4IBZA

Human p53 core domain with hot spot mutation r273c and second-site suppressor mutation t284r
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
193
structure length
193
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVCVCACPGRDRRREEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title Structural studies of p53 inactivation by DNA-contact mutations and its rescue by suppressor mutations via alternative protein-DNA interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 44
structure length 193
sequence length 193
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ibzA00
2ADYA 4GUOA 3WTUA 5AOMA 3WTVA 5AOJA 5G4MA 1LJMA 5AOLA 4AGOA 1UOLA 4G82A 3TS8A 5BUAA 4IBQA 2P52A 3D05A 3WTYA 3IGKA 3QYNA 2J21A 1TSRA 4MZRA 3Q06A 2OCJA 1IO4C 4XR8C 2J6WA 3IGLA 3QYMA 4KVPA 4IBTA 3VD0A 5LAPA 3VD1A 4IBWA 2H1LM 2X0VA 2IOMA 1GZHA 1HJCA 4LOFA 2GEQA 3EXJA 2VUKA 5G4NA 3ZMEA 4L0ZA 2RMNA 2J1XA 3US0A 4HJEA 4LO9A 3D0AA 3US1A 4A63A 2XWRA 2XWCA 4MZIA 5A7BA 3D08A 3WU1A 2BIOA 5LGYA 4IBYA 1HJBC 2IOIA 3KZ8A 3WTWA 3D07A 2BIQA 2PCXA 1TUPA 4IBUA 1H9DA 2AHIA 1EAOA 3D06A 3WTXA 2AC0A 2FEJA 3KMDA 2BIPA 2J1YA 2BINA 4AGMA 5AOIA 4IBSA 3WTTA 3WTSA 4AGQA 4LOEA 5ABAA 2J1WA 2J20A 3Q05A 3VD2A 2BIMA 1GZHC 2X0WA 4L0YA 1EANA 5ECGA 1CO1A 5AB9A 2YBGA 4IJTA 3D09A 4L18A 4G83A 4AGPA 2X0UA 5KBDA 1T4WA 2WGXA 5G4OA 2J1ZA 4QO1B 4AGNA 4AGLA 2MEJB 4GUQA 1CMOA 1HU8A 1E50A 3Q01A 2ATAA 4IBVA 2IOOA 5AOKA 4IBZA 1YCSA 1EAQA 3EXLA 1KZYA
chains in the Genus database with same CATH superfamily
1PZ5B 3JTSB 2CU9A 1MJUH 3TH2T 1ZSHA 4A6YB 4TNFA 5FKAA 1QPPA 1SFHA 1GGCH 2AJYH 1FV1A 2CIKA 3WTYA 3ARFC 5CUSH 5B39A 3FW6A 25C8H 2I5YL 1XF4A 1BQRA 1EJ6A 2CO7A 4IDLA 1DBML 1J9CT 4JQVA 4NKOB 4Q6IB 3MXVH 4Y5XB 1IEBB 4AYBA 3QO0A 1FVCA 3CHSA 2OTWA 3RGVD 4WO4D 3T2QA 3TCLA 2OV0A 3E8UH 3TNMA 1OAUL 2R59A 3ZRFC 1HWHB 4MAYA 4PWHA 5JW4N 2V2WB 4PJEF 7PCYA 1B9ZA 2J43A 1ZJAA 1P4UA 4S11A 1RVFH 4O02B 4P46A 5CZVH 2CMRL 1CICA 1OCCB 1HNFA 1NIFA 1WAAE 1JK9A 3B43A 3SOBL 3WI9A 1J8HA 1Q0XL 5I9QC 5K59E 3KJ4B 2P5EB 4XCNA 3M88A 2GJ6E 3G6DL 2FIRT 3FQRA 2MQCA 5EN2B 5TTRA 1ANUA 2H3KA 2ZF9A 5KSUA 4Y88A 4IMLB 3MRJB 4FYRA 3CD4A 4XNDA 4NHUB 4ZFFA 2VB5A 3LRLA 1E27B 1JZDC 3LYRA 3N5AA 3QCVL 2R1WA 1H9DA 1FQ9C 4KUCF 1OKEA 4MJIE 3Q8EA 3GRGA 1NQBA 4OLWH 4NUJB 4EIZC 3UYRH 2YMXH 4IKNA 1NCOA 3C6SA 5JO5B 4JFDE 1BFTA 4NN5B 4AQAA 5JYMA 1QZ1A 5HHOE 4OLXH 4AKPA 1A9BB 4YIQA 5T5NF 4J3UA 1PD0A 3FO9A 1YNKH 2WLLB 1NMBH 3QO1A 1QEWA 3BZ4B 2E7MA 1MZYA 4EXKA 5C0ND 3MC0A 4ZXBA 3QEHB 1HL8A 6PCYA 1IGIH 5L4MA 1UADC 1QRND 4HKXB 1U8CA 5IQ9A 3ESUF 5DMGD 1UJ3C 1OTTD 1FIGH 1S5IL 4APQC 4M8RA 4P2AA 4LLYA 3A6BH 4X6CE 4RX4A 2BLFA 2QGBA 3JV6A 5E2UL 2ICWA 2ITCA 5EULV 2DQGL 5JXEA 4PJCF 1OGAE 1OZTG 1JGDA 2W0LA 4BUGA 4DIXA 1DVFA 1R47A 3CXFA 5DDHA 2NUPA 5EZJB 3IFLL 4TL4A 3NRFA 3N42B 4PRHD 1RZIA 3TESA 1JN6A 5AYQA 3VRJB 4HMEA 5JXAH 1TZHB 3H2QA 1KGXA 5T5FH 3ABLB 3S34H 3DC0A 3PHQA 1M1SA 1DANT 2KT6A 3U1PA 4AEIL 4AENA 3RFZA 1NCTA 4OZHE 5AB0A 4Q58C 5B38B 4GAGL 1NUNB 5DEFA 3Q6FA 2COQA 2YD9A 2WZ6A 3ES6B 2GJZA 2YN5A 5EB9A 4IBWA 3RPIA 3HN8A 1E4KC 1AKJB 4V1DE 2XV0A 2OCFD 1S7VB 2IPUG 3FT0A 2DM7A 3DX1A 4UTAA 3CX5K 2WXQA 4E9SA 4IHBA 1MY7A 2VQ1A 4UT6L 2PTTA 2PCFA 1Q8MA 4JCLA 4LHUB 4JGUA 4D0DB 4KKNA 2LV4A 2FYYB 4UM8B 1MRFH 4F9LC 2XI9A 3L95A 3RWGB 3LPGA 4ZW6A 1BF5A 4P2QE 1AR1C 1ECZA 2OX5B 5AUMA 5I0YA 3WENA 4Q74A 4KK5C 4U6VL 1VCBC 1CYGA 1F90L 4ADIA 1ND0A 3W5MA 1U3HA 4ONFL 4PY8I 3WHE1 1JZ8A 2W0PA 2YPLB 1DQQA 2Y5QA 3KBEA 1TYEB 5HHQB 2B1HL 2F58H 2YRBA 5IESH 1JRHI 4HUNB 2VLRD 1KXTA 2GB2A 3T2LA 2VXQL 4TS6A 5DVPA 4J2QA 5AYUL 1WFOA 2H47C 2W92A 3Q5OA 3CUPA 1NDTA 3MUGB 2Z8VC 4M43L 3ZKSD 43CAB 4IRZH 3U0PA 1SJEA 2X70B 4L4TE 4DP1X 3IBEA 4DKAA 4HISA 2HTLD 5EUOA 5LBSH 1MQ8A 1F2QA 2ADGB 2PP9A 4CVUA 2X4OB 4F92B 1A7OH 4M6NH 1IEHA 1U2YA 4X5RA 3WKNA 2GSGB 1KFAL 1XSIA 4DKFL 2QMJA 1N5YL 4PYHA 4OFYA 2XQYA 3LS4H 1HHHB 5AW9B 4BFEA 4GKZB 5GGQL 5T8IA 3V79C 3KLAA 4Z3EA 3GBMH 1I1AB 3EFOA 5JOFB 2PCPB 2X4NA 3FT3B 2YAQA 3NGBC 5D96B 4BKTC 5F7WC 2VL5A 5T5FA 4WUUE 2IPTL 2J57A 2YEQA 2Q1EA 4NUQA 2MPAH 3MLRH 4G6FB 4CAGA 1ZJBA 4PREA 1IIIA 2UXVA 1LL1A 2B2XH 1ITBB 3KYOB 4FXKA 3GIZL 2J5LB 3RUGE 4AI7A 4U0QB 5CF3A 1VIWA 3HNSH 2NY7H 5B8CC 3PGDA 3I50L 2JF1A 3WFBL 3KPPA 4LCIL 5C3IA 4GO9A 1FNAA 1BFSA 4LOVA 4AM0A 5F0JB 1UD5A 3T8MA 2CPCA 5BXFA 4LVOB 3L4ZA 3EJUA 1NKRA 4FHBD 1ACZA 5LO7A 2F2HA 3MRIB 2CAKA 2B0SL 2A9CA 1B4JH 2E4FA 2HH0L 4FTVD 4JS7A 5D7JB 5DJDA 1NOAA 2EUZA 3F84A 4JUSA 1NLDL 4LU5H 2AK4D 1T5XA 3GSNB 4PJXB 4XP1H 4HPYH 4EOWL 2DW5A 2KI6A 5TFSL 3DHUA 4UQ2A 5B3SB 4Y1AA 4UQ3A 1G7LA 2AKRA 2ED6A 4LGSB 4A7VA 1FNEA 3FL7A 4FCHA 5FM5M 4DPBX 2ZWNA 3KS0J 4HG4K 3BVTA 3TXAA 3OSVA 5I73B 1YEWA 2IOMA 3BSZH 3P73A 4KK6C 1OAYL 1YY9C 1XB3A 1E9PB 3WN6A 4YHMH 4UNIA 4JY4B 3OMIB 1LQSR 3MQIA 5ACMA 1QLEB 3EXJA 5AAPA 2N0KA 5KYWB 3DBXB 4PCTA 4XBEH 3WSQL 1FVDB 4GAJH 3CBRA 2HUHA 3GS4A 1J8HE 3NAAH 5F1NA 4ANWA 5HVWA 3WJJC 4PR5B 4LF3A 3PXLA 3ETTA 1UZ8A 4IRZA 4Q6KA 5LN8A 2EXSA 2FWOA 3ZRCC 2GCYB 3RP1A 1ZD6A 3ZE0F 2GTWA 5LBSA 1GPOH 4XCEB 4DP5X 32C2A 5KJRH 1B4RA 1UB6B 2QKIA 