4IBZA

Human p53 core domain with hot spot mutation r273c and second-site suppressor mutation t284r
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
193
structure length
193
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVCVCACPGRDRRREEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of p53 inactivation by DNA-contact mutations and its rescue by suppressor mutations via alternative protein-DNA interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Cellular tumor antigen p53
total genus 44
structure length 193
sequence length 193
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ibzA00
2AHIA 4LO9A 4IBYA 5KBDA 2BIOA 2BIPA 4QO1B 4IBWA 1CMOA 2J6WA 4IBTA 4AGPA 4L0YA 3WTTA 3KZ8A 3ZMEA 2IOIA 2PCXA 2J1WA 4LOEA 4L18A 5ABAA 1T4WA 1LJMA 5LAPA 3US0A 4AGMA 1GZHA 1KZYA 5G4MA 4A63A 1CO1A 5A7BA 2J20A 3KMDA 2IOOA 2P52A 4XR8C 3D07A 4LOFA 3D0AA 1TSRA 1EAOA 2GEQA 3EXJA 1HU8A 5AOMA 2RMNA 3D05A 2OCJA 3VD1A 3VD0A 4IBZA 2H1LM 3QYMA 4AGOA 5LGYA 4AGNA 3Q05A 2BIMA 2J21A 2IOMA 3D06A 4AGLA 1H9DA 2MEJB 3D08A 4MZRA 2WGXA 3WTWA 2XWCA 1EAQA 1YCSA 4AGQA 1HJBC 2AC0A 3QYNA 2J1YA 2J1ZA 4IBQA 5G4OA 2X0VA 2X0UA 5G4NA 3US1A 2X0WA 3D09A 1EANA 3WU1A 5AOIA 3WTYA 5AB9A 1TUPA 5AOLA 1GZHC 5BUAA 4IBUA 3WTSA 3Q01A 5AOKA 4HJEA 5AOJA 4MZIA 4IJTA 3WTXA 4IBVA 2YBGA 3WTVA 3IGLA 3TS8A 1HJCA 2XWRA 3WTUA 1IO4C 4GUOA 2J1XA 3IGKA 4KVPA 4L0ZA 5ECGA 2BIQA 2BINA 1UOLA 4G83A 2ATAA 3EXLA 2FEJA 4GUQA 2VUKA 3VD2A 2ADYA 1E50A 4G82A 4IBSA 3Q06A
chains in the Genus database with same CATH superfamily
4LLVB 4KJPD 3GS4A 1ODAA 3HAEA 4K15A 3GNMH 1PFCA 1N8ZA 2G60L 5EPMA 2Z31D 4QHMA 2YEQA 5C0GA 2A5UA 5LAXA 4ZS7L 4PGEA 4YQXH 3M45A 3D39A 5DRWA 2K7PA 4KFZC 3H54A 4ZX4A 2XTJD 1QBMH 3TM6A 3T0ED 4LASH 4HIPA 4JUTA 1ZEAH 5J13C 3B83A 1DLFL 1WFNA 2FLMA 3JZYA 2CZNA 5JDSB 2Z4QA 3TASA 4JCWA 3V2AR 2H32B 4L4TE 4OQTH 5E6YA 4NXSA 1F45A 3RWHA 1MREL 1NIBA 2VXVL 1EEYA 5FHAH 1Y18A 1HSBB 4I88A 1W8OA 2IBGA 4K5PA 4YZWA 4JPWL 5KYXB 1ZHBB 4DCQB 3NFNA 3X11A 1H19A 1XMEB 4LLQA 5IVXA 1KCLA 4HBQA 3BP6B 2E27H 2RJMA 1MY5A 2VLME 5HHXH 2N4IA 1OK0A 2CJSA 2VDRB 1MG2C 5FA3A 5T1LA 3U7YH 1CJYA 2YAOA 2AC0A 1Z5LA 4U2ZA 3G7TA 3BUBA 4W9FC 3M6DA 3DSNA 1T6VN 4X6CE 2H6UA 1JWMA 4X5XB 2ODHA 5EUOF 1ZLEA 1G87A 5E51A 1UJ3A 3AXLB 5AW9B 5FUZL 5DJ6A 4JANA 2WNXA 4NQUA 5DD1H 3VTAA 1KT2B 2G2RA 5HHOE 5BJTB 1K5WA 1UZ6E 1E7UA 2O6DA 2XTLA 3FFCE 5HYSB 1SLXA 1DCEA 1RJLA 4O9HL 5F6HJ 1PX3A 3P4MB 3V4VA 4MMZC 1HHKB 3QDGD 2JKJA 3KPOA 3CFMA 2CUAA 1PBYA 3RTQD 2XN9E 3EFFA 3DX9A 4HFWA 3VUAA 4G43B 1Q0YH 3TO2B 3T0WA 4JDVA 4J6RH 2V7NA 5CLXA 1MFDH 1KACB 4JQXA 4JFOB 3VFNB 4BSVB 4L3AA 1U8MB 4P5KA 1SFHA 2NY5L 3FSOA 4YGAB 2DZEA 4Q2ZB 4RSYA 3OR7A 4CW1A 2DLIA 3T4YB 5AL0A 4DUWA 3O3UN 5F0MB 4IRZL 4PRAA 2SEBA 1U9KA 4XP9H 3H9HA 4I87A 4UQBA 3RBSA 5F9OL 1LYQA 5CR8A 5ANME 1I8IB 4XNUL 3V5KA 4KO9A 3UTTD 3IJ8A 4R7DA 4J6RL 4WWOA 3FT9A 2A74A 1QHPA 1M7DB 3OL2A 3RGVA 1CYXA 4NQCD 4WI4A 2WZPD 1TVHB 3QXUA 4BFEA 2DWYA 4ZUSA 1XDTT 2DQTH 3S3SA 4X4MA 1FV1A 1IAOB 1PQZB 4JPVL 2IH9A 3AS2A 3WD5L 3DETD 3PWNA 5I6XC 4NM4L 3QUZD 4ETQA 4OBSA 1A47A 1JPSL 2DIBA 3GXDA 4OZGA 5D1ZC 1K85A 4AGOA 4UCFA 3KEDA 3EJZC 1NGQH 2PP9A 1PAZA 3GRWL 1FH2A 4N28A 5FLVA 3P11L 5L8KB 5EH1A 1TZHA 3ZXAC 4QKTA 2MKWA 2PO6C 1MNUL 4WIQA 1S9VB 3QJQB 5TDOB 1VJSA 1FORH 1VPOH 3PL6D 4KC3B 2H47C 5FDYA 4TUUA 2O5XL 1DVZA 1S5IH 2N01B 4Z18A 5JHDB 4V11A 3U46B 3DRTA 3IXTA 1H5BC 2ALWA 3VWKD 4I89A 4P49A 1P84J 1UZGA 3AAZB 1RU9L 3B56A 3K8KA 5L2KE 1X9RA 2R69L 3KYOA 1UG9A 4RH4A 3MOQA 5JMRA 15C8H 3ABGA 1U8IA 1K4DA 4RGOL 1CU4L 1HILB 5F9JB 1F11B 1CE1L 1NCCH 2X4QB 4X9FA 1MAML 1SYVB 2B59A 3HMWL 4P3DB 4RFEA 4N1CA 5C0IA 2NX5A 3OKOB 4QYAA 1ZA6B 5AZUA 4KHXH 2BXZA 2YRLA 3W2DH 1AHKA 4AMKH 5JW3H 2X41A 5KSVB 3QSKB 1ZWIB 2X9WA 1Q0XH 5IUSA 2VL4A 1KTKE 1AR1C 1A1NB 5I74B 2Q10A 3IE9A 1K5NA 35C8H 3O2WL 3RFZA 2BNQA 3GTNA 3L13A 5DFTA 1AD9B 3S35H 4KO5A 1RIHL 1D5IH 2DLEA 4HS8L 1XAUA 3JV0A 1R17A 1TJMA 1O6VA 3FMGH 4TRPL 4UAOC 1HZKA 3E8VA 2YPLE 1LO2H 1JUFB 1KV3A 2QFRA 3FW6A 3OM3B 5EIIG 4ALAH 5I6LA 2N3JA 2E6JA 1FG2A 1GGTA 2OFQA 4JM0A 3AMKA 4XE0A 3UGXA 5I28A 1MCIA 1FFNA 4QO1B 4M8QA 1NLDH 2XUWA 4KRPD 5I1GL 5CJOH 4KRNA 5TH2B 4UIKL 4H88L 4F7MA 1XF1A 4CBPA 4MNQE 2N0KA 3P54A 5CUSH 2AI0H 3WNKA 5E95B 1UB5B 3QFJB 1M71A 2EIBA 4WNQA 5HGAB 5T33L 3OR6B 2EXWD 1KB5A 4H8PA 2GJ6D 2VRAA 4Y8DC 4C4KT 3X11B 4OH2A 3T6WA 2XQYG 3FO0H 2XTJC 1A14H 5CU5A 3RPKA 3BUIA 4HFUH 4H0IA 2NTFB 4X6BA 3PPSA 1OKEA 1WGOA 1P9MA 2W0LA 3VI4F 2WINA 4PLKC 2V2WB 2OYMA 2W60B 2W88A 3QNFA 1I1AD 1ZT4B 2X4UA 5D55A 4AZUA 2R9HD 4K9EL 4DW2H 4MJ2A 5GZNA 4H25A 4KZ0A 2H3XC 3E9UA 3MHZA 3WS3B 1JZ8A 4GEJA 3VXPA 1Q72L 3D12B 3M7FB 2LU7A 1QHQA 4XGZB 2ZOLA 1RZJL 5I15L 2XNAA 4ZBJA 3E6HB 1EQWA 2XSKA 5AYUL 5A40E 4JPKL 5KSAD 4OD2B 2B39A 4YBLB 1AAJA 1EHLH 5DZAA 3VFOA 1P4LA 5CBAA 4TPRL 4P4RA 1RSFA 2DQUH 5FB8B 1PD0A 3QZOA 2EUVA 2ZCHL 4ZMOA 1IFHL 1IQWH 4RETB 4Y1AB 1A6TA 1UENA 3HE6A 5DURD 2XTSA 2WLMA 4OIBA 1CICC 2IGFL 2A7BA 4RRPA 1ND0A 3WIIL 3QI9A 4F7TB 1PZ5A 3RNQA 4PSRA 3G6DH 4BFGA 1YPZB 3O2VH 4J28A 4M8VA 5AYUH 1XVSA 3QC5X 2Z4QB 1E6JL 1PJ9A 5E2TL 