4IBZA

Human p53 core domain with hot spot mutation r273c and second-site suppressor mutation t284r
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
193
structure length
193
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVCVCACPGRDRRREEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Cellular tumor antigen p53
publication title Structural studies of p53 inactivation by DNA-contact mutations and its rescue by suppressor mutations via alternative protein-DNA interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 193
sequence length 193
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ibzA00
2J6WA 4XR8C 4AGQA 1LJMA 2BIQA 1EAQA 5AB9A 4IBTA 2OCJA 3US1A 3Q05A 3EXLA 3TS8A 1EAOA 2J1ZA 5AOKA 5G4NA 5AOIA 1HJBC 2J1WA 2H1LM 4IJTA 4LOEA 4AGMA 1EANA 2BIOA 3WTVA 5ABAA 4IBWA 3WTWA 5LAPA 2AC0A 3VD1A 3WU1A 4L0YA 2YBGA 2P52A 2X0WA 3D09A 5LGYA 2J20A 4IBVA 1YCSA 2WGXA 5G4MA 1E50A 2ADYA 5ECGA 4AGOA 4AGNA 1HU8A 4MZRA 3IGKA 3D07A 4L0ZA 1H9DA 3WTUA 3Q01A 4LOFA 2RMNA 3D06A 3D08A 2AHIA 1TUPA 5AOLA 3Q06A 4L18A 5BUAA 3WTYA 4AGPA 5A7BA 3D0AA 1GZHC 4IBSA 2BINA 1CMOA 5AOMA 3KMDA 4AGLA 4GUQA 2X0VA 4IBQA 3KZ8A 1T4WA 4KVPA 3WTTA 3QYMA 4A63A 4IBUA 2VUKA 2PCXA 1TSRA 2XWRA 3WTSA 3ZMEA 3WTXA 1GZHA 2J21A 4IBZA 3IGLA 5KBDA 2GEQA 4G83A 4QO1B 1UOLA 5AOJA 4HJEA 4IBYA 2IOIA 3D05A 4G82A 2BIMA 3VD2A 2ATAA 4MZIA 2MEJB 3US0A 2FEJA 2X0UA 1IO4C 4GUOA 1CO1A 3QYNA 2J1XA 3EXJA 2J1YA 5G4OA 3VD0A 2IOMA 4LO9A 2BIPA 2IOOA 1KZYA 2XWCA 1HJCA
chains in the Genus database with same CATH superfamily
1D6EA 3GGWB 2Q20A 3DSNA 2F6AA 4IRJA 4JGUA 2B1HH 5HPMB 2IADA 4MCYA 5IB1B 3LZRA 1T0MB 1XCTB 4AZUA 4P5KA 2Q86B 4N5EC 1U92B 2FEEI 2BH0A 3BIAX 1I8LC 2FATH 2DI9A 2FBJL 1QO3B 1D5BB 2E59A 3UZQB 4YAQA 2W9EH 4QRFA 5GGQH 4Z8FH 5IVXF 4G9DA 3EFOB 5I73C 2UX6A 1CR9H 4H25A 3QDGD 4OFYA 5C3LD 2IQ9L 2YHGA 2YZ8A 3QUHA 5EB9A 2JLLA 1S5HB 1K4DB 4PYHA 5C0EA 5FYJE 2XWTB 3GSNB 3RX7A 1CG9B 2O5YH 1N0XL 3WXVH 4E9QA 1CE1H 3NCCB 2XWEA 2HXAA 2FECL 3HIZA 5CLZA 3BIKB 3V0WH 4DVRL 4PLKC 3UEZA 1XHHA 2HTKC 3FB8A 2KLSA 2B59B 1CFVH 2BSCA 2ZF8A 3L3OC 4YPGB 1QABA 3H6AA 3M46A 3IMVA 5K9JH 4OD1H 5FUOH 4JZOA 5AW1B 2C9VA 2FX7H 4WI7A 4Z0BH 4OCSH 1ZGLP 5BO1H 3OD3A 3UOAB 4KZ0A 2Z65C 4BKTC 4HUUA 5C0IB 5E6IA 4HAKA 1JF1B 1HH6A 2X40A 3EYVB 1RLBA 3A6BH 1YJDC 3FQNB 5IMKA 1R3HB 3B9VA 3HG1B 1UM4H 1ET5A 3S37X 3FRPG 3LNHA 4XXWC 1DEEA 1FQ9C 2C4FU 4CADB 1D2PA 1WA0X 1LE9B 1D7BA 3EH4B 2P8LB 4O2EB 4NXSA 3KJ4B 1KNOA 2WMPB 1LDPH 4I8DA 3C5JB 3BH9A 1FCCA 4HUVA 3GLZA 1KTLA 1UVQA 4RETB 1CPUA 2N1TE 3IBOA 3O4OC 3WIHL 5B39B 3ARZA 3O6FB 4Y1AB 5E2UL 1O6TA 4PJBA 1UATA 4IM8A 4GW5A 3CN0A 3RVWC 5C0FB 5I9QC 2YD9A 2H32A 4WSKA 4J2XA 1XV8A 5G2NA 4XX1E 2DLIA 4IRZA 4ZDHB 2VM9A 3MRDB 2FAUA 4OBSA 3HZYB 1Y1UA 5JOPE 5CM1A 3D9AH 4I85A 3VXRE 1A6TB 4BH8A 1INEH 4LCVA 4YN3A 2ZTBA 4Y7OC 5I1JH 2WLKA 5FUCE 2WBJD 4WJ5B 5LAXB 3HC4L 3RIFK 5IQ7L 3UTOA 3K3QA 4M1CC 5A16B 4HCGA 5HD8C 1TYRA 1Z9MA 3K46A 4FYQA 4H88H 2BIIA 2EDWA 3FQ4A 3SDXB 3TVMA 1UASA 5F9OL 4NNYB 4NJ9H 3KDMB 2VLKD 2VGLM 2X05A 3F84A 3ETSA 1MW0A 3QDMB 4HZLA 1BYNA 3RWDA 5I1HH 4R4BB 4LKCA 2H3KA 4FERA 2LOEA 3MUGB 4ZK8A 3NIGB 2D3NA 3P11L 4HBCL 1OD7A 3FJTA 1KCKA 1AXSA 2HLAA 4CMMA 5DVNA 2FWLB 2DV6A 3ZE0F 5LDUA 1KFGA 1RK1B 5DRWB 3CFNA 4GP8B 3WTWA 2DQIL 3D69B 4APQC 5T1KA 3S37L 1IEBB 4KOBA 3TPUB 1A4AA 1L3WA 3S3JA 2JJSC 2XN9A 2FJUB 1B6UA 2YPKB 5C09B 4KZEH 3M8OL 3UC0H 3BZEA 4YOKA 1N18A 3NIFE 4HUXB 1MI5E 2Y2WA 1SXSA 4KKQA 1E9QB 4NQTA 3T8XB 3EO9H 1CICC 5FYKL 1R5WB 4MAYA 4I89A 3HN3A 5DRZA 1MRFL 1JI2A 4AEIH 1XZ0B 2QL1A 1KGWA 3CDZA 4HUKB 4N8CH 3TT3H 4GG6E 5FO9B 1QLEH 5KSBF 1TSHA 1VFUA 1A7QH 4JFWA 4WJKB 3ZYJA 4LCWB 2WBKA 3D34A 3HHSB 2Y7NA 3C6LA 3NA4A 3HN5A 3SE4C 5BS0D 4XBGA 2Y25A 4CL7A 1Q1JH 3B7RL 3KL5A 4M9PA 5B39G 4DP4X 3FONA 3QXVA 3P0YL 4K9EH 3ZOAA 1Y6MR 1XSJA 1YPZB 5DJYA 4ILDA 3GJFK 3QJHB 4UF7C 5AUMA 3HVNA 2NRDA 2VJ0A 1VDGA 4HIJB 3H7BB 3QIBA 3VXUA 4WUUA 5C2UB 3BUQA 3HPJB 3DA0A 2UZXA 1W72L 2GJPA 1CGVA 2NXYD 2ORBL 4B0MB 2WLLA 4QHNB 1TZHA 4YHIA 1BVNP 5FEBA 3NCBB 2NW3A 2KI6A 3QAZB 4G8GA 4Z7UB 2NX5A 4JLRA 2E86A 1FH5L 4NO0B 3VI4F 2H6PA 2EVIA 3KGTA 3V0IA 4NKOA 5JOEA 5ACMA 1M56B 1RK7A 5KUKA 1KIUB 1MY7A 2IF7A 1FAIL 3N1MC 2P46B 1YEKL 1QKZH 3HNVH 3QHZL 3TEUA 4MQ7A 2ZCLH 1L7IH 4IRJC 2PYED 1OTTD 5EN3A 2X89D 5D72L 4ELDA 5DK0B 5I5RA 5D8JH 4XVJH 1V7ML 3D39A 2CPCA 4IDJH 1RZFL 2ITCA 3MRPA 1GOHA 3DDFA 3VRJB 3GB7A 3IDJB 5I66A 4Z7WA 3SYOA 4KI5D 3S7GA 3KYKL 5DFAA 1F41A 4OD2B 3KW8A 4NDMB 3CX5J 2Y3NA 2UUDK 3HNTH 2OCJA 1XL6A 4W9EC 3SDCA 3U82B 1A66A 1YNTF 3OKKA 3P9WB 3Q05A 4YXLH 4BDVA 4EIGB 2K9FB 3ZW3A 3TS8A 5D1XA 4AL8C 3LN4A 3PIQA 2V8LA 1Y0LB 1NC2A 2NY6C 2VLJA 2YXVA 1W0VA 4UTBL 4UT7H 4Y1TA 1KJ3H 2G0LA 2GY7B 2VXSH 2XWJA 3GPSA 1KBKA 1S78D 3FUMA 5ILTH 2R0KL 2F1AA 1DSYA 4O02L 1ACCA 3BN3B 5D1ZD 1XR8B 2VQ1B 5SWZB 1ZK5A 3GMNB 5FB8A 1WEJH 3QZBA 2DDQH 2CK2A 3C8KB 3F5WA 4UZUA 4FP8L 5E6IC 1DVYA 4FFZA 3O41A 4LCIH 5D6CA 1FV1A 4KX8A 3V4PL 5E9DA 5I6OA 5DQJB 3MJ7B 1MHHB 1UB6B 2YD0A 5DJ8A 3ZGIA 4JNXA 4FQIL 1F4YL 1E30A 3IMRA 4P59H 4PPTA 4W9JC 2VRKA 1Q0EA 5DYOB 2UWEA 5DSCB 2Y3AA 