTYA 4ELDA 1SDDA 3ROOA 2VDRH 4NNPH 2G30A 4QHLA 5IK3A 3I50L 3V4PL 4XBGB 3VXNB 4IMKA 4CC1A 4A6YA 1BMZA 4JFXB 2ZKXA 4Y2NA 1ZTXE 2HCZX 2YD1A 1T66D 2X1QA 5HGDA 4NXKA 1P7KB 5D7JB 4N8VG 1SHWA 1F3RB 3NIGE 4RDBA 2Q76A 1KBVA 1OVZA 3WNIA 2ZZUT 1BWWA 1DBML 3MKKA 1AGFB 5FYKD 2AMUA 1FBIL 3ZR5A 1ZGLP 4JRFA 3E38A 3RDTB 2X9YA 2YD5A 4PB9L 4S2SA 4ZO9A 2VUKA 3BCFA 3V6OE 2B5IB 2Z4TA 4OM0L 3CBJB 3SJVB 3TVMC 3QJZA 1GGBL 1KB5H 3OXRA 4WJKB 3VI3A 3BUYA 3DDFA 4KI5E 4W70A 5IMOA 1WZAA 4K71C 3EHBB 3MRMA 4IRSB 5J7CC 2FEEL 1F11A 4TUOA 1WA0X 4DCQA 1L9RA 1Y1DA 5DZPA 3P11L 1J9QA 3NJJA 1CICD 2R29L 4LVHC 2PMZA 4RFEB 4U0RC 3DSNA 3BKMH 5DHDA 4CW1A 1QO3A 3DMMB 3B7RL 2CUHA 3F00A 3ARSA 5DJ0A 3UTOA 1JNNH 4PBVC 4DN3H 3H9SE 3ULVC 4MD4A 1UTDA 1M1XA 4LGRB 3TEXA 4JE0A 3X3FH 1A1OA 3ARBD 3GWJA 5IVXF 5D7LA 1TOXA 3KXFB 3NTCL 4IKIA 1JD7A 4JN2B 1ZT4B 4TSBH 3FU0A 2QGBA 2CSPA 4FG4A 2N1TE 1J0IA 1OD7A 2EEBA 3IGLA 4Q6IC 1B9KA 3DIFB 4ZTOL 3MREA 5IW6B 3O8XD 2EDJA 3W5MA 4FADA 1JCVA 2YAEA 1NMCC 4HDIB 5EWIH 5AAPA 5IMMA 1KBWA 4B9KC 4LSSL 5DRWA 4OCXH 1N67A 5FYKE 4ANWA 2KS0A 1JZ7A 5DJCB 4B6ZA 5C2BL 2PP8A 4L5FL 1SYSB 3ARFC 1FVEB 4TNGA 4LNRB 1RMFH 4HYTB 1AXTH 5C9JB 4FG6D 4L9LA 1AP2B 3KJ4B 3QSKB 4PRHE 1KGIA 3L7EB 3PWVB 3IJEB 3BPCB 2VQTA 4OJFL 4MA8L 3PWNB 2EYTA 1DVSA 1SHMA 3HEIB 5A6IA 1TO5A 5AL0A 2APFA 3CSFA 4H5SB 1H8NA 9CGTA 1TJMA 5E5RB 3RWCA 3TBBA 1BHGA 4KXZH 4PS8A 4Q9RL 3MUJA 1CG9A 2H32B 1C08B 2BDNL 4H0GA 5DUPL 4EQ3A 1MVUB 1RCYA 4N2MA 4YDJB 5KOMC 1NC2D 3UO1H 4L4VA 3CZFB 2XHNA 1OB1B 3FOLA 3WUZA 1N5YL 5B4MD 4Q9QL 3QXUA 3IDYC 5E99L 4NENA 2R4RH 2WANA 2VRAA 3VU1A 1ACCA 3BP7B 4NYLA 3HB3D 5C0AD 4ELMB 5EO0A 3RNKA 5G5DB 3EOYG 4TOYL 2PUQT 4KOBA 1DFBL 4XBPB 5DJAA 3D34A 5FYKU 3UTZB 2ZAIA 4CSZA 2J88H 2P5WA 2GY5A 1NOAA 4A66A 4JFFA 3Q2WA 1L7IL 4W6YB 5IB1A 4P5MA 1MY5A 4YFDB 3U6RA 1IM3B 2XWEA 1MHEB 4PHZA 3JUZA 3O81A 4KZDH 2EAEA 1IAIL 2D73A 4XVOA 5KN5B 4N2FA 4ZPVA 1KCBA 3H0TA 5E95B 3J27A 5C08A 3ULUF 3FT2A 2GAZB 3ZDYE 3G6JA 4HC1A 5K9OB 3WNMA 3GBNH 5AW4B 3LVTA 1LE9B 4Y1AD 1VERA 3AADB 4NWTL 2ZOKA 5DMIH 1CXEA 4F8QA 1YNTF 4GQPH 1BP3B 1NSNH 2G5BB 1IFHL 3VFVB 2Q3ZA 2FTAA 4N26A 3MMEA 3QXVA 4MA3A 4OLWL 1WA2X 2FX7L 4AY0A 2C1OB 4B41A 4HOWA 3ZTEA 5GS0C 4DERA 2V3FA 3N42F 1W6LA 3KPPA 1RPKA 4EE2A 2CGZA 2WXMA 1NAML 4LLDA 2LAAA 1ZPUA 5E94A 3BD5A 3GZQA 4ZW6A 4HIIA 3RUGA 3VVWA 4YSDA 2XTJD 2NSMA 4YNYA 1F18A 2N1KA 4ZSOE 2HN7B 5GGTH 4JN1L 4Z7OB 4ZFOL 4APQD 3QWOB 3SE8H 3FULA 5BQ7A 5EBMB 4A67A 4LGPB 3AU1B 3L3JB 5LCVH 2EYSB 1OT1A 3BLBA 5ALCH 4J4PD 5JUEL 1MF2H 3TYFB 4FNPA 1CGUA 4FQXB 3GBMH 4XCYA 1UOWA 3QNYB 3WDHA 1S7XA 5LNGA 3UZQB 1MFDL 3GSXA 4V1DA 1ZV9A 2NSQA 4KKBC 1J87A 1T20A 4P2OD 4X5LA 1OSPH 3RPBA 5MI0B 4WJ5A 5T8IA 2OSWA 4X6EB 3KYKL 1P2CA 2DQUH 1R33A 1VACA 2EABA 5FGBA 3FS9A 1TCRB 3KNBB 4LBEA 1RJZA 4LT7A 4O58H 3V6OC 5DWUL 1JDCA 3NRPA 1A6AA 4NN6B 4H8WL 4Y1AE 3PNWB 4P5TB 4NKMA 4KI5C 1DE4B 1Y0LA 1E6OH 1QBLL 1I7ZB 5C0GA 2DD8H 1FG9C 4R97B 4ZW3A 5DFVD 5JIMA 5MERA 1QFWH 3HBZA 4WO4C 3DECA 3GM0A 1XSIA 3LKSB 4B27A 5KSAD 4NOFA 1PX8A 2H26B 3KCPA 1YA5A 4KTDH 5CILH 5FHAH 4XPTH 4NQDB 2ZWKA 4P2QD 3LKRA 1CGWA 2YN3A 1HI6A 2FJUB 3OXSA 5GISH 1TCMA 3CXDL 4WSKA 3LH2H 4YHKH 5LN4A 1QUNB 2EE2A 5EIVA 1HILA 1T2JA 2GBVA 4RFOL 2G75A 3CFDB 3MJ7B 5INCA 5T1KA 2OR9H 5B3JF 5DJ2B 1ORSA 4YHLL 1SXSA 1L7TH 1JNJA 1CB4A 4YXLH 2H9GB 3PGDA 4PJHF 3OF6D 3GJEA 4H0LC 1OM3H 1FRGH 6TAAA 3KPLA 1T66C 3CZSA 3MRQB 1E3ZA 1F3JA 2W92A 1OAJA 2VLKB 1TZIA 1JWSB 4NLAA 1QFPA 2EIBA 3FB5A 4IBVA 1YPZE 2MHAB 2WUCH 4QXGL 3UACA 3A24A 3NCFB 1DQDL 3V0JA 1F0LA 4GMTL 1PKQB 3D2UD 1EDYA 1FFPA 2YGNA 4XO3A 2BXYA 3HG3A 3F84A 1FIGH 2R0KL 3LIZL 4GIOA 2G5RA 3RZCD 4C47A 5TDNA 1AZRA 2BM3A 3EG9B 5L8KB 5CCKH 3ZL4H 1I7UA 2VZUA 3QYMA 4HUXB 3T1WA 1THCA 1CICC 2YGOA 5F7LB 1U92B 3GIVB 1A7RH 5AOIA 1ZKAA 4O5LH 4P2QE 4LMQI 5IQNA 5BO0D 4JB9L 5I0VA 4KGLA 2ZP0T 1PLAA 2OYMA 2WXLA 4R5TA 4AYSA 1CBVL 3EZJB 1E3FA 4IS6B 2WW8A 3ARBC 1XCTA 3ESPA 4YHMH 1JDDA 2IQAA 1TJHH 3NPZB 2DWDA 2J8UB 2R56L 1TQBB 4GXFA 1AYOA 1IC4H 2EIJB 2V9QA 15C8H 4G42A 2VDOH 2IIJA 4WSJA 4WGWB 3S5LB 4HIQA 3CFEA 1NCAL 2PXYC 2GJ6B 3M1OA 1A7BA 4I18A 2QVTA 3N1MC 4NZFA 1MCJA 3ILEA 4LSTL 2GSMB 5IIEB 2K9FB 1PY0A 