2KKQA 2EXYD 4HCGA 3ZQXA 1MW0A 3NRFA 5IEKA 4KI1A 3BKYL 3RTQC 2P5EA 5GJSL 3K6DA 2DJ4A 2R51A 3ZL1A 2XWRA 1OF2A 2X4RA 4OFYA 3D48R 4WI9A 4MGXA 3PDGA 2AXGA 2XG4B 4CU8A 1CF1A 1PNCA 1U4EA 3GSRB 4YNYB 5EEYA 4OI7A 1ED3A 4FG4A 2FB4L 4OI8A 4QR7A 2JF1A 5CNHA 4PGJA 5JQHC 5I8CB 3CLFH 3O45A 4M5TA 3OC5A 3S35X 2NY4D 4G80A 1USQA 4HU2A 4WU7A 5I1EH 1CBVL 4O5LL 4AX3A 1WYJA 3PP3H 1WCQA 3NSXA 5LDUA 1UT1A 1YNKH 5I5IA 3ARGC 2APSA 2HFGL 3ENEA 4MMXC 5F7LB 3L4YA 5CP3H 2X6UA 3O8XD 1BD2B 3Q5TA 1SM3H 2GBAA 1T3FB 3SPVB 2H32H 1SQMA 4G70B 3MR9B 1U93A 3O6LH 2FHBA 3IVKA 1BYPA 1F1DA 5C08B 4U31A 4GAYA 3SDYH 3II2A 1N5AB 2B9AA 3QUMB 1IVLA 3BT2L 2OZ4A 2AGJH 3HZYB 2EABA 4DQOL 2JQMA 2Y7QB 3V9CA 5E5UB 4F1SA 5J6GB 3NYKA 3LXCA 1E4WH 1L9SA 5GGSY 1N2RA 1WWAX 2RB8A 1DFBH 1N6QL 2YOCA 4JPQA 2UX6A 4NQDB 1QLRB 1FCGA 4Z1PA 3ZT5A 2X2UA 3DX0A 1QP1A 5FYJH 3A22A 4O02L 1RZ8A 4MB4A 1FHGA 1ZV9A 3O4LD 3HHRB 5T1MB 5E8NA 5KS9F 2VC2B 3MZGB 4PRID 3FYEB 4LOVA 4PJ5D 5LXGL 3T2OA 2XWJB 1FZKB 4LHUB 4OFVA 3LQAH 4BSJA 2ZWKA 2JH2A 5DT1H 3L17A 4L9LA 2Z7WA 2EH7H 5DMKA 4Y89A 4V2CB 3FBQA 1AZUA 3ARDA 1NH6A 2Z31C 4MD5A 3W82A 1PFOA 5KBPA 5JHLH 2H7WA 5HYEA 3ROLA 1A64A 2YUZA 4NQDE 4UOJA 4YPGB 2Z93A 4HUCA 1M7DA 4NNXB 5D7JB 3RGVB 3DMMD 4OB5H 2X44D 4D7BA 4RFEB 3MFFA 4UMSA 4DAGL 1S7SA 3ZYIA 2Y36L 5IB4A 5KS9A 1FAIL 2OMXA 3FT4A 3OKKA 3AWEA 3BWUC 3F2LA 1YNTF 1T83C 2WCGA 3LQAL 4N9GA 4QAWA 5CILH 4LLDB 4W9ZA 3Q3GA 1AZBA 3FUJA 3H42L 2FRGP 1B90A 1TEGA 1UB6B 1MFEH 1QACA 2WO4A 5E2VH 3L48A 2XA8L 3WHE1 2HFEA 4U6HB 3SCMB 4EKXA 5AZEL 3RWIB 2O72A 1LILA 3GMRA 2LAGB 2QVKA 3IRZA 4DAGH 1GKOA 2BINA 2FWOA 5AW6B 4LHUD 4DP2X 3MGAA 4GKZB 3MGTB 1PKQB 5F8QC 1OWWA 5MEQA 3RVXD 2JIXB 4WO4C 1XIWB 1KB9J 3VW3H 2QLYA 3LB6C 4DPAX 2LLLA 1NC2A 5I75B 3QR2A 1F3RB 4GBXB 5EF0A 5I18H 2OYKA 1RZIA 1CLYL 4DUXA 3AB0C 3BKJH 1E2ZA 3K6FA 3SKUD 1FO0A 4OZIA 1JSYA 3ESVF 3FUFA 4U1HB 4LCUA 4OIFA 4C4BA 5GZOA 1ACZA 3VFOB 2X4QA 2D3JA 2RCSH 3QEUB 1ZTXE 4JO4H 3V4PL 4FFYH 1JI1A 2JI2A 5C07B 1T4WA 3DBXA 2BDNL 1GPOL 4PJ9B 4U0QB 1QQDA 3KM2A 1RUMH 2WIMA 3VXME 1WWCA 5DMGC 5G55A 1WZLA 1HESA 1G1OA 5JZ7C 2GJZA 2NY6C 3AUVA 5DLLA 4L1LA 5B4MD 4W9HC 4AEIL 4WLCA 3VCLB 3VVVA 2Y07H 2HRPL 3BWZA 5DZ9A 5ICUA 3SDAD 2YQBA 3H4FA 3SE3A 3I9PA 2J5WA 2MFNA 4N4YB 2YA0A 3QDGE 4ZUTB 2CHZA 3HB3C 1X5YA 4ZQTA 2X1OA 3HUJB 4EPSA 5JIIA 3KDPB 5LJYH 5J1SC 1NFDE 2IQ9L 1X4XA 1F90H 2GY5A 4OV5A 1YN6A 1PMYA 1FIGH 1L6PA 3D3VB 3MJ7A 2QMJA 1BBDL 1K3ZA 1DEDA 2HMIC 2VITB 1Q94B 3S48A 2E47A 3DV6A 1G4MA 3FU7A 1N5YH 4NN5C 4U1GC 3T09A 2E27L 5CU9A 1UXSA 3RVUD 3QXWA 1CWVA 5DQ9B 3N1GC 1G5AA 1BD2A 1YEGL 4GG6A 1HZHH 3NZ8B 2OW7A 2IAMB 3WNOA 1ZVSB 3HUJE 3QCVL 1WTLA 4XNYL 5IW1A 3T0EA 1PEZA 2EIJB 5C0CA 3KBHE 3QWRD 5E0QA 4K71B 2PPFA 3MODH 1JTTA 2C3VB 4Z7VE 3LX9A 3UYPB 2J8UF 1BA9A 5JW4M 3ETSA 3MRIA 2NYZA 2IBZX 4MVBD 3ESUF 1L3NA 1NMCC 1MFCL 4JRYB 4M1CD 3ZL2A 3TO4D 3P30L 4YEFA 1N7ML 2BOBA 3OKDA 1EFXA 2PW2A 4Z3FA 3ASWA 5LGJB 3QUYA 1WHPA 5F89A 1MHPH 5EC1A 2MHAA 3ARFA 2WXLA 2YK1H 2DLFL 3QUYD 4R96A 4IRJA 3B4NA 2F19H 3V52L 1KYAA 3VXSE 3QB7C 3FAXA 4HJ1A 4R4NC 2BNRB 3QQ4B 4JFPA 3RGHA 1RCYA 2E7HA 1RY7B 2DQJL 4OSUH 3SE6A 2EIMB 1RV6X 4XZUA 2NUTB 2EDWA 1MJJA 3FB7B 2W8CA 2VSDA 1A6TB 1MWAA 2DPKA 1UM5H 2XZCL 5EWIH 5C08A 5T1KA 4FQHB 3ARBD 4OLWH 1J9QA 3NFSL 1U2YA 2IH3A 4NQXB 3TWCL 3V0FA 3MV9A 4P23B 2GJ6B 4RBPK 4PJCB 3RU8H 1EK3A 1KTDB 5B3NA 1G7HB 3ATEA 1C16A 1HXMA 1LL1A 2DLFH 4ORZC 5E94A 3RWGA 4FAAB 2OL3L 4ZFOL 5A16A 1I3GH 3P3YA 1XZ0A 4XBGA 5IOPA 1IGTB 2VXSL 5IB5B 1JHLL 2R0ZH 4F8NA 3CX5K 3MRNA 3VYNA 1BM7A 3Q1SL 4TL4A 5B39B 5C0FA 2PETA 2R15A 1CGYA 4KRPB 2FJFB 1NCBL 1PZCA 3D4YA 2FCBA 4R2GB 1AC0A 3MPCA 5LGYA 2QADB 5E6ID 3GO1H 4L8BB 2EYRB 5AALA 3VVWA 2PCPA 1IAII 3D2UA 4QRUA 4GQPH 4HEMA 4KWUA 4ZQKB 5IMLA 2QQKL 4O02A 3J8F7 4YDZA 3T4YA 3U4EB 1ZT1A 4FF9A 5E1AA 4JFXB 4PP2A 5J3HC 1AZRA 5J6SA 2XYBA 4WDIB 2HTKD 3MJ9H 4LKCB 2WVVA 4TVUA 3TO4A 3FJTA 1RZIB 3BVNB 2YPVH 3ULUL 5J3HD 4YHOH 3APCA 1IU1A 3UCQA 5DMYA 4XRCA 5B1AB 1ANUA 2DMKA 1MPAL 2NT1A 4QO1A 3WAJA 3EBIA 2K9UA 3HW7A 2AQSA 1Q9OA 4LLDA 3QDMB 4LVHC 1KN4L 4KOCA 3RX7A 1KELH 5JORB 1QUNA 4XWGH 2I27N 1T5XB 3T0XA 1FZOA 4LPWA 5E6ZA 3ZTJH 3P2TA 3VWKB 2YLKA 4AC4A 4PRPD 3CFBA 1UD6A 1JI2A 2KYIA 1EX0A 1UJ3C 5B3SB 4HU8A 4K71C 4IU3B 1RZKC 1HH9A 3VXOB 4CN6A 4FEIA 3BVTA 3IPEA 4LPUA 3AG3B 4X7TB 1XIWA 3GBEA 4N5EC 1NMAH 4NHCL 1D5ZB 3NJVA 4Z95H 2VUKA 1OE3A 2KDGA 3GSOA 3HG1B 1G9ML 3HI1B 2W95A 4ONGH 3T8VA 1AXTH 2HUEA 3S37L 4BGDA 2V3EA 5HYIA 4Z8FL 4FQLH 3QRFM 1OAXH 5EULV 5E9AA 1CLZL 5EU7C 4I9WE 1AGDA 1HE8A 2WLYA 4PW9A 4IS6A 2XKSA 3B9KC 1OANA 5EOCL 4AY0A 1BOYA 2C9QA 2B15A 5F9DC 3B8SA 4HWNA 4JRXA 4BDVA 3WTTA 3DYMA 1DTUA 2XKNA 4HQQL 3T9WA 5IESH 1XAKA 1MW2A 4Y4FC 4M7LH 5IBUB 4HEPG 5L7XH 1OQOA 3DJZA 1SY6H 5BXFA 5L88L 1P4IL 3BZEA 1Q0XL 2QT6A 2J57A 1NGWA 3O4OC 4RIRB 3WYRA 4ZMVA 3QI9D 1LK3L 1QASA 1P5UB 2AJYH 3MV9D 5D70L 4YHML 4UNTA 4WWKA 5DUML 1HHJA 2ICWI 2AEPH 1BPVA 3HC4L 4QRTB 4I4WA 5DK0A 4JN1H 4I13B 1S8DA 5DGRA 1QVOB 1UWGL 3A4DA 3WFEL 2AXFB 3K6IA 1AYRA 1U21A 1TQSA 4GP4B 4BUHA 4C83B 1YQVL 4BZ1A 2EE3A 2PO6B 3MRIB 3AREC 5FGSA 2XT1B 4ABWA 4S2SA 3JYCA 