1H6UA 4GSQA 5GS0L 2FYYB 2BS8A 2I5YH 4S2SA 1WFUA 3MLTA 2J55A 4GRLD 3VFNA 5DI8A 2JELH 3VFSA 4M03A 2DM3A 4BFGA 1X4ZA 3NABL 2HLFD 1MCWM 2Y1YA 2D3JA 2FEDC 2BSRB 2FK9A 3ULVL 2WXKA 2L8AA 1TLMA 1Z2KA 5F1SA 2AGJL 3BFQG 1QZ1A 2Y07H 5IESH 4BSJA 2YUZA 4ZBJA 4CC0A 2PETA 3A67L 4KQ3H 1K4CB 4PMEA 5CBAB 2PP7A 1KGJA 2I07B 4XWOD 3DK2A 4XN9A 3BH8B 3PHOB 3M45A 2ZP0T 4BFOA 1MELA 2CE6A 1VFOA 3BLKA 5T1MA 3FMGH 2ZNXA 3HS0A 3RTQD 1WAAF 5IHUH 2ZYHA 3DO7B 3L3HB 2WK2A 4JFYA 1XH2A 3S35X 5AZ2H 3QRLA 4GP5B 4TMPA 1J0ZA 4F57H 5CMAB 4Z3GA 4M7KL 5C7ZA 3UFIA 2A5UA 5E8PA 3TVMC 3O81A 4NBYB 3VMPA 3JWDL 3FQTB 3O9WA 4JHZA 3PAVA 4MD0B 3VJ6A 1EJFA 3TFBA 3QRGH 3L5HA 4H0IA 3B4NA 4MMXA 3BZFA 4FG0A 1AZVA 3TWCH 4NN6B 5D5ME 3AXHA 4ELMA 5CJXC 4ANKA 5IFAH 3LIUA 3R06A 3D6GA 5TFSL 4U1IB 2NPLX 3RDJA 2C9UA 2GJ6E 1G6VK 3GDCA 3FCSA 1NC4D 2ATPB 1I7UB 1BQHA 2VXUL 1EEUA 1HEZB 1L7TL 5MI0C 3WNJA 1I4FA 5CJQL 3X11A 1UUSA 4ODTH 2NT1A 5E6ZA 1O7DC 2HJFB 1TQBB 3AFLA 4R4ND 1SHXA 4WTZA 4X2UA 3G5WA 4EIZC 5K1JA 3DVGA 5I18H 1MIEL 2HRPH 3GMPA 3NG5A 4MAYC 3IVKA 5C0GA 3S3SA 4P9HL 2CCVA 1AZZC 2X2HA 4WJG3 4GKSB 4YZWA 3V52L 4EZJA 4KROC 1QSZA 4WGWB 2V3FA 2QTVA 5HY9B 3P4MB 3VQ2C 2YAEA 1GKEA 5H4ZA 3C6LC 1F42A 1N2RB 3KBFA 1RSFA 1IC0A 1AGFA 3LZNA 1KEMH 4LLAA 3N5AA 1R24A 1JNHA 4JRLA 1E40A 4UV7H 7FABH 2H2SD 4G9FB 3BAIA 1LO5B 4MQXD 3L1GA 2Z8VC 3GSQA 4IDLA 1X9RA 3KWUA 4JFXB 5DT1H 2X70B 3SYQA 3G5XB 3MLVH 2ERJB 2HG0A 5CSZB 5D2LE 5HJ3A 3VG0L 3QIBC 1N0LB 4FJYA 3S35L 2WBWB 5FECB 4KUCF 3ROLB 2UYLB 1AO7E 3BESR 2C1PA 2WCSA 1D5MA 2VXTL 3HVDA 2OTUA 2ZKMX 3L1FA 5K9OA 4JAMB 4ZODA 3FN0L 1N5AB 4CGUB 2OAAA 3SPIA 3IDYC 1RZ7H 2EDOA 1K8DA 2A73B 3LJ3A 5FO8A 5JDJA 2ZCKL 2FJGB 3ERXA 4XN5A 3B5HA 4J28A 4X6DF 3UDWA 2KS0A 2NY7L 1WRFA 1A9EA 2O4EA 3G6DH 4K8RC 3L6FB 4PBXA 1JHLL 4DUXA 4XMTA 3D2UB 1FGVH 3C75A 4FYTA 2CBTA 3IGFA 1ETJA 2DQFB 3ARFD 1G7PB 1EHKB 1XR9A 4GO9A 2WLYA 4FNQA 3VD2A 3OJVC 4P2QE 2VLKE 2HWZH 3GMLB 4HCIA 2H0FA 4BZ1L 3MJWA 5D96C 3AU0A 1OAUH 5B8CB 3WFBH 3R0NA 4M1GL 2VIRA 4UB0H 3L95A 3ZKMC 2F54A 5KVGH 3QVAA 5A1AA 3V0HA 4R96B 2ZSVA 5D1XC 1NEZB 4C4BA 4QWWD 2V9QA 4O2CA 5KANI 3HMXL 3DOSB 5TH2B 5IHBA 3ZTNH 4H8QA 4GJTB 3V6OA 1N7ML 2MHAB 5FW7A 4FN0A 2HFGH 4L4VA 3B9DA 1PJ9A 4MHHG 1WZAA 5C6PB 3H9SB 1KGYE 1BX2A 3F7VA 3ZT7A 5KS9E 4Q9CA 4ONGH 2BSED 1XGRB 3V4LA 3WFCL 1DZBA 1ACZA 2VDNH 2ESVA 3D5OF 3EFDL 2FLMA 2CRIA 3TIDA 1BEYL 1IT9H 4AE0A 2AK4A 1I7TA 1M05B 1G6RH 2A83B 2AK1L 3BXNB 3DX9A 3RBSA 1B4RA 2NZ1A 2X6CA 4CN6A 4C58B 3N6YA 1ZDQA 1QYGH 3EUDA 1KCUL 1AIFA 4NWUH 2GTZA 3TZVB 4M5ZH 2JF1A 3CZUB 4ZOBA 2VXVL 4HH9A 3QG6B 2YBGA 4JPKH 1K3IA 4R90H 2AJXL 1J0YA 2FH6A 4RISH 4ZFFA 2MQ0A 4OF8A 4PVBA 1NCCL 4NZ8A 4JFHD 5H35B 4Q6IB 2XZQH 5ECGA 2YPLE 1N70A 1URLA 2OSLA 1S7RB 1KDJA 2W65B 4K5PA 4YX2H 5AL8A 1K3ZA 5DK2B 4MJIE 2GAZB 4WHDA 3NA9L 3WN5A 1N64L 1AE6H 4H1LA 3VXPB 5DMJB 2K8QA 5EU7C 4GW4A 3MN8A 3FOMB 4ZMQA 3U79A 1XB3A 2FRGP 4NKDA 4WTXA 3R7QA 3W39A 4A67A 4QCIA 4JKLA 4ZUTB 2OR8A 1Q9KB 4MCMA 2KLTA 5KEZA 3D2TA 4KHXL 1OAYL 2EH8H 1ZANL 1PBYA 3DRTA 4ZMLA 4NKMA 1G1KA 2KH2B 3HS0C 4XMPH 2GW5A 2CG9X 4OSUL 4UM8B 3T3PE 4KKCD 3WGVB 2LFGA 4W9LC 3FT3B 2CO4A 3BZ5A 3NSDA 3ARDD 3VGGA 2RCSL 5KUMA 3V0AC 1LK2A 1CZ8L 2G2RA 3HG2A 4LEOA 2JWYA 1T4KA 1Z1WA 2B1OA 3I9GL 3NCJL 3X14B 3O9WC 4DPCX 3EH3B 4GT7A 3E8UL 3NDYE 4U6HB 4I3GA 5EOQH 4DHLA 3MLZL 1DYZA 3RGVA 3S3BB 3U7AA 1FYHB 1WHPA 5KJRL 1JS4A 4F27A 1NEUA 4ICWA 2IQ9H 4F91B 2RFXB 3VXSA 3HAEA 5KN5B 3WEXB 4OCRL 3DJSA 1N0XH 1XGYH 4BUHA 1EK3A 4G3YL 4MMYA 2VDQB 1IQDA 4YBLB 4NPKA 5CEYA 3VFOA 3MV8E 1JWMB 3OKOA 4DVRH 5ID1A 3P9MA 4NNPL 1U9KA 2H3NB 4F9LA 5GS1A 4FL4B 3QFDA 1DVZA 1UJTA 4Y9CA 4W6YB 3QUYA 4WK0B 1H3VA 4X4MA 3KL3A 4LMQI 3BO8B 4U1GC 1Z9LA 3NPSC 5GIRB 4F2EA 1IL1B 1ADQH 3NJXA 2W80C 4QT5A 4XCYB 4ETYA 4PGEA 1NUGA 5BVPL 5E0QA 4P2RA 1KXVA 1IAII 1W0WA 3CTTA 2OX5B 1BFVL 4DPAX 4A6YB 5LAPA 2V2XB 3CSYA 4X6BB 4XHJC 4FQQB 2R7EB 4JFED 1U3HB 3SJVB 3QUMA 5GRWA 1KGXA 1JHTA 4LLDA 5B3SB 3QPQD 2D7TL 2D9CA 3OKDB 4PRBA 3M7FB 4IBVA 3AS3A 1CJYA 1OB1B 3ZO9A 5F7BA 3CZLA 4GAFB 4LVEA 5D7EA 3VFUB 4FABL 3NRPA 1PKQB 5ELIA 5AYTA 3MXVH 3WIHH 1CYXA 3S2CA 3EJPA 4KJYA 1ANUA 1XF4A 2PCPB 2CUHA 1V55B 2EC9T 4OB5H 4XBMA 1TCMA 1MLBA 1NGWB 3E2HC 4JDTL 5H2BA 2XG5A 4U7MA 3WFDL 5EBGA 5IVZA 3JT0A 4LAQH 3Q1EA 5EU6B 3UDWC 1KYAA 2KMWA 1N8ZB 1KN2L 2XV3A 2CIKB 1I1AA 4FFWC 1ECYA 1I75A 1BLIA 1Q9WB 1DN0B 1TPXB 3N0AA 5JXED 5IQ7H 5FDYA 3PAZA 1MWAB 3IJ7A 3VA2C 5EU4A 1SYVB 3RB5A 1GS8A 1UCBL 2RA1A 5J0BA 5F9OH 3LY6A 4LT7A 4QOKB 3QDJD 4HXAH 3D0VB 4M61A 3T2LA 1ZIAA 2F19L 4QGYA 5E2WL 1XH3B 4KKAC 1QTPA 1MW3A 3P11H 5DFVC 4HBCH 1V7NL 4DCQB 2Z92A 3TPKA 4GBXD 4MDJB 3BSZA 4OF0A 2P5WE 3X2QB 1UWGL 4AJWA 4ZI8A 5E7BA 1INQB 2DQIH 4OQTA 1P7HL 2FQDA 2PCFB 3KBEA 2J1XA 2QSCL 3P3TA 3S37H 4LVHC 4TQHA 3TBYB 3WFHA 2X7LB 4HS6B 1KJMB 3FU7B 3M8OH 2B5IB 5JLZB 4GQQA 1FNSL 5I6KA 2YFNA 4G8IA 4PJ7E 2F7IA 4P48A 5IEKB 3QDGA 3BUTA 2HX8A 3MX0A 5FYKH 5INDB 1MRFH 3QQ3A 1BBDL 4YSDA 5DVOA 2VERN 5EU3A 4YZFF 3CDFA 1KB9J 3SZ6A 1XCQB 4CBPA 3VU1A 1VERA 4PVLA 4KUCD 3LKNB 2ZG2A 4XNDA 2WTRA 1HXKA 1IC1A 2ZSWA 3B8YA 3QC5X 2PO6B 3IK2A 5C0RL 1R33A 2GJZB 4M8QB 