1L9TA 1YO4A 4G80A 3LH9A 3U2SB 4HHGA 4PJXA 4XNXL 1DLHB 2V33A 2DQHL 4KROD 2DTSA 4Z7UE 4ICWA 3G6DL 2B3RA 4Y2DA 2BO0A 2X7LA 5CJQH 4FZ8H 4N68A 3BXNB 4AGNA 2DQMA 1KYUA 3NIFF 4Q9CA 5F1SA 1HYRC 2Z7WA 4DESA 3GMLB 1ODAA 4WCYH 4DAGH 3MYJA 4CU6A 2JIXA 2YN5A 1DZBA 1MAML 3R1GL 1CDJA 5CGBA 3HS8A 4JQIH 4U6XB 4UNUA 3VXTA 2H47C 1URLA 1KFAH 4UILH 1BVLB 1CE1L 5D7SH 1W72A 1M4KA 3FFOA 3BKCL 2FLMA 1S9WA 3LNDA 4HV8A 3I9PA 4M6OH 4UAOB 5MEPA 5EIIA 4YJZL 4XN5A 2VE6A 1X6NA 4HHAB 4HXBH 4LLWB 4N90E 2VXQA 4KK8C 4G6KL 1KELL 4PGCB 4GBXC 4E9WA 2F7PA 1UD2A 3S34H 4Z6AT 1GIGH 1KN4H 5DJYB 1EAPB 3MCLH 3ABZA 5A2FA 1KTDA 4AQ1B 2G2RA 1G4MA 3W11D 4FNTA 1Y18B 4KJQD 3GRWA 1IU1A 4BFJA 2AQ1A 4TYUA 4RMQA 1CTOA 3V4UL 5JA9A 2EC8A 4DEUA 2V17L 1OD9A 3O6FD 5JPMC 2ED7A 4HG4J 4JUSA 3WXWL 5IVNA 1CT8B 3T8MA 2WLIB 3BWSA 5GGRY 4PSRA 1KIPB 1PZ3A 2NY1C 2C4FU 2WP3O 5BV7C 3WGUB 4DP7X 1Y6MR 2X6BA 5G4MA 2KYIA 3OXRB 1S7TB 1DDHA 4OCSH 3BUYB 4EKXA 2YUVA 4ORZC 2CJTA 1TVBB 2IDFA 4WI9A 1F41A 1A3RH 1LXMA 4JCMA 5AYQA 5D1XB 3WL9A 2B1AH 5HDLA 3LEYH 1UZ6E 4UV7L 2Q8AL 3DYOA 5E9AA 1H3GA 4YHPA 5IB4B 5JHDE 3K1KC 3DHPA 1Q9KB 4M5ZL 5GS1A 4XH2A 1D9KB 3KLDA 1M56B 3QUXA 1NC4D 2FQFA 1SVCP 1CFTB 1HSBA 5E08L 3S8GB 1A1OB 3L1OH 1X9UA 1SEQH 5D7LB 5AVUB 3SGDI 1L5GB 2BOCA 2CXGA 1ACXA 2ATPA 2ED6A 3O3BB 3PRZA 4JFEA 3O6KL 2IH9A 4UDUB 5JOPD 3DVFA 4M29A 4OI9A 2H6PB 4LCWB 5MP6L 1K6QH 2F2HA 2DKSA 3IDXL 1P4IL 5T3ZL 3CZGA 2X4OA 4WNQA 3HC2A 3WFHB 3ETBF 3TWYA 4W68A 1F4YH 3B83A 4PJ7F 5I2IA 5KJ7E 3VDBA 3V4PB 1C16A 5EORH 4OZGE 5B38B 1HCZA 1VGEL 5ITBL 2ZG3A 4KQ0A 5D8JH 2G60L 5CM1A 3BZ4A 4KPHH 5FHBH 4ZX3A 5GSRB 3H56A 4OQ1A 1KTJA 1UXSB 5B8CB 1EGJH 2B1HH 4JG5A 1CIDA 2Z4QA 3IRZA 1MPAH 4K73A 4HT1L 1LL1A 1WWWX 4X5PA 5DD0H 1WGVA 3SKUD 4N8UA 4YDIH 1KEGL 3D18A 2X05A 3MR9A 5FV1L 3VI4E 5L88H 2J1XA 4J6RL 3TJHC 4TVPD 1NDMB 4IJ3B 1YY9D 4QRRB 5TFSH 1H15A 1XT5A 1T4WA 3CHPA 3DBXA 4ZUWB 3FTGB 4JRXB 5J56B 2WQVA 4D9RE 3UYPA 4MJ4A 1YC8A 4PAZA 4XVTL 5KBMA 2VRKA 5I1IH 1V54B 1G7PB 2E9BA 5IW1B 3IFNL 5AOZA 2HX9A 5C09D 5DFVC 4AM0A 1MLBA 2EUXA 2YKLL 2OJZH 3ZZLA 5KSAC 5JOPE 4P5RA 1NCWL 1CU4H 2WLHA 4XAKE 3FUFA 3N6YA 3CZNA 4P04A 2WO3B 5IQLA 2YD4A 5ID0A 1DVFB 1EVUA 1N0LA 4OLYL 1ECYA 5FFOA 3U9UA 3WY3A 5DJAB 4ODVL 1ZV5A 3QJOA 3QUYA 4JDEB 3TU6A 3CUPA 4G7VH 4YS4A 5F0MB 2FR4A 3HN3A 3MLVH 4GINA 3D0AA 1Z3RA 4NPKA 5ICYA 1BMWA 3FOMA 3M7OA 4Y4KB 4P5SA 4HJ1A 4CN1A 2DL9A 1NZRA 3MPCA 1OZUA 2F7OA 3IBOA 1ZVHA 4RAVA 4ZS6D 1VIWA 3PWUA 4DOHE 3KDMA 1I7TB 4IRJA 1TVHA 4M62H 1QFWM 2ICWI 4ZPVB 2CJUH 3HNSL 4XX5A 4U1GC 4L0ZA 2CE6A 3RVUD 4WKXA 3RY5A 32C2B 3G6JB 2C3VA 1MNUL 1WFUA 1OW0C 4KZ0A 4R4BA 4TVPE 1CQKA 4FXTA 2OR7A 1NGPL 4MYPA 2H32H 5D71L 1F56A 2R69L 4KGJA 1MCEA 1Z9SB 4NC0B 3RZCC 4JO2H 1DP0A 2YQBA 1ILUA 3G5XA 4DK6A 1OGAB 1JD9A 1G9ML 4GG6A 2VZTA 4NQCA 4U3SB 3WFDL 1TZGH 3CVHB 1G7JB 1ZDQA 2F54B 3F6LA 4MBOA 4QXVA 4G83A 1FE8H 4LLDB 2KL6A 5GJSH 4MQXC 1FNSH 1A4KA 4DEPC 2ARJA 2FO4B 1B6DA 1U4EA 5F9OH 3EYUL 4UB0L 4M7ZC 4YZWA 1BEYL 5EN2A 4BWUA 5I73C 3QEUA 5ILTH 2LVCA 2ICEC 2PPEA 2XFXA 3EFDL 1SXNA 4YDKH 3RX9A 1HKLH 3D0LB 3B9KB 4JKMA 1NFDA 3UJTL 5BMFH 5BQ7B 3BP6A 1RZKH 3FRPA 1QLRA 1AHWC 1PLBA 1DBJL 5AWNH 1JWUA 3C09B 3RIAK 1OV8A 5KTEH 3BEVA 1A3QA 5E8EA 5L2KA 1NANI 1XL6A 5EA0L 5HHMB 4YHYC 3AT0A 1H6UA 3VTMA 1J9TA 2X4TA 5DYOA 2XQBL 5B38G 2EH7H 3MRBA 4XO8A 2A9BA 2I24N 2DQFB 4U31A 4LLQA 1O0VA 5GZOD 1M6OB 4UINH 1QA9A 1JGIA 4RZCA 4N6RB 2VMEA 5F7UA 3V6FB 2GB2A 4C56D 4K8RD 5DQ9B 5I18H 2H6UA 1DEDA 2D0FA 4L3CA 4HUVA 1AO7D 3GSWA 4HFWB 4N0CD 1KF9B 1LDPH 1ZT1B 2JK5B 4AQAB 3KCPB 1EZVY 3T2QA 3LKRB 3R06A 4FQIL 1PU0A 2IOIA 5AVWB 1HJBC 4FX5A 4ZNCD 2CHXA 3GS0A 4R83A 3MV9D 1IAMA 4PJDA 3US0A 2ENYA 1YC7A 1LD9A 3ESMA 3FQUB 4ZAKB 3RX7A 2Z35A 1X5JA 3LRHA 1RV6X 1ORSB 2AXGA 3INOA 3QUKB 4X9GA 3MBEB 1IEBB 2DN7A 1MCOH 5IFAL 2FB4H 2WJ5A 3L4VA 3V52H 1DDTA 4AH2A 5AAMC 3VRJA 5T1MB 2GC4C 3W11C 3BYYA 4JRYD 4I4WA 3FO0H 4ZFOB 5ADPL 2XKNA 5LQBL 4YXKL 3DUSA 3FB5B 3MLTA 4KX8A 3O6FC 1NFIB 4UQIM 4X6DA 1U41A 3BESR 3H54A 5F1NA 2F53B 3NH7L 3Q3GA 4XAWH 2DIEA 1ZLSH 8CGTA 2DWEB 5ESVA 3K71B 3FQ1A 3ZE1B 2B2XH 3BSZL 1OY3B 4UM9D 5TDNB 5DA0B 4C56E 4LVNB 3QZLA 4CC4A 1CF1A 1F58L 1WWBX 5KAQF 