3TT3L 2CGRL 1BOGB 2FX7H 2WTPA 4GBXA 3CN4A 3RIFF 1Z5HA 2FJGB 5F7DA 5FM5M 2DBLL 5K1NA 4R2GC 4G9DA 4OJEH 4R4FH 5T1DH 3IWUA 3MRQA 3QXDB 4MCNA 1TLKA 4K8RH 4RGMC 2E3VA 5FOBA 1BG1A 4FNPA 5J1AA 3JV6B 3ZDXF 1KJ3H 2UXTA 1T0MA 3QDGB 3UCRA 4YX2L 4JRXE 4ZW3A 1GHFH 1CGWA 5CZXC 4ZD3H 4TVSa 4MBOA 1QBBA 2X6CA 5IW6A 4Q9RL 1M1XB 2FJHA 1TO5A 1WAPA 5MI0B 4BQ8A 1XF4A 5FGCB 1T7YA 3OR6A 3ZYZA 1WZKA 5J11C 4HUWA 1YZZA 1VRSA 2ZUVA 4IRZH 3LEXB 2OSLA 4UT6H 2ZCHH 3QI9B 2FECL 4MHHI 5F7KC 3BWAB 4GO6B 1M57B 1C8QA 4F37F 1Q38A 2FX9L 2QGCA 4DZBB 3OHXB 1BX2B 2QQNH 3ZR5A 1U8LA 3OKMB 3OC8A 1RJZA 3F01A 4P9HL 1DE4B 3KH4A 4MKMA 3MXWL 4OLUH 3BH8A 3IDNA 4WEUD 4Z77B 5JIMA 2K1MA 1U2HA 1U3ZA 3FH8A 4TNWF 1AFVL 4F8OA 1CXHA 2R23A 4L3CB 4N0YL 1FNHA 4Z5RA 2OR8A 3RG1C 1EHNA 5B7FA 3OMIB 5HYFA 4ZTOL 1FHNA 3E6HA 2C9UA 2W0FA 2RD0A 2WWMC 2H26A 5B7MA 3QORB 1NCUA 5T1JA 1JGIA 4AW7A 3O8XA 5DMIH 4JG9A 3RIAK 3KXFB 1PLGH 4DHLA 3TONA 1GJWA 3QZNA 4LZKA 2ZKWA 4QRPD 1CTMA 2CKBL 1B2WL 2IFFL 1LO0H 1UFUA 2DQCH 2NT0A 3QRGL 5CEXB 4GW1B 3RIKA 3NCCB 3OAUL 5ID0A 3W39A 2YD7A 1F4WH 3KLDA 5F1IA 2G30A 3F7RA 2UUDH 4U3CA 4G7VL 3UDWA 2HTLC 3RZCD 3PV6A 4IYKA 4S1QH 5SWSE 2D0FA 2I69A 4LOEA 1BLNA 5IJBC 2DM4A 5CCGE 2O5YH 3NJLA 4BZ1H 3UTZB 2ZKXA 1V10A 5TQ0H 4POYA 3WELA 2EE0A 1ACYL 2P45B 2VZSA 1OD7A 2V6HA 3IF1A 3OF6D 3QI9C 4HK3J 5B38A 4ZO8A 2Q9OA 4UQ2A 1KSRA 4M62L 5IROD 1AS8A 2NUPA 5HVFB 1LDPL 3LH2L 2ZCKL 5BQ7A 1QABA 4A2EA 1NWOA 3CNKA 5GS2D 5IJDC 2PXYC 4LIQL 3TEZA 1OGAD 2V8MA 1RULL 3V10A 5ITBH 4WTWA 3X17A 4EZJA 3KPMB 3RVTD 3EHBC 3IK2A 4ODXB 2VH5H 3HG1D 2BY0A 5I17A 1S7WA 5GRJH 2JNZA 1KF9B 4OQ1A 2XV0A 1ZANH 1GTFA 2ZWSA 5CEZE 1VGEH 2EH8H 4AVJA 2HKFL 1QRNA 4H26B 3ISWA 2WXNA 1WK0A 4NQEB 2ZP8A 2WO3B 1LDPH 4ZX5A 5KTEH 4MJ5A 3FAWA 1YEJH 3US1A 3FUIA 1YA5A 5IVXE 1T89A 1UT2A 3U7AA 5J5EA 1T6BX 5DGQA 2FX8H 2NY7L 4U1HA 2B77A 3RI5K 2Z93B 4OZHE 1A4KA 4PN6A 4WV1A 3RVUC 1KTCA 3MLPA 5GRWA 1QUNB 4Z7VA 4LMQI 4PD4K 4HJEA 2JI3A 1KNOB 3QNXB 5F97E 4JM2D 2DI7A 3BDYL 3I50H 4TSCL 3HCVB 4MDIB 2VXTL 3BVDB 5AW1B 3WIHH 1OB0A 1QTYT 1FSKB 3WEBA 2Y06H 4J1UA 5HHPA 2VABA 3U9UA 4HOZA 1J5DA 2Z3FA 3FOMA 5DC0A 25C8H 2WGNB 3JWDC 4FQ2H 1Z9PA 4QKXB 4NPJA 4G6FD 1JYXA 2QVIA 4RFNC 4TXVB 2GJJA 5F1OB 2JB5L 5K5YA 2AMGA 2XIIA 4F5CE 4WFGD 4XNZB 1FL6B 3MLTA 4K94H 4MKTA 3ZPDA 5E6IB 1NFDA 4WW1A 2QADD 3EOTH 5KJ4A 5E1HB 1E65A 1OCZB 4B3VA 2PKDA 4M1DL 3X3FH 1CZ8H 3BUYA 3QO1A 2VW6A 1N0LB 3LEVH 4ZNCD 2BVQB 1MHEB 1JGVL 1RZJH 1E7VA 5I15H 2NY5C 1E4XL 3CVHH 1JZ6A 5EZOH 4D9QE 2CCLA 2A73A 4L37A 1DBJH 4OFYD 3B5TA 4PRDB 4LSDA 5DK2B 5AZEH 4H1LB 1Q90A 1JWSA 1EUTA 1FZOB 1FL3B 4KJYA 2C8NA 2XWDA 4J7RA 2BOCB 2QJDA 4WTZA 4DUVA 3LY6A 2GIYA 2C9RA 5B7EA 4NN6C 3PREA 5D5ME 2QFPA 4XCYB 4W81A 1I7UA 4M6NH 1KXHA 2D0GA 5HYQA 2BRRL 1OB1B 3EYSH 3LAFA 4OZGF 3ECVA 4LLQB 1SMDA 4IM8A 1FGVL 2XZAL 1NGXB 4YSUA 5I0DA 3IJSB 2NY3B 3QIUD 3RUGB 3VM7A 4XPBH 1RZFL 5I9QB 3X1FA 5J06A 5D7LB 3PJNA 1UWEH 4HGKC 2V7NB 4WFFD 2CUHA 2LQRA 1AMXA 3CV5A 4PJHB 3KWWB 1K9TA 4JMNA 4H20H 4N2AA 1HH6A 3LCYA 4A37A 3C5ZD 4NWTH 1HK6A 3EG9B 3R4RA 3LXAA 1QW9A 4L1BA 1WIUA 3SKOA 4X5WB 3SO3B 4YHIA 3QEHB 3WE1A 2G2RB 3KPPB 4OCYL 3U82B 5F7UA 4P5MA 5GS0H 3E0GA 3L2MA 3UC0H 1D7FA 5D2LA 3X2QB 1WAAF 3UG3A 2VDNL 3QNZB 5IM7B 4HUUA 3WNMA 4NSKA 3ULUC 3UTSB 4M5SA 1S8DB 3HI5H 3REVA 2ZUQB 3G5XB 3X1GA 3B43A 4X50A 1QKZL 1CL7I 2ZX9A 1AJ7L 4DZ8B 3CFDB 3FQRB 3NA4A 5EOTA 4UV4H 4ODUA 2NNAB 1VHPA 1UXMA 4RMQA 4OVVA 4RAUA 8FABB 5JIQA 3CDCA 1ROCA 3FH7A 1IGYA 3KW7A 5TE7H 1NDGB 3BP5B 2AGJL 1L6ZA 3MA7A 2BIQA 3DURB 3W5NA 1ZT7A 4KDTA 1X44A 2GSGA 3Q8AA 2WLLB 4E9LA 1RPQA 4YSSA 3HLKA 3ERXA 3UEQA 3WEMA 3BZ5A 5F7NC 4U05A 4O2CA 5CR1A 4F92B 2DLGA 2GT9A 3P9LA 2Y5TB 4TUOA 4DN3H 2JIXD 1ZHLB 3NSCA 1TZHB 2ZIDA 4JO1H 3FCGA 1E3FA 4MA3B 4PB9H 4DKEH 2QDVA 1LGVA 2MKLC 5HHVH 2Q8BL 4HKBA 3L9RA 3SYPA 1GYVA 2CU9A 2ADIB 3LDBB 4ATWA 3S4SG 2ESVA 3MODL 3TNMA 4HKZA 4Y5VB 1IIKA 1ADQH 1KIUB 3CUPB 5ABDE 1P4BH 2VLRB 2V2XA 3RDJA 4YFLI 1BWWA 1EERB 2PR4L 2X2HA 5JXAH 1S9YA 4KUCD 2ENJA 2WCSA 4MWFA 5LNGA 4WHYH 5FHBL 4XXDB 1OVZA 5DTFB 2WZ6A 3CU7A 2P52A 1UVQA 2B4CH 3D07A 2OQJA 1QATA 2BHYA 4HOXA 3BH8B 4WUKH 4A68A 4X0KB 3S5LB 2GEQA 1P1ZB 4UNUA 2QELA 4KDVA 4NENA 1IEBA 3T2NL 5IWLC 2OJEB 3FYIB 4F9LA 3QIBB 1FZMB 4LGPB 1UACH 3D4GA 1A3RH 4IEFA 3VFTA 3I75B 4LLWB 3I02A 4U1IB 5IB3B 5JO5A 3QHTC 1OO2A 5IVXF 5IWLA 3APDA 2OW6A 3QH3A 3SGJA 3RI5F 5ACZB 2HN7A 5BRQA 2HMID 1W0VB 3CVIL 5B21A 1MWAB 4WO4D 2BP8A 1EJOH 1OD9A 5DRNA 2DQIH 4L3EB 1BZQK 1FL6A 1UCTA 1G94A 2NY3C 3MLTB 4Z7OE 4D9LH 5F8RC 3OZKA 3SCMD 4MDJB 4MASA 4NQDD 1AGCB 3ZDXB 4B9JA 5LBSL 2P5WD 4AV5A 4JS7A 4J12A 2DQHL 1OT2A 1AGBB 1WUNT 3JWOL 4LLYB 5I18L 4DH2A 2D2CC 3T5WA 3EZ8A 3V0EA 1GGBL 4XN4A 4J3UA 5EEXA 3MLXH 1W0WB 2ZKMX 3GLEA 4J3OC 5LAXB 1WD9A 2Q76A 1I8MA 2DS4A 2ADJA 5HHOB 4JM4L 4OLYL 4JR9H 1CFSB 3DMMB 5T5FA 4JFYA 3CFEB 5DJXA 4Z7NB 1RP9A 1BAWA 3FDWA 4J8QA 1L4IA 4IKNA 3WJMA 4EI5C 4ANUA 5C2UB 1GOFA 1R3JA 1SXSA 3PGCB 2UVFA 3EYUL 4YIQB 3LRSA 4YSAA 4WUUD 1URIA 1WITA 2H2SC 4LSTH 3V0HA 5KN5B 4MJ6A 4CADB 4UTAH 4WSJA 3H56A 3SGDH 2X9XA 1OE2A 5IQ9A 3QG6A 1OAZH 2H2SD 2GI0A 2YAHA 3MMEA 5DK3A 1KTLB 