4PLNC 1SLWA 4FOMA 5CLXA 3P0YH 2VR7A 3T4YA 1RSYA 1YQVL 1P5UB 1I8KA 3EBGA 1CD0A 2K70A 2PTTA 4Z7QB 4X8CA 1RUMH 3CFDA 3WD5L 2QFRA 4I1RA 3JV5A 3KPMB 5GSVB 1EH9A 1X7QB 1AD0A 2ORBH 3GF8A 4H20L 1WJ3A 1PVHA 4PJCF 2EABA 4X7FC 2GHWB 4WWOA 1RZGB 2V7HA 3P77B 2APBA 3H2QA 3AITA 4Q4IA 1IBFA 4WI4A 2Y7QB 1FH5H 2JCCE 3B2UC 5AAMA 2DLFH 4F7KA 2B2XH 3K80A 5SX4I 1J05A 2WWKT 5A3IC 1IJ9A 1M1SA 1FAIH 4U6YB 5HHVL 3RWJA 3WNNA 1Z6JT 3QHZH 2ZOLA 4FKKA 4JG1L 2NZ9C 2ZWLT 2WLMA 2YD2A 2OMVA 1G9HA 4XCEB 2AZAA 2YA2A 5HGBA 2I32A 4KKRA 2QPUA 1PQZA 1RZFH 1KCRL 2COVD 3RGVC 2VN7A 4OD3L 2FX8L 1HZKA 1PLGL 4I18A 2XT1B 3SQBA 1DE4A 1SJMA 3PS6A 2EC8A 4FTVE 3GMMA 1AGDB 3RIFF 2NY3C 2NXZB 1MG3C 3FB7A 2YLKA 2WBJA 2W9LA 5HGDB 3BP7A 3IRCA 4X7SL 4ZO8A 1BVOA 2WKOF 2Z8WC 5FKAA 4MLSA 5FYKD 5CD5D 1GIGL 4HDIA 1AS8A 2CR0A 1P4BH 1RIVH 1FG9C 1NANI 3QEGL 4UTBH 2VXQH 3K91A 4F9LC 3SDDB 5GS1C 5CEZE 1RUAL 3NMEA 1UM6H 2QR0A 3HZMA 3QUYC 1X5GA 2R0KH 4PRNA 4O02H 4NX0A 4BWTA 2XPGA 1XQ4A 3P1VA 4OTXL 5ID0A 5DJXB 4J3OH 5KYWA 1DQQA 2LV4A 1U36A 1G9NC 5EUKB 4XNXH 1F18A 3NJIA 4FP8H 1O6SA 5EFIA 2PF6A 4HIQA 2QMJA 4YHOL 1KXVC 4XO8A 3V4PH 5I17A 5I1EL 3MLRL 1PZ3A 2NY4D 3H9YA 2EEDA 5I1LB 2ZCZA 2ED8A 3T3MF 2WSPA 1F4YH 4FQIH 1AAJA 1W0YT 3MA9H 3EXLA 2KUTA 4JFHE 1Q9OA 1R5VA 4RQQB 3GZQA 5JMOC 4HJSA 1ROWA 4YPJA 4MJJA 1I9IL 4Q6YA 2GFBB 3L4WA 4YDKL 1ND0B 2CJUL 3VSUA 1A1OA 2E3VA 3AU1A 3N04A 1WA2X 3UGEA 4D8OA 4YXKL 4FA6A 2GT9B 2KQMA 9CGTA 3EKCA 4X50A 5IIEB 3PDOA 4L8CA 3CCHB 2AGJH 4F3FA 2W95A 1UWFA 2GITB 1FNGA 3EYSL 4DSYA 1II4E 4WCYL 1WFIA 1F2QA 5GGTL 3ZKNC 2P7TB 2C4XA 3VXRB 3QE5A 4HJUA 4IKJA 4MMZB 1CU4L 1LO0L 4QTHA 4NGHH 3SBWA 4ZMAT 2BY3A 1XTLA 2BP5M 2GK0A 3NP4A 4FEIA 5ESAB 5GGRY 4DVBB 2AJVH 1I1AC 1F8TL 3MUJA 3U4AA 2F74B 2FO4A 2K3HA 5AOLA 1YNKL 1JXGA 7CGTA 3IETA 2CHZA 4FFYL 4TNFA 1T5WA 4MD5A 2D4DA 2HVKA 4M7KH 1FN4B 3E38A 3ATAA 4WEEA 3I3EA 1GC1L 5ADOH 3JWDH 1IGTA 1AD9A 2ZZUT 5CZXD 5FUZL 2W59A 1NLBL 3CLFL 3GLAA 4GMTL 4D9QD 3STZA 5TFSH 3ZDZF 4F8LA 2D31A 4ALAC 2GKIA 2JKLA 5B1CA 2PYEA 4J3OD 5LG1A 2X89A 1NIBA 3VTAA 4WO4B 1A4KB 4JN2A 2AJ3A 4TRPL 5IBUB 3RUGE 5IUCA 3VWJD 2E8ZA 3NIFB 1ES0B 1MI5B 1L7TH 2A4CA 5IHZB 3ZXAC 5CJQH 3I9PA 1S3KH 5C86A 1TVDA 2K1MA 4ENZA 3CPLA 4FXKB 1MIEH 1HE7A 3BAJA 4KTDL 5EOTA 3CWGA 3ML8A 4GG6B 4L4JA 3WIIL 4PGBA 4KNUA 4X99B 4EVNB 2PMZA 1V10A 3V52H 2NQDA 3BUIA 1J5CA 3N50A 2XYCA 3W9EB 3HC0B 2NY5L 1EZUA 1K8IA 1FIEA 3FQRB 3KPRE 3LIZH 3FUFA 3HA0A 5EZLB 3NCYS 4P3CL 1MWOA 2BNQB 2XLLA 4PRPA 3TT1H 4G7QB 1M6OA 1S8DB 1OF2A 4XWGL 1BA9A 5IHWA 5E23A 2DKMA 4FHJA 1A0QH 4HBQA 4OGAD 4LZKA 4J39A 3S48A 5LG6A 2WQUA 3Q6FA 3TNMA 3BHBB 3MJ8A 1WWBX 3FOLA 3GZPA 4Z3FA 3FN3A 2DL2A 3VG0H 4ZFGL 3KPLA 5JIPA 1UXSB 4JE4B 3GLEA 5KYYA 3S35H 1DCEA 4RLDA 3TCLA 2H26B 3GIVB 3MRJA 1PPIA 2VXTH 1N3NB 2J8UB 4S1SL 4UQDA 5B22A 4PCTA 1ZE3H 3TBSB 3FN0H 3DJTA 1C08A 3OXSA 3HE6D 1FVCB 1SLXA 3CZGA 4CW1A 2DQMA 2GBUA 4GRLA 5AAMC 5LGYA 3MMEB 1AYRA 2ZCKH 1X9UA 3VNYA 4UOW1 1IGJA 3C9NB 3B9EA 2R1WA 2Y2YA 3ZRCC 2NY7H 5DA0B 5DXWA 4XI5D 2WLIA 3BIBX 4QGTA 1F3JA 5DEGB 5IBTL 4KXDA 4MDIB 4NZFA 5I1GL 1BFTA 1NCUA 2AXWA 3CDGB 3QEQB 2BX5A 3CMGA 1I8MA 4RAVB 5E7FA 3TIEA 2J71A 5FK9B 3NDZE 3U9WA 4OCYL 2UY6B 2CALA 4YIQA 4UMSA 5F89A 4BA0A 5C0CA 4I18C 4HEPG 2FSEB 5IB2B 4CMHC 4LGRB 3RTQA 4IMKA 4YEFA 4TUOA 5G55A 1EAPA 2ICEB 2VTFA 3UYRL 1VLXA 2J4WL 5C0AB 3QPXH 5HHXL 4JZJA 1UYWL 3HMXH 4DGIL 3MV9E 3RWIB 5HVWA 1N7MH 1H8SA 1SXAA 2QQLL 3DIDA 3SD2A 2CK0H 1KG0B 3CSBA 1EQWA 1K9TA 5JORB 4G1MB 2XBDA 1NL0L 4K73A 3WFCH 2IOIA 3EFDH 4JDZA 4DN4H 1AY1L 1TCRB 4HLZH 4LSRL 2Y5TA 4N0YH 2DWSA 1BEYH 1NC4A 4AYBA 4X5RA 1UTDA 2AK1H 3NT0A 3REVA 3HLAB 3DXAE 3QEHB 4NQVA 4ENEC 4P4KD 4ZTPH 2CIIA 4F2FA 4F33A 4NQXA 1TZ8A 2VXVH 4JY4B 5E5LA 1UZ8B 5JIMA 1DANT 1QSFD 2ODIA 3DDGA 1TO5A 2QADB 3UPRB 1MHPL 2AJXH 4JPVH 5EOCL 2IOOA 3CZFA 4GPVA 3X3GL 1NCCH 4Q9QL 1VHPA 3OL2A 5D7LD 2ZOUA 4R5TA 3T65A 4LDCA 4AQ8A 3G6JF 3LN9A 1E0OB 4YDIL 3QWRD 2VR8A 1DVXA 3FT0A 2HN7A 3STBA 1HOCB 3U1SL 2F8OA 2ZKWA 5I0YA 5IR1A 3NA9H 3ZQXA 4JRWA 4KAQH 1IM3D 1N64H 1JFHA 2CCLA 3JTSA 3QEUB 4MJ5B 2J5LB 4G7YL 4E42B 3G5ZA 4IJTA 4QRUB 4NEHB 5EEZA 3F6JA 1T22A 2QQKL 4I9WE 2QV2A 4EUPG 1FG2A 2K4WA 2O30A 4KHXH 4OT1L 1OAYH 3BW9A 3BZ4A 1ZANH 1NH6A 4FFVD 4LKXB 3EFFB 3IN2A 3LQAL 4OSUH 1DN2A 3IWVA 3L7EB 2XFXB 3NJKA 1D6VL 3QJOA 1IEAA 3P4NA 2RCSH 4ZAKD 2BMKA 1CZ8H 5F7YC 3I74A 5F9JB 1ACXA 3IDGA 2OMXB 3I9GH 5D5MB 1EPFA 3E8UH 5EUOF 5AYUH 5IY5B 4D7BA 1EXHA 4XH2A 4B96A 1L9RA 2GJ6B 4AMWA 3MLZH 2WLNA 2VR6A 4G6AD 2VT0A 3PGCB 4U2YA 2EXYC 2NTSP 3SPGA 1T21A 5KJRH 4YDZA 4LLYB 1SVCP 3OZLA 5I8KL 3NRFA 2DWDA 4JRYE 5KYUB 1S7VA 5JW5A 1KJVB 3OPUA 1OTTC 3APCA 5FYKE 1MXDA 3ARFA 4KZCA 2YAQA 1DDHA 4OCRH 1QI5A 1T4WA 1YEHL 4P04A 5HYSB 4F7TB 4ZX6A 2Z8RA 3G04B 3LH9A 4G3YH 3BKML 2H0EA 3BVNB 4MJ2A 3UERA 2G60L 3CC1A 4NNPH 4KI5C 4ZNCD 4FAAB 1PW3A 1EUUA 2RJMA 1BXXA 4TSBL 4UMGA 2ZG3A 3PY9A 1EGJA 4L8BA 1U2HA 2K4AA 4UAOC 4KKBD 2L4OA 1QFWL 1T6BX 3EIFA 4MSWA 1TQCC 4LRNL 4OZFH 4XN7A 4AJVA 5BVPH 1SRDA 3A5VA 1FIGL 3ZE2B 2Z7WA 2VB5A 3QSKB 1M7UA 3IBEA 4N0CD 1PSKL 1S78C 3IFPA 1BFVH 5E8NB 2AXFA 2EIBA 2IALB 3LYRA 4IHOB 