4IBZA

Human p53 core domain with hot spot mutation r273c and second-site suppressor mutation t284r
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
193
structure length
193
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVCVCACPGRDRRREEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of p53 inactivation by DNA-contact mutations and its rescue by suppressor mutations via alternative protein-DNA interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Cellular tumor antigen p53
total genus 44
structure length 193
sequence length 193
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ibzA00
1EANA 2VUKA 1CMOA 4IBWA 2IOMA 1IO4C 1KZYA 1YCSA 5G4NA 5G4MA 4GUQA 4IBSA 1GZHA 4QO1B 5AOIA 1H9DA 1EAOA 4AGLA 2J1ZA 4LOEA 1HJBC 3WTUA 2IOOA 2BIMA 2X0WA 3D0AA 5AOKA 4L0ZA 1TSRA 1EAQA 4AGMA 3KMDA 2BIPA 1CO1A 2J6WA 3D05A 2MEJB 4IBUA 4IBVA 4AGOA 3KZ8A 3WTTA 1T4WA 3TS8A 3QYNA 5ECGA 2IOIA 2J21A 4AGQA 1UOLA 2BINA 3Q05A 2J1WA 2J20A 3IGKA 1LJMA 4MZIA 3WTSA 2GEQA 2BIOA 3US1A 4IBQA 2WGXA 4IJTA 5AB9A 2XWCA 4KVPA 3Q01A 3D06A 2ATAA 4AGNA 3EXJA 2ADYA 3WU1A 2X0UA 3IGLA 5G4OA 1HU8A 4MZRA 3D09A 3WTYA 2X0VA 1TUPA 4IBYA 2H1LM 2PCXA 2OCJA 3D08A 2J1YA 2BIQA 1E50A 4L0YA 4HJEA 2AC0A 3Q06A 2AHIA 1GZHC 5LGYA 5ABAA 4IBTA 5BUAA 4LOFA 3VD2A 4XR8C 3EXLA 2J1XA 5AOMA 2XWRA 1HJCA 4AGPA 4G83A 5A7BA 2P52A 3VD0A 5AOLA 5KBDA 3WTVA 4GUOA 4LO9A 3D07A 3US0A 4G82A 2RMNA 5AOJA 3QYMA 4A63A 2FEJA 3VD1A 4L18A 5LAPA 2YBGA 3WTXA 3WTWA 3ZMEA 4IBZA
chains in the Genus database with same CATH superfamily
1AGDA 1A9EB 3RLSA 2RR3A 3FOLA 1UG9A 1H5BA 3I84A 2A4EA 2GBAA 4IU3B 3IXAA 4AYBA 4Y4KC 4NGHH 2H2PD 1WZMA 3NJIA 5F93C 3VWKB 3N55A 2O5XL 4UT9H 3SOTA 5E9DA 2BVQB 1AMYA 1QSFD 4FNTA 5L2KD 4PJ5B 4XBEL 2DKMA 5CD5D 1WZAA 2VLRA 3LKNB 4AH2B 4GRLB 1W6WA 5C0CB 1EAQA 2C8NA 3GZOA 2JMRA 4P3DB 1THCA 3VJ6B 3IJYB 1IEBA 1K3IA 3CFCH 4N3UA 1BFOA 1UA6L 2J20A 1QA9B 2W60B 2V8MA 4FEIA 4WFGE 4POZC 4URKA 1T6BX 4XP5L 