3Q7JA 3TZVA 2FNBA 4RMRA 4BQ9A 3L1OL 1X5AA 4FG6C 1O9VA 2QSCH 1YEIH 1I7TA 3QO1B 1ETA1 1KIRB 1ETZB 1NKOA 2F7QA 1VFBA 2FEDD 2XVKA 3CLEL 3HKFA 4XH2B 1I9EA 5DHEA 5F7DB 3BGMA 3CQPA 4FQ1L 4UYPA 4X4XA 1BLIA 2AQPA 5LCVL 3O0RH 4J2XA 1MIMH 5FA4A 1AP2B 1UA3A 4MJJA 2BIPA 1A3QA 2A73B 1JZJA 2ATKB 1MUJA 3KWWA 2WAHA 1Q9OB 2RA1A 2ZT9C 4PJGE 4XOAA 1M4KA 1BIIA 1J8HB 1NGQL 3MLVL 1PLCA 4M6OH 1WA2X 2PWFA 4OZGE 2RFXB 2X3CA 3QEGL 4FULA 2ZYSA 1SEQL 4PJAB 5GRVL 3US0A 1CICD 4AV0A 2P8PA 4QYOA 3FFCB 4KXCA 3LKRB 4NT6A 4HUWB 4EZMA 1KCUL 5C0RH 5IB1B 4JG0L 1I7UB 5FECB 2BY1A 1FFPA 1TSRA 1D5MB 1ZV5A 2P42B 3FCUB 2DTML 1BD2D 4XO3A 4RMBA 1H3TA 1NCWH 3BXNA 3LRGA 3OGCB 3EYQC 1MHHA 4BBWA 4R5VA 1A4AA 1MFAL 3L6FB 3E38A 5I1KL 3DTDA 3GSOB 4EBQL 4FYRA 4C83A 3RWFA 4YQXL 3I6GB 2VN3A 1R5IB 2WB1A 1A25A 4DK3A 4FFTA 5KSAB 2OMVA 4AL8H 4AQAA 5FCUL 2VERA 1PNDA 5D8JH 1RURH 3GBNH 2ED7A 4LAQL 2HJKB 3UOAB 2VR7A 5IESL 2O93L 3WGUB 3IJHA 5EHFA 1IM9A 3VB8A 5AVTB 4HA1A 2FZ3A 3WO4B 1VADA 4WU5B 4BK5A 1ZVYA 1UQSB 1MCFA 1NANH 2CCVA 2P24B 3MLSL 1A6UH 4XN9A 4NZ8A 1TQTA 3WAKA 2ZSVA 5ISZB 3HMXL 4Z76B 4YPJA 4X5XA 3Q2LA 3AG1B 4G8GD 3P1VA 2V2TA 4RDQG 4QT5A 1MEXH 4GMSL 1BQKA 1MFVA 2BH0A 1L9RA 3NTCL 4NO0D 3RY4A 2FVNA 3U7YL 4Y1AD 2WSDA 4IKLA 5FO7B 3N04A 5DD5H 2OSLB 4GRLB 3FB6A 3UTQB 2BSEA 1MCOL 2CGRH 3HS8A 4JFWA 4BXVA 2N1KA 1I1YB 3IJ7A 3WTUA 3INUL 1T1ZB 2WVSA 4JDVB 4HHWA 1LHZA 4XNXL 3ZE0B 4KI5D 4NNYB 3ARBB 1CD0A 2P80D 1MVUA 3F84A 4PV1C 1JG9A 3EH2A 1JS4A 4WNSA 5CEYA 2VDRH 3FXIC 4JFDB 4M7ZB 3MVSA 3VSUA 5KSAC 5JW5B 1WTGT 3QPXL 2L8AA 3F7VA 5GGTA 1H0DB 3SYCA 5I76B 5J1AB 2OP4L 2X12A 4AVHA 5FYLH 1MRDH 5HGBA 1J5OH 1OTUC 1E3ZA 3HS0C 4PJBE 1LO3H 3MRKA 5K39B 1H3GA 3BAIA 5DS8B 4UT6L 4JFDD 1I7ZB 1OARH 2H6PB 1QO3B 1JWUA 3LOWA 4G6JL 1PG7W 2HFFA 3OB0K 4NC0B 3B7UX 4XAWL 5DWUH 3ATBA 1KT2A 1MCEA 4XPTL 4AQ8C 2EVHA 4D0DB 5TQ2L 3V6BR 2I85A 5I2IA 2LR4A 2N0MA 1F4WL 4APQA 2XWBA 3ETBF 1U8LB 4GRLD 4JFHE 3CHSA 5AAWA 5DUPL 2XYCA 3VXSD 4H8HA 1R47A 3MV7A 5DVKA 1NCOA 3Q3GB 5DJYA 2A6JA 3TIEA 2QHLA 1KB5H 3BCDA 1BQUA 3DMMA 4Z5RB 5L0QC 5I1GH 3DTUB 3VD0A 4GW4B 2V37A 4Q4EA 1IGML 2YHGA 4KAQL 4X83A 4A1RA 3BH9A 3T4AC 2E8YA 3CG8A 3PHSA 2BO0A 2CKBB 2AANA 5IEHA 4NRYA 3IB4A 2FBOJ 3MLRH 5F9AC 2J88H 3PIQB 4NZTH 2VRQA 2LW3A 5E1GA 4P59H 1X5HA 3IFPB 3NJIA 1DEEB 1LE9B 4NM4H 1I3RA 2VZ1A 4BUGA 1PDKB 3E8UH 4W70A 4CJ1A 2XWEA 4NUMA 1A21A 2ZYRA 1OTSC 1NFIA 4H44C 2W91A 1VGEL 1O7DC 1S5HA 2HJLA 3EO0A 5DHVB 5F3HA 3CBRA 1GAFH 4FL4C 4ZUSB 1S7QA 1FAKT 2L04A 1KGCE 3ETTA 1OP5H 5I1IL 4YVNA 1IC1A 1UVQB 2AEIT 2BCMA 2QKIC 3GTTA 4MCYB 1H3UA 4HMCA 4X98B 4ZMQA 3POCA 5DSCB 4B9GA 4FMFA 4F9PA 3ZKNC 2XCMC 2ZWZA 5AWNH 2J8UA 3ABMB 1ZGLB 2OZNA 3DJSA 5E2UH 3RZCB 2OJZH 5GGRA 3ZQ9A 4EKJA 5I1JL 5I1DA 1FFPB 3FQXB 4E9VA 3QDJB 2AEWA 1XGRA 3BPNC 3PU7A 1FNLA 4LT7A 2V2WA 2Z34A 1UFGA 4WWPA 1KN2H 2JCCA 1MAMH 1O7VA 3KL0A 1JD7A 2HG5B 1GSKA 4ENZA 4R5TA 3APNA 1VIWA 4GFXA 2W07A 1NGXA 2I07B 3QORD 2GBTA 2L7JA 35C8L 4H5SA 4QLRA 1HKLH 3ET9F 4ZFGH 1GRWA 1KDJA 2ATKA 5C3TA 3SDDD 2MNWA 3VFVA 4LCWD 3UTTE 3GUFA 1EDQA 3IYLW 3LV3B 3MNVA 5DDHA 5EU6E 4XOCA 1WCBB 4K94L 1TJGH 2VLLB 3FUKA 2BFGA 4U6XB 3ZMEA 3O8XC 3BPLB 4BK8A 2CD0A 2FIKA 4L18A 3QHZL 2FK9A 3BPOB 3F7LA 1D9KB 2V5MA 3QAQA 4FL4B 3Q9PA 2FX7L 4QXGL 4WSGA 1QBLL 4YX2H 4Z76A 3FUNA 4WQOA 2XN9B 4ALAL 4E42A 1FYTE 2WINB 4C8XA 4YIQA 3JQOB 3T3ME 3DNKA 3WXWL 1JWSB 3KPQA 4N85A 5HHOD 5AZ2L 1SUHA 3AFLA 3B3IB 3HHMA 3CXDL 1B0IA 2VJXA 2YGVA 4H88H 3CJJA 4QHNB 1L9NA 5AB2A 4FXGA 1MZZA 1AZCA 3L5XH 4HIJA 2AKRA 4Z7OF 1CFQB 5LGKA 5DJDA 2ROYA 3EGXA 3FT1A 3R1GH 4LCYB 1GKEA 5D7SL 5B8CA 3H7LA 1TNNA 4QRSB 2DM3A 3QUXA 5HY9B 2ZOTA 4Q9QH 4GFTB 1FVCA 3IMWA 5CILL 1RFDL 3QUXD 2NMSA 1U3HC 4C4UA 4NWUH 4DW2L 1NC2D 1J05B 1YCSA 2PYEA 2D7QA 4XCEB 1MJ8L 1C5CL 4L5FH 4U0RC 3PHQA 2AABH 4XMPH 4AUUA 3WNJA 3R0MA 4YXKL 2JTYA 2ZSVB 5ISZA 2IAAC 2YEZA 2NW3A 2A99A 2X2JA 3V0VA 4B96A 3S98A 1PZ5B 3BQUC 1PW3A 1XCQA 2CH8A 3GHEL 3B9EA 4NM8L 5D2LE 3T77A 3E2HB 2YQ2A 3BISA 2YD1A 1UXWB 2IDFA 2PPDA 1OSPH 5JYMA 2BOCA 4Z7AA 3ULVC 3FO2B 2BMKB 3UYPA 3KPNB 3GLZA 1F3JB 1XT5A 3DJTA 4MZIA 4PTUA 3WKYA 1J7VR 5DJ6B 4HOMA 4HLEA 1OZUA 2YARA 3DX7B 4F3FA 5FDWA 1KBPA 1Q9WA 4X7DC 5E8EA 1EGJL 2JJWA 4L8DB 3A0OA 1UJTA 2ALAA 4JZOA 1NJ9A 2VDNH 2WANA 3DO3A 2C7FA 4FZ8L 3NA9H 3ARDC 4RDQF 3HG3A 1R3KA 2CBPA 5ECGA 4NI6A 5K9OA 5FKPA 5I26A 1PLBA 4G80B 4WU7B 1ZLSH 4K9JA 1EVTC 1FO0L 3LRLA 4NIKB 4UT7H 4OTXH 3OHMB 5E8OB 1ED3B 5EC2A 3GSNA 4HHAB 3T0BA 5E2TH 3QQDA 5HYJB 1KJVA 4JFOA 4YH6A 4KJWC 3VFNA 4A2MA 1TZIA 2NW2A 3P11H 2WVTA 4N26A 5FUCC 1E8ZA 4JO2L 4JL1A 2R1XB 2FBRA 5ERWA 2IH3B 4MXQD 4F7TA 3SCMC 3U4KA 3KLSA 3N85H 3DPDA 4J2QA 5IMKA 2BX5A 2PWHA 4YJZL 4H40A 2LVCA 1RVFH 2XTJB 1U93B 2BNUB 1R3HA 2CBOA 2WXFA 1CXLA 5F9WB 2SODB 3MV7B 1UYWL 2J44A 3K1DA 2NNAA 3NSDA 4OIAA 2FJFA 5HGDB 5F3BB 4MCYA 2YUXA 4CVZA 3C6EA 1JNLH 5D7EA 5JPMC 4QHPA 1GGCH 4HCFA 4ODWA 4APQC 1V7NL 3PHOA 5JOPD 1QR1A 1WZ1L 5CEYB 4PG2A 3C09C 1AR1D 3U1PA 2WN2A 3MV11 4ELMB 3D0LA 4RA3A 3EGDB 1ES0B 3TN0B 4M3JA 4HPHA 3U2SB 2BWIA 3AM8C 3K80A 3V4VL 1GIGL 1D7CA 2LLNA 4I3GA 2DI9A 1LE9A 3KD4A 5HGBB 1J12A 4N3TA 3TZVB 