5D2LB 2BSEA 4QRPD 4WZ9A 2V5TA 2XY2A 2JFCA 4V1DA 1TVBA 4PTTA 5B7FA 3TBWA 3KPSE 4K9EC 5DUJA 1AO7B 2D7TH 5H37H 4YK4C 1B90A 5I5MA 1QRND 2XTLA 2CLRB 3TJPA 1PL3A 3VFWB 5IB4B 1I9RL 3ZHNA 4FABH 2ZX8A 2P3YA 1BF8A 1WC7A 2MKWA 1ZHLB 4X0KA 5ESQB 1RUPL 3VQLA 3R1GL 1QSEE 1MFDL 3IMSA 1M53A 1CBVL 4Y9FA 5DQ9B 1REIA 3VGDA 1R9FA 4IS6B 4YL9A 2DH3A 4GRLC 5AB2A 2XPYA 2R2BA 4Y8DC 4JDTH 4PLOB 5I75C 1EANA 2IWKA 3FT2A 4P5RA 3WFDH 5L4MA 4OLXL 2HLFC 5E00B 4E5XG 4PJFE 2AXGA 2AJUL 4L3AA 3TJHC 1GHFL 1KN2H 2VDOL 2PR9A 3FF8A 1NPUA 3G3LA 3L5WA 3AMKA 1KYOK 3N41B 4P2QB 2AV7B 3BWAB 4Y5YB 2FQFA 2J20A 2VCOA 3CMOH 2QQNL 1MEXH 1NGPL 1F6FB 3GSVA 3MV01 4C83B 3D8MA 1UCBH 4PJXE 1MCFA 3T0VA 1M7IB 5F7HA 4YMPA 3GTNA 4PJIF 2IQAA 1C5BL 4F93B 4J12A 1N67A 4ZUSB 4IMKC 5IB5B 3RTQC 4AEHL 2JMRA 3TASA 5HYSG 1J1OL 3PXJA 5E2WH 3AJ7A 3MXWL 2GHZA 2CNZA 5F2FA 5IVOA 5TF1H 5AVQB 5HVFB 3ARDA 3IU3B 4KK5D 4KK8D 4M00A 1V7NH 2AQRA 2H47C 2X6AA 4JZJC 3D7PA 3WNIA 4PR5B 3PAYA 1FZKB 3CH1B 4MASA 1UWGH 1MH5A 2EYTB 4TUJB 2OJZL 2IVFC 2VNCA 4JFPB 5DRNA 3U30C 2I69A 3OF6D 5KS9B 2A4ZA 2QSCH 1PGRB 2VABA 2AQQA 2OI9C 4ZX3A 1L9MA 2YD7A 1R1CA 4IBUA 5D6DA 2G5UA 2WLHA 1FNSH 3EW3B 1EWHA 3RJOA 1NGQL 2NUTB 1DQVA 1VGKA 2I27N 2A6JB 3CN1A 5BV7B 2Y1VA 1BBDH 4YE4H 1R3LB 3P9LB 5J1AA 5HDLA 1G6RA 4GAJL 3L4TA 4Y4FB 3ULVE 5ICZA 2A9CA 4R4NC 1ZSDA 1C16B 2KZ1B 1HKFA 2YPLB 4Z7OE 5I0WA 3V95A 2WSDA 4IW4C 2ZAIA 2EIZB 3KR3L 4I2XE 4AQ8C 4MJIB 1HYRC 2YRLA 4BXSV 4PB0L 3CC5A 5CILL 4Z23A 3VRIB 1YQVH 3ZZ1A 4XE0A 4FQ2L 2YQBA 5FDWA 5FCSH 3VYPA 1UHVA 5LCVL 3G08A 3V55A 3WD5H 5FO7B 4OLVH 1QUNB 4X4YB 1VAHA 4H20H 4R7VA 2BNRD 4TV3A 4KRMB 1G7MA 4MQXC 4ZQKB 1JCVA 1O9WA 1U93B 3T3PB 3C60B 4JFEA 4FQHB 3RPIA 3K72A 3FBQA 4KNTA 1CFTB 4XXCA 1KN4L 4XN8A 1ZT7A 1CXLA 1WAAA 3MO1A 3C09C 3MRKA 2AZUA 2BOBA 4UIMB 3KYNA 43CAA 1B2WL 5T1DL 3SE9L 2X2UA 5HHVH 4LLWA 5IJVB 2VQTA 2WXIA 2XWBA 5MHSE 3NQIA 5T1LB 1QSVA 4W1TA 3II2A 4HHWA 3LQZB 3ZTDC 3FQWA 3V4UL 1R34A 2DD8L 1KCRH 2A74A 3UXFA 3QI9B 4OD3H 4DJMA 1UEMA 2FX8H 3CFBB 2YQ3A 2YA0A 3AUWB 4GG8B 4OBRA 4PCYA 2V9UA 4WFED 1A1NA 2ADYA 1NBQA 2WY3B 4JFFD 4JFQB 6PAZA 1CDYA 1JZJA 1QLFA 4A2FA 1NGXA 2H3XC 4DN3L 1I31A 3VXME 2IGFL 1YAIA 2I60H 4IRSD 3ZLQC 1I3RA 1GIGH 3PV6A 3QEGH 3QDJA 4P23B 3QFJE 2PUQT 5AW4B 4YVUA 2EKSB 1RUAH 3EOAA 1L9NA 3AQXA 1J7VR 4LLUB 4UU9A 2E5EA 2B14A 2C34A 2DWXA 3OKEB 1WAPA 3O3BA 4OTXH 5GRVL 5LO7A 1LO2L 1E2WA 1M2VA 4IU2B 4GBXA 3K8MA 1L9QA 4JB9L 2AK4E 4PB9L 4XNMA 3ZTCC 4B60A 3FHAA 3RY4A 3UO1H 3VXOB 1DUYA 1JTOA 4M5TA 1FYTB 1ADQA 4YHOH 3Q5YA 4ZPTB 5I1EH 4YHZL 3MLRH 1ZXKA 5B3JF 4PTUB 3TO4D 4DGYL 3RTLA 4LVOC 1KLGB 4OZHE 4U1HA 4N2MA 4ZXBD 4RWYL 5GRUL 3ZHLA 2VE6A 2VDLL 5C0BB 2DQTH 1YMHA 4FD0A 3H0TB 1RHHA 2ATKA 5DC9B 2X38A 3CFMA 3WI9A 3X13A 1MXGA 4NN7B 1I9IH 4NRYA 5JIIA 3D4ZA 4YDKH 1XH1A 4H44C 2EINB 1PG7H 4P46B 3K6IA 5BQ7B 5IMLA 2G9HA 2SEBB 1WBYB 4M43L 4LB8A 3FCGA 3FTZA 1SFHA 4OFIA 4TQPA 1A7RH 1ETZA 4LU5L 2R27A 3MRFB 1BQLH 1OAZL 3TO2B 3EYSH 4KXZI 3WIHA 1RI8A 5EDSA 1J9CT 4WCYH 3JWNE 2NSXA 4IK7A 5GGTH 2ITEA 3VB9A 1UT2A 1DVFD 1CU4H 4JRXD 4WNQA 1LO0H 2QHRL 3FCTA 3OKYA 4GEIA 4U3SA 1LLAA 2HP4A 1MFAL 2WCGA 5AD0B 2CZNA 5HXMA 4GIOA 5DO8A 1XGZA 4W4OA 4PIRF 4HAFA 5M7QA 3K2KA 4AKPA 2NYYD 5LGHH 1YNKH 4QR7A 1U8HA 1K2DA 1TFPA 4PWGA 4YFDB 5T5FL 4FFYH 3TXAA 4XPGL 4AC4A 2CDEA 2WQAA 1VZGA 2FT7A 1GC1H 1OGPA 3BPLC 2R0ZH 2ZYRA 1A4JB 4QHKJ 3FFCD 4RFNB 1CT8B 5FUZH 1IAIM 3D09A 3PDDA 1KPVA 3MKKA 1MN4A 1NAMA 5EHFA 3GSNL 2P5WB 3ARDC 1NLBH 3CLFH 1BCIA 4NENB 4GMTH 1D5ZA 4JO1L 1S9XA 2JE8A 2JI2A 4J1UB 2QVMA 4TF4A 2IXQA 2EILB 1JV5B 3EDKA 1A1MB 4BZ2L 3O4LA 1J5HA 4TRPH 4H4NA 2D7OA 2ENSA 4PJ7B 5L0QC 4OFDA 1SJVA 3QJVB 1ML0A 4M3JA 4FI7A 1NDGA 5D6DC 4Y4HD 5GJTL 2OMZB 3DVIA 4ZFOA 1MAJA 1YMMD 2BXZA 2XXMB 2YGOA 3DJZA 5FM8A 2VLLB 4KTDH 1U8OB 5HHQB 1U3JA 4G42A 3MLSL 4GS7C 4BSVA 2IAMB 2KC0A 2ADIB 5E5MB 3H3BC 4EPSA 2MQ3A 4C59B 2NY5H 1V05A 2OP4L 3WENA 1G7QA 5JQ6H 4NAJA 3VU2A 1AKJA 3V0EA 1PS3A 1JP5A 5J7CC 3A22A 3NQKA 4WU5A 1J5IA 4JDVB 3DETC 4QRPE 4P3CH 3BKYL 4LLQB 4OM1H 1FF5A 3HE7C 1UWEL 2G75A 3DPDA 3LPPA 1HDMA 1FBIL 1VFBB 4FNPA 4XWGH 3NFNA 5I19L 1YC8A 1IGYA 2DJMA 3OKMA 1QRNE 5ESVB 4UTAL 5MERB 3R4RA 3LH8A 1S7WB 4ZFGH 2DJSA 2YK1L 2R29L 4IQHA 2G3XA 3GC3A 4PJEE 4O58L 1X4XA 3F12B 3I3DA 1KY7A 5CZRA 4WTQA 2XTJC 4S1SH 2CDFA 1FDLL 4I5BB 3WMQA 1FL5A 1KCWA 1AXTL 2X10A 4QKTA 4PJAE 4EN3D 5F88A 1XF5A 4BRVA 1DQJA 3QPQC 1E9PA 3BISA 4KVNL 4XXCC 3U46A 3M1OA 4L4TB 4XPFL 4JFUA 3DV4A 4I48B 5BXFB 1A65A 1TU2A 1HHIA 3SPVA 5D7KD 4Q97A 3FAXA 3QPKA 3W0WD 2JIXB 3RU8L 3DUUA 2DTSA 5IBTH 3QZWA 1AGEA 5DD0H 2WC7A 5I1GH 1FFOB 3APNA 3H9ZA 4PGDB 3PP3K 2A6KB 4C56E 5C9JA 5K1NA 2VDRB 4NNXB 4FTVB 4OCYH 4YDVA 1WBZA 1FI8C 5CIPH 2EDEA 1EZVX 3NSCA 3ECWA 1F4XL 2E46A 4QRRE 4P5MA 1EFXB 2F1EA 2O26U 3UYRH 4PG2A 1UWXK 3MRGA 4O51A 2J4WH 4Z7VF 4YQXL 2QVFB 5SWSD 1PLBA 4APQB 5ADPH 4B27A 5HHXH 5I76A 1UYWH 1BWWA 4DGIH 1P7KB 2AV1A 3V6FA 3LRHA 3AWGA 3MACH 4PM1A 1JWUB 4LGPB 3FUNA 3OJMB 1X5MA 4A7UA 4N2BA 3D07A 1X5LA 2QQLH 1AHWB 3TP4A 4UTBA 1TJHL 2VXQA 3D08A 3QARA 5C71A 1CICB 2HAZA 3QC6X 1NL0H 1DBAL 2WOYA 3N1GC 2YD1A 3HOGA 4GBXC 1NFIA 2ENYA 