3QDGE 2CR3A 4GT7A 1FL6B 1H8LA 4L1DA 4ISVB 1L5GB 5GZOC 3PWLB 1TZAA 4FG0A 1IKNC 1L9RA 1S7SB 3ECBA 4YDZA 2OR8A 2DS4A 2MNJB 3P1VA 3FU5A 4UV4H 4P2CG 1GVIA 2HFGL 4NKMB 2N1KA 4D3CL 3M07A 1CZ8L 3QWRD 3WKML 3V8CA 1USZA 4MB5A 4OZHF 4RISH 4DO6A 5HHQB 5F6HJ 1L0QA 1I7RB 1CIUA 1HK6A 2BNRA 4A7GA 1SQ2N 2YUWA 3ATAA 3EOTL 1FYTB 2AABH 4NDMB 2UY6B 2FX9L 4MHHI 2YLHA 3TESA 1SXZA 1JZ7A 3U9UB 1MFDL 1HL8A 2H5UA 3RILA 2EO7A 4O4YH 1CDCA 4AM0B 1CGXA 1XGQB 3O6FC 4Q8BA 5D7JC 1HEHC 4R5VA 4EE2A 3VG0L 5BQDA 2CO6A 1KEGL 4S2SB 1I1FA 2ADJB 12E8H 3NZHL 4AE0A 2ZOLB 5AAMC 2XJKA 4C83A 4HIEB 3PWVA 5DXWA 3I9GH 3L9RA 3L3KB 3OHXB 2QKIA 1V7NL 1D2OA 4HS3A 2XG4B 1AOHA 1QLRA 2IQAA 1OOWA 4H2CA 4J23A 2LW3A 4F8NA 4AJVA 3EO0A 4UT9A 2X4PA 4HDIA 3RUGF 1NLDH 3MCYA 3PUCA 3OQRA 5DD1L 1BIIA 1LHZA 2YSSA 4WW2F 4XRCA 5LDSA 5DD3H 1FN4B 5JA8B 2V37A 2E47A 3U83A 1IVTA 1KG0B 1BLIA 35C8L 3QI9A 5D1XC 3WFEH 4JM4L 4JVUA 3L95B 4M6OH 1FJ1A 2NX5D 4GH7B 1AYOA 3HRZA 5SWSE 3V7AG 2JQAA 5I1JL 1F56A 3VI4B 3NAAH 4JN1H 2YBRA 4HCGA 5F7EH 2JXMB 1HCVA 5I66B 3HCVB 2ED9A 2EXYC 4MD5B 1IGFL 1KJ2B 1ZV9A 1HHJB 3D85B 1CDGA 3KEHA 3SBWC 4A7UA 1MWOA 4MXVE 5DJCA 5D7LA 1J5OL 1PIFA 5JYLA 3N40P 3EYFB 1RJYA 5HGBB 2WXLA 4NM4L 1JI1A 2WJ7A 4TUOA 4EI6B 1NCDH 4L0ZA 1LO2H 4C8XA 3KYNB 1AC0A 5DRWA 1P4LB 4K3DL 2V2XA 1QFPA 5J11C 3BEWB 2Y5TB 1CLCA 3LYRA 4R8WL 1YC7A 1U8IB 1FVCA 3SGEH 4XPBL 4PBVC 3UZVA 3P11L 4MS6A 1LEIA 4FQQA 4ZZKA 3FT0A 4TUJA 1U91B 3MZTA 3VD9A 4L1HA 5EG6C 4D2NA 2X38A 1UM4L 4POUB 2V2WA 3BKCL 1KXTA 1D6VH 4OFIA 1TNNA 1PKQE 1PYWA 3AJ7A 1G7QB 5DO2D 4PJ8D 1N0XH 1QUNB 1MJ7L 3ET9F 4X4YA 3IMRA 4FFYA 2VZOA 2B1HH 1BREA 1MIEH 1SZNA 4GW5A 3WN5C 2F61A 1DVFC 2YKLL 4LVNB 5HDQH 4Z3IA 5J9PB 1DO5A 4LPVA 2DLEA 2EKJA 2HLAA 2Z93B 2EDTA 2IAMB 3MRKA 1RI8A 3PAZA 1RP8A 1FFQA 2Q6WA 5GPRA 1SY6A 1H6UA 4G6MH 1EFQA 4N5ED 3ZHDA 4QRSA 3WUWB 4JL1A 1KXQA 1KGXA 3T1WA 1FH5L 5E8EB 3LVEA 3ZR6A 5DZOA 5C0IA 5I15L 2WXPA 4MMYA 1OT4A 2MOVA 4IIQC 4YUEL 5DI8B 4RWHA 2VLRE 2YS4A 