4X5WA 5C09E 1YMMA 1QFWI 5FYKD 4AE1A 2OLDA 3UCQA 1ID5I 3VSTA 5AFAA 4XVJL 4I3GA 3AADB 2WQWA 5FV2A 4G9FA 2EDHA 1G43A 3UTSE 4WK4B 3PWVA 5ICXA 2XWXA 3FSZA 4WTZG 1V10A 3V6FA 1OLLA 3DDGA 4FI7A 3L4UA 4YPJA 4EKXA 5CR8A 1HZKA 2OL3B 5DXWA 1IM9A 4DW2L 2VR6A 1MI5D 5CJ5A 1EPFA 2HT2C 2QLYA 1KYAA 3RAJH 3A21A 3BGFC 2XZQH 4UWQB 4FOMA 1P53A 3RWIA 2V8LA 2H3XC 1BCIA 4YHYC 3NSJA 4OCSL 3LKRA 3HCVA 5EU7C 1JFQL 3ZL1A 4QRRA 1B0IA 1NEZG 3QNFA 4KOCA 1JNHA 1N5AA 4PLOB 4KZCA 4JPVL 5TDNA 4NZDA 4URKA 1T1YB 1KTDB 3TGXA 5JQ6H 2AEIT 2R27A 3DNKA 3ZPDA 5TD4A 3ARGC 4PRID 1DBAL 1GJWA 1ZA3B 2BDNL 2XWEA 3C6LB 4EJ1C 3QWQB 3MV7B 2ZKYA 4NNXA 3Q2VA 3VNZA 2AJXH 1E4XL 3ZXAC 1XGZA 4XE0A 1X9RA 5BUPA 4G5ZL 3TT1H 1F45A 3EBGA 1M71A 3W57A 5L2KE 2F53B 2E47A 2PTUA 4QHMA 1LO4H 2A6KB 3TEXA 4RGNB 3FO0H 2DJSA 3BIKA 1F6LL 3BSZA 2TAAA 3HC0B 3WNOA 4MNGB 2NY4B 3MRRB 2C3WA 3GSUA 5CZXC 4NZ8A 2AVGA 3MOBL 3IGKA 3C8KA 4PCKA 1RK0A 3TN0D 1QTSA 5DJXA 4X4ME 1MREL 4AW4A 4I3RL 2GIMA 3QSKB 2DWEA 2FJGA 3VFTA 5D7SL 5BV7B 2BVPB 5I8KH 4GRMB 4X83A 4PTUB 2WBJD 3UADA 2F61A 5LBGA 1DBJH 1QQDB 2BIIA 2PXYC 2VW4A 1J0YA 4CMMA 1UC6A 4JM2A 1E5CA 4QRUA 1QHPA 5FAAA 2HFEA 4JMNA 5KG9B 5D5MF 2LOEA 3INOA 3BPNB 4U3HA 3HR6A 2VXVH 1TU2B 3DOSB 2PPEA 3PXHA 1S9KC 3GMLA 4LLVA 3MRQA 2FJHA 5T1KD 1EHAA 2H6PA 4X7CC 4Z95H 1U93A 4G8EB 3ZDXF 4HK3N 4NN6B 2DLHA 2OMXB 3L9YA 4N0YH 4HJJH 5MERB 2XN2A 2XDHA 2H32B 2XZAL 2CRIA 4TYUA 3GHBH 4X99A 3NEEA 1U8MB 3EYSL 3IDXL 5FEBA 1X5JA 3BZFA 3TBTB 3QNXB 1NFKA 4QHKJ 1NUGA 4JO2H 1NCWL 2LU3A 1QFUL 3CFUA 1QO3A 2C1PA 3D52A 4WFGE 3CDYA 1RUMH 2MOGA 1ZHNA 1FC1A 1BFOA 1L0YA 1NBVH 4H8HA 3SQOL 3BEVA 3IJEA 2QGCA 4M7JL 2EYTA 4DAGH 2TRHA 1PLBA 4L1LA 2DD8L 1TVHB 3L5XL 2BRQA 3UMNA 1K3IA 5AB9A 2VAAB 4NCDA 4ZODA 4MLSA 1EJOL 5FUZL 4NWUH 2Z7YA 4OB5H 5F70A 2FE0A 5LGJA 5EU6D 3TA3A 5HYQA 5TF1L 5I23A 2HX7A 4AJVA 4QT5B 4NC0B 3S35H 2H8PB 2VN7A 4UQBA 1H8NA 5GS0L 3MLWH 4ELME 4UDTB 3Q01A 3ELAT 2OP4H 4HHAB 4QGTA 2P48B 3IDIA 1DFBL 4JL1A 4D0BB 1SHXA 2H1XA 4U1LA 2W81C 3B37A 3WKPA 2O5ZL 3Q13A 1GS8A 5HHMB 1JS4A 3EDFA 4PGCB 4RNRB 4HQQL 1NGYB 3QQ3A 4GRLD 2W0FA 4LARL 3LZQA 1JGIA 4HXBL 4XHJD 3DX9B 1T1XA 5IB5B 2DLEA 1I9EA 1MUJA 1NSNH 2MCPL 4DQAA 2BNRB 3FULA 3II3A 4YC2B 5DJAA 1D9KC 3B9DA 4JDZA 3MGTB 5IROD 3NABH 3B2MA 1I3RB 4Y4HB 3HPJA 5TE7L 4F37K 2X0VA 4DSYA 4P9MH 1KDIA 1HOCB 1SF5A 4WNQA 4UINH 2AQQA 5CJXA 3HBQA 3T0XA 1T6BX 1YYLH 4CNIA 1BVLA 2X7LA 2Q20A 1Q9WA 3L16A 3QEQD 1W16A 2KPNA 4MCYB 3L9RA 3QP3A 1CDIA 1UWEH 1ETB1 2VJ0A 4A38A 2E9WA 1EFQA 4YLBA 3H6JA 3H3BC 3LPOA 5KVFH 4X5PA 3SY0A 3DRTA 2ZUTA 4P0DA 2VLLB 4E42A 3S5LG 3WU1A 4GG6A 4BGLA 12E8H 4I88A 3NP4A 4F2MA 4R9HA 2ZXQA 2YD6A 1UM6H 4FD0A 4JFXB 5CP7A 2MQ0A 1YMME 3BOVA 5J11B 5HGHB 1E5BA 3GSVA 5EDXA 2DPKA 1CIUA 1ODAA 2BP8A 1IGJA 2WB7A 1MH5A 4KRPB 4OIIH 4FQHA 3C09B 5EU5B 1AE6L 1PZCA 3LNHA 1UFUA 1BPVA 3MRPA 3L81A 3QUZA 5L9DL 4A04A 3WLBA 1LGVA 2ESVB 4IRSC 4RISH 1WFIA 3A6OA 4YN3A 2Y07H 5DJYA 1RZ8A 3NN8A 3HS0A 4N86A 5T3ZH 3ZIMA 4ZFGH 4K2UL 1JYXA 4KPHH 1U42A 4EN3B 1CXHA 4TPRL 3BIAX 3LQAH 3S36X 4PRAA 4OD2B 2J8UA 1PVHA 1NIAA 5HPMA 1HFUA 5TGBA 5GS1A 1FPTH 2IAMC 3AY2A 2ZXDA 5EBMA 2VITB 3U6RB 4UOQA 2JKLA 5ECGA 1A7RL 5SWZD 4G7VH 1DDHB 1I1FB 5J12B 4L29B 5A2CA 2WD0A 1K85A 5C2BH 4I0CC 3S3CB 1G0YR 1LVEA 1NANH 1NGQL 4WTZA 1E9QA 3WEAA 4K23H 1OE2A 4AL8C 1N7ML 2A73B 2IADA 4O2FB 2R83A 3EYOB 1CJYA 4LLUB 1FN4A 3D4CA 3RNQB 5EA0H 3P77A 5AOKA 4Z3TA 4BFKA 1RFDL 1KV7A 3LTVA 3W9EA 3FO2A 3EJCA 4JHZA 3K71B 1NEZA 1UCTA 3BCDA 3GI9H 3O6FA 3OVUB 3REVB 2CKBL 2E7DA 4GAYB 1COBA 5D1ZD 1FLTX 3FMGL 3Q8FA 4YDNA 3TM6A 4UIKH 3L2NA 3UPRA 1JG9A 3D05A 3AG3B 1DQLL 1PBYA 2VUOA 3QEUB 4PRNB 3FFDA 2W9DH 4QXTA 2JKJA 4FABL 4DK6A 2BWQA 4HK3J 3HBZA 1BQ5A 1WAPA 5EZPA 2NUTB 3EDEA 4YMPA 1LO5A 2A74B 3WNMA 1T7WA 3ZZSA 2EVGA 1CURA 3MRKB 3QHZL 3MV9D 5JPMC 4PRPA 5I6NA 1MFAH 4K3JH 1R3IH 4XMXA 2N7AA 4EBQH 2PR4H 4FXGA 2F5BH 4QTHA 4P2OB 1PMYA 2CLVA 2IQAA 3CU1A 5IB1A 3VXMB 4DO6A 4N0FB 4WW2C 2XWCA 3DXAA 4UIMB 3DROB 4F57L 3PP4L 4GSXA 3QWRA 3KPOA 3KXFA 1IBZA 4XO8A 5DMIL 3SEPA 5L8JB 2O26U 1RL1A 2YAEA 2NLJB 2F1BA 4H1LA 2JELL 2CZNA 2JV6A 3M7OA 1NMAH 2WKGA 5FX3A 4AUUA 2CM6A 4FXTA 2DICA 3BVNB 5JA8B 4Z3JA 3C5JB 3LKSA 1RUQL 3A0OA 1S3KL 3O2WH 4L3CA 2PYEE 3FQUA 1AGEA 4I87A 5KBMA 6FABH 2ICWI 4R26L 1IC5L 1J0KA 1R24A 1WS7A 3JWNE 5FOBB 4O58H 1PYWB 1XVSA 4GXVL 2PW2A 5CHNB 2R2EA 3L8QA 1ZK5A 1I8LC 2K3TA 3JV5A 3NQIA 1UOWA 1SVBA 3DMMD 4OQTL 4G2AA 3QJSB 1UYWL 3QDJA 3VFPA 2EJ1A 1A6AB 2DYSB 2Z4TA 2W9LA 3L4CA 5KVMC 4X7TA 4NQSB 4IJTA 4HKZB 2DWDA 2F54B 1YEDB 1OP4A 3GK8L 4XRCA 1A1MB 1IKFH 3M8OH 3DURA 5ICZA 4N2BA 3BKJL 2VDNH 3E1F1 2XTJE 5BMFL 1YC7A 3LB6C 3O41A 1X3DA 4X4ZA 5HGDA 1JHLL 1KG0A 4N9GB 4KQ4H 2HTKD 3CDGB 4EO5A 4Y19B 3K72B 3SDCB 2O5XH 3MLSL 2WTRB 3QZNA 1W72A 1NJ9B 1XGUA 2VO8A 1MCEA 1SGKA 2OMVA 2R23A 2ZCLH 5IVXE 2FO1A 4L1DA 1RUPL 3BQUA 1HHIA 2QPDB 1ZGLP 4GXFA 4AJ0A 3L3KB 2WLYA 5AEAA 5INCB 1U33A 5LB1A 3UZQB 4WJ5A 4JQIL 5LG1A 1U3YA 3K2KA 3QI9B 4R97B 4P3DB 1FYTA 4OM0L 4GKLA 4GFXA 1T22B 3EUUA 3D33A 4A7SA 5H2BA 2PXYB 3IBOA 3EHBB 5D1QA 2LAAA 1X5HA 3GB7B 3HMXL 1A3QA 3DTDA 3HA0A 1FZMA 3ABGA 4JKLA 