4LSRH 3QDHA 2GCYB 5FWQA 1JGLH 1RZ8B 3G5YA 4NQCE 5H94B 5A2BA 5KTEL 1JYNA 3PG2A 5FW6A 4YSTA 5DDHA 4GW1A 5BZWB 2F68X 3CFKA 3WKML 3KPNA 3V4PA 4HWNA 1AGCA 1FZOB 3DX0A 5EF3A 4RGMB 4N2CA 4KXBA 1MHPH 4IOFD 5EOCH 1Q94B 1AFVL 1MCKA 2WWMD 3BQUB 4OU3A 2WKGA 3X3GH 4PV8A 5JPNA 4Q9QH 3GMOB 4ERSL 3DRQA 3I6KA 2DWTA 4RMRA 2R8SH 4MX7B 3VI3B 4HW6A 1EEZB 1BF5A 1T2XA 4YDIH 3DIFB 4LCUA 3U1SH 1E4KA 3P40A 3GHPA 5E1QA 4PV1C 1LE5B 3FHEA 1VACA 5DJ2B 4J8RA 5HDQL 4OFQA 1KLFB 3FUHA 1G7JB 1MUJA 5HP5A 1H3XA 4AOFA 2OYKA 2QQKH 2PYFB 2X0UA 2YXWA 2DIBA 4OT1H 1AGBB 1WBXB 2E8YA 2XRAL 2HRGA 4Y9GA 1M42A 3LQAH 4G72B 3CSTA 4KHTL 4W4OC 1AR1D 1D6VH 3E6FB 4IRJB 2E6PA 2IADB 3GRGA 4MCYB 3FO0L 1BFOB 2XG4B 2NQCA 1F5WA 4AENA 3HE6A 4YAQB 4X6CE 5CU9A 1XF1A 1T2QL 4FHBD 1A02N 3C8HA 3DX8B 4WFEE 4HIHA 4UILL 5J8OA 1KIRA 4TUUA 1DBJL 5CINL 2IFFL 4ODUA 1IBGL 5C0EB 2X87A 5SX5K 3RUGB 4CNIB 5I8KH 3KPOB 2NZIA 4FXTA 3MZGB 2FHCA 5HHME 3E6HA 4DQOL 3OMNB 1YN7B 1UCTA 1YEHH 3MRMB 1QI4A 3NOIA 4OJDH 1HQRB 3BKMH 1Y6NR 2G60H 3BVVA 2EADA 4RFEA 1KIPB 3HG0A 1FVDA 3C5ZC 2EEAA 2NDFA 3DLQR 5E6IB 2XVLA 4LPXA 5JW4N 2E7HA 4M5YH 3CD4A 2ISDA 3KPRB 4EZMA 5CD5C 3M88A 4D0DA 2E76C 1QFWH 4CJ0A 4LRNH 4L8DA 1EMTL 3QO0A 1FIGH 3ME0A 1QHPA 2F15A 1XAKA 2CKBL 3AM8A 5T3ZE 1PSKH 3WJMA 3LIZA 2ZUSA 2OQJA 1DQMH 1E27A 2P47B 4OZGF 4PJGE 1QBML 5EH1A 3Q3GB 3UTZB 3UTTD 2WIMA 4AQAA 2N0MA 4EKXA 3TC9A 1BAWA 4XO9A 3BH9B 4HUVB 4FQXD 4H0LC 3X3FL 4I7ZC 5JQHC 2PWGA 1C9SA 3RHWF 3GRWL 4HFUL 1UUNA 3KYMA 2BSTA 1UB5A 1I9RH 2QZ5A 4E68A 4NC1E 5D7IF 4POYA 2H32B 1RUPH 1QSFA 1WAEA 3R1GH 3NN8A 4PJCA 1MFDH 1CBVH 3EGXA 4BYHA 2XSKA 3IXAB 1GL4B 4TTGA 5AW8B 3EYOA 2GABA 4O2FA 5D7LA 1N26A 2XIBA 1B0RB 4KH2A 2FEJA 4U1LB 4PBDA 3K2MC 3QWRA 4BM7A 1H0DB 1T83C 3CU1A 3GO1L 3MBEC 3OJDA 1ECZA 1GHFH 3ULUL 5ANME 5JIKA 4QAWA 2VDOH 1IM3A 5D2NE 3SGEI 4U1SB 3TVMB 1EO5A 4M7LL 4PH8A 3EGSB 5DEZA 3BUBA 1EEQA 1E4HA 2QQNH 5JOFB 1MDAA 1NGPH 1U8QB 2Q9OA 4WW1A 3CSPA 3O3AA 4Y1SA 1SEBB 4LEXL 3T2NL 4AEHH 1XF3B 1AXSB 1GRWA 4IOIB 1BGXL 1I7RA 5EIIB 3EDJA 1J1OH 4OIFA 3VXQA 4FXLA 5BVJA 1VEPA 4AIXA 4B50A 3MV9B 2OJ1A 3BCFA 3VXNB 4B5EA 1HILA 3L4XA 1X6NA 1EHNA 1Q0XL 4UYPA 4ZAKA 4GYBA 3RVXD 4XN1A 5BZDB 2XA3A 1JUFA 1RZPA 2OJZH 5A43C 1BVNT 3HMXA 4IOSD 3MVSA 1SF5A 5FS5A 4ZMXA 3AGWA 4MAYB 5DRZB 3DXAB 3RY5A 1N59B 3B2MA 4QHPA 1NGQH 4AGOA 3CZSA 2WYTA 3AT8A 4KROB 1F97A 3HC3L 4HG4J 2BWQA 4J3OC 4NUJB 2OFQA 1M3IA 1S46A 3C5SA 3EH1A 3KLAB 3FTSA 5J9PA 1H9DA 3BH4A 1MHCA 3CVHB 2JH2A 3C6LB 2P28B 4BJLA 1MLCB 4OCWL 4LVNC 4X0NA 4GAJH 4HWBA 3V0JA 4UOJA 1PDKA 2NTFA 4WRLA 2X6BA 1FZMB 4L3FA 3SO5A 1XTMA 5CCHE 5DJYB 5JPNC 5DJ0B 3KR3H 1RZIA 4NB7A 1IGFL 4PI0A 3JZ7A 1I9EA 2XQ0A 4PB0H 1T0PB 5CILH 1QWNA 4WFFD 2QT6A 1E4KC 2UZXB 3RILA 3OGCB 4FQ2H 3SBPA 4A7VA 5IJBC 2WLLB 2F61A 2YC1B 4L1SA 5LCVH 4YHIB 3MTRA 3WHE1 2YD3A 3IDYB 2J21A 2Z6FA 2I25N 4JLRB 4N9GA 5EZOH 2MWCA 2BCMA 3WS3A 5I8OL 5LDSA 4XN4A 5E8EA 4OGAC 3W82A 4WQOA 1JN6A 1IFHL 5DZLA 1E2ZA 5E24E 1SYSB 2EDLA 5BJTB 1DSFH 1KN4H 4K5OA 3TBBA 3IFOA 3NFPA 2VITA 1B2WH 1TMCB 1ZV2A 5T1DH 1TEFA 1MJJB 2WXOA 4WWKA 4CU8A 2IDQA 2PWEA 5EIIG 4F24A 1QMUA 2ITCB 2Z31B 4WFHD 4HS3A 3HE6C 2DMKA 3OQRA 4GRWB 3FSWA 3CAFA 1FFNB 3QNYA 1OB0A 4RGOL 3EZJB 1OWWA 4M4RB 2DD8H 5DMGC 4Y9EA 4HHAB 4JRYB 5F6IC 2OYPA 3NCMA 4FF9A 3WY4A 3PWUB 3DYPA 1XWVA 2X2YA 2B9BA 2ZKYA 3NJFA 4BDVB 5IVXE 3RPBA 1UD6A 1CK0L 4TNVK 3GYRA 3DX6A 1NC2B 1A7PL 4DEUA 1W0VB 4DN3H 5K9KB 1YC7A 5MEND 5CSGA 1IKNA 2IGFH 1QP1A 5D55A 3IPEA 4J5VA 3FO9B 3KXFD 4BIKA 1GCYA 2PWFA 1S2EA 1PCXA 1HSAB 4NC0B 5D7SH 2YN5A 1XL4A 3OSVA 3ARXA 3DVNB 2CHWA 4HWEH 4FGMA 2FL5A 4OLWL 3B2VL 1FUNA 3WEAA 2HX9A 3HUJF 5D6CB 1LO2H 2HVJB 5D7JB 1R47A 5E9DB 3B9KD 4UDUA 1A3QA 4JB9H 1OIOA 3DC0A 3BRDA 4OLYL 1QQDB 1W72B 1H5BA 4K7PY 5TE6L 2AEIT 3OF6A 3AM8C 3D48R 3BP4A 4UT9H 3W9DB 4A55A 1YYML 4K3DL 4L23A 1A4CA 3KPSB 4N2EA 3LZQA 1YN6B 3VFNB 4EI5D 4RWYH 5DI8B 5GRUH 2MJWA 3WLWD 2DOCA 3ZE1F 2VDLH 3EH2A 3PAUA 1U41A 4UT6H 2W38A 1XXFC 1YO4A 1A9BB 4MRBA 4W9ZA 3RJDA 5J6HA 1E8YA 1M1XA 3S6CA 4HUWB 3V6ZA 4CRPA 1QSEB 2KQNA 1JGEB 3LB6D 1TZIA 4NCDA 4POZC 1WCBB 4ZD3L 3MJ6A 5H37A 4UM9B 4M43H 1XIWD 1IRAY 5FIEA 4A63A 4LU5H 2YMXL 2WAQA 4CSSA 3BDYL 1OAZH 5EBLA 4F7MB 4PJFB 3HS0B 1ZE3C 4NRZA 3VD4A 2ZOKB 1KB5H 1ZHKB 3F01A 3QA3B 2EIDA 2QHRH 4JFYB 1A3ZA 2K9UA 3UTQB 2QPDB 3UMTA 3N9GH 2VR4A 5GXBB 1I3GL 1MFAH 3AQYA 3HCVA 1NCAL 2WOBA 3F7LA 1SJHB 3IDMB 5E8PB 3C6SA 1M7XA 5L8LB 3UROR 4PJXB 2YR3A 2YOAA 5T5FH 5I71C 3O9WB 3DUHA 3VJ6B 4W9CC 1G9ML 1A6AB 1SPDA 2BFVL 2BNRA 2E27H 3LEXA 1U8IA 4HIEB 4AQEA 3B8SA 4FC3E 2ZAHA 3T0ED 1THAA 4FFVC 2DLHA 3R06B 3SKNB 5DZOA 12E8L 5CHNA 1PF3A 5TDOB 4W9HC 4K07A 4NCC1 6PCYA 5EO1B 4QHKI 3CG8A 2Y7OA 2OZ4L 1IIIA 2WWNA 3GSNH 3VRLF 1BQHB 5LKNA 1ZHNB 4CILA 3E1ZA 1UOKA 4JO1H 3CUPA 2VDQL 4NSKA 2Z64C 4ZAKC 2V2WA 2MPVA 1LJMA 4G43B 4BZ2H 5DHXB 5LBSL 4WI5A 1XB6A 1U58A 2OMYA 1SLVA 3DVGB 3CXFA 2BVQA 1D2OA 3QIUA 4LCYB 3CBKB 4Y5XC 5DZVA 4PJHF 4PJDF 4MA1C 5GJTH 4KZDL 4HC1A 4TSCL 4K23H 4JFFA 4U1GB 5JPMA 2VLRE 1PY4A 4LLMA 2X3AA 1BZ9B 3OAWA 1P5VA 4DEPB 3BSGA 4X80H 4RMSA 2DWEA 4GKZA 4MXVF 3WO4B 4A6YL 5BO0D 4KQ0A 4Z7OB 