2EADA 2IV9A 3GPSA 4O2EA 4BFIB 2JJUA 4A6YB 1MW2A 3RGHA 3QUKA 3ALXA 3QEQB 4OZHA 3HW7A 2B2XH 2BP5M 1JD7A 1T89A 4KJPD 5C0BB 3BFWA 1TCRB 2DLHA 5EIVA 5T1MA 3T3MF 2X4NA 1UYWH 2GK0B 4LRIA 4NZFA 4FQXC 3JQOB 1LK3L 4AQ8A 5M94B 3LS4H 4HJ0D 5AOLA 4AQAB 2EH7H 1MJ8H 3VM5A 4R7DB 5EORH 4W9IC 2ADIA 2BRQA 2RMNA 4Z0BH 5IROA 3S37H 5E4OA 4D0DA 1WIOA 4MSWA 4GMTL 2AJVL 4FA6A 2FEJA 3VFGL 4Y7OC 4L3EB 3RNKB 4P5SA 4AIOA 5DFAA 1KJMA 4JMXA 4DETA 1JGEA 4NKDA 4Y5XB 4M7JL 1WFMA 4Y1AB 2BHUA 2VQUA 4JFDE 3WEXB 4DF9A 2R56H 1JRHH 1MFNA 2AQTA 5EO1B 5J6SA 4F2FA 5HHOA 4LLMA 2ATPB 2NY4B 4B50A 2J6EL 1KLFB 2JV6A 2X7LA 3TH3T 3ZVVA 3ZQ9A 4PJ5A 5DD1H 2Z92A 1AQKL 1VFUA 2X88A 4NM8L 1EFXB 3DX8A 4CGTA 2PP7A 2QLYA 4OUUA 2BVEA 5HDLA 1BQLH 2WAHA 3SE3C 2WNKA 3C2AL 4GBXA 1DQML 1ZLSH 4YHLH 3QIWD 3UCQA 3H54A 4JUTA 2O30A 1I1RA 2GJJA 3QFJD 3SE4A 5LBSL 4NO0B 4XTRD 3RDTD 4Y2DD 9PCYA 4R3SA 4ISVA 4NLAA 1FZJA 3WIHL 3DJRA 5F44A 4BIKA 1E28A 4CSTA 4JZJC 4FGMA 1N7ML 2ATKB 1MNUL 2O1AA 3TN0D 1J05A 3L2MA 1RK0B 5SWZA 1YEEH 1HXMA 1UB6A 3E3QC 5DEFB 4OJEH 4PYGA 3HZKA 4JHAH 4XO9A 3UJIL 1K5WA 1TJHH 4A6YH 2NNAA 4M1DH 2CU9A 5D8JH 5I16B 4HKJA 1QNZL 4LSSL 4G6KL 1A7RL 1WZ1H 3WMSA 3I3BA 3HB3B 3NJHA 5G5DB 2BP8A 3MLUL 3CFMA 3T1FB 1ECZA 2APWA 3X11A 1Z5LB 1FYTA 3FN0H 4UINL 3D0LA 4MA3A 2P8MB 4EAEA 2FX8L 2WYHA 4PJIB 3TA3A 1WUZA 2DYSB 4JM0A 2OMYB 1YMMB 1YUHB 3NK4A 2XWZA 3FB6A 1E50A 1KB3A 3ARBB 1J0IA 4UQBA 1M7XA 5CSZB 4FJZA 4FXGC 2ZOLA 1Z3GL 2XZAL 4XT1C 4WFED 2IH1B 1RUAH 3H0TA 2SEBB 5CUSL 5SV4A 1DQDL 4CMHC 2VQ1A 2EECA 4L8BB 1GZQB 1JZGA 1K8IA 3KM2A 4AGPA 4H1LA 4MJ5A 1ZT1A 3LKNA 2YSSB 1QSVA 4ODTL 4TMPA 1XSIA 4U1GB 3F58H 4KK9C 1P5UC 4DK3A 1BJ1J 2X1XR 3KYOB 1U8CB 1DLFL 1ZLVH 3O6LL 4PLOB 3VRIB 4AYFA 3UEZA 1HHKA 2AQRA 3LRSA 1MJJB 5DQDH 3TWYA 4A1RA 5IBLD 3SBQA 2ZXEB 2QT6A 3FUNA 1I85C 4K2UL 1NIEA 5JIKA 2CRMA 5E94A 2XA8H 1TZGH 1FFOA 2WVTA 2DH3A 3VFRA 1IO4C 4HH9B 3TONA 5HHXL 2CG9X 4K23H 4B9IA 4CC1A 4XNUH 4QRPE 1WIPA 3VFGH 5GGUA 1JK8B 5KYWB 