4GXUM 2RBLA 2X9ZA 1DO6A 2B1AH 2VISB 3LHPL 5D1QD 5M94B 1BXAA 1GC1L 5F7YC 4YSEA 2VXTH 1KCRL 4N0UE 4H5SB 4YFLF 4Z0XA 4OCXL 1LEGA 4FI6A 3T71A 3STBA 1T7ZA 3SDCB 1PF3A 2DWEB 4BRVA 4KKBC 3GS0A 2P28B 3SOBH 5G2NA 1HCFX 4HPYH 4Z3HA 3L8QA 4HAKA 1W15A 3BE1H 3TBWB 3QQ9D 1AYOA 2CHXA 3MUJA 1BQLL 2X4OA 3QCUL 2COVD 3A5VA 4OF8A 4G6ML 1F4YL 1KCBA 2WSKA 3SY0A 5TK4A 5K9KA 3AMLA 4F33A 3GI9H 4R6UA 1TQCC 5GGRB 1HHHB 4F7EA 3BEWA 4G42A 4QXTB 4F1ZA 1AMYA 3MLXL 3EJZD 1A9EB 2D03L 4IEFB 4Q0XH 4I18A 4OGXH 4PJFF 3KR3H 4Z7QE 3BRFA 3E1ZA 1CI3M 3FT3A 3CPLA 4G6KL 3RL2B 3ZYJA 4E41B 3VCLA 1PU0A 2VSCA 4LPVA 3JV5A 4CADA 2IJ0C 4E9SA 4P5TD 4OQTL 3L3HA 5FYLD 1ASOA 4ZUUA 4OF3A 4F9LC 1JYWA 4PSPA 3UEZA 4D3CH 3IKCA 2UWEF 3HS9A 4A66A 2XACC 2FO1A 4GJTB 5FIEA 5E24E 2EYSA 2IEPA 4G7YL 4QRFA 1Z3GL 2OJ1A 3TJHC 1HCVA 3TCLB 2VUOA 1A7OL 4PJAE 5JW4Q 4EUPB 1U3NA 2DDQL 3I9IA 4HIIA 5INDA 4Z7WE 5BS0E 2FTAA 4WUUA 4D9QD 2ARJQ 1IJNA 3OX8B 1TFPA 5C9JA 5KJRL 2KLRA 4TQIA 3VI3E 5I1AB 1F8TH 5IW6B 1HHJB 4NB7A 1PAMA 1NAML 3WHXA 4XPBL 1SMOA 1MXDA 3BKMH 2EVGA 2K3TA 4YXLL 2VDLL 4KKNA 5KS9E 2YJLA 1PEWA 1KPVA 1CO1A 1YEEH 3D25A 2B1HL 2K45A 2X40A 1ET5A 5DJDB 3PJLA 2VAAA 2B20A 2DDQH 3ZT7A 5T3ZH 1FLTX 2GJZB 2LLGA 1BFTA 1ITBB 4IBZA 5BS0B 3T3MB 2F2HA 2Q20A 3MX0A 2C9PA 3CFJA 4QUOA 4JO4L 3INOA 1E27A 5LBVA 1T21B 2Y2YA 3O81A 4JFUA 5J9PB 4H0HB 4LCIL 4OJFH 2D9CA 1BFSA 3IU3B 4RZCA 1XSIA 2BVUA 5TGBB 2PXYA 3QJSB 4GI8A 4FNTA 4NRZA 4XWOD 1RZGB 4JGJA 4CBZA 5TE4H 4KVCL 3WUWA 1JBJA 1TTUA 1EZUA 3MBXH 1YN6B 3VMOA 3SDAB 4UI2A 4M7LT 3EH5B 3Q44A 5TE7L 3QS3A 1MJJB 1WE5A 5LUMA 3CTTA 4APXB 4ZSOB 1LE5B 3UADA 4JG1L 2EAEA 3STZA 1NQBA 1R24B 3CC5A 2B5IB 1AXTL 4JE4B 3S37H 5IMKB 3S7GA 1F90L 1D5MA 3T1FB 3L9EA 5CM1A 1KTDA 3F6JA 5GRVK 3QW9A 4BGLA 3VG9B 1T04A 2Q86B 4I2XB 3BXNB 3VXNB 2ED8A 4URTB 5AAPA 3SOTA 4WFEE 2BVPA 1YNLL 3HRPA 4AKQA 1THAA 4WFGE 4GMSH 2PTTA 2NZ9C 3V4PA 2IDQA 2OCFD 1BZEA 1DBAH 4WI6A 4FERA 1B4TA 3DX8B 1IM3B 4YSPA 5C07E 3WD5H 4BSVA 1P4BL 5DO2D 3RWEA 4FADA 1TEFA 4LCCC 5B1JC 5TDNA 1SZNA 2D9QB 1YAIA 5CBEB 4G82A 4L8BA 3BHBA 5CD5C 2YQ3A 2EDYA 4LNVA 5CZKA 2D7PA 2VC2L 1VADB 4GSDL 4WU5A 3NEOA 3DGGB 4L29B 3H2PA 3MRBA 1PY4A 1TVBB 5ELIA 1NC4B 5F0LB 1YYMH 1ZD6A 3H7BA 4NKMA 3L54A 3MA9L 3DX6B 1J9CT 2DAVA 2H41A 1N6UA 2NQCA 3KYKH 4MB5A 3TBYA 2BSRB 5KVDH 3NK3A 1YUKB 5EUKB 3D34A 4LSVH 1IGTA 3ML8A 4HCIA 4A6YL 2ENYA 4NHCH 4TNVF 2P80A 5CIPA 1UOKA 2BNQE 2Y23A 3NP4A 3QUZA 3RE0A 5I1HH 3NPSB 1JPFA 2ZWNA 2VMJA 3RL1B 1F58L 4X7EC 4P23A 3JT0A 3KPRD 3MV7E 3OKNB 4G72B 1HEZA 2WKOF 1VESA 1INQA 3GSUB 3HLAA 4XXCC 4XBGB 3GMNA 3W9EB 2W9EL 3P0YL 1S9WA 1FIEA 2WQXA 1X5ZA 3FUDA 4PWIA 4R7NA 3HR6A 3RGVD 4LBEA 4DO5A 5J6GA 3G6JF 1HNFA 5T3ZE 2IWGA 1DLHB 1T1YA 2JLPA 3GEWB 3JVGA 4M7KL 5EFIA 3ZDXE 4LSUH 1U8CA 2DQHH 6FABL 2XZQL 3ZZLA 3HC0A 5IY5B 3GEFA 3QDJA 2KZWA 1U3YA 3MUY1 1N3NA 1UM5L 3TH3T 2EC9T 3TFBA 1VERA 2PLTA 3M7OA 3MNZB 2J71A 3GKWH 5TJWK 3DOHA 1JHLH 1FNEB 2R0ZL 4ELME 5BUPA 1NKGA 2XU9A 5FM8A 2MCPL 4FKEA 1JZ7A 4BKLA 3APFA 3BD5A 2KHAA 3F12B 1Q1JL 1CU4H 1BG9A 4HS3B 4QXWA 3A4FA 5D93C 2H3KA 1KBVA 4BA0A 1IARB 2FBJL 4GKNB 3HNVH 5EEWA 2E56A 2KT6A 5E8DH 4Z7QF 5IVZB 4IKKA 1KDIA 1IBDA 2UXVA 2YOAA 4JQIH 3QDJE 1JV5A 1CXEA 1N4XL 1FPTL 2F5AL 1XXFC 2I26N 4IJTA 5EO0B 4OZFB 3WY2A 1K72A 4I18B 1QLEH 3DPBA 3VGFA 1NLBL 3OQRA 1T2QH 2WVUA 4J3XA 5E08L 2HKHH 1SXCA 1U2CA 3LNIA 5EOQL 3U0TB 4Y19B 1BVZA 3C60A 4ZRGA 2HFEB 2DQEL 3BSHA 4KNTA 4JREB 4MA8L 3MLYL 3NMEA 1B88A 1F97A 4WKXA 5K93A 2DKMA 4P3CH 4PS8A 2AKRB 2XY2A 3EO9L 4LVNB 3QWNA 2HH0H 4QJ5B 5I1JH 2CDEA 3MLZL 3EJTA 4HT1H 4LKCA 3KXFE 4QRSA 2XHNA 1FFNB 3QIUC 4X6CF 4EN2A 1XB8A 5I1KH 5JPNB 3B9KD 5CGBA 2HT2D 3SDCA 3IJYA 2VL5A 5MERA 3CFKA 2QQNL 4YO0A 1N70A 4B9ZA 2PXYB 1ITCA 3OX8A 4OLVL 5GZND 3OHXC 1CDIA 2WLJA 5DJ2A 1F3DJ 3FO1B 1EXHA 4JY4A 1OAXL 5BQDA 4U2YA 4KKZA 5ECJE 4Q58C 1CGXA 1CYWA 1BREA 2VLLA 4G6AD 3K2MC 4FYTA 4NC2B 4AE1A 5I6MA 2VDKL 4UF7C 5C07A 1ZSDB 3QUML 4F20A 1D9KA 4K9EH 2J8UB 2P8LA 2GFBB 3PQYD 2W60A 4NOFA 1T6WA 4ZJ9A 3RVWC 4WEBL 1JZGA 2DYRB 2PO6A 3VI3B 3U48A 5EZJA 4UUJA 3FT3B 4JKKA 1ASPA 3OF6A 5DRXB 1J1OL 1LNUA 3GTVA 3VGDA 4ODBD 4X4YB 4KFMA 4F15C 4P5RA 5CJXC 1UD2A 2NNXA 2VN6A 3RVXC 3WN5A 2Z31A 2BIIA 4F57L 4KZEL 4BZ2L 2CAKA 4MXVE 2YBRB 2EUXA 3WKNA 1M9WA 2UUDK 3ES6B 3PWPA 4Y1AE 2Z8RA 3ZLQC 1MJ7L 1MFCH 4GQQA 3KGRA 5AVXB 4NDMB 3R19A 2DWXA 3S36H 2CUIA 3B2XA 3OVUB 5E6RB 1P0SE 3SB3A 4BDVB 3WI9A 2GK2A 4FS0A 4FFVC 3D3VA 4N0CC 4JAMA 4HCRL 3V52H 3NBNA 3QPXH 2CR6A 1D2PA 5T1DL 2AEPL 1UURA 3ML9A 2EVJA 1P5UA 2DMHA 2VQ1A 2OTUA 4OU3A 4Z9KB 5ERWB 5PCYA 4N6RA 3WUWG 3WL9A 1E43A 5BMFL 2QKSA 3U0WH 3F05A 4RISL 5LGHL 1B6UA 4WHTB 4TS6A 3BW9B 2G0KA 2HPOA 4B3EA 4ZUWA 4HIXL 4ZSOE 2F53E 4KZCA 4Q6YA 2X4NB 2IMNA 2CE6A 4UDTB 4MA7L 4S10A 1WAAA 4S2SB 1I3GL 2DL9A 3TV3L 4Q9RH 3WSQL 5FW8A 4E9WA 2W0FB 2A83A 4CMHB 1NJ9B 2ZJSH 3QUGA 1OW0C 4KHTL 3O9WA 5CD5D 1J88A 2Z7YA 2CA4A 4QRPA 4TQEL 4PJBB 4MD0B 1OCOB 3PL6A 1K8DA 2P8MB 2C4FU 1Y1DA 3BX7C 4WFFE 3T65B 2X5PA 3K74B 4KHXL 4ZOEA 3GRWA 1QG3A 4UM8B 1AXSA 2YGQA 4XVUD 1S78C 4M6MH 3TX4A 5L8LB 3DI2B 2BP0B 4K3GA 4NKIL 5C8JB 1JNJA 1FDLH 2EKSB 4PRHB 3O6KH 