1PY9A 5KSBE 2OP4H 3ILPA 2X1PA 1AKPA 4I2XB 4X5XB 2EDJA 3GSQB 4Z3IA 3EJUA 5FOBA 4OCXL 3BKYH 4H26A 4E41A 3N85H 2OMTB 1UWEH 4P2AA 1FBIH 2V37A 4V1DE 2EUVA 5IW6B 3G6JA 4KDVA 5I19H 3AG4B 3MUHL 1RZQA 4KKBC 2OMWB 1LHZA 3RURA 4UTAH 3Q2WA 2C1PB 2FJFB 1UXLA 1EEYA 5IQOA 2YK1H 4UDTA 2CWRA 2R29H 3RX5A 4M5SA 2CM5A 4N0CC 4MNGE 4O58H 3TO4A 3X17A 4ZX5A 2SODB 3QULA 4ZXBA 3P73B 1K8DB 3E2HB 1FDLH 2A0LC 2D8KA 2DBJA 2FJHA 1AXTH 2R69H 3L3DA 4GOSA 1SY6L 1A9EB 3WKPA 3NSFA 4KVNH 2FO8A 2C9RA 3VI4E 3F04A 4XPFH 4FTDA 1ADWA 2WO3B 2VL5B 2ED7A 3PWPE 3L9RB 2M26A 2ZIDA 4N8VB 4FLSA 4WWKC 5E94B 4YS4A 4ZZFA 4ODWB 4RDQG 1XR9B 2OSWA 1BM3L 1U8LA 4UZGA 1DQDL 4X5WA 3RU8H 4B9CA 5DO2D 3V8CA 1BQHG 2R2CA 2QVIA 3CDYA 2BVOA 2XN0A 2ZXCA 5IQLA 5EUOA 2H7WA 3BUYA 2VIRB 4LHUB 5GS2H 3MROA 2F54B 4JRXA 5JYMA 3T6ZA 4ZS6C 4L2YA 4WTZG 4XVUD 3UEQA 4ZW8A 5FA3B 1CO1A 1I8AA 1P4LA 2FYVA 3VXMB 1HHGA 4KMQA 3FUDA 1ZLUH 3SE3A 5J56B 1H8OA 2XU9A 1UD2A 5F8RC 4Q58C 1IKNC 1QD0A 1U0QA 1IVTA 1C5DA 3EZ8A 3QFJB 4L4VB 2GSGA 2D0HA 3HG1D 4LVHB 5ICXA 4MD4A 3BEWA 4ABVA 4LF3A 5CR8A 1XGTB 3FFCA 3IJSA 5FO2A 3UYPA 1E7UA 2OK0H 4ES8A 3CZJA 4MCZA 4RBPH 1TJHH 4G6KL 2AK4B 5DMKA 3ARGB 2AS5M 3DX9B 1OTSC 4KK5C 4KK8C 1DBAH 1F45A 2YD5A 4CC1A 3BRGC 1OXYA 5CS7A 2H2PC 2LVEA 3B9AA 5CLYA 5E6UB 1EHLH 4HEME 4HPOL 1AIFB 2WLJA 2H5UA 1BW8A 3CK0L 1H5BC 4HH9B 4OZHB 3OWEA 1Z66A 5KTEH 3QWOA 4OF6A 3O6FD 4F8PA 4HKBB 4Y1AD 4PRIE 3W3BA 5C6TL 3O2VL 3EOBA 3FCUB 4BGLA 5BOPA 5I74B 5F3BA 4RMQA 4Y4HA 4YDMA 2DKUA 4XCFL 2W5PA 1YMMA 2XKNB 4HIPA 1IMHC 3QNXA 1AFVH 1N12A 5MEQA 1H6TA 4WFFE 2QEJA 4GI8A 4R8WL 4DPRA 4H8HA 1ONQB 1TEYA 1VIWA 5I2IB 3OR6A 1S9KC 1MVYA 1W16A 1U91B 1S3RA 3K71A 4KTEH 3OHXC 4QCIB 3FKUS 3TYGL 1E5ZA 1HXYA 2HKHH 5HDQH 1F90L 2PR4L 8FABB 3IMBA 2J1KA 4NKMB 2CO6B 3GBMH 2HH0H 2XTJE 5E8OA 1S7SB 2IDTA 5AOMA 3QDMD 4Z7NF 4AX3A 2XRAH 1NFKA 4M62L 1KC5L 2XQYA 4DO5A 5JDSB 3IAQA 5TDPA 5GS2D 2FSDA 3ZDWA 4KHTH 2EIJB 2MNUA 2OJEB 4NBXB 1CGSL 3S96B 2G2RB 4UYQA 2YBRA 4JHAH 4LEOB 3P69A 4WLCA 3CFCL 3LVTA 3FO0H 4MQSB 2V2TA 2WUCL 1TQVA 1WFOA 4R3SA 3RGVB 4EN3A 3X1NA 5C09D 4C55A 4PJIA 3ETBJ 3ARUA 1NGYB 1T2QH 2RIKA 3BPCA 2LQRA 1FL3A 4XMWA 3REWB 3TH4T 5EEUA 2Q2LA 2Y6SD 2V0AA 4K71C 2NY3B 4UILH 5IBLC 1DBJH 5CINH 4W9FC 4XB8A 2IFFH 1KPUB 2HPTA 1IBGH 2OR9L 4FZ8L 1IIKA 2JXMA 4J27A 3W0WA 2I7OA 5DEFB 4AI7A 3G9VA 1JYWA 3B7YA 2VYRE 4PBVC 5TF0A 3FYIB 2YGPA 2FUQA 4KJQC 3DV6A 5AVTB 5SV4A 4LCWD 1VF5C 1A64A 3QFDB 3MNWA 3IKCA 3QIUC 3T6VA 4PY7B 3FZUC 5IV2B 3ZZLA 2FT8A 2L7EA 3QNFA 5JPMC 4XNUL 2BSDA 1EVUA 5K5YA 1J5OH 1T66D 1Z5YD 3PHAA 5AWNL 5BRQA 2H9GA 2JK5A 2APSA 4PJBF 1GJIA 2B4CL 1P4IL 1BSIA 4W6XB 5AOKA 5SWSA 1I7ZB 3SKJL 1KGUA 2ZOOA 1C7SA 3O8XB 1ZV5A 1CGWA 2G3ZA 3K2UL 3CSYB 3QORB 4RNRA 1EMTH 4H1LG 4WEBH 4YDJB 3LPFA 1OAKL 2E9IA 1OE3A 3CHXA 4LLDB 4PRBB 3ZBMA 1KLUA 2VJ8A 3JWNG 4NO0D 4QRTB 5JHDE 1QBMH 2YRPA 2K6ZA 1MFBH 3Q2CA 3ALPA 4PJEB 3E3QC 3X3FH 1I1FA 1GJUA 2V8MA 4Q9RL 2O6FA 2ADJA 2V5MA 3GRWH 4HFUH 4WHTA 4KJYB 2Q8AH 2OL3A 2CBMA 3EYFA 4PJAB 1XF4B 3TO4C 2CLZA 5I24A 3PGDA 4ZXBC 2TRHA 4CKQA 2ZKHL 5H2BB 2HKFL 2Z7UA 5IVZB 3LMJL 2MIZA 4PVMA 1OPGL 3A4EA 4JCLA 5C0DA 2H4EA 2C3GA 4XC3H 4OY9A 2R0LH 5ERWA 5KVFE 4A2HA 1G1OA 1I1AB 2NYKA 1RVFL 2ZG1A 5I0DA 2H0JA 5KVMC 2FWUA 4X6DE 5KJ4A 1ZGLA 1I8IA 3GO1H 1CB4A 4KBPA 2IBGA 4K5MA 3ULUH 1J8HA 1KFAL 1SXBA 2P8PB 2A2QT 4C56B 2XTSA 3WGUB 4LBAA 4M7LH 3PABA 2EDBA 3HAEG 5IP4A 1FZJB 2QMKA 1X5AA 2ZXBA 1ZS8B 3H9HA 4UQEA 4OJAA 5GISL 2P24B 4QRRB 3ARTA 3MNZA 3IEAA 2E7BA 3OHMB 3N43F 1KCVL 4LEXH 1J87A 3U0PB 4TTDC 3ZDXF 1S7TA 1BGXH 3D18B 2JTYA 2DQUH 5SWZD 5CIPA 3SE3C 1RZJC 3T0AA 2I9TA 2NYYC 2WBXA 1JE6A 3EBIA 3ARYA 1EHXA 2QGBA 1X7TA 1LP9A 4N2LA 3DGCR 4NKQB 1RUKL 4TLUA 5FHAL 3VB8A 2GJRA 1SOKA 3DMMB 3EDFA 4TLSA 3VFPA 4I0PA 3O4LE 3WFHB 1P1ZA 2W81C 4ORGB 1E9OA 1L9OA 3CXHJ 4F8NA 3FCBA 4N0UA 5AVZB 3RI5K 3HI1A 1VEMA 4ECNA 3CHPA 1Z0NA 1QPXA 5IM7B 4PG9A 1GA2A 2UXGA 2Q3ZA 3CFEA 4Q6KA 4RIRA 1SZNA 4DZ8B 4KH9A 1AQDB 4NQCB 4FG6D 5F7EH 1JXKA 5FM4A 4NJAL 4P57A 1JD7A 4XR8C 2A38A 2PCYA 3HC3H 4R9HA 2AEQL 2BW5A 1XGPB 2JQZA 5LXGL 5D70L 2JCWA 3RWCA 3I02A 1ZPUA 1EX0A 1NBZA 4Y4HC 1HCVA 3CGTA 4MVBD 4QIRA 4RGNE 4FI6A 4JHBA 4R7DA 4U2ZA 2JKTM 4H2AA 3T4YB 3OXRB 1ZT1B 4MZ2A 4LESA 4NC2B 1UH4A 2Y1AA 5LUMA 1GZQB 2PTTB 1IGFH 4H8VA 4NT6A 3UG4A 3CFDB 1A4BA 3PJNA 1NM4A 2H1XA 4QHMA 3WMSA 4QPEA 4HK0B 1BZOA 1UADC 3O6KL 4OVVA 3FO1B 1MW2A 1E4XI 4G80A 4Z7WF 4ZUWB 1P4UA 3RIKA 3ULUD 2C1OB 4BXVA 4R2GC 1HH9A 2QQQA 3FF7A 3VUAA 3F7PC 1IC5L 4N1CA 3RKDC 4G7VL 1GAFL 5DS1A 5I8OH 5KBPA 3UTTA 4RSVA 3ABGA 1IFHH 4FQXA 1PLCA 1A2YB 2XDHA 3BI9X 3BT0A 3RWJB 5KG9A 1D5IL 2ALWA 2AXJA 2ZOLB 3LXAA 1E6JL 3QR1A 4K94C 1RULL 2R1XB 1RPUA 1J0KA 1QNIA 2BVPB 4KMLB 4FHKA 4WI6A 1YY8B 3MBWB 3OKNA 4X6CB 1B4JH 2R4RL 4J3SA 1U4FA 4EN3C 4M7LT 1LDSA 2QZQA 4L3EE 1NFDA 5T8IA 4HFWA 1UJ3A 3L3KA 4YO0B 3EYQC 3GNML 3SQBB 3VD5A 4LSUL 3ZKQD 4CMHB 3K5RA 1MCLA 3HNSH 3GMMB 3S4SA 3ZTJG 4QY8B 5DEJA 4Z77A 1G0XA 2UXVA 5E0FA 3FB7B 2YQ2A 5B1KA 3Q8FA 1RUQL 5HHMB 2ZPKL 4A2LA 1ZWIA 2HMIC 1T3FA 2X4QB 2L7UA 4Z18A 1CK0H 2WNWA 1IE5A 1WGVA 2UWEF 1A7PH 1DLHB 5CD3A 1DHKA 3WIFA 2XBTA 5A2KH 