3EYFA 2H2PC 4K3JL 3P0VL 3TJEL 3CX5K 4NNXB 4EIZC 4L3EE 4NGHL 5A2IH 2C9AA 3PWJB 3L16A 4JUSA 4O2CA 4X5QA 3ULUC 2IPUK 5ANMB 5E8OB 5FAAA 1WT5A 5E8NB 4XVTL 1D6EA 4BK5A 1EEQA 3SKOA 3C8HA 3FFCD 3MRIA 1JTTA 1E90A 2YPLB 4XPHL 3MAWA 1ZA3B 2VB5A 2GJPA 3CVHA 3SDAD 4MD0B 5HTSA 3AXLA 3QUHA 2DDQL 2A7BA 4PJFE 4M6NL 4P2RA 1QHPA 5DYFA 3BP5B 3PP4L 1BVKB 3MV9B 3QQNA 5EZPA 1DQMH 1YEIH 3GSQA 4K0OA 2Z35B 4PRNB 4Z7VB 4PH8A 5JHDD 3IS1X 2CDGB 1XXDC 3WJLC 4TXVB 3LRHA 2FH8A 4P23C 2Z9TA 4OZFB 43C9B 1THAA 4YHNB 4WNJA 3PF2A 4JZNA 5A3IC 3APDA 4K94C 1E43A 4L8SC 3WKPA 1B6UA 5E6IB 4PPTA 5AAMA 3WNNA 1WBZB 2A9NH 5CKGA 1PAZA 3FU0A 3TO4A 3KPLA 3SDXB 3O4OB 4I4WA 4BQ9A 3I9PA 4I2XB 4ZUSB 2YN3A 1BFSA 3X3FL 1J9SA 3LZNA 2VLJD 1OK8A 3DV4B 5HYFA 2VSKB 3LIZA 4NQDA 2L7EA 1NGWB 3KYMB 1DANU 2ICCA 4W70A 4YQXH 2P5WA 2ZKYA 3TX4A 3UTQA 2X3AA 3UABA 2VDRB 1YZZA 3S36H 1QKZH 3T3MB 1NQBA 2VUYA 3IS0X 3PGFL 2AC0A 3U30B 5D5MB 2XNAA 1MFDH 2BY2A 1JXDA 1YYLH 3OSKA 4BFRA 1AD0A 1JVLA 4JRYA 5E5RB 4OJCA 3VTMA 4Z7NF 5I8KH 3WIIL 1RQ5A 1HHJA 3D85A 2YGPA 2IALB 2QQNH 4N5UA 2VUOA 4XCYA 3QCVH 2WO4A 4GIOA 2VAJA 2XWRA 3LKRB 4U1SA 4UU9A 4OIBA 2GSIA 1RIHL 1I8LA 1ORQA 2XN2A 4NBXB 1D3CA 2Q5BA 4KHTH 5IB4B 1KTDB 5HYIA 3VI4E 1LD9A 1MCCA 4WKZB 3ZQWA 1WHPA 3MJ8A 3BH8A 4J1UB 2DPKA 3L17A 4V2CB 5TE7H 3MRFA 4WWOA 3MPCA 2HJLB 4BWTA 3U7YL 4QXUL 1RJZB 3DUSA 2A9BA 2GPZA 2VR8A 4ACPA 1CMOA 1PLGL 1ILUA 35C8H 2X7LB 1SMAA 4FRWA 3HZVA 3O4LD 3QUZB 1CGSL 3C5ZB 4GAYB 1SMOA 3O2WL 5IB1B 4Q9QH 3IXAB 2X5PA 2X6CA 4FQCH 5GGTA 1REIA 1TQWA 2F08A 2QVIA 1AGEB 4LT7A 3IJSB 4OZFH 3VCLB 1TTRA 2Y7QB 2LABA 4KAQH 4JZJA 2A9CA 2J4WH 3BUIA 2CZNA 4RMSA 1KCRL 5BJTA 3TFKD 3FMGH 5F72S 5HY9B 1I7ZA 3T0AA 1A7NL 1WG3A 5F7MC 3GB7B 4EI5B 1CGWA 5T5FL 4A2HA 5BVJB 4W9HC 4Z8FL 2B1AH 5SWZB 3QYNA 4HEPA 1N4XH 1NGQL 1Q9OB 4OT1H 4F7KA 1JZDC 5C97A 1ZTXL 3QG6A 3AG2B 2HFEB 1VPOL 3TNMA 3F62A 1FZKB 5BW7A 3L5WB 3R8QA 4Y5XC 4ZMAT 1FL5A 3PWLA 3L48A 5GISL 3RHWK 3RX5A 1AO7B 2BOCB 2VYRE 2WCSA 