1UADC 3PUUA 3SE4C 3TFKD 3S5ZA 3FT4B 4FFYH 1I7UB 1ADQH 3TA3A 2YGQA 3MRKB 4G8EB 1AO7E 4U0QB 3VUAA 3IPFA 4UQ2A 3UAJC 2NCEA 4YUEL 5JMOC 3DI2B 4ZYKA 3ARGC 3HS0A 1NJ9B 1JGVH 1TQCC 3U79A 4WHTB 5EF2A 4MA7L 3HG1B 2EDQA 4B9ZA 4JGJA 2XWXA 1ACZA 3MV9E 5JA8B 2DLHA 3L7FB 5SV3A 4EI5D 2GUOA 1XZ0B 1A9EA 4GQ9H 1LJMA 1YEEL 4DKDC 3T6XA 5BPPA 5T1JA 2Z64C 3A67L 3KL3A 4J3OG 2DWDB 5EBWA 4E9XA 3CC5B 5AOMA 3VSQA 1FL6A 1JNHB 4TNWK 3GEFA 2YWZA 3RL1A 5AG8A 4FFZL 1NLDH 3DNKA 2NW3A 1CC3A 1NIEA 1Q9LB 2IQ9L 2V2XA 4DZBB 4JRYE 1FYTA 5K1JA 4KK9C 5I71C 4P2RA 5BOPA 1D5BA 3SGDH 3GXPA 2OI9B 3LV3B 1U8CA 3ZMRA 1O6SA 2GYSA 1OIOA 2QSTA 4K3GA 3D69B 4M5YL 4AYDC 2QBWA 1WWAX 4EI0A 4X6FB 5EU5A 2J8OA 3CAFA 4YSEA 3PWPA 1G0XA 3ECQA 3RWFA 1QSFA 3I9IA 5CBEB 1A14H 1ADWA 1PYWA 3LY6A 5JNYB 4LAQH 4YSRA 4NI6A 3C5JB 5JORB 3VXTB 4QYAA 3L5XH 4L8DA 4PJ9B 5LAPA 4N0UA 3UEQA 2BZ7A 1MJUL 1H5BA 1RK0B 4JJ5B 1J88A 1S9WB 1F42A 5E70A 4DGVL 2ZJSL 1GW0A 1E42A 1U8HA 5EFIA 1ASOA 4RQQA 1CD1B 2YQ3A 4YIQB 5E8DL 2Z8SA 1TPXC 3K4AA 4UCFA 2OMXB 3MNDA 3MRNB 2X4PA 5JHLH 2HJFA 3DYMA 4TPRH 1UD5A 4LSUL 3EYFB 3NJVA 4Y9GA 2YD8A 2Z9TA 2WLMA 2AGJH 1IAII 2F74A 4KKQA 4ODSL 2KLRA 4HW6A 2QEJA 3V55A 1HINL 4M4RA 4QNPE 4OZHE 1A8ZA 4HUUB 3F2LA 5DUBA 2WO2B 1MVFA 3D85D 3V0DA 1EUTA 1UWEH 2X3AA 5CP7B 4JR9L 3W5NA 3F58H 4ECNA 3S36L 5DHYB 1PG7L 3HNTL 4QOKA 4XMZA 5DVNA 1PIGA 3DARA 1I31A 2WXHA 1EJ6A 5JLZA 4OLZL 2WUBH 4WF7A 1RZQA 1KXVC 3DGGB 1MKFA 1DDHB 5DGRA 4AMXA 4HSQA 2W07B 3QA3A 4ZS6C 4CU7A 1WJ3A 4KOCA 5FO8B 3QIUA 4JFQA 5KZCD 1A2YA 4MXVE 2CM5A 1QNZL 5HDBB 4ES9A 4QUOA 1N6QH 3RVUC 3NG5A 4AMWA 4M1CC 4UF7C 4R26L 5BS0E 5CZVL 3CLFH 1S7QA 4PWJA 4AI7A 1LO5B 3HHSA 4AL8C 1N7MH 3QIBD 4NZTH 4PP2B 2X3BA 5DZOA 5CKGA 3C60D 1HSBB 4Y5XB 1Z9NA 3Q48A 1D6EA 1LO3H 2X4RA 2NNAA 3QPXL 3PY9A 1KT2A 1XF2A 1A6ZA 3D12B 4X7FC 4FXGC 1I9RH 3HG5A 3U1QA 1NCBL 3O2DH 4CBZA 4CN4A 5F9WB 2WBJB 4ABVA 2F08A 1A4CA 3ARXA 3KVQA 3O45A 4KJWC 4U1KA 3UC0L 5IMLA 1LEGA 4K3EL 1CDCA 2PF6A 3SOTA 3NEOA 2FSEB 1LEIA 3T4AC 4W9JC 5EU6B 4JMXA 1RUQL 5CIPA 4OGXL 1QVOB 2NUTB 3IDIB 3T1FB 5GRJL 3MXVL 4FF9A 1OP4A 1G1YA 3P73B 1U8KB 4ELKA 3TEZA 3GRBA 3UIZA 3L4YA 3C6SA 5MEQA 2Q3XA 1WAPA 2H0EA 4AV0A 3UG5A 4YE4H 3DOSB 4FQQB 4KI1A 1IEHA 1QRNB 1PLGL 2R2HB 4Z7NB 2Z4QB 2BY2A 1GS8A 4KQ3H 4MDRA 4YDVA 2AS5M 1MRFH 4BFOA 1E5ZA 1GC1C 3QXAA 4I1RA 4BV1A 4F7MA 1MLCA 4JGUA 4LCUB 3HLAB 2WXFA 5IHWA 2XWTA 4W9HC 4Z77A 1ET7A 1U3JA 7CGTA 5GZOC 2BNRD 4IDJH 4GW4B 1OE1A 3PJNA 4WTQA 1YG9A 1GKOA 1P5VB 3GKWH 3NJIA 1HL4A 3QC6X 2B77A 2AJ3A 1NANH 4PRPA 5ISZB 2C1PB 2VLLB 5EZOH 2WY3B 3GZKA 2XX0A 3L1GA 1DUYB 3BLKA 4N2AA 1MLBB 2OXHA 3FF7A 5J11B 4AIZB 4U33A 1RJYB 4AYFA 3CH8A 3EJJX 4YEFA 1AQHA 1IKFH 4AEHH 4NO5A 4YSUA 3RWGB 2X2JA 4Q6IA 4RGNB 1R3HB 2VH5L 1HHHB 3I50H 3V4PH 3EOAB 3RLSA 4EZLA 2DWSA 4AM0Q 1MFCL 4Z7WA 3C5SB 4JBSA 1VJSA 5EO9B 3BP4B 4KKCD 3UP1A 4AVJA 3FQRB 5D1QC 1R47A 4S0HA 5DS2A 5IBUB 4Z7QB 4RAVB 1DVZA 1RLBA 2C26A 3V6ZA 1DBMH 4LLMB 1FBIH 2ITDA 2UVFA 5GQBA 1EZVX 4DPCX 2RJMA 1ZWIA 3FCSB 4PB9H 2WZAA 4OLEA 3Q8CA 4F92B 3CNKA 4OM0H 3SZKC 1CUOA 2AI0L 1GGBH 3MI6A 3U82B 3N0AA 3K80A 3RA7L 3PQYE 3C8DA 4PCYA 1AR2A 4X0KB 3HLKA 2JKLA 2C9VA 2X42A 4FC3E 2W5PA 2WK2A 1XH3A 2BNRE 1JGEB 2NXZB 5A16B 5BQDA 3MODL 4HCFA 2JCCB 4OJCA 5DRNB 3P11H 1CDHA 1MW3A 4R9HA 3QYNA 3W38A 2R29H 4XX1G 3KBFA 3L4TA 1T3FB 5F97E 4GG6B 5HD8C 1MW2A 4NQCB 4ONFL 1CVRA 4QYOA 2JJSC 2R2BA 1DHKA 3U25A 2J5LB 3OAUL 1HYSC 3FQ2A 1ND0A 1PQZB 2N56A 5IB3A 3KYNB 1X5YA 5TDOB 2W38A 5JPNB 1S3KL 1GZQB 3K4DA 4HMEA 2XFXB 4GP5B 2VRQA 2I27N 2XN9A 1QSVA 5T1LA 2HTLD 4ATTA 5A2AA 2DMGA 2HFTA 1JK9A 3AGWA 3U2JA 4P05A 4UUJB 2WNXA 4ZMTA 1PSKL 4U7SA 1XSJA 2ARJQ 3CFCL 4LDEB 5D2NA 3UMTA 4PJ5A 4P4RA 3FN9A 3ISWA 4S1DD 4LSSH 2ZOLA 4GAJL 1NL0L 1HZLA 1JZEA 5I16A 2Z31D 3T0WA 5C2BH 4L5FH 1M3IA 5J6HA 2I07B 1DJHA 4I3RL 1YEKL 1G7IA 1O9VA 3C8KB 4FQJL 1IRAY 4PRNA 5GHWH 3W2DL 3KPNA 2NY3B 2KC0A 3BN9D 1QA9B 4PJIE 4CVZA 1XIWD 4S11A 4OJFH 3CDYA 4MA8H 4AYBA 4AIXA 1EAQA 4AEIL 1YMMD 2PWFA 4JFWA 5DLLA 3W0WD 5HP5A 4L3CB 3ZW3A 1FDLL 4J3OH 3WO4B 5AKTA 4Z1PA 2BVYA 2WNWA 4H8VA 1I9JL 4PVBA 1HEHC 1DBKL 3NJHA 1UT1A 1HH9A 4QWWD 4Q9RH 3CX5K 4DTGL 4GSDL 1L0YA 2BDNH 1BJ1J 1NA8A 