2CWRA 5D71H 3MXWH 4KAQL 4OBRA 2LLGA 3P9WB 2JK5A 4ESKA 3CLFL 3QORA 1QVOB 2Q76A 3MJ9H 3DI3B 4YDLC 4NQDB 5EWIL 4A68A 4EI6B 1MG3C 4RFEB 3GUTB 1T0OA 2H2SC 1OANA 3BD3A 4LL4A 4D8OA 5I19H 5IKCA 1FFOB 1P6AB 4GSDL 3BAWA 1OP5K 1FGNL 3TO2B 4GG6E 2N7SA 3HE7C 1QSFB 3ECQA 4HUMB 4M1DL 4F2ME 4LASL 1HYSC 4KVCL 2UYLB 3O8XB 2XKUA 1RZKL 2VKWA 3ARED 3MMEB 3L1FA 3MRHA 2YGOA 2GEEA 4F7PA 1WP6A 1M53A 4AG4L 4Q8BA 1EAOA 2IFFL 3VXNB 3OHMB 4HWZB 4QXUL 4BWWA 1J11A 1NFAA 4W9KC 3J07A 2N7BA 2UXFA 1OP3H 4AGMA 3LQMA 4DO4A 3BGMB 2HKAA 1FGVL 2XNAA 4XN5A 3T0EC 1BP3B 5JOPD 5L8KB 4JRYB 2WWMD 4LCWA 3QUHA 3SD5A 3LEYL 3DA0A 1I8MB 3OKOB 2CJSA 5MENB 3FB8B 1ZSDB 3S5LA 1HL4A 4PHXA 3Q2WA 5IQMA 1SHWA 3DRQA 1F02I 5E9DB 1P5VA 3D09A 3K4AA 3NP3A 4R3SB 4HUKB 1BJ8A 2DQUL 1A6UL 2ATKB 4N2KA 4JZJC 2OJZL 1RUKL 4UT9L 2W65B 2V17L 4P9HH 5IK3B 3TJHD 1TCRA 4Q2ZB 3BN9C 5F7KC 3KGUA 2ZJSH 2B77A 4MMZA 3L3HA 4ZRGA 5E6SB 3WMPA 4P2YA 3P4NB 4TRPL 4B9PA 3SQBB 2IVFC 4ECNA 5IFJB 2X6BA 3QFJB 2OQJA 3SDYH 1MDAA 3ZDZF 5TH2B 1T03H 3DUUA 5B7MA 3BZDA 2O72A 4XMWA 1RZGA 3AUVA 3F7LA 5CLWA 1ZT4B 4FQIH 4FLSA 4Z7WF 1T4KA 2Z1PA 2X28A 2MPVA 1A6WL 1MIMH 4OCWL 4XPAL 4JN1H 4Q0XH 1LE5A 5HDBE 4U1SB 4JFFA 5T1MB 1YY8A 2WNGA 1IO4C 3SDAA 4NP4H 3MN8A 3IDYC 1XF5A 4NRXB 2AEQL 1I8KB 3S96A 1PAZA 5A2IH 1TEFA 2V2TA 3NSXA 3GM0A 2J25A 3FT4B 1CGVA 1XWVA 2EIEA 4JKKA 1I3GL 2X42A 1OAZH 1KJ3H 4PRPE 2ZKWA 1PQZB 2OI9C 5DFVD 3GWJA 3T1WA 4W68A 1I9JH 2F1AA 4MB1A 5DURD 1CTNA 4J2XA 4JR9L 5EU3B 2EIJB 4R0LA 4WY7H 5ISZD 4S1QH 4RZCA 3GZPA 2EE3A 3MLVL 3IKKA 1TQTA 2IV8A 3ETSA 2OMTA 2O1AA 3T1FA 3T0AA 3GJFH 3BWAA 4M6ML 3F83A 2P3YA 1BV8A 1S46A 3BRDA 4D3CH 2KS0A 3UJJL 2P8PB 3UFIA 3WNIA 2UXGA 3DIFA 2IXQB 1A1OA 1KTLA 2W07B 1CL7H 5ENWB 3I85A 4GW1A 2BSED 1QX1A 3FUJA 3MVSA 4OF6A 4BEIA 3TZVC 3C5ZB 5F9AC 1X5FA 4GI9A 4WV1A 1MCPL 1GGBH 3U9PL 2XV3A 2Q7YA 5E8OA 2HKHH 1EERB 5GS3A 3SPHA 1JHTB 4ZUSB 3VXUD 3QS3A 4PBWD 2JIXD 2H2PC 4BA8A 2OTUA 3QDGD 3RL1A 2HRPH 2J20A 3RZCB 4Y2DD 2EECA 3UAJD 2ZQKA 4ZW8A 1MHHA 3G6AB 2YWZA 2DMGA 3F7YA 3PPSA 3QDJE 4P59L 4GUCA 1HQRB 4QI3A 4CN4A 5CCKL 1EFXA 4N2NA 1D5IH 1KC5L 1KGCD 4JFYA 5I8OL 1SYVA 3TBBA 3QPKA 3UH8A 2IANB 1RPQA 3ECBB 2JKNA 4FLHA 4UQCA 3KNBB 1JPSH 2Y9RT 5FYJH 4ANVA 2JJVA 4L37A 4WEUD 1G9NL 3LRSB 2ZSWA 2OMNA 4KVNL 3IVKB 2KQMA 3MR9B 1QRNA 4TUUA 5GSVB 5GZOA 4ACTA 2VGLM 3OHXA 4KZDL 1SY6L 2EC8A 1QTYT 3CFBB 4UAOC 4GBXA 1ORSA 2BNUB 3POHA 1K2DB 4AYFB 3RILA 5JIMA 5SX4H 1CG9A 1J5HA 1PY9A 5JIDA 4G8IB 4M3KB 4OLUH 2PP7A 4XZUB 2LFGA 2CCVA 3IJSB 3OB0K 5FUOL 5BRZE 5D7KE 5DSCB 1B0WA 2IH8A 4I77L 5IJKC 3F7VB 4K3EH 1HHKA 1TMQA 4K9JA 1FYTE 2AJUL 4PJ8A 4WSGA 1G7MB 3GJFA 4KKZA 2BX5A 5CEZL 2QPEB 1IBFA 2OZ4H 5KSAA 3B1TA 3VI4F 3GMNB 5F9DC 4KITB 4DN4H 3BO8A 5LUMA 3FB7A 5K93A 2EUVA 4P23A 1JP5A 1WO2A 4GOSA 2Y3NA 1EXUB 5GSRB 3SGJC 1R34A 4W9GC 1V3KA 3W2DH 4FERA 3ULUD 3COOA 2EE6A 4J4PD 4QRPD 2NY3B 3HPLA 4J6IA 3V0WL 3VX0A 2WSKA 4M7KH 1IGFL 5T3XH 4Y2OB 1IQDB 3K46A 5CLTA 2OSWA 2VSCA 4XP6H 1RIUH 2CCLA 4HUWB 2Z9TA 5E4OA 2YRLA 3LXAA 1OSZB 4J3XA 3DKHA 5B1KA 1OO2A 4WI0B 3SDXE 1YUHB 5BZDA 4YHNB 2J72A 2BNQD 4PRBB 2JXMA 2R4SL 1HESA 3QC5X 1KTBA 2MHAA 3NDZE 4IOSD 1CU4L 4HETA 5GGVH 1Q0YH 1FNSL 2YK1L 2YRPA 3L4VA 3AMLA 4HH9A 3LXCA 4YK4C 4YDVA 1KWKA 2BW5A 4MZ2A 3RDJA 1HX0A 4MA8L 1HOEA 1NC4B 2P24A 3CHXA 1AMYA 3IDJA 2R0LL 3M45A 4GAFB 1AS7A 1BZEA 5DZOA 5ESQB 1U2HA 4V2CB 4LCWE 1BXUA 3TWCL 3KH3A 2AQ3A 5L4IA 1XGRB 2I07B 1V7MH 1EANA 3B5GA 2UY6B 1LMIA 1U8OA 4PGEB 4TVPD 4YVNA 2WV3A 1ZGLB 3K2IA 3EGDA 1E90A 1W0VA 4L3ED 4Y4KB 5AW3B 1E8WA 4ODTL 2NTFB 2A6JB 2QADD 2ODIA 5EPMA 1DE4A 2JFCA 3UG5A 5E4AA 4AGLA 2VIRB 4PJDA 4NKIL 4KMQA 4HWBL 3WMQA 1IILE 2FNWA 3BSHA 1VF5C 2C3HA 4JKPH 5EOCL 2VW7A 2HT3D 4MNHA 3PABB 3RY6A 5D7IE 2QHLA 2P5WB 2GTQA 1M3JA 2VYRE 3FQ4A 3H2PA 2R1YA 4XX1G 3X1BA 3N1FC 4CRPA 1KN4H 1IAKA 3MNWB 4K94C 4YE4H 1M7XA 5CEZE 1BDYA 4LIQH 4M61B 2F74A 2W59A 3HI6H 4Q9BA 3CTTA 2P46B 3D9AL 4ZZKA 3T3MB 1RJLA 1TTAA 4DFHA 2SEBB 3V9CA 5DCCA 2WXPA 4N24A 5J56B 4YZFF 4PP2B 1ZWIB 1YN6B 1RPUA 1CLZL 5HYSB 3UACA 1YA5A 1M2VB 4KU1A 5C0EB 3T8XB 2VDKB 3ZHLA 4HJGB 4MQXD 4I8DA 1EJFA 2D3NA 3IKCA 1D6EB 1JPFB 1WAEA 3OGCB 4TUOA 3MRMA 5DRWA 4ZO7A 5FA4B 3ZUCA 5D9SA 5J6GA 4XNZB 4PJAB 4QHUA 2G2RB 4C56D 4XMPL 4R8WL 5E0FA 1ZS8A 3VXTA 3HAEG 3CFEB 4YDIH 4KQ0A 1AZZC 1VEOA 5D6DA 3VWKA 2GBTA 3TIEB 3US0A 2H26B 4NWTL 4YSTA 2C7UB 2XOTA 3EOBA 1FWXA 3QFDA 3DARA 3OKNA 3ASOB 2K4AA 5HYJB 3WEXB 4K9EH 1NCBL 2RCSL 5ITFB 3HE6A 4KTDH 4GKSA 1ROCA 1OVZA 1WA1X 2ZX7A 3B2PA 4YDJA 2A6DB 1WH0A 3DWTA 3VA6A 4UCFA 43C9B 4ADJA 1CE6A 2PR9A 2DIJA 3MV01 2DY2A 1T2JA 3X11B 2A9BA 2ZNWA 3HN5A 1AANA 4JQVC 5KSBB 1TOXA 1G9MC 4ZX3A 2YGPA 1XIWB 4DETA 5K33A 3KBFA 1CVRA 4LP8A 1P6WA 4POYA 3NG5A 5FECB 1C08A 2HUEA 5I1KL 1PCXA 2CDGB 4MAYC 3QRGH 1KYFA 3MFFA 5F7BA 1J10A 2R69H 4OBSA 5ESVA 4FYSA 4HFUL 3LH2H 4P46C 1CICC 5I1JL 3LEVL 5E08H 2YAHA 1NFIB 2XPGA 2FJFB 4HJ1A 1SOQA 5ICYB 1E4HA 2C7FA 4N4YB 3RKPA 3MRCA 1BQLH 3V0EA 1OAXL 2FBRA 4BKLB 3V8CA 4LCUA 4XOBA 2HMIC 5JW3H 4S2SA 1QRNE 4LAQH 3L3JA 4Q9QL 1GOGA 4JPKL 4PY7B 2Y7SA 3QUMH 5AZUA 3OB8A 3B2DC 3WV0A 2H9GB 3DOHA 3WO3B 2X1WL 2HPTA 