1FI8C 4ZXBD 2C4XA 4N0YH 2B14A 5KWYC 1U3HA 2SEBB 4LGSB 1KZQA 1G9MC 2DWEA 1QLFA 5C08E 3T1FA 4QY8A 5KBMA 5F7EL 4WHYG 1HEZB 3FMGL 2ZNXA 3A6BH 1GOHA 2X7LB 4CSSA 1U91B 1TPXC 3MJ9A 2XRAL 5IG7A 1MF2H 2WB7A 1URZA 1SUJA 1MCSA 3D9AL 2Y2WA 1HNGA 4OZIE 1Q4NX 4O02H 4Z7UA 1K2DA 2FUTA 1REIA 4NCDA 1E5UI 5B1BB 2V9UA 1GGIH 3VFTB 1C7SA 2YAPA 4P9MH 3HCVA 5HP5A 1IAIL 5C0FB 3QEQD 4JHAL 2ODIA 1T1WB 2EC9U 3L5WA 4ZAKD 2VIRB 3OLEA 3NQIA 3ILQD 3WIIH 3X1EA 4K23H 2Z1PA 5CSZB 4OV6F 4ECNA 1GGCL 3CPLB 3GF8A 3RL2A 5DMKB 2NNFA 4PW4A 5J1TC 4LDEB 1GYWA 4PJDE 4K5MA 3AADB 5F96H 4XBPA 3KLLA 2J1ZA 6TAAA 1NFDB 4WW1B 3IAGC 3TCTA 3AACA 1IBYA 2CJUL 4G8AC 1CG9A 5I6OA 4ODHL 1NUGA 2W0KA 4GOSA 3GMQA 1BMZA 1ML0A 2AJXH 3S36X 3HMXA 3V8OA 2AJUH 3G5VB 4QRQB 4YAQA 5I1CH 3ABLB 3GSVB 2FYYB 3OKNA 1KEGL 2ITCB 5KZCB 5JOFB 1BIIB 2VW4A 4MAYD 4Z7NF 4MS6A 3NH7H 2W1NA 3GMNB 4NQCB 5HI5C 3BCFA 3C2AH 4AQ1A 4IDJH 4BWWA 4BZYA 2C9VA 4RWYH 3RGVC 5DXWA 3FS9A 4IMLB 4MS8C 1NUFA 5T8IA 3LNFA 1XGZA 2XQBL 3D25B 2J7LA 1UUSA 1K4CB 4GYBA 1LK3H 4PGBB 3FCSB 5E9DE 3ULVH 1JZIA 3BJ91 4R7VA 2VLJA 1ADQL 3BDYH 1O6SB 3WY4A 2G3NA 3LZQA 3SDYL 4ZMYA 5MEOA 3B9VA 3DWTA 3WN5B 3TN0D 2Z64C 2CCWA 2WP3O 3WS6A 1TJIL 5FA4B 1TEYA 4FQ2L 1WZMA 2OTWB 2Y1ZA 4TUJB 1MIEH 3WIHL 3BVWA 3KWUA 5I23A 1KEMH 2EEDA 5DQJA 1YMMB 2CDGB 1OP3K 5T3XL 4K5LA 4B7LA 3D8MA 3QG7H 5DO8A 2MPVA 3GHBL 4JRWA 2EXWC 5LWYL 1T0NA 5CMAB 5D7SH 4KRLB 2UZIL 2XBZA 4NT6B 1N18A 3KYMB 4HJIA 4I48B 5AW3B 4G5ZH 3PQYB 2QHRL 1KBBA 1JMXA 4NP4L 1DSYA 1IGFH 3NCBB 4XI5D 4NWUL 4IGBC 2TRYA 3UBGA 5F88A 2OCCB 4GXVH 5GJTL 3ZO0A 5ESQB 3TJPA 3LEVL 1BJ1J 2F74A 2VMCA 4RDBA 2OMWA 3MU3A 5D7JC 1Z5YD 2W9LA 1N9PA 2X4NA 4KO6A 4XCYA 4KDWA 4R97B 2B1HH 1NDGA 3BP5A 4QOKD 4G9FE 4J3VA 1JJUA 1RUPL 4OCNC 4B27A 3S8GB 4PCKA 4GG8A 4UINL 3WN5C 3C75A 4N20A 3CXFA 1PPIA 3MGOB 4JMXA 4YGVB 4EE2A 1E9QB 2D31B 1HJBC 4G9DB 3PPEA 1TKWA 1CTNA 4WUKL 2NLJB 1B0GB 1XL4A 3EJCA 2MCMA 3NFPB 3B2DC 1GY2A 3KPSD 1XCXA 3BO8B 5E9DB 1ID2A 4XNMA 4OD3L 4JY6B 2DY2A 4PVLA 3ARFD 1B4RA 4N87A 5F7HA 1AZVA 3WTSA 1BFVH 4ICXA 5GGTL 5D9SA 1JIBA 4ILDA 2Y1AA 3V6ZA 1KIUA 4GAFB 2XXGA 3EDKA 3NABL 2OSXA 2P5EB 3T6QC 3SPHA 2VE6B 3BMVA 2NYYD 1MCNA 3L4CA 1LD9A 1GCYA 4TNGA 2I9TA 1VEOA 2ZUQC 2K0RA 2BJML 3NACL 1MY7A 4X4YA 3OKDB 4J27A 3VXRA 1DBKL 3ARBA 2WXGA 1KJMA 3M46A 3PABA 5B39G 4XP4L 4U7MA 4OZHA 5DJYB 2OR7A 4GRWH 4KJQC 4OKVB 5AAMC 5A1AA 4XGZA 4NJAH 1F6FB 1KCSL 4OT1L 3RA7L 3T65A 2JK5B 4BE6A 1A7NL 2GIMA 1P69B 4FTVB 3SBRA 3MA7B 3VFPB 2B0SL 1GS8A 4HKBB 2XPGB 1A2YB 3VA6A 4WI2A 3K6OA 3QIWA 2Q87A 2R2BB 2DI8A 5E0FA 2OYPA 3SKMA 2XG5A 3O3DB 1NANI 4G3YL 3JWDL 2EIEA 2CO3A 1U3JA 1MRFL 2XQ0A 4H4NA 2A77H 5CGYD 5H35B 3S37X 1ACXA 2CDFB 4GT7A 4UILH 2V2XB 4BK4A 4YHKL 1G7QB 2GTZB 2PCXA 2R7EB 2OKMA 4TOYL 3WUZA 1FJ1B 4HD9A 5L2KB 3A4AA 3TNMB 3MFFB 1KGYE 2IQ9H 2MQGA 2CM5A 4A63A 1R3IH 1TQWA 3D85D 5JOFA 4XVSH 2WPGA 4XR8C 4E5XA 1G7IA 1QFWL 4AQ1B 3U6XS 4X6DB 3HLAB 2ZNWA 3IDIA 3UBXA 4IIQB 2WLLA 4WO4A 4WSKA 4YK4B 1KUMA 1JD9A 2X2YA 2ESVD 1YEGH 4U6HA 4ABQA 3N1MC 1Z66A 3TPKA 4KK5C 5EFIB 1PYWA 3WOVA 3HN8A 4WDIA 4KX9A 3RILA 1QW8A 4ZPVA 1QI5A 1MFBL 3MGTA 3SGKA 2NY0C 3MZTA 4FMKA 3H7BB 4NKMB 3NZHH 5B1JA 3QDJD 3LIUA 1MCOH 4J8RB 3QO0A 2GY7B 3VFMB 4Y7MA 3GIZH 1BXUA 4UYQA 3RNKA 5IGXH 1J5IA 4PBVC 1IBZA 3BGMB 2FL5A 4X4XB 5LCVA 3MV8B 2PWEA 3GSVA 3TJHD 3BP7A 2FO4B 5I8OL 3B7RL 4J3WA 2EDDA 3VFGL 1W9XA 4KMLB 1JFHA 1ODUA 2A38A 2FWSA 3KYOB 5DJZB 3G6JA 3KPRA 3RKDD 3CVHL 1PL3A 3BC9A 3JWOH 4Z7VB 4APQD 3J27A 3REWA 5JA8B 3ZKXC 4EN3A 1U8CB 3GMRB 1DVFD 5SWQA 3EFOA 1CR9H 3BUPA 4EOWH 5IQ9B 1U8QB 3MOAL 2A1WL 3QQNA 5F88B 5AG9A 3RDTC 4GKZA 3EOBB 3H9SB 4P23C 1U8JA 4YDMA 1OSZA 1IKNC 1IKOP 1YRKA 2BWQA 2D8KA 3L2NA 1J0JA 4OW6A 2W07B 1ZTXL 4NKOB 4WHDA 4BK5C 2VXUL 4MJHA 2DM2A 3UO1H 2HG0A 3NP3A 4BFJA 1BP3B 1JGDB 1TTAA 2WBJA 3EO1A 4ZAKB 3V5HA 4FJ6A 5HHMD 4KRPC 1DVSA 1X5XA 5HHMB 2YMXH 1HAWA 3GDBA 2VZVA 4PJ8D 1T1XA 5AKSA 1QSEB 3ZE1B 3ZTEA 4K3JL 4YDLC 1D6VH 1A5FH 2E7DA 1UWEL 2KMWA 3F64A 2OMXB 3FT4B 4A2GA 1EMTL 5BS0D 5FCSH 4KNQA 4QDGA 2XIBA 4N2CA 4PRNA 5E7BA 3FHAA 3OLIA 4B9CA 5JXEA 2I60L 3U36B 2K70A 1YPZE 3K0YA 2RIKA 3RFRA 1DVFB 3CFEA 2E7LC 2WWKT 4KPHH 2X4TA 2WUBH 2E9BA 3VX1A 2NNRA 3QK0A 4JL2A 3ZDYF 1CPUA 4AM0B 2WO2B 1ZE3C 5LCVH 3TA3B 5AKVA 3ORJA 1OAQL 3E8UL 1WBXA 1EAJA 2R9HC 3FTGB 3OXSB 3P4LA 1BVLA 1CUOA 1LVEA 2XZCH 5BV7B 3JZ7A 4LEBA 3WKML 4B9PA 2EE9A 3VXRB 1TU2A 2GUYA 3MJWA 1QFUL 4MNQA 1DLFH 2XTJE 4M9PA 3OGCA 5F6HI 4KK9D 1DBMH 3MV8D 3PE9A 4HEPA 1OGTB 2C3HA 4L4TB 5ENWA 2CR3A 5HJGA 1Q9LA 4GB9A 4PJ8C 4FNLH 2OBGA 5C0RL 4PJ5A 3AREB 3DSNB 4XC3H 2MCAA 4WK0B 3JBG7 4LCCA 2IQAA 2AQRA 3L9YA 2BNRA 3H55A 2F7IA 3QQ4A 3C6LC 1SEQH 3GZKA 3ECBB 4JY4B 5F2FA 5GHWL 1O7DE 3HOGA 3ASNB 1GYAA 2GC7C 3SHSA 3SBQA 4NLHA 3S3CB 2X4SA 4HUVA 5AB9A 1H6UA 5ALCL 3VXMD 2BXYA 2AJZB 3SE9L 2NY1B 1VLXA 2GFBA 2G75A 1NPJA 1Q9WB 5E8EB 3LN5A 2YGOA 2HX8A 3I3DA 1DJWA 4N86A 2RAMA 3S5YA 3DOIA 3S3BB 3BIKA 3JWNG 4JFQA 2EICA 2R83A 4G8FA 3N40F 4ZOAA 1HDMB 2H8PB 3IBOA 3IDXL 4BZ1L 4LBAA 1W80A 2FSEA 4AL8L 1SLWA 1J8RA 3BPLC 5AL8A 3CWGA 4X5LA 1CL7H 2VXQA 1AZZC 4M7LL 2GAZB 3SDCD 4JDTH 2MRYA 