2I60H 2F68X 4GAGL 3HE7D 2VXUL 1L9SA 4FA8A 2B16A 5KYUB 3HMXH 3FT1A 3UZVA 1N5YH 4R0LB 4Q9QH 1LD9B 4WV1B 3VWKC 5E99H 2Z35B 2VW4A 1XBDA 4UZUA 3U2IA 5FV2A 2GIYA 1KYOJ 3SBWC 4KMQA 1E5YA 4YPGA 3JXAA 2V8MA 3ZR6A 3EYVA 1F6LL 1DFBH 4UANA 2WBKA 3CC1A 3NGBC 3VRJB 4GRWB 3ZKXC 1LWJA 4EDWL 3L5IA 4GKSA 3T0ED 5DJ8A 1N5AA 4Z5RA 3PL6B 4W9ZA 1EANA 3TJEL 3AWFA 3ZE0E 4MWFB 5I1JL 1E4HA 2XPZA 3SDXE 2BSRB 2Q7AA 4MQ7A 2FWUA 5F7BA 2F8XC 4FD0A 3BD3A 1Q0EA 3JYBA 3V6OA 2UWEE 1IAIH 3G6JF 5IBUG 3QHZL 5F1KC 1MCLA 4OUUA 3WFBH 5SWQB 5GGUB 2LR4A 4N0FB 3AUWB 1AHMA 1X5FA 2F15A 5DZAA 2VWEE 2QKSA 1TG8A 1YMME 4PJBE 4NAJA 4ZRGA 3BQUD 1RZJC 3W0WE 4A63A 2X89A 2XZAL 2EVGA 1U93B 3MNZA 2OSXA 1T03L 2EDBA 1HJCA 4Y1TA 4NWTH 4WO4A 3HI6L 4R7LA 2J4WL 5IMKB 4XVJH 4ZYKB 1SMDA 1IFHH 1O6VA 2XA3A 4UV4L 2VC2L 4RRPA 2K1MA 1BECA 3IAQA 1H3WM 3H9SA 4J27A 2FX7H 4OLWH 1KN2L 5EC2B 3RUGF 1Q9WA 2ZUUA 3C60C 1QR1A 2ODIA 5D1ZI 8FABA 2FATL 2WVTA 3TC9A 1OTUD 3EBIA 1IVLA 1NAMH 1AMYA 1ID2A 4QTFA 1UKTA 2HYMA 1VHPA 4JFZH 1FL6B 2E7HA 2FH6A 3RL1B 4JN1H 3ECBB 4ZD3L 4PW4A 3EXLA 4ISVA 5ANMB 1IKNC 2JKRM 4FGMA 5AAWA 3LIUA 4MCNA 3S37L 5IOPA 1GZPB 3T0EE 3B2XA 4L9DA 4GUOA 1IGFH 5JUEH 4CMHB 2YUXA 1HH6B 5PCYA 1U8CB 3HI1A 3DUHA 4E9TA 4NGHH 2V9RA 3SPCA 5I6KA 4AQEA 3MRHB 2AF2A 4GRLD 1HL9A 4CSSA 4LP5A 1UB5B 1MFDH 2FE0A 3STLA 3QI9D 2NXYD 5L4MA 2XXCB 4A7QA 1AOHA 4PRHA 4QTIL 1BFTA 3KYKH 4PCTA 3FB8B 4EJ1C 1W8NA 5J13B 4H8WH 5A3ID 4M43L 1AZUA 2AQ3A 1SDYA 1LLAA 2EADA 2KKQA 3IWUA 4ZPTA 4Q97A 3C87A 1CICA 5KBLA 1ZDSA 1N64L 2W0FA 3UTPD 1QBLH 3JWNE 1KPRA 3KS0J 4D94A 3EKCA 2GJPA 1NWPA 2NY4B 1GYVA 4JHBA 4M7LL 3E9TA 3VXQA 2MIZA 3BO8A 1JVLA 1N59B 2MJWA 1I8KA 5CFHA 3MZTA 1GGCL 3ARBA 5KYWA 2HT2D 3L3IA 4TNVF 5DCCA 3GMNB 3CXDH 1TKWB 2ESVD 2VXVL 3BDBA 2F74B 3E8VA 3T8XB 4I2XE 4RFOH 5B3SB 4P0DA 2CA4A 3FU7B 4MCYB 4MMXB 4ZJ9A 3CFJA 2PXYA 5AZEH 4RBPH 2FHFA 1CFMA 4YHLH 5DHVA 3O8XA 2F58L 1ZT7B 3GNML 3Q8FA 5H37A 2NR6C 2AJZA 3A4DA 4L8BA 3HZ3A 5AZUA 1X5ZA 2WQWA 4BRVA 2W0LA 1YYLL 4KKCC 4J5VA 5HHNB 2AP2A 4K07A 3GSVB 5SWSB 1FGVL 2EO7A 2GBTA 3NCCB 3H2WA 2J43A 3GS4A 4AJYV 1C7TA 5C0IB 2ILLA 3ZE1F 2X0WA 1DQDH 1U36A 3IE4A 4DUVA 3WKNA 4TNWF 4OD2A 5LAXB 1A2YB 4Q52A 2UX7A 3LIZH 2R0KH 3P3TA 1URIA 4OZ4A 2B39A 4AENB 4ODXB 4NKQB 1TETL 2VR6A 2EDOA 4NO0B 3UTPE 1TFHA 2HPTA 1HXKA 4QHMB 3CVDA 2IGFL 2X70B 2E7LC 4UBDD 2AAAA 2DF3A 2XRAL 5E8NA 3WJLC 4A2EA 1NC2A 2XKSA 4GBXA 4OW6A 3DX9A 4I0CC 3GI8H 3DVIA 2BNQD 1WC7A 4JB9H 5KVMC 1P69B 2BCKA 2X6MA 5IMLB 2LAGB 1OKEA 2ESVE 3O45B 1GAFL 4QLRA 4TTDD 5F8RC 1VFAA 1CWVA 2QADB 4BK8A 2LOEA 4JAMA 2XVBA 3WN5B 4ZSOA 2R56H 2ZF8A 5JPMA 1MFBL 1XEDA 4D2NA 5HGBA 4U1HB 2HTLC 3T77B 3CD4A 3HZYA 1CLVA 3LN4B 3L4UA 3POHA 3PPSA 4LIQL 4ELKB 5IFHL 1C12B 4PJXF 1NCAH 1UC6A 2JLLA 4OLVL 3ECUA 5DDHB 3LVEA 4LSTH 3VTAA 3CSYA 1MCWM 1T2QL 3FSWA 1G43A 2EDDA 3KR3L 4S1DC 3QG6A 4WDIA 4YDVB 5HHXL 2DQCL 3ASNB 3BWZA 1ZE3C 2DQHH 4WWNA 1ZEAH 4TXVB 2WN3A 1AKJB 3LRSB 1G5GA 2D7QA 3G6DH 1KTLA 2Z31C 5AVSB 1F4XL 4IYKA 3WLWC 4EDXA 1GXEA 4UTAL 1JF1B 1GYCA 1KYOK 4HGMA 3G5VA 1D3CA 4Z7VB 3GZOA 4Y1AA 1KGJA 1QFUL 4X8CA 2PR9A 1E6JL 3R1GH 1MAMH 1CD0A 3IU3A 3EBHA 3DHJA 1AGDA 4Y8AA 3QQDA 1P7HL 3IDJB 1X5IA 1CE1H 1TZAA 3QUZC 3BKCH 3RRQA 2JFCA 1J5HA 4XP6H 4M1GL 4GQZA 3WDIA 2A73A 5CCGE 4JL2A 4WU5A 4HBQA 4QWWC 1P1ZA 4X2UA 2ITEA 5FKPA 4K94H 2V2WA 1DEEA 2ZICA 1HDMA 1HTYA 4G6KH 5HSFA 1KELH 2YPVL 4KKPA 4YHZL 4HH9B 1NEZA 4GQRA 3IDGA 1NUFA 1EO7A 4APQA 1HHIA 4ZUSB 2XWRA 3WKPA 2XXMB 4JM2C 2UUDK 1KJVA 4NO2B 2V17H 3NCJL 3UBGA 1GMIA 5EIQA 2Y22A 3V6ZB 3CFBA 1IM9B 3WXWH 2PWGA 4JRWA 3MJ6A 1ZSHA 5HVHC 3QISA 3AMKA 1ED3A 2IG2L 3T0EC 1YPZA 4KTGA 3WEAA 3P2DA 4URTB 4P2OA 2J2ZA 2YFOA 4J3SA 5SWZD 2CRYA 4JY5L 4R2GD 5TH2A 1JZ5A 3CZKA 2LV4A 4M7LT 2R1XA 2UZPA 3TASA 1SGKA 3DOIA 1XH3B 5FUCC 3P2TA 4QRFA 4Y5VC 2NY0C 5KYYA 3VCLB 1PAMA 5F0LB 4I3SH 4AGPA 3GMRA 4D0CA 3GSUA 5LBSL 3UDWC 5GGRA 2G3XA 4FHBD 2Q8AH 1TLMA 1SJXA 4TL4A 1T5KA 1MFAL 2YAQA 1U3HB 5FYJH 4M5ZH 1A9BA 1DLFH 1MJJB 2ZXGA 1TSHA 1I8UA 3DTXB 2X6UA 4GSQA 4YAQB 5KSAA 4J3BA 2DLIA 5E08H 1PFCA 4AWJC 1JWMB 4P2QA 1F1GA 3JWNC 4DFHA 3KL5A 2GEQA 3MTXA 2CG9X 4OJAA 2H8PB 3RPIA 1E8YA 4R7NB 3IETB 3O6KH 3LHPL 2DEXX 