1BVOA 1MWAL 1HK6A 4H2AA 1NFDB 1EXHA 4UBDC 3LMJL 1UXSB 4BZ1L 3SKUD 1T3FB 3VMOA 1J1XL 2C1OA 3IDYB 3MNMA 1U8KB 4L0PB 1N64L 4MNQA 4G6KL 4PRHE 1L5GB 1NIDA 3LNDA 3PREA 4NQVA 3N0AA 3O11A 3DV4A 3MV7D 2W0KA 3G6JB 1JPTL 4LFHG 4MDIB 1QPKA 4F8LA 3OKYA 2OYLA 8FABB 4P07A 3GTVA 4M8VA 1BEXA 3DHPA 2OYMA 1NANI 3IDGA 4XNMB 1HE7A 4ZXBC 4FG6D 2K8MA 1ZAGA 3HG3A 4A2MA 4DGYH 5CD3A 5F7NC 4E0RA 5C0CA 3PL6D 1F4YL 4BE6A 1HT6A 4NM8H 3KAAA 4N2AA 4J6RH 4FN0A 3CFDA 3OKLA 5IB4A 2DQIL 1ORQB 3V0HA 5JXEC 3TURA 4QOKD 1BJ1J 1W0WA 3I6KA 4WNJA 3F64A 1DVFC 2WCGA 4IOIA 5MI0B 2X9XA 4R7DA 1DBKL 3BUTA 3F01A 1IGML 1M6OB 3BFQG 3CE1A 4OGAD 3TZVB 3NESA 5KYUA 4XNUH 5TE4L 4B27A 2R69A 3BW9B 1ZLVH 4KKPA 4F58L 1MCNA 1CFSB 5HY9A 2OTPA 4KMTL 5J13B 4ATWA 3KMDA 1CYXA 3RFZC 1J0IA 2IWGA 4M5ZH 3IFNH 3UC0H 5IBUB 2VLRE 4HIJB 1HXKA 5SWQA 4XVTH 2AGJL 3HVDA 3LV3A 4LSPL 1KLUA 4FFYH 1WIUA 4HIPA 5IIEB 5A3ID 1JHKH 5EO1B 1NGZA 1AXTL 4FRWA 3ZKQD 4KMLB 3E6HA 4LDLB 4TSCH 5FYKL 3L9BA 2VZSA 4NNPL 4FULA 1QATA 3G3LA 1IARB 4HSQA 3L5WA 2DWXA 3MDJA 5C6PB 4F7CA 4F7MB 1AIFB 4GI6A 2GJ6B 1HAWA 4IRJA 4IIQB 5BQ7B 4N8VB 2IBZX 2WHVA 4AQEB 3NA9L 3O3EA 4PJEA 4X6DE 4YSEA 1SDDB 1U8NA 4GT0A 3HAEH 3GPSA 4UM9D 3VQLA 4ZK8A 4OCLC 3MOQA 4DNLA 1QSED 4ZSOA 3U46A 5JHDD 4YX2L 4NQCD 3EJJX 1V7NH 5C08D 4MJIB 3KPLB 1I9IH 5GGSY 1U3HC 1YCSA 4KKCC 2VDMH 3GJEB 2XKNB 3QCTL 4UV4L 3W11C 4GUPA 2OJ1A 1KCSH 5KVGL 4JFDB 4JFUA 4GUOA 5FK9A 5J1AA 5HHOB 1KCWA 5C70A 3JWDL 1TYJA 2GSIA 5BO0D 2YBRA 3O3BA 3EKCA 2Z8RA 3T5WA 1BLIA 4K7FA 3CH8A 3T4AA 1QBML 2NMSA 2EEDA 3NEXA 4I2XA 2SODB 1ZTMA 2EDWA 4JJ5B 5I76B 1CDCA 3E9UA 4XC1H 2D3LA 2OCJA 4M00A 4FTVE 3O3DB 3QDMD 3RY4A 3OAZK 4IBTA 4PW3A 4DCQB 4F33A 2AK4E 3FO1A 4OGYL 5EEXA 1CD1B 1VFUA 4FQJL 2X1PA 4LSTH 3O2DL 3II1A 1VSCA 3QHFH 5IROA 1II4E 5L6YH 3MBWA 4KY1H 3DI2B 4X6CB 3KPTA 4HAKA 4JLRA 4EI5D 4WAFA 4O9HH 4N68A 1OGAB 4JDEB 4F8TA 1Y1UA 3PGCB 2H3NA 2RACA 4C4BA 4APXA 1XGYL 3GSWA 3OAYH 3V4VH 3GGWA 4KHTH 3QEQA 4FXKC 4N3UA 4FFYA 1JWSB 4K71B 3SJVA 2VLKD 5CEXA 5M95B 4XO4A 4C4KO 1FG2A 4YXHH 4D2NA 4TN9A 2VERA 5C6TL 2PWEA 4M4RB 4OZHB 7FABH 3ZN6A 3D0VA 3VGDA 5HI4C 3BCFA 3P9MB 5J1TC 5K9KB 5FYJU 2IPUK 1T83A 5FYKE 4D9QD 3FAXA 3FS9A 3MBEB 4AVKA 1JZ4A 3BP5A 5AW4B 4JRXD 3OKMB 1EEZB 5JUEL 4GMSL 3HAEA 4V1DB 3RWEA 2Y7QB 4JFPB 3RB5A 5I1DA 4FYTA 4LOEA 4HGWA 1VPOL 3CQQA 4XE5B 1YEKH 2VCOA 2PO6A 1CGWA 1MI5E 1TJIL 3H9HB 4FFZL 4FZ8H 4OJCA 3KR3L 5JZ7D 3MYJB 2X6UA 4ZUVA 2YBGA 4X5LA 1P7KB 3PHAA 4MJ6B 4LSRH 3DV6A 1YO4A 5GISL 3SBRA 1KJ2A 4P2QB 5DT1H 4PWGA 4YPGA 5CP3H 1UENA 2ZAIA 4K07A 3RVTD 3NJNA 5SWZA 1SMOA 2C5DC 3MJ6A 3B3BA 3CIAA 1BM3L 2ISDA 4X8JB 4PRIE 5MP6L 1CMOA 4G7YL 5F89B 4DTGL 4HUUA 1R17A 1E50A 1C16B 1A7BA 1B2WH 2QKIC 4UOJA 1Y6NR 3APDA 1NBYA 4Z7UF 1CFTB 5DZLA 4HDIA 1OAJA 3EJYD 1MJ7H 2ZSVB 4OLEA 4J8RA 5AOMA 5KVDL 3WN5B 4L4TB 4G59C 3I9GH 5AOJA 2XBTA 3O6KH 4YS4A 1IGCL 4HPHA 4BSVA 5T1LA 1HI6A 2CIIB 2ENQA 3SE4A 2C4XA 1BBJB 3PHSA 3EBIA 4U4BA 3V4VA 5IFAL 1ZT1A 4L4VB 3CSYA 3MBXL 4BSWA 4N5UA 3ZYOA 3BYYA 1RHHA 2HFTA 2YD5A 4JM0A 4QHNB 4MJJA 1AGFA 4WUUB 1JPST 4GINA 1S4IA 1YEGL 2WUBH 3BH9A 3M17A 1XTLA 4UQEA 5AVWB 2N1TE 2ZXGA 2ZOKB 4JFTA 3VE0A 3HHSB 2N3JA 1IEAA 3IDNB 3MREA 3ETBJ 3NOIA 4L5FH 4JMXA 4G3YH 3RUGB 1EHLL 3KVQA 3MRLB 2FSEA 3QIUD 4ILDA 1U8IA 2EXWC 3K5SA 3DPBA 5DVMA 3TTYA 2AK1L 1KB5A 1JV5A 3C60A 5BZWA 5H35B 1KIUB 2IOIA 5FKAB 4CU6A 3AT8A 1CLYH 1XO8A 1DUYA 1PU0A 3N1GC 4YHKH 4OR1A 1U8HA 3UO1H 3D8MA 1H19A 2PYFB 4GFTB 5DD1L 3NSDA 4NNYA 4M29A 5F7HA 2PLTA 1QW9A 3VFWA 3D5OF 1A5FL 2EDRA 4X9HA 3QO0B 2H5UA 2VM3A 1FVCB 5J6SA 5CP3A 4AYGA 3KPNA 1UH4A 2QGDA 2CRZA 5I66A 3MXVL 1DQKA 1ODUA 2X4RA 3UTQA 3JV4A 1ZPLA 1MQKL 1SXBA 1BYPA 1X7QB 2X1XR 5J06A 2NPLX 3L08A 3K4ZA 1D5MB 1JGVH 5LNEA 1SLWA 3RWHA 2DYPB 4H8VA 2CJUL 1P7HL 2WNWA 3MJ7A 4KGJA 4Y7MA 3KPRE 1WTLA 3QPQC 3BH8A 3FFOA 1RVFL 3QW9A 2ARJB 3ILPA 4JM2C 1TQCC 4XCNB 3LZFL 4P2RD 2DQ6A 1E5ZA 3K6IA 2O6FA 4KRMB 2R4RH 1FO0L 3JTBA 1KNOB 4KRNA 1UG9A 5AZ2H 5C09B 5C8JB 3T3MF 5IMLA 3AXLB 1O6SB 5KVDE 1CL7I 4EDXA 5I24A 2CNZA 5EU6E 4S1SL 2R1WB 3UTSB 3MODH 3QJFA 4YFLI 4NRYA 2GY5A 2X6CA 1IBHA 3A4FA 1IC4L 3PY9A 1S3RA 4B3VA 4K3GA 1VJSA 5E2TL 2FTAA 5IUCA 5E6RB 3ARTA 2NW2A 1CUOA 1U92A 4WKZB 5ECJE 5EOTB 3UYRL 2VMFA 1KXQA 1E67A 1NEUA 4H26A 1PZAA 5I8CA 1QMUA 3JWNC 1E3FA 1PZ3A 1BXXA 1HVXA 1EA9C 1WZKA 4PJAF 2BPBA 1UKQA 3GRWL 1U8JA 3V9FA 4Z7VA 3DVNB 4HMDA 2X2UA 2BVOB 3T0BA 4HCFA 2YA0A 3ZTCC 5EZOH 4FEMA 1NMBL 1CXLA 1J1PL 3GXMA 3SKMA 3Q44A 5B38G 3ZDYE 2WXKA 3IFOA 3FQ1A 2WN3A 3CGTA 1A22B 3OR7A 1U8CB 1KCRL 2OR7A 4HWEL 1XL4A 4JPIA 5KJ4A 2VDQL 4RFNC 1G4MA 4ZZFA 1ES0B 2IMNA 3JV6B 1FIGL 5L2KB 3TA3C 1OTSC 2XWJA 2RA1A 5EBWA 1GTFA 1F56A 4P48A 3RWCB 1U3NA 4YBQC 1ZDQA 5DLML 2NUPB 2JSFA 1RZJL 1J5CA 4WO0A 1P5UB 3QEQE 4LHUG 1F3DH 5I26A 5SX5H 5SX4I 5KSBF 3HW7A 3JVFC 3K74B 1BFVL 3N40F 3NJMA 1YQVH 5DD5H 2AP2A 2AZAA 2CHWA 4GQRA 2G5RA 4G8GD 1E3ZA 3QQXA 4GMTL 1PLCA 2HJLA 4JFOB 3P4MA 4R4BA 4XOCA 3P2BA 4BZ2A 4WK0B 2PWDA 2NYYD 3DO7B 1VERA 5FWRA 2D4FA 2D03H 3QR1A 3S34L 4JZNA 4N90D 1YNTA 1E7UA 4ZO8A 2VR5A 1N2RA 5F88A 2CDFA 3T77B 2F5AH 1WDAA 4N28A 4OFIA 4OGZA 1MEXH 1A6TB 