5EC1A 2QR0B 3HZMB 2VKWA 2ZUXA 4L1HA 3KWWB 4PRNB 4M02A 4F9PA 3DO3A 4G9FD 2XPGB 1LEIB 3WXWL 4HUCA 3LZPA 1N6VA 2HT3D 4N85A 5HHNA 4L1DA 1DQQB 1MRDL 1MCPH 4MYPA 5F6HJ 2C4FT 2WHVA 3EO1A 3MUUA 3NIDF 3GBNL 4OLWH 3K6SB 3LD8C 1KZYA 4AYFA 2A6DA 2GPZA 5IF0A 3MV7E 4OLYH 3LH2H 3T4AA 3FT9A 4WHYG 5TE6H 2EH7H 4EOWL 3QH3B 4PJGB 3AACA 4LOUC 4IOSA 1WZKA 1YYMH 4K3DH 3FSZA 2NMSA 2NOYA 3PWJA 1CF1A 3KEDA 1W6WA 3PP4L 2BS9A 5EZJA 3ARSA 4TLTA 5KBMA 1Z32X 1OGTA 3AU1B 2OXHB 3BP5B 4R7NA 1IUZA 5ETUA 1FPTL 1BXVA 43C9A 2IFGA 4YDLC 3D2UD 4X4XB 5AALA 1RJZB 4F3FB 3EJYC 1TOXA 2CXGA 1FNGB 5E8DL 5I8EA 4ZD3H 3BPNC 4PWKA 4XP9L 1GKOA 5BZXA 2D03L 3FTGB 1PEWA 5E5UB 3SDXE 5D93C 4ELMF 1NBYA 2YMXH 3FB5A 3WY3A 1DVUA 4GSRA 3BDYH 4KOCA 2WWMC 4RDQF 1PTZA 4YXHH 1NUNB 4G6FB 3NIGE 4WKZB 1J8SA 1GOFA 5D1QA 1NCHA 1CTOA 1OCZB 1TTCA 5D2NB 5F1NA 1I3GH 1EJOL 1T5WB 4WU7A 1NCAH 3TV8A 2J43A 3AY2A 2WTOA 3TM6A 2Q76A 2P44B 1AHMA 3R4DA 4LPYA 1CE6B 1XXDC 2AMUA 1G9MH 1AD9B 1QZNA 2BFVH 2BINA 4N9OB 1GGUA 4V2BA 4NHCL 4G8EA 3JBG7 2JKIS 3H9SD 2BFGA 2VJXA 4QF1B 3ZL4L 2APWA 12E8H 1Z9SA 2CCWA 3DOIA 3EGDA 2WQVA 1FSKC 3MA7A 2OZ4H 3OX8B 4DERA 5LGJB 4W4NA 5JR1L 3QWNA 1YEDA 4PV9B 5CCGE 5KSAA 4I0PC 4ZSOA 2VDQH 3WHXA 2EECA 2PW1A 1TTUA 3L5IA 1W9XA 3RE0A 5CR1A 5TE4L 2D73A 3TZVD 4IU3B 5LBSH 5SWQA 4N6QA 3U4EA 3IF1A 3F2LA 5CEXB 1ZY9A 2X1QA 3MOAL 4BE6A 1Y18A 5F7LB 1COBA 3Q2LA 5CLWA 1XGQB 3P4OB 4PGBB 3PGFL 2IWGA 4KZDH 2P5EE 2HSIA 4TSCH 1IAKA 3NFSL 2EEFA 5KANG 4UAOB 3J8F7 2CKNA 5MEPB 4WK4B 1S9YB 3ATBA 5MENA 3KD4A 4AXWA 4A6YH 5H8DA 3TA3C 2V3DA 4Y19E 3KXFA 1KSRA 4PRPB 4XAKD 1M6OB 1JMXA 5F0LB 3O2DL 4WIQA 5CFAA 1LMKA 1WZ1L 1J9RA 1JRHH 4NM4L 1JPGB 4OCXH 5D4IA 5IOPB 2GBVA 3MJ8B 3WNMA 2AXHA 2FGZA 4WVRA 4I87A 4JJOA 2V7NA 2DQCL 2WUBL 3KPLB 3BPOB 2TSAA 3PYCA 5KYYB 3B9KA 1GYUA 2FGWL 2R23B 1F6AB 4Z7AA 4GEJA 5ES4B 4AVIA 4S0SD 4P49A 4QI3A 1OCOB 4BBWA 4RWHA 4I0CC 4ZO6A 1P2CA 2X6VA 4QHLB 3OXSB 4FA8A 1CFNA 3T77B 5K59E 4Y4KB 3TJEL 2IV8A 3GUFA 3OR7A 4EI5A 4QXTA 2W0KA 3KHQA 4HJIA 4AW4A 4XZUA 3VYOA 4NZUL 3D52A 4V33A 2WLIB 5GGUB 3IDIA 4PD4J 5LXVA 1NTDA 3OC8A 1MWAH 2VZUA 4MXQD 1GYAA 2JV6A 2OW7A 4X8JB 3Q01A 3WE6B 1XIWA 1IX2A 1BM3H 5DVLA 3FRUA 1DQDH 5EA0H 3VCLA 3U36A 3TBTA 3CX5K 2AERT 3U7WH 5C0CB 3RGBA 1G7LB 1YLBB 1UJ3C 4XVOA 2ZJSL 1BBJB 4U0RB 3RTQB 4ZUVB 5IVXB 2JJUA 2UZYA 5SWZE 3OMAB 3TF4A 2ZYIA 5I6MA 3DROA 2VMDA 3NZHL 2X0VA 5B38A 4NI3A 1ILUA 2F53E 4XVSH 3SE6A 3AREA 3UZVA 2D2OA 5L2KA 5I6PA 1LEKB 1UACL 4F1ZA 2OI9B 2MQGA 4F9PC 3K0YA 4R84A 3T0EA 5HHPA 3ZZSA 4IGBB 1IARB 1ROCA 2JJWA 3D51A 3L4UA 4LEEA 5BV7L 3QCUL 3UC2A 1HAUA 1AMYA 1U3HD 2Y5TB 3SJVD 1OV8A 4G6KH 4YHNA 3V5HA 4X83A 3GD1C 5AOJA 3REVB 3RFZA 1VJSA 1KTRL 1N19A 4NO3A 4OFKA 3BD4A 3WUWB 4BKLB 2CIIB 5DGRA 5C8JA 3CK0H 4JM0A 4PRHE 4FX5A 1AVAA 3T4AC 4TNWF 3V0VB 5DHYA 3ET9F 3UP1A 4FQLL 3T3ME 4PUBH 5C6TH 2EUZA 3O2VH 2GSIA 1BLNA 4UT9A 4XCFH 3I9AA 1RP9A 3LRLA 4W6WB 4XTRC 5EU6D 3FB6B 5IR1B 4K2UH 2DEYX 4R8WH 5FGRA 4UT6A 5L7XL 3JTSB 4EO5A 5I15L 4LFHD 3F8UB 2WIIA 4EQ3A 2EZ0D 4HWZB 5D7IA 1NCOA 3VM5A 1JWSB 2RAMA 3TYGH 1WSST 2M83A 1F90H 1MHEB 2F5AL 2PR4H 3BW9B 3LNFA 4LHQB 3SOTA 4F5CA 4QOKD 4JE0A 4KKLD 4NN5C 3S8GB 1FRGL 4N0FB 1PZ2A 5TDNA 1YEJH 1DP0A 1NJ9A 4HETA 5D1QC 1HI6A 2LE9A 3CFJA 4FZEL 1IEAB 2NY0B 1YQ2A 2YARA 3FDWA 4H5SA 4N2AA 1KC5H 4ZYKB 3QXAA 3SDYL 1KB5A 2PABA 4M29A 3GGWA 3QR2A 3WUZA 1CGSH 2AJYL 4UAHA 3H3PL 2E6QA 4B9GA 1TIUA 1CL7L 3CFCH 4IKNA 4XH2B 2R56L 4AKQA 1J48A 2WUCH 4PVNA 3IT8D 4UANA 1E6OL 1U92A 1T1XB 1QO3A 4LXFA 2NNAB 3UZQA 4MJ6A 3NVQA 4IJ3C 1B0GB 5HHOE 3EFOA 1S7VB 4L18A 5JW5B 3FULA 4U3HA 3N42F 3ZE0B 5T3XL 5ANHA 1SMOA 5KSAC 2OR9H 2XWTA 4LASL 1TZOA 5GGVY 1CG9A 1XSOA 3MAWA 2FD6H 2FNWA 5EC2B 1NMCC 3U9PH 4TSAH 3BIKA 3R8BB 3IKKA 3ZL1A 5L2JB 4DETA 5AW7B 5KZCB 2PO6D 3IDXL 3SODB 5FKPB 4BZ2A 4FJ6A 3SQRA 4YPGA 2VLRB 4I9XA 5GS3A 3FUKA 2HFEA 2AITA 5E2VL 4R83A 2MQCA 4L8BB 1B3IA 1XZWA 6TAAA 3TONA 4UNTA 5AWNH 5KSBB 5C0JB 2OTWB 3MRBB 4LNRB 1P4IH 1JF1A 2IPKB 3EYVA 2YSTA 3SKJH 2OYLA 1RXLA 4ACPA 1R3HA 4JQVA 3HG1A 2AXFB 5HPOA 1UD4A 1E67A 3GM8A 3K2UH 5EEWA 4V1DB 5FOJA 1L0XA 2Z1KA 4PTTB 3JV6A 1KXTB 1OAKH 4CVZB 1LNUB 1LE9A 1S9WB 4R7XA 2VAJA 1ZCRA 3IE9A 3B9KC 3BWUC 2JNZA 3L7FB 2WVVB 4O2EA 2WMPA 4HD9A 3FUIA 3C5JA 2Q87A 4AMXA 1WC7B 4X0KB 3IGAA 4Q9RH 1RFDL 3O6FA 4Y1AA 2P80A 5CWSB 2EDMA 1GY2A 3WLWC 2ZCHH 3LDBB 2HKFH 1AI1L 3ALXA 3VI4B 5KYXB 3DPBA 1OPGH 1EJ6A 4ZDHA 3PWPB 4C4KO 2DYRB 3HZYA 4GQRA 3K7UA 5DQDH 3HTLX 2E6JA 2VW4A 2R69A 5HDRA 1A6TA 3L5WB 3AC0A 4X8GA 4ADIA 3LB6C 1RVFH 2NXZD 3ARRA 2H1PH 2Q8BL 1WYJA 5LAXA 4WJ5A 2J25A 3AXIA 1WS8A 5EBMB 3TX4A 1KFAH 4E9XA 3QISA 5A16A 2AAAA 35C8L 3H2WA 3MCLL 2YGNA 1FE8L 1T7XA 2R9HD 3BPLB 4Y0GA 2AKRB 4NNYA 2J7LA 3KDMA 2PNDA 3GXUB 3SDDD 3ZO0A 3AAZA 4DOHE 3OGOE 5GISH 5DFWH 4PP2B 5IMOB 2X4OB 3QDMA 2DLGA 2A4EA 3MUGA 1YNTB 3MRHB 2ALAA 3GSWA 4LNVA 1J12A 1KXQA 5G5DA 3GUTB 4AT6B 2IBZY 3AREC 1P6WA 1ET8A 1RK1A 1RUKH 2X9ZA 5GHWL 3MRQA 3D69A 1OGAE 3TPUA 3T0EC 1QVOB 5F9WB 2GTWA 4YHLL 2YPKA 3ARWA 1L9TA 4PCSA 5JHAA 5E95B 5BRZA 3E1F1 2VERA 1E9QA 1BF2A 1OP5H 2ZOWA 3T8XA 5GRYA 3RFZC 1PFCA 3QDAA 4FQ1L 1YJDL 1R5WA 