5ECGA 1OTUC 1JK9B 5LO7A 3D1MC 5MP6H 5T3ZH 3IDXH 2PWEA 2A6KA 1AG0A 4PLJC 3MBWA 1IAIM 1U58B 2CK2A 5D2NB 4NNYA 3OF6A 4PJ8D 4UM8A 2B0SL 3NSCA 5EZLB 4TNFA 2ZOLB 3PHSA 1T5XA 5TTRA 1BZOA 2FIKA 3GSRB 5K59F 1NQBA 5ITBH 2G60H 4G43A 4YSQA 3QP3A 5MEOB 1G7IB 1SRDA 1V3MA 3II1A 4Z7UA 5SWZE 1G1OA 3P69A 5F44A 4NBZB 4HX1A 4HT1H 4P3DB 5ESAA 1ZHKB 4ONGL 3FK3A 2X4NA 1KEGH 1KFGA 4G9DB 1WEJL 3RZCA 3QXDB 1J8RA 4X4KA 1WWCA 2E8YA 4MMZC 2BP3A 3SCMD 4HWBA 5ICZB 1HH9B 2COVD 2H3KA 3GSQB 3K6SB 1MWAA 1FZOA 1SJEB 4K5OA 3SGKC 4XVTH 4M3JA 1QEXA 4JNXA 3RY6A 2E75C 1A6UL 4EBQL 2MPAL 3IFNH 4Z3EA 4JHUA 1XZWA 3ARQA 4V2BA 3UTQB 5BVJA 1OAXL 2YKLH 2R1YA 2WC7A 3II3A 1MOEA 3Q43A 4RX4D 4X4XA 5D5MB 3ULAB 1NCWH 4NXSA 2VN3A 4PS3A 3O9WB 1WAAE 1T0PB 4ZDHB 4RWYH 1AHWA 2OMWB 5GRZA 4YPGB 2HT2C 2KDGA 1SEBA 4WTWA 4OLYH 3A47A 3EYVB 5FO7B 3BGFC 1TJGL 5B1AB 5DJZA 5LGJA 3EJZD 5B21A 4ODVH 3BMVA 5ESQA 1QNIA 5FWQA 3PAYA 4OFYD 5DJ8B 1KCUL 3QG7H 3N06B 4XOEA 1JZDC 1I8AA 25C8L 2BS71 2O6DA 2OQJA 2YA2A 3BZEA 2BS8A 4LKCA 4DP9X 2VDML 2AZAA 4G8FB 1U0QA 4MSWB 4YHIB 2Q20A 1L6XA 5BRZE 1HEJC 3DX8A 5FYLE 4OCMC 3HNSH 3B56A 5C6WH 4HHWA 2IO5A 4KDWA 4GH7B 4GAAA 2ZXQA 3WS6C 3P9LB 5F89B 3T5WA 1MNUH 2DW5A 3T2OA 2X53A 2B1OA 3CFKB 1GJUA 1MNNA 5D71H 4GG6F 4I0PB 4K55A 3NJMA 4XP9L 1KIQB 2XZQL 5I1HL 1F90L 3B1UA 3VFOA 3WE6A 2PPDA 3CDGB 5JHDA 3NFNA 4AZUA 2Y7QB 3QULB 1UKSA 3CU7A 4MNGB 5T1DL 1G9MH 1LNUB 1QR1B 3RZWA 2XI9A 4BGLA 4NPJA 4Y4FC 4HPOL 3DSFL 1OXYA 4NHCL 2J12B 1PEWA 2PYFB 2OW6A 1DO6A 2IDSA 1LTXA 2C4FT 4OUOA 3V2AR 2VLMD 3IJHB 3EYUH 4PY8J 4UB0H 4WAFA 1BEYH 2E6PA 3JV4B 1EUUA 2F5BL 4ISVB 3N41B 4A68A 3UJTH 2XWJA 5LWYL 2AJSH 3QJQB 3BW9B 1DBJH 5IOPB 3DX7B 1XCXA 3O6FA 5EC1A 2VLRB 2GFBA 4OZGA 1EVTC 2F6AA 2W9DH 3EO1B 2IH1A 4L37A 3DGCR 5EA0H 2DYPB 2EZ0D 1JYNA 2X4SA 2KZKA 1RERA 1SVBA 1FZMA 2XQBH 3QDGB 4PREA 5CMAB 1E4WL 3TIEA 1S7SA 2H2SD 3SE4A 2AV1B 4PP1D 4K9EL 5LLIC 4BCYA 1W0VA 1O7VA 4RMTA 2X87A 2WSDA 3WHE1 3VI4A 4NAMA 4Y9BA 1WK0A 3N9GH 2E74C 4FMVA 2A6DB 2AV7B 1R3JA 5CF3A 5EH1A 4G8GB 3Q5YA 5C3TA 3F7LA 5INDA 1NC4A 1SXBA 2AABL 4POZD 1NBZB 4PJDF 4X99A 4FQIH 5KYWB 2FX9L 4I87A 1XGQA 4XPAH 3SD5A 4HFUL 3X11B 5D7JD 2VLME 4WHDA 5FEBA 3IFPA 2X4UB 2VC2B 3UBXB 3VW3H 3MFFA 4NO3A 4G6JL 3BI9X 4PIBA 4XNMA 4LCYA 4GRWF 5F7DB 4XP1L 4IIQC 3O8XB 4H20L 5CD3A 3GMOA 3F7PC 2LU7A 4IKLA 4L8BB 2W65A 3T0XA 2C7UA 2W9LA 4L4TD 4UDTB 4G59C 4X6DF 4YGVA 1GZHC 5E0QA 3SJVD 2GG1A 2KZWA 4DVBB 2K0RA 2YMXL 5HY9A 5ADPH 2EEDA 5LQBH 4YXKH 2QT6A 5LXVA 3BKJL 1ZGLA 3R4RA 2IGTA 5HBBA 5CJOL 4IRSD 5HYIA 4PJGB 2EE0A 3T3PE 1R3KB 3NH7H 2N7AA 3UPRA 1LK2A 2ZIDA 5IHLB 3SDCD 1HCYA 4MS8D 3ZZSA 1A7OL 2PWHA 3AS2A 3DMMD 3BRFA 1AR1C 1FG2A 2I69A 3UZEC 2K6YA 1WZKA 1F58H 3HNVL 1V05A 2AKRA 3UFIA 2YPLB 4HJGA 4LSQL 3LYRA 1NLBL 1A1NA 4QRQB 3KXFD 4IU2B 3MUZ1 5I75B 3IJ8A 3IRPX 4YUEH 4MCMA 1NC2B 2O1AA 1A65A 4IGBC 1FHGA 4PB0L 5BJTA 4GSUA 1FNHA 1Y07A 5AENA 2H2PD 3VFNA 2BCKB 2CH8A 4ENEC 3GO1L 2DJ4A 4HLZG 3HB3B 5C0AB 4K2UL 4OF5A 3T04D 3C75A 2NQDA 5H2BA 3A67H 2R9HC 4ZSOB 3VMOA 3FB6B 4UTBH 3HE6B 5E2TL 4FFZH 2EO1A 5FDWA 2AC0A 3TTSA 1WBXB 4FE9A 1H3UA 4L4TE 5CSZB 3SJVE 3X1EA 2RQ8A 1JAEA 1OGPA 2IQ9H 3EJUA 43C9B 5FLUA 3CFUA 4XXDA 3X13A 2A83B 1KXVA 4WWKD 1WT5C 1AYRA 3KYMA 4IOSD 2FD6L 2BP5M 4P9HL 5A40E 4PFEA 3ARTA 1NGQL 3RYMA 3I9GL 4M5YH 2IV9A 1JPSL 5L0QB 3VRLE 3NP4A 3B34A 4F7PB 1U91B 4XNUL 4UT9A 5I1CL 3TONA 3KG5A 2Z7ZA 1KCLA 2ZUXA 3QEGL 4QAWA 2OTWA 3QDMA 2F7IA 3DDGA 3SDDB 2FYYA 1B90A 4BQCA 2GT9B 2WNGA 4XMLL 2RTTA 3IU3B 2YRBA 4LLYA 1AGDB 3KXFE 2OULB 1XR8B 4JFDD 3TO2A 1MJUH 1SBBA 3MGOA 5C0BA 2ZCLL 2VSCA 2EACA 5HHOB 2ZAHA 3SCMC 4DKTA 2A73B 4DGVH 2ZJSH 4WU5B 4K9JA 5ABDE 1ES0B 5IG7A 2Z8WC 2F7QA 4X7TA 4ZMOA 5I9QB 5E8DH 3X2QB 2DZEA 5EBLB 4FLHA 2XTJB 3T4AA 5G2NA 2AW2A 3GDBA 4YO0A 3LZRA 4I3GA 4LSUH 4QR7A 3V5DB 2VSKB 2J73A 3GIZL 2ZSWB 5LGKA 1OE3A 4ZQKB 4ODSH 5EPMA 1BOGB 3CIAA 5FFGA 1HINH 3REVB 3WHE0 5AVZB 5DYFA 3MRIB 2K8MA 3UBXG 1TTRA 4NQEB 2VERA 1SJVA 4LLVA 5IQ9B 4FG2A 1YDPB 2DYRB 2LT9A 3ZGIA 2CRZA 4R4FL 4IU3B 3S36H 1PG7H 3R4DA 3MLUL 3F83A 2CRMA 5H37G 3WE1A 1FV1B 4OLZH 4C58B 3PGCA 3EGDB 4P2OB 1UB6A 3ZTDC 2DLEA 3HHRB 5DGQA 3LZFL 2OXGA 2J7LA 5GZOA 1UXMA 