5CSGA 3MRPB 2ZUUA 1TZGH 2APVA 2AXHA 1DVYA 4RRPM 4YGVA 3WMQA 3K4DA 5CJ8A 1QFPA 4P2QB 2VIRA 2VLKA 4MMYB 4ONHB 5EU7E 1RKRA 5LG1A 1BFOB 4EI0A 4XNBA 1Q94A 2MMXA 2VTFA 4NAMA 5EN2B 3MRKB 4IRJB 4PYHA 3FU7B 3I9GH 3THML 4D8PA 1MLBA 1JF1A 2Y1YA 4JFED 3CZGA 2Q1EA 3K91A 5E2UL 3VFWA 1NPUA 5CP7A 1AR1B 2DIAA 2HLFC 4XZUB 3OD3A 1I3RB 2DIJA 4AEHL 1XEDA 4P07A 1R3HB 3G5YA 4TVPL 3P77A 1MCJA 3OPZL 3PWUA 4OGAC 1T3FA 3SPVA 1CICB 4IRZA 4WAFA 4Q9QL 5DMJB 2VDPH 1LD9B 4PIBA 3IDJB 4RLDA 1BAGA 3CHPA 4X7SL 3RWJA 2N59A 2J20A 4RWHA 3GRWH 4HF5L 1O9ZA 1QI4A 3FRPB 1K6QL 4XXWC 4HXAH 1VGKA 3AY4A 5IMMB 4XXDA 3KYAA 5DTFA 3ZKND 4NO5A 4M4PA 3HE6D 4W9IC 1N64L 4WNJA 2EECA 2J2ZB 2YA1A 2WBXA 3P0VL 4AW4A 4U7SA 2X05A 5AVYB 5L7XL 4HEME 4Z7WA 2AJVL 1YQ2A 4YDIL 3EOBA 1JHKH 1HCZA 4HUXA 1CS6A 1QBLH 4AK1A 3QVAA 3GGWA 1QI3A 4NRYB 3VQ1C 1DSFL 1OGAA 3BLKA 4WY7L 5EBLB 2MQ0A 3VQMA 1JL8A 4IRJC 1D5IL 4LVEA 3EYFB 1QO3A 4JN1L 5CJXA 4AZ8B 3ZZ1A 4FQHA 1KB5L 2Z0BA 5HSFA 1CDUA 5IV2B 2HKAA 2W9DH 3UPAA 5G4NA 1KBKA 2LAAA 2N56A 5CCHE 5AOIA 4JJOA 1S3KL 4ZUVB 2HUHA 1FP5A 2XWBB 2GBUA 1CZ8L 1CLCA 4NZRH 4XI5C 1T03L 1J86A 1DJGA 3MV9E 4H8QA 4IHOB 4WI0A 1ZLVH 4GKLA 4KZDL 2BY2A 2ITCA 1H8LA 2CIIB 1RIHH 2ERJC 3BZFB 2Y9RT 3I6KA 4MNGA 3GIVB 2EE6A 3N6YA 5HDOA 2CO2A 2E7CA 3VGHA 3DIDA 4OM0L 4NZTL 4M8RA 1PYWB 5E5RB 3CN3A 1F3DH 4MB1A 2D7TL 4HISA 1UWXH 2JJUA 2NXZD 1YC8A 3PP3K 4Y8AA 4ZFZA 1MI5B 5E1AB 5CWSA 5I74C 3RNKB 2GPZA 3MOBH 3MRRB 1BQ5A 1ASQA 2X89A 4IW4C 1ZPUA 1INEL 3O3EA 5FUOH 4M62H 5IF0B 1CF8L 1JOIA 3BP7B 1OTSD 4YUEH 1A6PA 4QOKB 3LH2H 5DJ0B 3V55A 5I66B 4HSCX 5KVEL 3R18A 2BPBA 1NMBH 1N26A 1T5WB 2YKLL 4R3SA 3HZ3A 3IAQA 1SF5A 4ADIA 1JK9B 4R0LB 2A4CA 2QPUA 3NGBB 1V3KA 1FRGH 1NDMB 3EGSB 1UZ6F 3EZJB 4QWWC 5IQ7H 3V6FB 3HG2A 1CFNB 1KB3A 4HXBH 2APBA 4XBEH 3EJJX 4M61A 4UQ3B 4WENB 1XCQB 5EA0L 1J8HA 4PMFA 2BWDA 3OKLB 3T77B 4IMLA 4GLRI 3MFGB 4MLSA 4POUB 1KZYA 2NTFA 1WFJA 3FF8A 1JXJA 1QMUA 1V55B 3WNPA 1RZQA 4G7RB 3B3IA 4PJAA 4ZFGL 1E5AA 1OGSA 3K2KA 3BLBA 2R2EA 5GGQH 3SGJC 4XMWA 1RZFH 4MMXB 2P4AB 5EOCH 2I9TB 3HG4A 1U8PA 2W94A 2BSCA 3BGAA 1HHKA 1H3XA 1YMMD 1TTRA 4YHZH 1AHWC 1FLRL 4HJ0C 4K7PH 3RUGF 4AMWA 1RK1B 3GSWB 4FXGB 4HIJB 2CM6A 1RVFL 2IDSA 1KEML 4S1SL 1Y18B 2ZPKL 1RZJC 6CGTA 2BSTB 1MH5A 3LKOB 4HJUA 4K73A 2OTWA 1N6VA 2VW7A 1NWPA 1MVYA 3S96A 5LN4A 1M7IB 2R2HB 1A22B 4XTRC 5I0WA 1TTFA 1A2YA 4JQIA 1X3DA 5SX5K 2D31A 1ZTMA 4L29A 1O75A 2NR6C 3HI5L 1KPRA 1DN2A 3RWCA 4RFNB 1T20B 2ZSWB 3FO2A 2ZJSL 5CJQL 4M5ZH 4WWKB 5FS5A 4AITA 1G6RA 3GWJA 3ZE2E 4N24A 5HYSA 4YDKL 3TC9A 1E4XI 2CXGA 2DW5A 4MNHA 4KTDL 4YC2B 3QA3A 1XR9A 1FNGA 1XSJA 2V17L 4TTDD 2CPCA 4LU5H 1J0KA 3FO9A 4JQVA 5TTRA 2VE6A 1CFQA 3SY6A 1VAHA 3SKJL 3UG4A 2HLAB 1AQDA 4IKJA 3TBSA 2J1XA 3EUUA 3SBWC 2WBKA 1ROWA 2WTRB 4DEPC 4O5LH 1EEQA 2AQTA 4UQ9A 2AERT 4HIQA 2GT9B 3P9LB 4TUOB 4XP1L 3EFFB 3VDCA 4G83A 1HHIA 4CGUB 1JFQL 3AREA 4Y19E 4H2AA 4KUZL 4DO4A 5HI3D 1JF1B 3OGOE 2K7QA 4IOIA 1AACA 2XZZA 4D9RE 1FQ9C 5DLMH 2O6CA 2OR9H 1F4XH 2OPCA 4MYWB 3BO8A 4ANXA 3JSSA 5C2BL 2TAAA 4WJG3 2IANA 1TITA 4S1RH 4ELKB 4PWEA 2KL6A 1AG0A 2ZUXA 3CBJB 4IMKC 4NYLB 5EBWA 2IOIA 2ITEA 4RBPH 2DQIL 5IJVB 4M9OA 3RKDC 2BJMH 3NACH 4I3SL 1IC7H 5T1KB 3AXIA 1CLOL 3UTOA 3MJ8B 4NQSB 1AI1H 1DHKA 1DSWA 4G8FB 4RGNC 4Y2OA 5G4MA 4PJCA 3LDBC 3B2UD 4U6VL 3B9AA 2WP3T 1IE4A 4YC2C 1AIFA 5DLML 4NERA 3PABB 3CN0A 1FYHB 1M3JA 3KAAA 5GISH 1OT4A 1SPDA 1U4FA 3BUTA 3OZLA 4O2FA 2YAQA 1A6WH 2AAAA 2BIMA 3LPFA 4MQ7B 1FFQA 2YWYA 1L7TH 4UV7L 3D2UD 3NRPA 3RKPA 4Y5YB 1ZSHA 2FJUB 1KJ2H 2NZ1A 5BW7C 1V7NH 4G9FA 4HLJA 2XBTA 3K72A 4QXVA 1XXDC 2ICEB 3N85L 3CIQA 3RHWF 1LEGB 3VFWB 5GGVY 5E8PA 1FVDA 1UD4A 4ZUUB 3TGXA 5GISL 1U95B 4XC1L 1JAEA 5DEJA 1NBVH 1BLNB 1RUQH 3DIVA 4P2YA 2Y5QA 2D2OA 2G5BA 4HGWB 4I7ZC 4X6FA 3QCTL 32C2B 2ZAIA 4YWGL 4KH9A 4MXWL 2BFVL 1A3LH 4FI8A 5FOJA 5GSVA 3TYGH 2XBDA 4KKAC 1KXTA 2MWCA 4DK6A 2FHCA 3O11B 4FJZA 3NCYP 2W80C 1INDH 4FFYA 1XF2A 4MCZB 2HVKA 1ZK5A 1OK8A 1CDCA 2DYPA 1SYSB 2G9HB 5I8EB 3VFGH 1N67A 3O41A 2UZIH 3VJ6B 2WYHA 3DBSA 2VDMB 3BN9D 1A7RL 1U58B 1A6ZB 1XF5A 3BEWB 3MMEB 4HPOH 1LLAA 4NN5B 5KVDL 1IGFL 2FGWH 5CINL 5CZVL 5MEQB 1S7WB 2YLHA 3GI9L 3G04B 3ZHKA 3QFDA 5EZPA 4RRPG 4MXWH 2PP7A 5AVUB 4I1RA 1U8JB 2LVEA 3VD2A 4XCNA 1EO8L 1YAZA 4IHBA 5LNDA 1AZNA 3SOBL 1NM9A 1X7TA 4FZEL 5F3FA 3U46A 1E3XA 3TV8A 1N0LA 2ICEC 2VO5A 1J0YA 3QAZB 4EUPA 4RX4A 4F8QA 4W6XB 4PJIF 5KBDA 4DKAA 1OAUL 5J0BA 2AZUA 3EOYG 3JWNH 1DJYA 4P57B 1SXAA 3VFSA 1S78D 4XMKH 2IG2H 1XH3A 3DHPA 3KZ8A 5I30H 4DERA 4K9EC 2EDTA 1NGYA 1BZ9B 1FVEB 2MPAH 4ZNEE 5GS0D 1XO8A 2CJ3A 5IHLB 2JB5H 4QHMB 4E9XA 1LO4H 2R4RH 3QZWA 3B2UC 3ZUCA 3DSFH 3LS5H 5AVQB 1KY7A 5I1AA 4U1NB 4FXKC 4EN3B 1I9JL 3FFCD 4EBQH 2MCPH 5EEVA 3GMLB 1PZBA 2C1PB 2M8XA 5GGRY 2CK0H 4N2MA 5H94B 1WS7A 1E9OA 1G7MA 2XWXA 3VTMA 2OMVB 3PAYA 3D3VE 4ZW8A 1SN5A 5HYJE 1YPZF 4KY1L 3KXFD 3O0LA 3IPFA 2A83B 2PR4H 2ZWLT 4U1GB 5CN2A 5FV1L 4J4PA 1A6UL 3DX8A 3GKZA 1MQKL 1ERNA 1SY6A 3RWEB 4ERSL 3O4LE 1QSEA 1XGUA 3IU4H 4O2CB 4ZK8A 4NJAL 3WLBB 3RFZC 3CDGA 2LU4A 5EU5B 2Y3NA 4DGVL 3VXUE 3HB3B 2OL3A 3L45A 1J05A 4PP1D 1JGEB 2NQ3A 1CFNA 2KZ1B 4PGCB 5EU6A 