2WKLA 3EO1A 4A6YH 4P5KA 1ZTXH 4HOWA 1TVDA 4NKMA 4HV8B 1U8PB 1A2YA 2EH7L 3D25A 1X5AA 5FW7A 4OZIA 2AQ1A 4LVNB 3DETD 4NZJA 1AAJA 3VD2A 3FSAA 2PTTB 2OMUA 3EYVA 4FFWD 3ZHDA 4I7ZC 4KKBC 3S88L 2QR0A 3BWSA 3NSYA 1NCDL 4JQXA 5CJXC 2FR4B 1BLNA 1INQB 2WLZA 2YA2A 1G7QA 5DMKB 1NFDF 3PWUB 4H20H 2KHAA 4RWYH 5SWZE 1IL1B 4X9GA 1AHMA 1T7VA 4PJIA 1OCWH 4AYDC 5I6PA 4O02H 2ITDB 2GI7A 5JW4M 5KVEL 2J6EH 1MW3A 5I5JA 5IFHH 3HI1A 4JRYD 3G6JF 4GKOA 4DN3H 4KK9D 4XHQA 4KXBA 3OAUL 4OCYH 4QAMB 2F58L 1P2CA 5C0GA 4M6OL 3FN9A 1AZNA 2UWEA 4NJ9L 2NXYC 2C9XA 4R7LA 5MEND 1IMHC 4M62L 3ZSSA 1YEEL 4LHJB 2EADA 3MX0A 4YHIA 1UOKA 1D5ZB 1MFCH 2CO6B 3QUZC 4J3BA 5BS0E 4PG2A 4JJHA 3MNZB 3EH4B 3RWDB 3WG7B 3RNKB 4GEJA 3HS0C 1OSPH 3P0VH 1CE1L 4GO6B 2Y2YA 2JKTM 3UTZA 2V8MA 3KLAB 3MNVA 5I2IB 3RA7H 5GS1C 4YSRA 3GKWH 4KTGA 2G60H 2P7TA 2XY1A 2GIXA 3TWYA 1EK3A 2W60B 4XCYB 4M5YH 4PREB 4NAQA 1T1ZA 1X44A 2BFVL 3V6OA 1A4JB 1CB4A 2WGNB 3MROB 3MLRL 5GIRA 3MV9E 1RURL 3ARBB 3HLAB 3ZRSA 4ELMB 4Z8FH 4B9IA 2GHZA 2HT4D 3ZO0A 1PZ5A 4ERSL 3O6MH 3JTSA 4OVVA 2ZCKH 1OOWA 5IQNA 4A6YA 3HNSL 2OYKA 4YDKH 1AC0A 3MRDB 5BXFB 4N5EC 3WIHL 1E5YA 3ZT6A 1YYMH 3P40A 4N26A 2WXOA 3O6FC 3E6FB 5J1SC 4ZAKD 3J8F7 4K5PA 1L3NA 1IEBA 2CGRH 2VH5H 4Y5XA 2NDGA 4ABQA 1CXKA 5K59F 2OMWA 2DQCH 4XP1L 4KUCD 4UV7H 1P0SE 3QIWD 4ELKA 4BSJA 5I1CH 1QLRB 2J1YA 2V2WA 5ILTH 5IMOB 1L3WA 2NY1C 1OM3L 5MEQB 3ENEA 3FONB 4EZKA 4P5SA 1LEKB 4WVRA 2CJTA 4O02A 4NZUH 3HIZA 1M7UA 3B6SB 3TO4D 3RLSA 1FYHB 2OBGA 3VXUA 2DF3A 1M9SA 4R6UA 2W9EL 4DP9X 3ORJA 4NGHH 2J8OA 2P5EA 5EN2A 4OGQC 1U6AL 2NZ9D 3V4UL 5KVEE 4MQ7B 4IMLA 3MRJA 4FLQA 4JCMA 3JZYA 4FXGC 1H3XA 4KRLB 2GTWB 5FDWB 4NHUA 1OARH 5HDLA 3SQRA 2VC2L 1E27A 3DX3A 1PL3A 4RRPM 4X5WB 1YMMB 1NL0H 4GUQA 2X9YA 3VG0L 3M1CA 2G3MA 2YJQA 3OGOE 3VQ2C 4Y2LA 5KJRL 1L6XA 3Q6GH 5BO1H 3NACL 1JOIA 4D7BA 2NY6C 1Z9LA 2I9LB 3IK2A 1UWFA 2VXUH 3LNGA 2G75B 2WTOA 3LQZB 3MV8D 4LESA 1A9BA 2ADFL 3EDJA 1I9RL 3QISA 1KEGH 2R0ZH 2WLLA 3D7PA 4ETYA 2YKKA 4X6CF 4ONGL 1FNFA 2IH3B 2B14A 5TQ2H 1DJSA 1LDPH 3HS9A 3RAJL 3UYPB 5C0DA 4PUBH 3WXWH 4PG9B 5CINH 4Z7VE 1JNHB 3WLWD 3G5ZA 4OGXL 4N2CA 1A66A 3QEHA 4XMLL 3WCYA 1WWCA 2KZ1B 3JUYA 4HKXA 3EH1A 4TQEL 1ZIAA 1GR7A 2P45B 3SBPA 1HWGB 1QACA 4NNXB 1FJ1B 2ADJB 2GAZB 3GNML 3IU4L 5LJYH 3CDCA 5M94B 1RH8A 4CKQA 4X50A 2FEDC 3ESMA 3NPSC 3ARVA 2EILB 1BD2D 1UEYA 4MYWB 3WNNA 4DZBB 4JREC 3K8LA 1VHPA 4G8FB 3EOTL 5EZJA 2QELA 2B7DT 4OLVH 3UDWA 4J4PA 3ECUA 1BZ9A 5GGTA 3VRJA 3VYNA 4AEEA 1LO4L 5A7BA 5DUPL 1TZHA 1BREA 2VT0A 3P30L 5BJTB 3BUYB 1RU9L 2JKSA 4LEEA 4I9XA 4L8SB 1IBYA 3GSUB 5AVUB 3WHXB 4NKDA 3BQUC 4XVUC 5ANHA 5B38A 1KPRA 1AZVA 3C8KB 3MCYA 2B4CH 3ES6A 3T0DA 3GEFA 5DJXB 1XSKA 4IOSA 5E51A 3NZ8B 4KDVA 1AKJA 1QBLL 2JLPA 3MA9H 4HAFA 3BAJA 1S7VA 4R7NB 3MAWA 4FLOA 4IBSA 4FQXB 4B5ZA 1NC2B 1TLKA 3NH7H 4FL4C 5HJ3B 4OZIE 2BCMA 5D1QC 2NQ3A 1G1YA 3CZNA 1VFOA 5C0IB 4LHUA 4QRUB 3OKEB 3GSNH 5JOPE 1DBJL 2HFEB 2CGZA 2FYYA 4UM8A 3DHJA 1J9RA 3RJDA 4BDVB 4Z78B 1S78D 2GTZB 3RWGA 3UCRA 3PFQA 3TVMB 1LTXA 2QSQA 1GAFL 1QNZH 2OX5A 3DJ9A 1LO2H 1MFBL 2LU5A 5D70H 1C5CH 2A77L 3LDBC 3QORC 4RMVA 3VB8A 3HI5H 1T0MB 3GMLB 5TE6H 2VXVL 1TIUA 2YPLA 1HQ4B 4FG4A 3TF7C 5HHQA 3KGSA 4PJIE 1KACB 1TDQA 2PNDA 4OFQA 4RMBA 5CFAA 1HHGB 4NCC1 1QLEH 1R3JB 4M7LL 1NAML 2X4UA 2I32A 4X99B 4I1NB 2PYEB 4MJ2A 3WIIH 2MKWA 1NGPL 3FTGB 4HJJL 3O9WB 3CFTA 4B7IA 3MUGA 43CAA 3GHBL 1GHFL 1QO3B 2R9HD 2X70A 4HKJB 4WWKB 5GRWA 2DI8A 4JO2L 3VAEA 1GMEA 2ADGA 3B83A 2X4OA 4G5AA 1MNNA 4FJYA 5DEZA 4Y9BA 1ACXA 1AJ7H 3SIKA 2GSGA 3SDDD 4G6AD 4AWJC 3U0WH 3QUYB 4ACPA 4D94A 3LRHA 1DVZA 1TQUA 2DDQL 4GKZA 1I1AA 2FX8H 3CFNA 1E6OL 4HP5A 2PCPA 2VZUA 3FT3A 3CSFA 4KNUA 1G7HB 4MQSB 1BOYA 4IU2B 1GRWA 1F1GA 2OL3H 2R7EB 4JO1L 3TOPA 4AK2A 5LGJB 2AXGB 2XTJB 2P5WD 2FATH 3QZPA 2CKBB 4NWUL 4OB5L 2HP4A 1N18A 1XSOA 3KYOA 3NDYE 1PIGA 5B21A 4MB3A 5KZCB 4M93C 4ZMNA 4F91B 1RKRA 2GSMB 1UJTA 5DJ0B 4MXQC 1HC1A 2RQEA 5HVHC 1T04B 4IU3B 3NZHL 4MMZC 3MLWL 4ZT1A 2YEVB 2P1YA 2HN7B 3VACA 4F9PA 5IVXB 4GLRI 3ML9A 3ALXA 4RGOH 5ISZE 2J88L 4ZTPH 1EO8H 4NN7B 3CJJA 1KF9B 5D7JA 2LFEA 1Z6JT 3UL4A 5LN4A 1JCKA 5K9JH 4PJXA 4HCRH 3GSNA 1J1OL 3TASA 2Z34A 3ULUL 2QPFA 5EU4A 5JHLL 3MOAH 5ITBH 1KPVB 2CO4A 3VQMA 5F6HJ 5GJSH 1SVZA 3KM2A 4JDZB 4HOXA 4I0PB 1NSNL 1F4XH 3HR5B 3GDCA 1WBZB 1CXFA 3OZKA 3BDXA 3HG4A 4ZFOL 2YA1A 5C0RH 4NQUA 3SDAC 1E9PA 3U4EB 4XBPB 1QR4A 1SOSA 4PJ9D 1GW0A 3DBXA 3UG3A 1CGSH 1UT1A 4WNQB 2R29H 1FVDA 1S5HA 1U3ZA 1FL3B 5FM8A 4ZX5A 3VXUE 1BHGA 4P9ML 3QS2A 2IBGA 4R84A 4N2FA 4PR5A 4KXZH 5E95B 2Q10A 3QDGE 2WN2A 3S6CA 3V7AG 2GCYA 4E41D 3T4YB 4Y0GA 4R0LC 1A7NH 4XCEA 4K5NA 3SY0B 2GABA 5BV7H 1UWEL 4E42B 4GG6B 3PGFL 3FUHA 4HA1A 1ZCRA 3AG1B 1E5AA 3LPPA 3PJSB 4F2MB 1KGCE 2V33A 3FC8A 4F1SA 4CBZA 4FNUA 4XP9L 3PWJB 12E8L 1TZ8A 3B3IB 1MNUH 3EDKA 5D1XD 4BFJA 4E68A 4PVLA 3OMZA 5FYLD 1WWAX 4NM4H 3QUZB 2XQBL 2CQVA 1FBIH 5HHVL 5ABZA 1LK3L 2YQ2A 1G1KA 4DF9A 1NLBH 5DJYB 4NPKA 3DX7A 3S35X 3INUH 2Q8AH 1NOFA 4WV1C 4P9HC 3A5VA 2I69A 3VJ6B 4PRAB 5HPMB 5GS1B 2R8SH 2H32H 1T1YA 1KTDA 3VGFA 3KPQA 3LQAL 4OF3A 4KNTA 3V0JA 2G4GA 4EVNB 1Y18A 3LJ3A 1ZA3A 4DUVA 5LWYH 