3GLDA 5IY5B 2YEZB 2UUDH 1YN6A 4E36A 2QFRA 2WNKA 1JHTB 1CD8A 1QNZH 3GMRB 4CJ0A 3GSUB 4U6VH 3RWDA 4C56A 5FPIA 5H4ZA 4JFDE 5HDOA 4R26H 3GMPB 4K5LA 2IXQB 1U8PB 5CZVH 5DEFA 3V0VA 4FFTA 3V8CA 2ADYA 1A9BB 1AO7A 3MRLB 4MNQB 4ELME 3BWAA 1KLGB 4QJ5B 3NIDF 1BQUA 1EA9C 3QPXH 2ADFL 4KRMB 2WXJA 4EUPB 2VISB 3EAKA 5A2KH 4IOIB 1Q8MA 3ZUNC 2O61A 2XPGA 1NCBH 1JUFA 3MV9A 1KG0B 4H26B 3EYQD 3S0PA 3BDXA 3H6AA 1BSIA 2J57A 3PP3K 3LKOB 3TNMB 1OAKL 1QPXA 1S5IL 3UC0H 4K3EH 1IT9L 3DX6A 4FQXD 3F05A 1TZOA 4LMQE 1RUQH 2Z92A 1PY4A 3VQMA 2MNUA 4PJAB 3FN3A 2DQEL 4R5VA 5GRJH 3MXVH 3ZKMD 4YWGH 1OTSD 1OTTC 4RESB 3LH8A 5A6MA 4JRYA 2RB8A 5FA3A 2VL5B 3DJZA 2JWYA 4K3HA 2XLLA 3JWOC 1ORQB 1VADA 4WTXA 3IEAA 1DQLL 4PGEA 1PLGH 1N19A 2G0LA 2ZUTA 3D2UB 5LGYA 5ESAB 4LEOA 3GTTA 3VXOB 2VJ8A 2EZ0C 1ZLUH 3SN6N 4BFIB 1DL7L 1KLUA 3WIHA 3HCVA 5FA4B 1NKGA 2UZXB 2XIDA 2JJSA 4NS0A 1PTZA 3VRIB 4OY9A 1FZOB 4N2EA 3V0IA 1I1AC 3NOIA 3JVGC 4Z7OE 2APSA 1TYEB 5HJDA 3Q05A 3OQ3B 2DDQL 5I5IA 1WFTA 2CO6A 2FDBP 4XNYL 4XN7A 5DRZA 4N2BA 5I6LA 1BVOA 3UAFA 4EI5A 1A64A 5E1GA 2SEBA 1DUZA 2EIZA 1JIBA 4LQFL 2VH5H 1BEXA 1O5PA 4L1DA 1SEBB 4NQXA 1GRWA 3B5GA 5D7JC 3OKEB 1MCSA 1CDUA 1MFCH 2WAHA 5DO2C 2CALA 4HZLB 2CUAA 4GOSA 4G71B 4QTHA 2ZX8A 5I82A 4PY7B 4X0NA 1ZVSB 4OZHA 3MRDB 1VFBB 5EEUA 1QBBA 2FBRA 3IXAA 3V9EA 3M1BB 2EVFA 3RDTC 3PE9A 3JTTB 3BAIA 5D96B 2OQJB 3LPWA 2B5IC 1SLVA 2PR4L 5IJCC 3K4ZA 4TVUA 4YQXH 3BZEB 1AQKL 1T1WB 4KKAD 4KROB 3QUGA 2BHFA 3K8KA 3P77A 4HOXA 3N5AA 3PABB 3BYTA 1PZ5A 3D6GA 3WY1A 1K72A 2DQDL 2WSPA 3GSNA 3OLIA 4HIHB 4I88A 3EHBC 4OV5B 4IRSC 4TQIA 2AI0H 1MH5A 3F64A 2DQIL 3D07A 3INUL 1DQQA 2AZUA 5EBGA 4LKXA 3Q2VA 3RA7H 2N0KA 4OGZA 4NEHB 5PAZA 2J6EA 3DMMC 1WISA 3MODH 2A6IB 3WE6B 2UXGA 5BS0A 4MJ6B 4HH8A 3C08L 3FZUC 3UTTB 1U8MA 1BQKA 4M4PA 2AQQA 4WFHE 1ESOA 3EBGA 1AC0A 4OM1L 2FNWA 4EZMA 4PG9B 5IHZA 3RVXD 3VWKA 1WG3A 1LEKB 3OAUH 5E2UL 5B39A 1S7UB 2YSTA 1BW8A 3GDCA 3L3GA 3SBWA 4NT6A 2A0LC 3ROLB 1S3KH 1PDKA 2GJ6D 2VJ0A 4O2EA 2AITA 2YD7A 1R0AL 2C9AA 4OFPA 3ZMNA 1MWOA 1SY6L 2VLKE 5HYSB 2WGNB 5ETUA 4TUUA 4PVLA 3FAWA 3AQYA 3L3KB 4NKOB 3PF2A 2EE6A 4MD5A 3PAVA 1PSKH 5FCUL 2HT3D 2PO6B 2ADJB 1KENL 3D85A 1PKQE 2AEOA 2EDNA 3IMRA 4MXWL 5AALA 2R39A 2BW5A 5HI4C 4LOEA 2YRZA 1NGYA 3KJ4C 3AT8A 4GAJH 2Y2TA 1EV2E 5C3IA 2JKWA 3P4OB 1NDGA 2X12A 4ZUUB 4ZOBA 5E5MA 5ACMA 5AD0A 4I3RH 1YEKH 3X14B 1S7SB 1FFTB 2A4CA 3AAZA 4FQJH 4M8RA 3W2DH 4X5WB 3N55A 4BK5C 5FB8A 1LYQA 1NAKL 3FNKA 4A1RA 4CADA 1W0VB 1FCCA 3RWJB 3HRZB 3AJ7A 2NW2B 1NCGA 5ID1A 3G5YA 3DC0A 4U4BA 3LQZA 2C3WA 1AD9B 1WBYA 4MHHG 4PTTA 5F1OB 4FLQA 5JW5B 4XZUA 3F85A 2H3NA 3MYZA 5K33A 5BCAA 1FDLH 1EMTL 2OFQA 3OAZK 5INDB 1SDAB 3F7RA 3O3EA 1I9JH 3VWJB 1W0WB 3C60A 2GTWA 4EI6B 1DBKH 4PV8A 2J8UE 4ZFFB 4B0MB 2W0PA 4Y19B 2FWOB 5BOJA 2VW7A 4GAGH 2VXUH 1TJXA 5DK0B 4ODWA 1RXLA 5IVZA 5FM8A 2Y07L 3SHSA 3LXUX 2F8OA 1JZ8A 2GJ6E 2Y2WA 3WY2A 4X6CE 4XMXA 3T65A 5GIRB 3VGFA 1ODUA 1T7VA 1GKEA 4OT1L 3OB0K 1IKNA 3FTSA 4MJ5B 2Q8BL 4UZSA 4LDLB 4M8QB 3GMOB 3NIGF 3TNNA 5DTFA 4E41D 1YEDB 2C7UB 4BZ2A 1CYWA 5DHEA 3WJMA 4F8PA 4FNLL 4EDWH 5JXAL 2IWGA 3NT0A 5HY9B 1B0GA 4FYRA 2OMVB 3BAXA 3V7MA 4CVXB 3TJEH 5I1JH 2WWKO 1KC5L 3ASOB 4JKLA 4PMEA 5D1XD 2P8MB 3L5WB 1CGXA 3KLKA 4KI5F 1G87A 1OP5H 5KS9B 4HUWB 1K2DB 2K7QA 4WKZA 6CGTA 3QHZH 3TO4D 1IGYA 1T0NA 1D9KD 2OCJA 3PQYA 4UIMA 1J8KA 1JN6B 2BZDA 4OGYL 3QCVH 4LPCA 3U46A 2BNRA 4W6XB 5I0WA 2XZAH 2OSLB 3OJDA 1T6VN 1T03H 2EKJA 4F7CA 3EO0A 1D5IL 3FUJA 2L7UA 3HI6H 2J4WH 3TLRA 1WE5A 3IF1B 3T6ZA 3X1NA 4Z76B 4QY8A 4JVUA 4LCWD 4AGMA 4PEEA 1X9RA 5C09B 4YSCA 2VC2H 3ULVL 3CDZA 5FK9A 1R5IB 4M93B 4H25B 4QXTA 4LDOB 4BZ1L 1RZ8A 5DQDH 2FATH 4QHUA 3W82A 5CBAA 4W6WB 3JTBA 3X1FA 3K6OA 3SKMA 5H2BB 1OCWH 3QJFB 1T1XB 4B9IA 3IMBA 5CN2A 2NR6A 1ZS8B 4E41E 1JNLL 1A9VA 5KUKA 3PHAA 5F7MC 4A2DA 2D03H 2HRPL 3DUUA 1B0WA 3FQTA 4ZD3H 1MJ8L 3BVXA 4MJIB 4FQXC 5T5NG 5A2CA 2QL1A 3DPBB 1MHCB 5IHBA 3S37H 5HYSG 1MAJA 1GYAA 2ATAA 4ZG1A 1KJ2L 3KD4A 4B9YA 2HJKA 4U1NB 3VXSD 3M17A 1OTSC 3HA0A 5D1XE 5MI0C 5IOKA 3GB7A 4QRRD 4RA0C 3ZIYA 3IB4A 3NVQA 2NZ1A 4HETA 1M2VB 2FHCA 3W57A 4YFLF 3L95A 4NN6C 4JPVL 3GI9L 4QTIH 4X6BA 4P5TC 2NUPA 2OPCA 2O5NA 4PJIA 2MKLC 