4AV4A 4MA8H 1M7UA 3FTXA 3RIFK 2PTVA 1DANT 4P0DA 1T7VA 3V0VB 4I0PD 3LS4L 1D5RA 4AYDC 5DHYB 1I1CA 5KVFH 4TTGA 3MR9A 3L1OH 2EDOA 1IB5A 3D30A 5TFSL 3S0PA 1QLFB 4P8QA 3LH8A 3PP4H 1CICA 3KE0A 5K59E 3PQYE 3DV4A 4FQQA 4ZODA 4JFTA 1AQDB 3SYQA 4FQ1H 3SE9H 5FFLA 2ZP9A 1IC4L 3H6JA 2YK1L 5HD8D 4QTHA 3ESMA 2A6IA 3JWDH 5DQDH 4YFEA 1WEJL 4AJWA 5D93B 3HRZC 1FWXA 3CSBA 5FM4A 5I24A 4K3DL 1JNHA 3KCPA 4P2OB 1IQDA 2OJEA 1UT9A 3O45B 4CL7A 2P8MA 2QTEA 1UCBH 3U9WA 5TGBA 1P5VA 5SWSA 2XOTA 2ADYA 3BSZH 1G6VK 4YNYA 3G3LA 2X9YA 3SE8L 4WCYL 4BD4A 1NIAA 4CSPA 2AEOA 9CGTA 4GI6A 2EKSA 2QEJA 1F6AA 4O51A 4PRHA 4AIEA 1MHPL 5EBWB 1AGEA 4OUUA 1GIGH 1DQDL 3TURA 3KS0H 3VXQB 5H8DA 3TJEL 2OMUA 5KYYA 1YPZA 4BQ6A 2YGPA 2Q7YB 4YBHA 1SVZA 3HZYA 3C60C 3U0PA 1IL1A 3I6LE 4CC1A 1NCBH 4N2GA 5F7WC 3W9EA 4HG4J 5GIRB 1A4BA 1RZKL 1ZY9A 3S5ZA 2F8IA 4GI9A 1IEBB 1J9RA 2BVEA 3O3BB 4LOFA 2CKBH 3D0AA 3MUZ1 3ZKSD 5J7CC 1TZGL 4M1CC 2B2XL 4FQXC 3K81A 3QR0A 3PFQA 5I1HL 3VD1A 2Y7LA 1A0QL 1AHMA 4HWBA 3BN9C 4PAZA 3CFCH 4NZJA 1S7XB 2UY6B 4PJGA 3THMH 5D1ZI 1WIPA 2IGLA 1IM9D 3QEGH 1YYML 1CLVA 2P43B 4ZPTB 1P6AB 3QG6B 1N64H 4OY9A 5KYNA 3MA9H 3WJJA 2XC8A 3MCYA 1J18A 2YS4A 4JRFA 1IKNA 4PTTA 1BJ8A 3FZUD 4ELKA 1KLFB 3OJDB 3JTTA 4XVJH 1AGBA 4X6FB 1HN1A 3NCXA 4AQ8A 4Z78A 4BKLB 3PWUB 1ADQA 1F4AA 5KUKA 2BVOB 1U8HA 3DC0A 3WJLC 5TF1L 4N8PA 2ATPB 5C0EA 3VXUD 3IGAA 1JTOA 4ICWA 4Z0BH 4ZUVA 2GI7A 3MV01 5FCUH 3ISYA 1KC5L 2X4OB 4HETA 3UTSD 3NIFE 3O2DH 1KNOA 3PQYA 3FL7A 4LRIC 3FFDB 1WD8A 4FQJH 4R8WL 4KNUA 5I0YA 2YEVB 4B5EA 1ZHKA 4KZDH 5E8DL 1LNUB 2VABB 3U9UB 5C0ND 4DK5A 4OCSL 2ATAA 3PWJB 2BNQB 3CVCA 4PLJC 1ET8A 1NUNB 4UZGA 2AP2A 4LVNC 4UBDC 4L8CB 3W2DL 1VB9A 1F18A 3X13A 3TLRA 3C12A 4WK4B 4R2GD 4CVUA 1I3UA 3IXAB 2DH3A 3TBVB 2YAFA 1IGIL 3MLWL 2W59A 3FB5B 3JVFC 2FQEA 1GYCA 1NAMA 2V9TA 2Q6WA 2ZXBA 2EZ0D 4QOKA 4G6AC 5AENA 4AYEC 4OZIB 3HKZA 1SXNA 4JFFB 3KYNB 3LKSA 5EO1B 3ARBC 4MCZA 3MRDA 1ORSB 3O3AA 4MBRA 2HXAA 4JLRB 2W65B 1ICTA 4OFDA 4IDLA 2WLKA 2O5XH 2JWYA 4YL4A 4Z7UF 3TFKD 5GRYA 4FGMA 5IQ7L 5M95B 4MAUL 3C60B 4UNIA 1WFTA 4FTDA 4H2CA 4JB9H 3CMOL 2ZCZA 3QR1A 1QFHA 3T6ZA 1GW6A 2YXWA 4ZUTA 3ZT6A 4AM0Q 4UM9D 3PAUA 3D39E 4ISVB 1QA9B 3L3IB 1DUYB 3VFUB 4C58B 1UH3A 3D06A 2HZHA 3HHSB 2BOBB 1S7RA 3VXTA 4OKVA 4JJHA 2FEEL 1XD1A 3QUYB 5D1QC 1EH9A 4GAAA 3WDHA 3MXWH 4LCVA 3L7FB 1SVCP 3GHEH 4NM8H 5IW3A 2QBWA 3ES6A 1JGEA 3PWPB 1T5WA 1JVLA 5DUPH 1JK9A 4R0LA 43C9A 3LN4A 2HJKA 4TUKH 2DN7A 1EEZB 2ZXAA 2R8SH 3KG5A 2F54A 3CZUB 4I1NB 2BS9A 3PF2A 1FO0H 1OM3H 4G6FB 5E5MB 3CVHB 1NCGA 2OMTA 3ILDA 1HXKA 1FN4A 1BF5A 2MNJB 4MMZB 5ANHA 1KN2L 5EU4B 1MVFA 2XI9A 3VXMA 4KX8A 2R0LH 3MACH 4OFIA 3S4SA 1FC1A 3OSVA 3V95A 3MV8E 4X9HA 4GRMA 3RX8A 5DJAA 1DQQA 3ZTNH 1AFVH 5IHHA 1JPEA 1H15A 4IOFD 4XX5A 5T3XD 2UWEA 3S36L 2QR0B 5JLZB 1A8ZA 1ETB1 5T1LD 3V6OE 3JXAA 3Q48A 2QVTA 2NY2B 1CFTA 2G3XA 3UBXG 2V5SA 3VD9A 2WV3A 5D2NC 3QJFB 3NJKA 1UGNA 2JKSA 5ETUB 4BV1A 3GSNH 3CSTA 15C8L 3UMNA 4OZFH 5C0AA 3BD4A 1QLEB 4HHGA 4N8CL 3WIHA 4IU2B 3V0IA 1KJVB 2ZCKH 2VR9A 4NO3B 1GJIA 3TZVD 3SZ6A 1WC7A 2BNQD 2K78A 4L3EE 5L6YL 4TNVK 5CLZA 5F70A 3ZE1F 1K8DB 2O5YL 2FWUA 4KMTL 1L6XA 4X6EA 1GXEA 1CURA 5SWZA 2AK4D 2Y0SA 2Z0UA 4LSQH 3V4VH 2UZXB 2O61A 1CMOA 2R1YB 2VKWA 4WW2F 2ZD0A 4LESA 3BJLA 1EFQA 4HIEA 5E94B 5A16B 2E74C 2QQLH 4LRNL 4X8XA 5I2IB 2FL5B 5K1VA 2DMBA 2NR6D 1LO0L 2CG9X 5I16A 3E80A 4N8CH 4NYLA 3P4NB 1JHKL 4L1DA 4NQCE 2VR5A 3PDDA 4E5XB 4DN3L 1R6VA 1QX1A 1SOSA 3V0AC 1C16B 3RWGB 3QS2A 2FE0A 5EIIB 3L4UA 4XB7A 5BZDA 4CGTA 2YMOA 4X9IA 5F6IB 1CFVL 1E5YA 1NAKL 2I5YH 1RMFL 2C26A 2CJTA 4P2OA 3TBTA 2DYPB 1S7UA 3VRIB 2ZG1A 4ODXA 5JIKA 5SWZD 4GIPD 5B39A 2EH8L 5DO2C 4R96B 4X0NA 3L5JA 5I71B 4O02B 2GG1A 4XPTH 4EIZC 1JPGA 3D08A 5EZLA 5ITFB 1CT8B 2EUWA 4DESA 2FR4B 1OSZB 1I1AA 3FRUA 3VDAA 4XPGL 2JCCB 5D1QE 5ACMA 3TNNB 3IMBA 2WIIA 3HZKA 4QTIH 5EZIL 4K5NA 4PJ7E 2WNKA 3GMQB 4ZQKA 5IMLB 3EKCA 4ODTL 3M1CA 1NAKH 2I5YL 1RUAL 1W0VA 3NIFF 3P3RA 1L5GB 3VRLF 5K59F 5DRNB 3V0GA 3CSFA 1FZJB 1F4YH 4IGBA 5EU3B 1YJDL 3E1F1 1YN7B 2R0WL 4PR5B 4WJ5B 1BMWA 4JCMA 3VMPA 5TE6L 3UAJC 1J1XL 3VFRB 4Z3JA 5D7JA 1TVDA 1BPLB 4YUEL 5ID1B 2YD2A 2X28A 3GMOB 1BYOA 2Q3AA 1S7QB 2IGTA 1X7QB 2K9FB 2X53A 1A6WL 2WZ0A 1F02I 1FCCA 1AE6L 2VDKH 1O6SA 4ODHH 1YJDH 4E9QA 4MDRA 3OQ3B 5HDBE 3WFHB 5ANMB 5ESQA 3FTGA 1WBZA 2NRDA 2RHEA 1RZ7H 2B7DT 4PGBA 4G9FB 3K7UA 3BSGA 2WQSA 2YUVA 1A1OB 5LKNA 3C6LA 4HUMB 1GTNA 4GUQA 5LXVA 3QDHA 5I19L 3SIKA 2AV7B 4OCRH 4S0TD 2DD8H 3N42B 5MP6L 2X70A 3WFCL 1I9IL 1AHWA 2HX9A 3ESNA 3PJSB 5CFAA 1K8IB 4G8EB 4MXQC 5E00B 4OI9A 4P2OD 4ANVA 4HUKB 4OZIF 3FOLA 4JJ5A 3ZQWA 1CC3A 2CIKA 2VM4A 3DXAD 4FKKA 4QRQA 1M6OB 4YAQB 3CIAA 1II4E 1N0XL 1U6AL 2IQAB 4TUJA 1BF2A 5B3JF 4FP8L 2E6PA 3B6SB 3ZKQD 2F53B 3QJRB 4JGUA 3GSQA 4N9GB 4F7PB 2WLIB 3HBZA 1NKRA 2FT7A 5D1ZA 5DD3L 1GZPA 3BPOC 3P2BA 5MHSD 3QP3A 3QUKB 4HBCH 5EU4A 5I73C 3GBDA 3VGAB 4ZS7H 4MRCA 2CO1A 2YPKB 1QSFB 4FFZA 3WJLA 2Y5EA 1E40A 2AVFA 4Y88A 3EW3B 2ZX6A 2E46A 4JQXC 3OKMA 5BV7H 4JHWL 4BE5A 2OMWB 3FT2B 2Y36H 1I4FA 3R4DA 3ZRFC 5DEZA 2PPCA 3CH1B 5JQIB 4XCCL 4RAHA 1QTPA 4S1DC 4FQPA 1VF5C 5IFAH 1HH6B 1NSNH