5B3JF 4HJSA 1FFRA 3VQ1C 3C6LA 3MRNA 3L1OH 4L23A 5DRZB 3LNFA 3MV7A 4ISVB 3DX0A 2DLFL 4LBAA 4CUCA 4HCRA 1T0NB 2LGNA 1C1EL 3QIBB 4Q14A 4C59B 1GL4B 1GZHA 5EFIA 4X6EB 5K69A 1NDMB 1SEBB 4WW1B 3R7QA 5C0NC 5AVYB 2DQDH 2A6KA 4K23L 4U1JB 2C3GA 2E27L 3ULUE 5GZOC 4QRPE 3EJZC 3GINA 4BYHA 5EA0L 3OHXC 5CM1A 2ZUXA 3HC0A 2ENYA 4MNGA 3J7HA 4GBXC 3JUZA 4JO3L 2Y36H 4I18B 3VM5A 2KKQA 1JVOA 2R29A 1SN2A 4PLKC 3QWNA 3VGAB 3VD9A 3VWJB 2XPYA 4WHTB 4HJTA 1FAIH 2N4IA 4DP4X 1OV8A 3QG6B 5HDBB 4UIKL 2BNQE 2X12A 4EZJA 5IBLC 5CJOH 2BVPA 2WINB 1BBDL 4GRMA 4FNRA 4KI5D 4PTUA 1LO5B 2C9VA 1QQDA 4MAZA 2X89A 4PJ8C 4FNPA 4MA7H 2H45A 4MCMA 5KSAC 3OLGA 1Q72H 4TQHA 2KPWA 4DEWA 1SMAA 4TVUA 4PS4L 5KG9A 2CLRB 2QSVA 2IGLA 4P23C 4HT1L 4FQPA 2BIMA 1AXIB 5E1IA 4QAWA 2XN9D 2ARJQ 3GT6A 1TU2A 1R3IL 5L88L 5FW8A 2CLVB 3DOSA 5IB1B 1M05B 2YUZA 3NFSH 4W9EC 3T71A 1A8ZA 3C9NB 4XVSH 4G8EA 4TVPE 2HJKB 1CR9H 3RURA 4L3EE 2J1ZA 2X4SB 5EUOF 1CBVL 2OMXA 2TSAA 4Y9GA 5MERA 4LRNH 4X5QA 2H32A 3F05A 3FOMB 4OU3A 1BAFH 4HFWB 4PJBE 3TBTA 3QNXA 4UM9A 3LKSB 2GK0B 4YSDA 2G5BB 3GMPB 3FQUB 1QSEA 2F8VA 2IBBA 5AZEL 3E9TA 5CSGA 4X7SL 5JA9A 2WYHA 3X17A 4DWHA 1SHMA 3I6GB 3NJVA 6FABL 1OPOA 3U36B 2ALAA 5AALA 2R2EB 4NO2B 4UAHA 5FR3A 4KJWC 5GRJH 5A6LA 4ZOEA 3DGCR 2GPZA 1JSYA 2YQBA 4I0KA 1FZJA 5D7HA 3UTOA 1X5ZA 1YJDH 3CK0H 1TVHA 2O5NA 4KC3B 4HXAH 4J3OG 5C0AE 3CC1A 1QZNA 4JKMA 5F9OL 3S5YA 1I7TB 3FTYA 3WIFA 1NCIA 2DEXX 2HZHA 4Y1TA 4Y9CA 2QQNL 4QT5A 2NNAA 5ADPH 3Q1SL 1I7ZB 2OMZA 5A16B 1GIGL 2FT6A 2H8PA 1GC1L 3ECVA 3IAPA 1J5OH 4UDTA 3NFNB 3FSVA 3VD7A 4A7QA 5J57B 4HHAA 4XC3H 4TTGA 3DGDA 5ABDE 4U2YA 1PKOA 3ZL2A 2UZYB 4D0BA 1ET7A 2IDUA 4TSAH 5D72L 2K4WA 4C56E 5PCYA 2JQAA 4PGCA 4RNRA 2R23B 5DWUL 1NGYA 1ZANH 1QKZH 3HZVB 2AV7A 3RY6C 1EZVY 1AQHA 1JGEA 3LS5L 3DX9A 4QXVA 5I1HH 2QZQA 2YFOA 2ZCLL 4MD5B 5IB5A 1UGKA 1XV8A 1YPZA 2P4AB 2XT1B 3Q9QA 5BRZB 2GW5A 3T3PF 5I6LA 4WJ5B 1OE3A 1PJ9A 4I5BA 3MGTA 2D2CC 1FYTB 2OCCB 15C8L 1I3RA 4TTDC 4LHQB 2FX9H 4Y4HA 2X3CA 3OXSA 2WNXA 3U30C 1L9SA 1HIMH 3C75A 1TT6A 4TUKL 1WZ1L 1HOCA 1MFEL 4MQTB 5GGSB 1UA6H 2W95A 4IEFB 3QUKA 3D85D 1DQJB 2VW6A 3FQYA 2BW4A 2VDRH 1A14L 4KV5E 4X0KA 1B3IA 1LYQA 5D71L 3LHPL 2XV2A 3MXWL 5B1AB 3MLTA 1KCLA 1HYRC 1THCA 2N01B 2OAAA 2VLLA 3VXQA 5AVRB 5IKCB 3MJ9L 1JL8A 4DUXA 1SDAB 1V54B 4XB3A 4JFXA 1CXEA 5D6DC 3SDXB 3VWKC 5HGHA 1E28B 2E7LC 4KKQA 4WLCA 3UTTD 3S37L 5AL0A 5EU5A 4HSCX 2K8QA 2Z92A 5KYYB 1FNHA 2EDXA 5EORH 2ESVA 3HE6C 1F1DA 1WFNA 4BJLA 4P3WA 2IG2H 3OQ3B 1QWNA 4KJYB 2A9NH 3SE6A 3WFEL 2BHUA 2EVJA 3N41B 4GW5B 3STZB 1B9KA 1KBPA 3E2HC 4EN3A 1Y07A 4LCWB 4K15A 4OD2A 4K73A 3NJXA 1FLRL 4Y16B 1AGDB 2IV9A 2R2HB 2AS5M 3IT8D 4YJZL 2LABA 2VITA 3MLXH 3U6RA 3T8VA 3ULVH 2J21A 1P4LB 1DDHA 3D39D 1I1FA 3O81A 3NIDF 4XODA 4H7VA 1PG7H 4L29A 4ODWB 2ZIDA 2QEJA 2FO4B 5FCUH 2EXYD 2E7HA 3STLB 3BISA 3F7PC 2FB4L 1JTPA 4QY8B 3IDUA 1TZAA 4QTIH 2CHXA 5J3HC 2A73A 4TUJA 1SVCP 4K8RD 4O2FA 1X7TA 3EYOA 2QDWA 3L3DB 2B1OA 4LLUA 4ZFZB 3RNQA 2X6MA 4OIFA 2F1EA 2ZONA 1A6VL 4AY0A 1TQBB 5D7IB 2ZJSL 3AACA 1A02N 3K71A 1ACCA 3FXIC 3D0AA 3REVA 4K3DH 3GHPA 3GTNA 4JX0A 4QXGL 4GAYA 3NBNA 1RAMA 4Y1SA 4LDCA 1QBAA 4KBPA 5FC9A 4QJ4B 4FG2A 5EZLB 4OVUA 4L4VD 1AOZA 3QEUA 1D5BB 4PRNA 3C8HA 4WUKL 4QOKE 2OSLB 3CWGA 1P7BA 3FQWA 2CPUA 3F6IA 4FQIL 4BCXA 1QLFB 1YY8B 3PWPD 3RVVD 2NUTA 3HC4H 2DQHL 3U4KA 1MIML 4XCFH 1FORH 2A74A 3WFHA 2ZE0A 3W81A 4MA1B 4LSDA 4IKJA 1H6TA 4DP6X 1PSKH 3F8UB 3HZMB 3RGVB 2FLMA 4WO4B 4G70B 1MRDH 3V0IA 3D34A 1S7WB 4K9EC 4J3OH 3ZQXA 5BVPL 1ETZB 1GJIA 5E2JA 4P2OA 1KJ3L 4YAQA 4RIRA 4XXCA 3VXRD 3VXMA 1OPGL 4HBQA 4WZ9A 3MKGA 1YECH 4FHJA 3FT9A 4UIMA 1T1WB 3DROA 2WXLA 4WY7L 4URTB 3T1FB 4S1QL 3RDTD 1SM3L 4XO9A 2NLJA 1RIHL 2DQJL 2PTVA 4DQOL 2J5WA 1KEMH 1J88A 4TLUA 1IIKA 3Q8BA 4M8QB 1ZHBB 3BAYA 3BVNA 4LEXH 1A1OB 3C5JA 1ASPA 3UJTH 3U2IA 3L45A 3MCG1 5L7XL 1CL7L 4M1CD 4NHCL 4QKTA 5FOBA 1QSEE 2CR3A 1TJHH 2XZCH 5CHNA 5JHDE 4NQCE 5C08E 2DYPD 2AEWA 5E8OB 1VEPA 3QJTB 5F8RC 4L3FA 5TQ0H 2YHGA 1I7UB 1NICA 1HHJB 2NY5H 4YHZL 2FCBA 3D2UD 4K5MA 4J3WA 4RDBA 3FH7A 5E4EC 1OEZW 2ED9A 3JZ7A 1A6AA 3L5JA 4E9RA 3F62A 3ZQWA 2HRPL 4HKZA 2F54A 1YEDA 5C09D 1QUPA 4J7RA 4F5CA 1BPLB 4JFYB 2ZUQC 1W6LA 1PY0A 3L2LA 4FI6A 1PIFA 1K8DB 4RQQB 4XCCH 3QDME 4X9FA 4L37B 35C8L 4ONHB 2ZOUA 5GS2D 4N9GA 4XAWH 3CDGA 3FTWA 4CW1B 1MHPH 2PWGA 2X4QB 3K72A 4IRJC 3SDCA 1IFHH 2WTRA 3ARWA 1QRNB 1RD6A 4OZGB 4GQ9H 2C9UA 4XN2A 3Q2CA 3IETA 2YLHA 4PJGE 1MW0A 3VFOA 4P5TD 3S4SB 3TT3H 3IWVA 2WLKA 3ZKNC 1VDGA 2K45A 3L3KA 4TQPA 5BRPA 5CLXA 2MOQA 4XO3A 5INCA 4GJTB 4LOUD 5J5EA 3UZQA 3ALPA 1DJZA 5C7XH 1E30A 1UH2A 1MRCL 2GC4C 1YPZE 2F7RA 2WXJA 1OT4A 4PRHB 3BVXA 4P3DA 1MFDL 4CADB 3CFCL 3WTWA 2VLKE 2DH2A 1XXFC 1MJJB 4YBHA 5IQLA 5GRUH 1GCFA 1P9MA 4PJFA 1T22A 2OK0H 3UAEA 1Z1WA 4X4YA 1CIDA 3T4AC 5BZXA 4AMKL 4ZDHB 2NTSP 4W81A 5C0BD 1N0LB 4I48A 5ALBL 4GG6F 4D9QE 3F7KA 1YNLH 2OZ4L 3LN5A 3N44F 1TPXC 2LHAA 2QPUA 4JRXE 4JRFA 2G4EA 2Y6SD 3SBQA 1I7RB 5L4FA 1V3LA 3HPLB 4NQDA 5IROC 3K0WA 2K7PA 1QBBA 3WMSA 3TJEH 3GUTA 2PWHA 4FMFA 3H7LA 3GMMB 3J2PA 2WSPA 2EE0A 1LO0H 3GPEA 5JTWA 3K7UA 1QSFA 5EOQH 3WEOA 4XP6L 1WHOA 2UYLA 