4PGJA 4KO9A 3BE1L 1U95A 4R97C 4RDQF 4M6NH 4LLYB 5I0DA 2FQDA 3RGBA 2G9KA 3UG3A 5BVPL 2E7LA 2QMKA 3AUVA 5ECJE 4PRBB 2GBUA 1DBBL 3SDAB 1NMAL 3MA9L 3WJLA 5HPMB 4LCWE 2Y5TA 4P49A 2WYHA 4KXDA 1DVFD 2JB6A 1KTRL 4ODHL 4M7LH 2GTQA 5JIDA 2OZNA 2QHRL 5C1MB 1A8JH 1J8HB 2XV2A 4XOBA 1GGCH 2BVOB 3MN8A 4F7TB 4Z3JA 2RQEA 2OTUB 2QR0B 2UY6A 2VXVH 3SQOL 1YEGL 1ECZA 2ENPA 5D93B 4XOAA 5EPMB 1EHAA 5T5FA 3TA4D 3VFGL 2HT4D 5ALBL 1DCLA 3GNMH 4GO8A 5EU4B 4L4JA 3D3VA 5CLXA 2V37A 3I6KB 1YYLH 3ZTNL 3VXSE 3WTVA 2MQ3A 1TXKA 2Z31A 3PGCB 3KPTA 1FGVH 4FQPA 4QRRE 3VJ6B 1UB6B 3VXUB 5GS2H 4FCAA 3SDXA 1DVUA 4MAUH 1UH4A 1ZRUA 4JS7A 3WNPA 4FMKA 2IJ0C 2H1LM 3ZDYF 2UWEA 3ARYA 1RIHL 1YN6B 2R0WL 1XIWA 1OGAD 2OMYB 3GMMB 4Q9BA 4U6YA 2CUIA 2NT0A 1CPUA 4A7UA 3PGFL 4J3OD 3ZN6A 1GCYA 1YMMA 3W0WA 2F54D 3QUZA 2E56A 1J0YA 2GSIB 2FHBA 1F4HA 1M05B 1TETH 2VDRL 4NNPL 1AO7B 2V6HA 4XCNB 2PCFB 1AZBA 2DQGH 1T1ZB 3APMA 4PRAA 2IGFH 1YN7A 2Y23A 3MLRH 4UQEA 3EO9H 2XRAH 5ACZA 3GJFA 3HE7A 4QGTA 1B0RA 2ZKHL 3UCRA 1QLFA 1CDBA 5GS0L 1U8NA 3DV6A 1IGJA 3RVXC 1GOHA 2PKDA 1KJMB 3DVNB 1TQBC 3PG2A 4F9LC 3BAKA 5CP3H 3QJSB 4G6FB 3OLEA 2V5RA 1GAFH 5FW8A 5J9PB 1KIUB 4MFHA 3IKCA 4LQ1A 4JM2A 5F0JB 3QQ9D 3FN0L 1P0SE 3L9BA 3B6SB 2HXAA 2X0VA 4Y16D 2MCMA 5IROD 1BV8A 3CXFA 1J5IA 4LIQH 2Y36L 5IFHH 1RZIB 4L5FE 4BA8A 3DX3A 5DQJA 3RIFF 3T0EA 2HLFD 1H3TA 2LQRA 4GUPB 4OLVH 4LPYA 1VADB 2H3XC 2BNUB 4XNZB 2A74B 3SB3A 3KR3H 4FA6A 5HHXH 3EH4B 2DQCH 1S8DB 3QRBA 3SKJL 4P4KC 3V4LA 1EK3A 1V27A 1SYVA 3TZVD 4MMYA 1OGAE 4MKMA 1F4XH 2O6CA 4DN3L 1KUMA 4UM9B 4GB9A 4F93B 4UTAH 3SODB 3UDWA 3DRQA 3S3JA 2F54E 5ANHA 3HR6A 3CLEL 5DVLA 3H8NA 3MV8B 1QFUH 2H1XA 5EG6C 2HB0A 3V4VL 1E6JH 2ZOWA 3HVDA 4TVSa 4EUPH 5EEWA 4HKXB 5I6OA 3U4EA 3IFOA 3K72A 5TE6L 4CA4A 4ZAKD 7PCYA 1Z5LA 5IHUL 5AKSA 3LZQA 3FFDA 4NI3A 4M1GH 3MBED 4EXPX 5DRZB 4F7EA 3QFJB 1PW3A 1JPTH 1HHJA 4FKKA 4PV9A 3RGVB 5AB1A 1BREA 3W37A 3KLSA 4LARL 4AQ1C 1MUJA 1FVDA 3HHMA 2BLFA 2RFXA 2NTFB 5EEXA 4QF1A 1HS6A 2YPVH 3OJVC 4HJSA 4L1BA 1AZVA 1NM9A 2VUYA 2GI7A 3S3PA 4I2XA 3I2CH 4I5BB 1BBJB 3EFOA 2DI7A 4ONHA 5I8OL 5KSBB 1B6UA 2F53D 1FLRL 1YY8B 4KY2A 5HHQB 1G6RL 4YC2B 3FONA 3OKMA 3BT0A 3G04A 3NCJH 1S6NA 1YPZF 2NYYD 3ATAA 3MUY1 4WU7A 5EDXA 5CEXB 1H9DA 2C9RA 5HI3D 1RZGA 1HHKA 3MRGA 3DJRA 5D72L 4GRLA 1G84A 4H8HA 1KB5A 1IBBA 2IG2H 2WMPB 3GSNB 4Y2OA 4HWUA 1GHFL 3CK0L 1JZ4A 1GL4B 4JY5H 4AEFA 5D1XC 3TWCL 1I8MA 4MMZA 1PCXA 5C92A 1UCBL 4FCHA 4ILDA 4QKXB 2ZF9A 1O7DC 4GXVH 5F7NC 3VXMD 3SPVA 3SGKA 1HCVA 5LBSH 3KVDD 2R4RL 1BYNA 1EWHA 1JV5A 1KZYA 1MFAH 3CFNA 1I9EA 5IHHA 1J0KA 4EQ2A 2EDHA 5B39B 3MA7B 3MBXH 3QR2A 4DSYA 5IESL 5IR1A 1ZHLA 3OMZA 4DW2H 1BLNA 3OG4B 1BDYA 4TSAL 2KMWA 3TOPA 1JPEA 1JZGA 1S7WB 1CURA 3ARED 3SYCA 2ESVA 3LHPH 1J05A 5I1LA 5ETUB 4JFTA 1GGIL 4W4OC 2D4DA 3D4GA 4MAZA 5DJDB 4Y5YB 4NQVA 4KZDL 1U8OA 4YOKA 2Q2EB 5B1CA 3ILQD 2F53E 4B9FA 4JX0A 2KI6A 2FH8A 2EDTA 4HJTA 1MW0A 1BLIA 1JV2B 2B0SH 4FJZA 4HUNB 2BSDA 3RP1A 4EXKA 4Z7UF 5JNYA 1RIUL 4PJFE 1U2YA 1PZAA 4MRCA 5DMIL 4UOW1 5E5MB 1KCSL 2WLNA 2BVQA 1UENA 5FB8B 1UM4L 3BKYL 5AW1B 1NDTA 3WS6A 4FNRA 3MGTB 4IJ3C 4JDVA 1CFBA 5ID1B 1AANA 3PYCA 4ONGH 3E1ZA 3I6LD 3HAEB 1QBML 3DBSA 3VXME 3HG1E 1BZ7B 4WIQA 2W60A 3QIBB 5D9SB 1D7FA 1PZBA 3OM3B 1S9VA 6FABL 4KDVA 2D3LA 3ZKND 3MCKB 4U1LA 4X9FA 1V5JA 4J1UB 3OMIB 2YR3A 1HSAA 3P30L 1VSCA 2MPAH 3OZKA 3ATFA 5F7HA 3LMJL 3V5HA 4G8IB 1DVFC 3U7AA 2CPUA 5JYMA 1OAXH 2APTA 1J9SA 3TV3L 1UVQB 5D4JA 1NCIA 2HX7A 3EYOA 3GM8A 2RACA 4M61A 1SOSA 2UY7A 3OAZH 1Q1JL 4GQQA 1XAUA 3TNNB 1DVXA 2KZBA 2HWZL 3FC8A 2H0JA 5I5RA 1TJGH 2MTAA 4BUQA 4IMLA 3B7UX 2QQKH 4Y4KC 2J1WA 2C5DC 4NZDA 5FDYA 3K46A 2A77L 2A9DA 3LDBB 2CZNA 1T1YB 3WNLA 4DGYL 4N9GA 1KCUH 3WAJA 1D6VL 3FCUB 4A38A 1LP9B 2CO7B 3OB0H 1KACB 1YMHB 3MV7D 1K4CB 4HEPA 1NTDA 2YAFA 2VDMH 5BV7L 2CK0L 4O2FA 2E6QA 2PW2A 1SXCA 3AXLA 3DX2A 3EDEA 1I9IL 1S78D 2XN0A 5D7IB 2XV6B 3I6LE 3NN8B 4O4YL 3BGAA 1MFUA 1UZ6F 5DD3L 1X7QB 5FHAL 1WCBB 3ENEA 5JW4M 3RTLA 3US9A 4P57B 4MAYB 3OJDB 5E51A 1T5WB 1ZLWK 2HKAA 3D7PA 4JHAH 1E5UI 2PCYA 3EO0B 2Y6TE 5F88B 3OL2A 4YHKL 4XP9H 1CL7L 3PJSA 7PAZA 2XZQH 4J3OC 4P3CL 1F90H 2OL3L 2W59A 4FXLA 2BWQA 3NSXA 3H6JA 5I19H 