4YSSA 4Q0XL 3HUJA 3RRQA 5E9NA 3U0WL 2HZHA 4U7SA 3INUL 4PRIB 1OK0A 5FO9A 2ZUQC 2LAAA 1G4RA 2AEQH 3FFDB 3FN9A 4LCWA 3HHSA 1DLFL 2VDKL 5D70H 5LXGH 4ODVL 4BFJA 2FLRT 3HE7B 1CLYL 5JOPD 3VXRD 5LNEA 4E41E 1YPZA 3QJHA 3QUZB 2QKIB 5BMFL 1KENL 2YJQA 3ZKXB 1YUKB 3NTCH 3H7BA 3JUYA 5AW5B 5ISZE 3SBRA 2JSFA 2XY1A 4Y2NA 3E3QE 3HPJA 2MKLC 3QG7H 3O6KH 1OP3K 1AZBA 3STLA 2R51A 2XTJB 3RVUC 1XCWA 3D12B 5AB9A 2EIMB 3K72B 4Z7UA 4K7FB 5CXPA 1LTXA 2WXQA 5F72S 1IC5H 2HYMA 3MO1B 2WN3A 1GAFH 4G7VH 2J3SA 4N6RB 4NO0A 4P2CG 1JYXA 3KYNB 5HI3C 3S8FB 3IWUA 3GMRB 2C9AA 1KIUA 5I30L 4X9YA 1IJNA 2CO3A 2NY2B 4HSQA 1R0AL 2VLME 2CU9A 2APFA 4FNTA 3BKCH 2FBOJ 1E6JH 2D0FA 3N41F 4UQ9A 1MJ8L 5J57B 1RULH 3K0WA 3LNIA 1FLTX 1KEGH 3WDJA 2VDRL 4AIEA 4J4PD 3NSXA 4WO4D 5DK0A 3TA4D 3AB0C 5E6SB 2R4RH 2DI7A 2OPCA 1MI5D 1UA6L 1TLKA 4GQ9L 5EV7A 3LV3B 1XBRA 3VRJA 2DBLL 2O5ZL 1A1NB 1IZKA 2HTLD 2WXFA 3BUDA 3F6IA 3GNMH 3IDJA 3PFUA 3R8QA 3L17A 2K6WA 1OTUD 4OD2A 1XVSA 2VSDA 1EO7A 1RUQH 1RU9L 2AJZB 4RAUB 4DP7X 2ZPKH 1Q8MA 4JM4L 4UUJB 1I3RB 5DO2C 5C08E 1T03L 1CC3A 4F15C 1BQRA 3ZRFC 1Y0LA 4XGZB 2IH9A 3JTTB 1EDYA 3TBVB 3KH3A 1JRHI 3VH8A 3EOAB 1ZVHA 5J5EA 2XXCB 2BNQD 4IBSA 3NH7L 5CN1A 4XVUC 1BDYA 4PJDA 3WXWH 4I88A 4OV5B 2J6EA 1PX4A 1XR8A 2VQ1A 1M2VB 3ESMA 1MRDH 3GMNA 1KJ2L 3C8KA 2Y2TA 4I3RL 3GBNH 4Z9KB 1DUYB 2VSCA 3ZPDA 5F6HI 2E7MA 3DUSA 5DUBA 1AXIB 1PKQE 2ILLA 2VO5A 3MTXA 4JQVC 4KNQA 3MZTA 3MJ7A 2ITDB 3OC5A 3QB7C 3RI5F 3S36H 4Y5VA 1F56A 4EOWH 4IKIA 1VGEH 5JHDB 1YMHB 1G7HB 1NKGA 1RHHB 4ETQB 2FYYA 5JZ7D 3LRSB 1RIUL 2FIKB 3PP4H 4ACTA 4G82A 4L1TA 3LS4H 4O9HL 3B37A 3KJ4C 3SEPA 5I1KL 4CDGC 1FJ1A 1FPTH 2X5PA 4XMKL 2BSRA 3DJ9A 5DHVB 3KLHD 1ETZB 1WISA 5HYIA 3OMIB 3O6FC 5E8DH 4XP9H 3QCTL 1J1XL 2D03H 5CBAA 3GRWA 2ROYA 2G0KA 3PWLB 3QEQD 1HCYA 4CAGA 3PHOA 2VAAA 6CGTA 4NQEE 1CDGA 1FLRL 2BNUA 4X6DB 2YGVA 2BOLA 5D4QA 3BKJL 1U8PB 4Z3EA 2C8NA 2J56A 4U1JB 4LARL 3L3HA 4HX1B 2WZPD 3AWFA 1U8HB 2G2NA 4TPRL 3DARA 5CZKA 5C0AD 3LEYL 3PPEA 1EJOH 4PU2A 1SOQA 5CMAA 1JZ7A 1CLOL 3ZQ9A 1JGDA 4XC1L 4KI5F 5L8KB 3ISRA 3TYFA 2J73A 4MD0A 3GMQB 3MODL 5KSVA 3C8DA 4NHCH 1A7OH 3IJHB 1NAMB 3EHBD 3AG2B 1W15A 4KK9D 1D5ZB 3GSUB 3ZL4H 4BCZA 1H8LA 1OQXA 2R2EA 4U1IA 4BWWA 4B3EA 3V4VB 3GSRB 1GXEA 3KGUA 5INCB 4UZSA 4XMXA 3E7JA 1ET7A 2ATPA 3O4LB 5JR1H 4ZW6A 3W2DH 1I7UA 4YSRA 1D5XB 1QW8A 1TKWA 1HEZA 2E47A 3BLBA 5LHDA 2LU4A 5HJDA 5TE4H 1NDGB 1OCRB 1PX3A 2EVJA 2HJFA 3WS6A 1PZBA 1I3UA 2QADD 5EG6C 3VFTB 2JB5L 5IJCC 5D9SB 3PL6D 3ZTEA 1KB9K 1OE1A 2Y6SC 1Z9NA 3OAZH 4XHQA 4B7IA 3C5ZB 2V33A 3D3VE 4HXBL 4BSVB 3PGFH 3MJ9L 3QO1B 4HLJA 1WS7A 3WMPA 3NFSH 4Z7QE 3K74B 5JIDA 4C57C 1YAZA 4KQ4H 2ZXDA 3KZ8A 1AKJB 5HY9A 3P4MA 1J1PL 4WU5B 4RGNB 1N2RA 4GFTB 1DQIA 2V17L 5EZPA 4F8QA 1DJHA 2OMUB 3WTSA 2G75B 4DGUA 5HYFA 1OSZB 4G9FA 3O2DH 1LO5A 5ALCL 3KL0A 4ADJA 3A21A 1WZ1H 2FWOA 3PQYE 4JFDE 5HI4D 4JFXA 1F3DH 2X70A 4U4BA 3ZYOA 4DUWA 3FBKA 4QYOB 1BD2E 3ATDA 3G5XA 4RA0C 5CSZA 4RFOL 2APXA 2WUBH 5C3IA 4Q9BA 5FECA 3ROLA 2UYLA 4IRZL 3HR6A 5BZZA 2EAEA 4AYSA 1T1YA 3U2IA 1WZMA 2CDFB 4HT1L 5FA4B 4JAMA 2R39A 3ZHKA 1N5AA 1DQTA 4AZ8A 1TZGL 3TJEH 1NCBL 2IANA 2GJ6D 3DV4B 1MVFA 2FJGA 5FFGA 3SY6A 4NZUH 1NSNL 3RX9A 3ULSB 3MBEB 4U7KA 2APTA 2L0DA 4JM2B 3BEVA 3D2UA 1RMFL 3AWEA 1O9VA 5DD6B 2HJKB 4L3EB 5EZIL 3MREB 2DQFA 1IM9B 1OHQA 1CURA 5C9JB 2IMMA 2W9DL 3DHMA 3KPTA 4YDVB 2E7LA 1EA9C 1WBZB 3GMLA 2Z3FA 3H4FA 3F00A 2ZJSH 4JVUA 5IUSA 4XBEH 1YDPB 1F86A 1L5GA 2Z9TA 3FUJA 4PBWD 3S97C 2VZTA 4GLRH 3FQUA 3GI8L 1T0NB 2W1NA 4MNHB 5I1AB 4R96A 3L3JB 1NEZA 5DD3H 2ZXGA 4A1RA 4JUSA 4XOAA 1ED3B 3RFRA 4AEEA 3MLXL 5HYJE 4Y7MA 2IPTL 5F97E 3RVTD 1J86A 1P53A 1CLZL 1OHZA 2MHAA 4OH2A 3AVEA 1UACH 4YC2C 1ZT4B 4WY7L 2R4SH 3MFFB 4LLVB 4OF5A 3H9SA 5B7EA 1XGRA 4G11A 4ZX4A 5BV7H 1I1YB 3TN0C 3CVHL 1QWUA 3IMUA 2BWDA 1BVLA 1AO7D 1JV2B 3MV7B 1M05A 3CZNA 2A83A 3BXNA 4TQIA 4WO0A 4Z76B 5AVSB 2J44A 2ZX6A 4PGZA 3TZVA 4JJHA 4UNIA 4AY0A 1GCFA 4Y5VC 1AGCB 4PEEA 5DJCA 3CZKA 1A7NL 5DYFA 3X12B 5I1IL 2YZ1A 1ZJBA 4ZMPA 4FQLH 2CM6A 4PLJC 1NLDL 5H35A 4DT2A 4FG6C 4Q6IA 2D9QB 1S7RA 4UQAA 2YO3A 5DK2A 2GAZA 3P3RA 5L7XH 1XBDA 5I15H 3QIWB 4P2QD 1INDH 2LW3A 1AQKL 3JYBA 3FOMA 1PZSA 3QQDB 4MVBC 1UKQA 2JCCF 1G5AA 1TFHA 3US0A 2F5AH 1FGNH 2ZT9C 2BRQA 3RAJL 3WO3B 1B0WA 5KBNC 1FRGH 1DJGA 4UM8A 2MRYA 3CFTA 3E0GA 5E6YA 3IJYA 3I50H 3LRGA 1BPVA 3IXTA 4E36A 3W5NA 3SDYH 3VM7A 1WFMA 4JZNB 3WSQL 2O5NA 2AQNA 2G5BB 3VGEA 2AJYH 4XP6H 2PTUA 3H3PH 1KELL 1UA3A 1J9QA 1CL7H 3X14A 5BUGA 4ZMYA 5B7MA 2EICA 3MLUL 5JNYB 1QEXA 4U6HA 2R56H 1YUHB 4HOZA 3Q6GL 3T2OA 1E6OH 5FLUA 1KIRB 3GXTA 5A2AA 4GAGL 1YYCA 1CI3M 3ZSSA 1KMGA 2VMCA 4ODUB 2IWEA 2VZSA 2B8OT 4KJWD 4L3CA 3WTVA 1HXMA 1KYDA 2RFXA 3DX4A 4YSOA 5T3XH 1E90A 1ZKAA 4FG4A 3BVXA 3ABLB 2W92A 5KN5A 4LASH 3WEXA 4EN2A 2OZ4A 4Y4FD 2MNWA 4NFDA 4J3OG 3WS6C 1TQBC 3SKOA 4XMVA 1ZLSL 1JWMA 2BNQE 1PZ5B 1J10A 2P5EB 2YPLD 3IDXH 1CDIA 4BV1A 4FFZL 5LBSA 1OM3H 2HRHA 3D25B 1FVDB 1MVUA 2DI8A 3H42H 4OI8A 5E2VH 3DURB 2NDGA 1UT9A 4MJID 3RNQA 5DJZA 1HQ4B 4DGWC 3BO8A 4HJ0C 5GIRA 5I5JA 3BLPX 3NEEA 1IL1A 3GKZA 4Y19B 4WV1B 1TTGA 4UI2A 3U6RA 1MFEL 3RWFB 5F1OB 3IB4A 2J8UE