1XH3B 3O8XA 3H4FA 3O6LH 3MCLH 4P5RA 1A1NB 3MMEA 3QRBA 2JXMB 1ZHLB 3C2AL 4J28A 2NT0A 1JAEA 2FVNA 1ADQH 2GI0A 3VXNA 4HWZA 4W9ZA 1G6RA 4FMKA 4IIZA 1Z9OA 2N1KA 1CLCA 1HTYA 1AG6A 4MDJB 3BGMA 5ANME 4ANUA 1T5WA 1KOAA 3CPUA 2VLRB 3F6JA 1ZHKB 2P24B 4JRYA 1T83C 4CC1A 1FSKB 1NCHA 1I8MA 3OKOA 5MENA 2VJ8A 2VZTA 3FB8A 1SJMA 4F7EB 2XIBA 4LQFH 5E9DA 1LXMA 3QCUL 1AMXA 5H8DA 3UPCA 2JE8A 1BZOA 5ETUB 2PO6C 4LLMB 2ATKA 3K2UH 5CBEB 2LW3A 1T6WA 2W65A 5IK3A 4OV5B 4Q2ZA 1DLFH 4X6DB 2F0CA 5D8JL 5EPMB 1TTGA 3R0NA 1MWAB 4Y5YB 4HOMA 4NUGL 1DE4B 2K9UA 1HDMB 3I9AA 5DTFA 5I71C 2Q3ZA 5TJWK 3VVVA 2BVUA 1Z32X 3P4NA 5E6IB 2CD0A 3UGEA 5HDBF 4WK2B 1EGJL 2VUKA 5IFJA 2E86A 4G6ML 5FO9B 4HS8L 1HCFX 3GZKA 3QFJA 4U1IB 4JK0D 2R1YB 5TH2A 5IHHA 5GGRY 3V6ZB 3WEMA 2XA8H 4WWID 2YAOA 2Y5EA 3WEBA 1ZT4A 2F74B 2NX5D 5C2UB 4YE4L 4XOAA 4XMTA 5JW4R 4BQ6A 2CBTA 2CHZA 2QQLL 2RTTA 4U1SA 2VISB 1JWUB 5T1MA 5IJCC 3UJIH 2DQEL 3KJ6H 3U30B 1HZLA 2XG4B 4FTVB 3BESR 4NRXA 1I8KA 5DMJB 2QJDA 3SE4C 3FT4A 2AK4B 2YWYA 4KJPD 2HG5B 3F7RA 1I3VA 5GJTH 4I3SH 3R4DA 1D5XB 4GP5B 1PQZA 4APQD 3IKCB 5L4JA 3QIWA 4G80B 1ADQA 1XGTB 5EU3A 3CCHB 2J1WA 4WTWA 5IHUH 4H0IA 2Z7ZA 3D48R 1ZS8B 5IR1B 3VXTB 5I30L 3P2TA 3E7JA 3TO4A 5J8OA 3AB0C 5EF3A 2J3SA 2V5RA 2WXNA 1WSST 1ET8A 4QLWA 2EICA 1Z66A 2P8PA 3OKNB 3ISYA 4EAEA 2IXQA 3BKMH 2W07A 4PSRA 5ENWA 3IRPX 3WFDH 4P2RE 2FRGP 2YAPA 4PJ5D 1G84A 3D3VD 1E8YA 3LY6A 2BJMH 3C60C 1YAIA 3B9KB 3C5ZA 3FQXB 4KTDL 5G55A 4PV9B 1DTUA 2VZ3A 3FOLB 2XA3A 1CE6B 1ED3A 4TQIA 1F41A 3RU8L 3FUEA 1JHTA 2P8MB 1A64A 4U1MB 1UD8A 4RESB 3DPDA 3RIKA 2EKJA 2EDNA 3S3SA 4U33A 3RZCA 2LLLA 3DJZA 3QPXH 3QQ9C 1U30A 2I26N 2LTQB 1MI5B 3G6AA 4X8GA 5ALCL 5KBNC 2AQSA 1L0XA 1E40A 3TFKC 2DN7A 3MFFB 4KXZI 3F3HA 2D31B 2A2QT 5F3FA 2IANA 2UV3A 3ECBA 1AR1D 1NCCL 3KNBA 3Q7JA 4RBPK 5SX5K 3SE8H 1JYWA 3QYMA 4KK5D 3K6OA 2BY0A 2JJSA 3HVNA 4LSUH 3V4PL 2NNXA 5HBBA 3MR9A 5CJQL 2B5IC 4PRIB 3ESPA 4TNGA 2I9TB 1ZVSA 1GGYA 4C83B 1BQLL 4I89A 3CFBA 1Z3GH 4MB4A 3FRUB 2VDOL 2E74C 2UVFA 4PI2A 4AYFA 3TNNB 3BPOC 1IM3D 2FLBT 1BD2A 1JD9A 3QUML 1P1VA 1S7RB 3VD4A 3W82A 4XZUA 3IJSA 1A8JH 5GS0D 3ZX1A 2HTKC 4WEBL 4OZFB 5DSCA 1FDLL 1KFGA 4J23A 4XPGL 3F7VA 3FRPB 2JQZA 3L2MA 2C1OB 3TH4T 1REIA 3QAZB 3O11B 1MF2H 1RIVH 4G8GE 4PJFE 3GMNA 2G2NA 1BGXH 1UB5B 3S48A 3KLLA 4HG4J 2BSSA 4F8QA 2XU9A 4X6FB 4NBZB 1EXUA 1CF1A 5GSRA 3TN0B 4N90E 1R46A 3FKUS 2Q86B 3TBSB 5L0QC 4YEEA 3SDXF 2EVFA 4YXKH 1TJGH 4HBCL 5IWLA 5IBUG 4TULL 1IAIH 3MLYH 3V5KA 1IU1A 2K0RA 4S1RL 2WBJB 5FO2A 2AQ2A 4Y2OA 1BZQK 2PMZA 3VMNA 1NCAH 3VXOB 4H0GA 1OSZA 5IB4B 1CO1A 3O3AA 4WI0A 2XFXB 2VDKH 1YUHA 4YHNA 3S8WA 5FUCE 4PJ7E 4PRBA 5K1NA 3QQNA 1AKPA 1PZDA 1ZA6B 4DKDC 2XKSA 2QV2A 4AQ1B 2VNCA 2XXMB 4N8VG 1N4XL 1MW1A 4RDQG 3EO0B 3LNIA 5T1KB 4JEGB 2LU7A 5FS5A 1EHNA 5HY9B 1CQYA 4LPXA 2V3DA 4Q52A 1NC4A 4Q4EA 4F37F 2E9BA 2DTML 3ARDD 1WHPA 5ESQA 1ILSA 2L3BA 5T33L 2BC4A 3LV3B 3O2VH 4JDTH 8PAZA 1XGRA 3L3OA 3IFNL 2I07A 4TL5A 3GTTA 4WTQA 5CIPB 4XP5H 4CC0A 5E2VH 4PGEA 2P52A 3FN0H 4ZMWA 1ZGLA 3KPRB 4BK8A 1L7IH 4HZLB 4YOKA 1BXVA 4OLZL 4PGDB 4Y4KA 4Q9CA 2DBJA 4PBVC 3LXUX 1RZPA 2BY1A 3QJOA 4ZO9A 4MAUH 2H6OA 2R0WH 2VIRA 4M48L 3T0WA 3GZOA 4O4YL 1DCEA 4JQXC 1K5NB 1JNNL 3U1SL 3PABA 4XI5D 3VM7A 3T2NH 2J8HA 3LPFA 5EU6B 2P5WA 5DFAA 2GJRA 1TQVA 4NKQB 3IMRA 1UGNA 2YS4A 1TZOA 2WUCL 3AQZA 3JBG7 2HT2D 4M61A 1T2QL 1NDGB 1C5BH 5I18L 2VDML 4C8XA 2NCMA 2CE6A 5DRNB 2SEBA 2YBRB 3U4BH 2ZX9A 2FGZA 1FL6B 5KYNA 2IWEA 3EOYG 4PP2A 1ZWIA 1YN6A 3T4AB 4GRLB 3RWJB 3V6BR 3VRIA 2XWDA 5HYSA 1KB9J 4PG2C 1M2VA 5C0EA 3T8XA 3ZTEA 3ARGD 3ZW3A 4Z7QE 4E9WA 2DWTA 4HJGA 4QHPA 1DEEB 2JJUA 3FO1B 3AM8A 1D6EA 1XCQA 3ZDYB 1JPFA 3WJMB 1TZIB 3OGCA 5FA4A 3OXRA 4BV1A 2HSIA 2COVD 3O4LD 4PJAA 4ELDA 5TK2A 2G2RA 2KLSA 3B7TA 5LXGL 4HPOL 1FFNB 4JB9H 3CFEA 3IAQA 3CVCA 3V0VB 4U1GB 3GI8L 2EP6A 1KYOJ 4ENEC 1L9OA 2BSCA 3QGVA 4ZNEA 3TCTA 1KCUH 2H26A 2H3NB 3FK3A 5KS9E 2C7UA 5D93C 3V6OC 3O45B 1DBBH 1NBZB 3NCWA 5D2NE 2IEPA 5HYJA 3SO5A 1WBXB 3TV8A 4LSSH 3WEXA 3DLQR 4E9YA 3W1ZA 2JVUA 1J9QA 1Y6KR 2A38A 2BO0A 2R2BB 4ODSL 4CMHC 5C9JA 5KBDA 4L4JA 5I1EL 4WCYH 4DZ8B 2A6DA 3BXNB 5DC2A 43C9A 4U7MA 3F12B 1O5DT 3ZSTA 1K6QL 2BOLA 4YXHL 1JZJA 4NQQA 1N6QH 1I4FB 4U3SB 3N06B 3X11A 4M03A 5E5UB 1LWHA 3UPAA 5KSBA 2HVJB 4OAWB 2KBGA 1XIWA 4Y5XC 3F7QA 3CU7A 3B8SA 4E5XB 1YEHL 1C9SA 4PJCE 5FECA 5DU7A 4MWFB 1FO0B 2CDGA 3MV8E 1I8IB 1MVYA 1X5GA 3QNZA 3EBAA 1CFVL 3JT2A 3T04D 1YEKL 1IJNA 4LSQL 5EG6C 3HFMH 4FZ8L 4YWGL 4JNXA 2G0LA 1H15A 1NFIA 1SJHB 4ICWA 4PM1A 2WPGA 2FJFA 3ZE1E 5ICYA 3B4NA 2QVFB 3KJ4C 1KJ2B 1N8ZB 4G9DB 4BKLA 4ZUWB 1NPJA 3SO3B 1A9VA 5SWZB 3A67H 4YHLH 5HHPB 3VCLB 4LSRL 4FKEA 1AO7D 2ZCZA 5DT1L 4X0NA 4LOFA 5JIQA 4W9CC 3WKYA 1ROWA 5MEPA 1TITA 1IQWL 4M5SA 4F20A 1NBYB 1FRGL 3APCA 2EO9A 4XP4L 5CKAA 3EJQA 3FJTA 4MJ5B 1BD2E 1UXSA 1MVFA 4EEEA 5E8PB 3IXTB 4J8RB 4MRBA 3MJ8B 1T3FA 1B0RB 1ID2A 5BS0B 1U8KA 4HCGA 1L5GA 3K0YA 5FPIA 4YFLF 1VAHA 2D9QB 4RAUB 5ID0B 3KH4A 1MW2A 2VDQB 4PWFA 5D1ZB 4MDIA 1PCSA 2HFGH 4OF7A 8FABA 1G7JB 1TO5A 5IT2L 1N6VA 3UXFA 4BSWB 1BWMA 4U7KA 5DQDH 4IOFC 2VR7A 5TDOB 1ACYL 3H6AA 3AROA 2AQTA 4IJ3B 3BH9B 