2GITA 5T1DH 1L7TL 5FK9B 1JPFB 3I3DA 4YXLL 1HWWA 5EU6D 5C8JA 2YLKA 1GY2A 5ICUA 4HPOH 2ALAA 3DSFH 3TM6A 5T5NF 2BVUA 4NHCH 4G9FA 3B9KC 5GGTA 4IIQA 2XV0A 5F3BA 4MNHA 2BWIA 3S4SB 1M9SA 2BVTA 5B39G 1XVSA 2BP8B 3RILA 5C0EB 1JZ6A 3ZTCC 5LCVA 1GZHA 2F5BH 3J8F7 3QZBA 3L5HA 3C09C 4OZGF 3NZSA 2ERJB 4R4NC 2EDFA 5E6IB 2GSGB 2V3DA 1GTFA 4KAQL 1HEZA 1FIGL 3BUQA 5L9DL 4XX1E 1D5ZA 3WIIH 3UXFA 1TFPA 3M17B 5HDBE 1G5AA 5HDQL 4G7QB 1JGUL 1EXHA 3T0DA 1CZ8L 3MV7E 1BYOA 2AVFA 1DZ0A 1EPFA 3ZL1A 4AQZA 4GKZB 5CCKL 3K7UA 3CHXA 1PG7W 2HLFC 4QCIA 5H4YA 4F91B 3QUMA 3SYOA 5SWZA 1I7RA 1KXQE 2EC9T 1E4WH 3UZEA 1AZNA 2NLJA 2RBLA 3FO2B 3VI4F 4AV5A 4PJIB 2BSSA 1BAWA 5DEJA 4K9EH 1NPJA 1U95B 1OWRM 3P4MB 4XHQA 1WCQA 3LSOB 4OR1A 5DZJA 1CE6B 1XHHA 5K1VA 1S5HB 3OB8A 4S1QL 5FYJD 1WTGT 3TVMB 4KJPD 4X83A 3FQNA 1KGWA 2OX5B 3EDKA 4IGBA 3RWHB 2R59A 4RGND 1RQ5A 2DBLL 1TJHL 4J3XA 3O3DA 3BSGA 3SO3B 1IC4L 2AABH 4J23A 5EU6E 43CAA 4ZAKC 1K5NB 2FJFA 2QPUA 2FX9H 3FB7A 4UOW0 1OGSA 3ME0B 1KBBA 4WEBL 3VFRB 4HFUH 1X4XA 4LVHB 3MBEC 4NUQA 5T3ZD 1NICA 4HOMA 1IAKA 1O7SA 4KY1L 1LVEA 3KLAA 1WAAA 4HS8L 4BRJA 1KYDA 4G6JH 1H8SA 3CHSA 3BVTA 4OAWA 2YD3A 3FFCB 1QPKA 4Z7NE 1N4XL 4XP1H 4H20H 4N2KA 5F7FA 1CFNB 4PJ8A 4KKLC 1JPGB 3EJYC 3Q2LA 1X7TA 5CEZH 3QPQD 2X2HA 1S9XA 4BHUA 1ZLDA 2IAMB 3I85A 5HJ3B 2IADA 2YMXH 4RCAA 3ZE0B 1Y1UA 4OKVA 3SDXB 4HMDA 4L29A 5CJOH 5HYQB 1S4IA 1UH2A 3F7VB 5HI3C 1KFAL 5DRXA 5BRZA 5ISZE 1P6WA 2AANA 4LVNC 5A1AA 1J1OL 1XGYL 1KJ2B 3BUDA 1TLKA 1KYFA 1A7OH 3E3QE 4NM4L 1YMMB 4PJBB 1S2EA 3ARFB 1MRDL 3DV4B 2LTQB 4KU1A 4JK0D 1RIVL 4LFHD 3QZMA 2WZPD 2GY7B 3HNVH 3SCMA 1MCDA 4WQOA 1QBAA 3POCA 4R7DB 4LSQH 4RGNE 5KBPA 1NLBH 4JG0L 4XPHL 4WEMB 3MCLL 2O5ZH 4LLUA 2PABA 4IKKA 1KIRB 2JJTC 1I3GL 3LNIA 3HE7B 2GI0A 3SBRA 4ZMYA 1MDTA 5AB2A 4XCEB 3PHQB 3AFLA 5BZWB 3ARPA 4HWBL 3OR7B 3T4YA 3TBWA 5AKVA 3WD5L 4ADJA 5L6YL 4JFYA 1UJTA 2WCSA 4JCLA 5F2FA 3UAEA 3WG7B 3GO1H 1BXUA 4ACTA 2X1WL 5T3ZE 3OMNB 4CNIA 5GSVB 1U4FA 4XMVA 4Z7QE 4K2UH 4RH4A 3VFMB 4XRCB 3TBCA 4BFGA 1YUKB 1A25A 4PBDA 1D5XA 1G7QA 1Q0XH 3COOA 1HE7A 2VERN 5CLTA 3QORB 5E2TH 1G9NC 4CJ1A 2OI9C 3EFFA 4JLRA 3S4SG 3GZPA 2OJ1A 5DQJB 1KYAA 5BW7C 2NY3D 4LRNL 1I3RA 3AS0A 1Z5YD 3ILPB 3FJTA 4HIJA 4ANVA 2N01B 4P3WA 2FD6H 3OKLB 1H0DA 2JCCE 1NGQH 3RL2A 3I9GH 1JGDA 1ZS2A 1AIFA 3ZQWA 3E9UA 4PJ9C 4XNUH 5FYJU 5I1CH 3BQUB 5FKAA 2O6FA 3L1OL 3QJRB 5EV7A 3REWA 1RHFA 1V7ML 2HG5B 3QEGH 4JQIA 3SO5A 4IHOA 4NDMB 2QQLL 2DM2A 4XMLH 5EU3B 1AGBB 1MCFA 3QNXB 1KNOB 1UWYA 3ARUA 4WW1A 2E9WA 1XGTA 1A4JB 1K6QL 2EDXA 4KQ4L 2ZCLH 1UXWA 2EDEA 2IEPA 3FFDB 1DQJB 4TLTA 2DEYX 4JKNA 5I15H 2P8PA 3W81A 3LQAC 1IFRA 4DIXA 4PV9B 1XXFC 2VDRB 1EBPA 2Q7YA 3H53A 1LK3H 1L0QA 3EJPA 4L3FA 4F1SA 3K91A 1DSFL 3GUTB 2FK9A 3TPUA 5EUOE 4ZFZA 1DQTA 4I2XB 1KGYE 3Q9QA 4PV1C 3PL6D 2MCAA 3WHXA 2A3TA 3RIKA 1P9MA 1EGJL 4GSRA 3GIZH 5BXFA 3B3IA 5GRXG 5CLYA 3QQ3A 3KGUA 4XNAA 2PPAA 4A2GA 5DD0L 5I76B 4YDIL 4Z7IA 4JPSA 1WHOA 5A7BA 1S7RA 4GRLB 2IALB 4R4FH 4CAGA 4LL4A 1MCCA 2JJWA 1KB5B 3MLUH 2A9NL 1KWGA 1DR9A 4HKBA 1BAFL 2MQCA 3QI9B 4NC1C 1XGUA 2NXYB 4GKLA 3ZE2B 4KVCH 2LLLA 1QFHA 4F24A 2EE9A 5I1IL 1NIBA 3LZFH 4K3JH 5IFJA 1IEAB 2C9PA 1CFQB 4PYHA 1S78C 3Q8AA 3SPVB 5DS8B 4NNXB 3S7GA 3UABA 4Y5XC 4PSPA 1CU4L 1JV5B 1MCHA 1FL3A 1TTCA 3I9AA 3JVGA 3QFDA 3U7YH 4OFKA 3S3BB 1BM7A 1W16A 4B9JA 3RVWC 1BZ8A 1RPQA 3KH3A 4XBGA 4M8UA 3VXNA 4WI8A 4AVKA 2H6OA 3RTQB 4JFXA 2XZCH 4N4YB 5F9WC 2WBJC 3K6DA 2ADFH 3V7AG 3OPZL 1P7KA 5D7JA 1UXLA 5GPRA 4HJ0C 4APXA 1J05B 4HSAC 2GPZA 3AITA 2BC4B 3L9EA 4I9WD 3F65A 2DBJA 4NQVB 1IT9H 3RDTA 4BSWB 3BC9A 1RKRA 3KPSB 4PPTA 3MUGB 4L4TA 2DQEH 3SJVA 2BIPA 2LFEA 5I6XB 1FL5A 2WV3A 4B0MM 4PS7A 4IRSA 4FJYA 2BIIA 1G6RB 2WQ8A 1DQLH 3GMQB 4LHUB 2BCMA 4QRTB 3FH5A 5DUML 1B4JL 5EO1A 1AIZA 1KEML 1O5DT 4RFEA 3SDCA 1KWKA 2MOGA 2D4FA 1IGMH 3DMMA 4M9PA 3EJRA 4LBAA 3WJJC 2HVJB 2W95A 4N8PA 4C83B 1FE8L 1GH7A 1XF4B 2CJ3A 1DL7H 5LGHL 1IILE 4O02L 4JY4B 1GA2A 4WI5A 3VD3A 2CLVB 2WB1A 3KXFA 3MJ8B 4JN2A 3WNJA 1ZT4A 5J11C 4ZT1A 1Q1PA 3A3YB 3KPQB 1CTNA 4U3HA 5E8PB 1RZKL 1JSYA 1IC0A 1HQRA 2BNQB 2UZYB 3DIFA 1OALA 2DDQH 3CQPA 3LPGA 4XNYH 2E7MA 5IW6A 1ASQA 3EYOB 4HDIA 1FC2D 2BFVL 4I9WE 3ES6