5GQBA 5KANG 3OJDB 4OSUH 4FQ2H 2CBQA 1TQSA 3AB0B 4MB5A 2PKDA 3VE0B 4BWUA 3BAIA 1IEAB 3MREB 4Z77B 4KDTA 3MV9B 1EMTH 4U2ZA 3LHAA 1U8QA 2L7EA 1HL9A 2VSDA 1NKOA 1ORQA 3I2CH 1QW8A 4PPTA 4B0MM 3VWJD 4ZI8A 1T7XA 4FNLL 1H9VA 2XRAH 5LVEA 1WD9A 3U7WL 3WUZA 3SGEH 2I7SA 2D7TH 1BX2B 5FLVA 1KB5B 5IW3A 5BRQA 2HYMA 1M6OA 3UDWC 1WIPA 4J4PC 1JK8B 4BKSC 3ULSB 3BW9A 3DUSB 4HLJA 4M7ZB 5HD8C 4WGVB 3S2AA 2YXFA 3A6CH 2I60H 1CFSA 1D9KD 1KLFB 2W88A 4M6AA 4OCRL 3X2QB 2BS71 3P11L 2I5YH 1VENA 3NIFE 4NENB 4HIJA 1X5MA 4XPHH 1N3NB 1CD8A 2VWEC 4LZKA 2NXZB 4QRBA 3EAKA 3QXDB 5IIEA 5EO1A 1AFVL 1OAUH 2DJ4A 1R19A 2DH3A 3QXAB 4PJDF 1WAAA 3V5HB 5IHZA 1EO7A 4DGVL 5IP4A 3LRMA 2LR4A 2V9RA 5E8DL 3MJ7B 3DMMB 3IMWA 2GJ6A 4S10A 4CKVX 1OSEA 2BERA 2CMRH 2MTPA 3BKCL 5I17B 4J27A 4NFDA 5I1LB 5ID1B 4JVPA 1CF8L 3HNVH 3SOBH 4IIQA 3N50A 4N8VA 2AANA 4FE9A 3CPLA 1Q0XH 4AQEA 5BQ7A 5J7CC 4YE0A 3IGFA 1SDDA 1H8LA 3G6DH 1LDSA 2DYRB 3S8FB 4PY8J 2ZXBA 1NMCC 4XH2B 3HC2A 1AXSB 2DZEA 2Y25A 1ML0A 3ARZA 4H44C 3IPBA 1TTUA 3ABMB 2BCKB 4MJIA 2Z91A 5BCAA 3KPLA 2Y2TA 2P5WE 3JTTB 4WHCA 3GJEA 2XKNA 2EH8L 4IRSD 3K4DA 2E6QA 3K1DA 1G1CA 3SKJL 3QCVH 4U1NB 1WFJA 4WI5A 3MODL 4A63A 5AW6B 2NW2B 1U92B 1DFXA 3VH8B 3PIQA 1O9ZA 4B7LA 5CD5D 2Y3AA 4ZMVA 1QTPA 1YVLA 1HAUA 2V4LA 2HT3C 4Z3GA 3R0MA 2XWZA 4JJ5A 5I76A 4M56A 4K94H 3O3DA 4XMVA 5HTSA 3GS7A 4MS8C 3V0GA 3WBDA 3ZE0E 4PGZA 1XSJA 3MNDA 2DKUA 2WXIA 5L0QB 3LEXB 3L1GA 3FAWA 2W94A 3POCA 3SSGA 4ZMXA 4WRLA 1D6VH 5EOCJ 1I1AC 2QVIA 3PJLA 4A7TA 4L8DB 5D96C 4X6CA 1MCDA 4QCIA 2PUQT 3KWVA 1FH5H 1KGYE 1OGAA 2ORBL 4JDEA 1S5IH 3GZQA 3PGCA 5GZNA 2RIKA 1J5IA 2FGWH 5B3NA 2WY3B 4ZNEE 1N10A 4EQ3A 2J5LC 2DQGH 3QR2A 1JWSA 2B4CC 1XCWA 2QBWA 2GBAA 3WDIA 3F58L 1TFHA 5A2LH 1JPEA 2AQNA 3IFLH 3L17A 2VRQA 1HSBB 5AVQB 3ASWA 4E41E 3E3QE 4F9PC 3U7YL 3KGRA 4OZHA 1VKXB 4LVOC 5EEUA 4GH7B 2VR4A 3P9MA 1UM5H 2WLIB 4KXDA 5D7JC 1YQVL 1WGOA 4UDUB 5DD5L 4NDMA 3MBEA 3MYZA 1KUMA 5DEJA 4LPCA 2YC1A 3UTTA 4AEIH 3AREB 3OKMA 5MEOA 1N2RB 2D03L 4RH4A 4V1DA 5D1XE 4GAGH 4UI2A 5F88B 2Y7QA 3TYFB 2VM9A 4JFPA 5FYLE 5E94B 4NAJA 1GA2A 4IM8A 2F5AL 3OG4B 3H9HA 1MLCB 3CXHJ 5I73C 1MEXL 2Y5TA 4OZIB 1CVSC 2VC2B 3U4AA 2CRMA 2GBUA 4OW6A 3VFSB 3MYJA 5BUAA 4HWUA 3MRBA 2L7QA 4K7PX 3KLSA 4NC1E 4L3AA 2CBOA 1P7KA 4NAMA 4MJ6A 1LEIA 1G9MH 2XYCA 2C4FT 1L6ZA 4KFZC 2D4DA 4P2QA 4UT6H 5CCJA 1BLNB 3C87A 3D39A 4ALAL 3JYCA 5EBLB 1MCCA 4X8JA 2IGTA 3CLEL 5F89A 3MLUL 2CM5A 4PJIB 1RK1B 4D9RD 4U6VH 4Y5VA 1C16A 5F7EL 4Z7IA 1JXDA 4HW6A 1CFTA 1V55B 3BEWA 5F97E 2OPCA 4GB9A 3PNWB 4FP8H 4R4ND 2DLTA 4X80H 3ZT5A 4M02A 5C0GB 2J6EL 1P4BL 4L4TA 4MMXB 3WN5A 4MZIA 4DN3L 2VXQH 2VLME 5IFHL 5D4IA 5AYUH 4YHIB 5T1DL 1HEZB 2CIIA 1BBJA 1S9YB 1NBCA 2F68X 3LH8A 1WCBB 4QO1A 1E4WL 5I15L 1ZDSA 1SOKA 1RP8A 2I7OA 2JB5L 4B9ZA 4ES8A 4L4VA 1M7IA 4G42B 3EDDA 5E56A 5I82A 4Y9FA 1U0QA 4QHNA 5K9OB 1KFAH 1OSPL 3AU0A 4DKFH 3P0VL 5H4YA 4PD4K 4WUUA 1GXEA 4LEBA 2DWSA 2ZOKA 1JMXA 3REWB 3HHSA 3B1UA 3C6LC 1FFTB 4MHHG 3X13A 2D7PA 2IPTH 3RUGA 4LCVA 5D93B 3MRLA 5C9KA 1SN5A 2GBVA 5DEGB 1GZHC 3HNTH 3AVEA 4LQ1A 4M5YL 2Q7NA 2P26A 2X4TA 5DURB 3WKQA 4DK3A 3MUJA 2ARWA 2X4PA 5H35A 1KIUA 5ISZB 2XN9E 4S0HA 3I50H 1ZPUA 1TJXA 1F3JA 3GLAA 4LCIH 4RGNC 2NNCA 3OC5A 1OGSA 2NY2D 3BDYH 2FWUA 2PYFA 3IRCA 5FGBA 3PQYD 1MFUA 2BRRL 2NY4C 3DSFH 5FGRA 2B0SH 1JZGA 3CV5A 4NYLB 1KBWA 4UT6A 4B96A 4EF3A 1NLDH 2MNWA 2OMWB 3MLPA 1XBRA 4EOWH 2VH5L 3KG5A 5E9NA 4ELKB 2A6IB 1Z9SB 3GFUA 4H0LC 3UZEA 1VCAA 4BFGA 1X7QA 4H2CA 3L4WA 1ZLWH 4UV7L 1D5MA 5BV7C 4LLWB 4ZMLA 2DYPA 3RHWF 4UNUA 5FDYA 1UWGL 3VXUB 3SPVA 1OAYH 2JIXB 5LXVA 2ARJA 3L13A 4NZUL 2WLMA 4MTMA 2RAMA 3QDGB 1G7PB 1NAKL 1EV2E 2E56A 1NAMB 3N3EA 2VXQA 4Y2DB 3WSQH 2QQKH 5F3BB 1XF2B 2D9CA 3A3YB 3HE7D 2DM2A 2MRYA 1KNOA 3IF1B 1FE8H 3D0LB 3BPNC 3PP3H 4ZTOL 4ZW5A 1HYSD 5C09A 1KCVL 3BE1L 3S3JA 4OJFL 5A3IC 5C8JA 1OF2B 3AXLA 1O6SA 3UC2A 3WY1A 3LZNA 3KYKL 4UTAH 5IJVB 3FQ2A 3DGGB 3UTSA 4U7SA 4NLAA 5CNHA 3X3FL 2WXHA 1NL0L 2IF7A 4NN6C 1U21A 1DJIA 3OR6B 3HC3L 3PDDA 4AEHL 3LZRA 5EOTA 4WKZA 2EDMA 2Z8WC 4GT7A 3KPSD 2XBZA 4NO3A 3T0ED 4RMUA 2CA3A 2CR6A 2P8LA 1WWBX 5DJ6B 4N2MA 1QASA 2VE6A 4KY2A 1F97A 4DW2H 2EIKB 4N0UE 3DVNA 4K8RL 2BVOA 3NCCB 4ZMOA 5C0DB 3TF4A 5E00B 1S7UB 2R0ZL 4OCSH 3G5ZB 5DR5L 1JFQH 5E5RB 1R5IB 5HGGS 3WXWL 1NM4A 1RULL 4JPVH 3LNEA 2FEJA 4AW7A 4YDZA 3I84A 3DO4A 2Y7MA 4CJ0A 1BQKA 3BN9D 1DVTA 3H3PL 2DV6A 1DBAH 2BDNH 2VOTA 4GAAA 4NO0D 1ES0A 4N1HB 5L2KA 4QYAA 3QAQA 4M9PA 4H40A 5E24E 3RVWC 2DAVA 2RHEA 1PY4A 2Z1KA 3RWCA 3WIAA 2E3VA 5KSVB 4PGJA 4LRIA 1P5UA 4QRPB 5EF1A 1JI1A 3GMQA 4I13B 1BZ9B 4OLVL 2D8KA 3CMOH 4JFOA 2XHNA 2UVEA 5G4OA 5IQOA 1H5BB 4ZFOB 3DO7A 3TEYA 1PZBA 2V5TA 3QXVA 4UT7L 4WSJA 4ZFQA 4NKDB 1IBGH 1KPRB 4X4MA 2BNQB 4N0CC 2A99A 3VFVB 3T77A 3ME0B 3UTTE 1GYUA 3H9SD 4DKEL 1A6TA 1Z7JA 4YC2C 1MREH 3OC8A 2DQTH 1DR9A 2Z35B 1U8PA 4HV8A 4BFFA 4WFHD 2O5YH 3JWNG 4Y4HC 5D7SH 3X1FA 5AOLA 3AAZB 3D4GA 2WQAA 4JUTA 1IAII 2FECI 4GS7B 4KHXH 1B6DA 3W3BA 2FR4A 1INQA 1NMCB 1M3IA 4OD3L 4U0RB 3V0AC 4N8CL 1RUAL 5CILL 5DMKA 3PWUA 1AQDB 1IL1A 3D39E 3VXSD 1UKTA 2R0KH 4L3EB 4ZQTA 5FWQA 1QNZL 3Q3GB 4MVBC 1LO2L 3RBSA