5FKPA 2DI8A 5EC2A 2NW3A 5C6TL 5F7EL 3BWSA 4MJ6A 4JR9L 3X13A 4KPHL 2ICEB 1JPFA 5D6CA 4HOZA 5B39B 3T3PE 5BVPL 2XV2A 5FO8A 1EJFA 3H2WA 1F4WL 1UJ3B 4GBXD 3RWHB 3VFOA 4N90E 3S7GA 5IEKB 1NJ9B 5JXEA 5J12B 3BYTA 3P9LA 1RUQL 1BD2A 5FOBB 5JOFB 5FDWB 2E9GA 3LD8C 3TBSB 4P23D 3QQ4A 5DLMH 5JR1L 4K3DH 1VJSA 3FB8B 4FQIH 1KNOB 1S9XB 2ENJA 1RZIA 4NQCD 5D7IB 3T65B 5DVMA 1GGCH 4ODHH 2JKIS 4XCCH 2YXMA 5A6LA 5JW4M 1BZEA 2Z91B 4DESA 3BH4A 2NXZC 1CI5A 1FVDA 5I0XA 5AW5B 1Z1WA 5C08E 1NIDA 2XICA 3V4VA 2VNCA 3LXCA 4TUKH 5FO7B 5CCJA 5AW8B 4KKCC 4FFZA 5BOPA 4PFEA 3H7LA 3LKPA 2NNXA 1L9TA 4GBXB 3VRIA 5DZVA 4AYFB 5D1ZB 3T4AB 3WFHA 1O6VA 3AAZB 5ITFA 3BP4B 3QGVA 3HAEB 5FK9B 2IQAB 6TAAA 1SFDA 2LLLA 4KVCL 4A39A 1YYML 5D9SB 2VMJA 1O75A 1ZT4A 3QNXA 4HEMA 3D2TA 3VO0A 4NZDA 3P2DA 1TQVA 4Y16C 4K5PA 4WU7B 3RVWC 1X5IA 5CJOH 3VFTA 4TTGA 1A1OB 4PW3A 2K7PA 4UQ9A 1IFGA 2X6AA 4O2FA 3SOBL 5G4NA 1XF3A 4M7JH 4KNUA 5FHAL 1INDL 1HILB 1Z2KA 3II2A 4PREB 1AQHA 3VD7A 4JPKL 4N87A 1LDPH 2ICES 3CWGA 4WTWA 1D6EB 1HH9B 2VN6A 3TF4A 2WXFA 1EUUA 1W16A 3AREA 2JKJA 4O9HL 4YXHL 3ULUH 4XVSH 1KC5H 3MRIB 4YDKH 5FPIA 4U2YA 3FULA 1E4WL 2IQ9L 2OK0H 4HD5A 3K8KA 1NGYB 3DX3A 4D9QE 3DX0A 4K7PX 3X11B 3LS4L 2A73B 5SX4I 2QSQA 4KH9A 4QJ5B 3A6CH 1MCPH 1ZVNA 4BBWA 4NZTL 4I13B 5EN2A 4ZFOA 2OMYA 4ANKA 3MV9A 4M1DL 3NIFB 1AVAA 1LEKB 3CFUA 2PUQT 3ULVL 3S2CA 1CDBA 1WF5A 3O4LB 3QUZD 4HJUA 4OZHE 5I0VA 3ZTEA 1JYWA 3BWZA 2VZ1A 5H94A 3MRPB 2FQDA 1E65A 4OZGE 3HE6C 5CEZL 1AXSB 4KZEL 4EUPA 5INDB 3T2OA 1ZHBB 2HVKB 2G2NA 2FQGA 1FVEB 3CZNA 3BEVA 3TBTA 4TLTA 1E2VA 1NDMA 4M6OL 3G6AA 4PJXA 5EOCL 4AJWA 1O9ZA 3P9MA 4Z7UB 4PI2A 5K59F 1OSPL 1TVHA 4X6FA 4FADA 2G60L 2V5MA 3JYBA 3NH7L 3P0YH 1KFGA 1TTFA 3H9HA 5CFHA 4NQEB 1UT2A 1SXAA 2IANE 4RAVA 4ANVA 4K9JA 4WWKD 3HC2A 4M61A 4MQXD 4AUYA 5KYYB 5IROC 1N18A 2Z6FA 1HKFA 3IDIB 4Z7QF 4J4PC 1Z0MA 1G7JA 1XL4A 2GYSA 4GUCA 2DYPA 1A8JH 4Y4HC 4OGQC 5ITBH 1ET5A 5ETUB 2QQQA 3QEQA 1YLBB 1NOFA 3W38A 4OH2A 2VLJB 1TCRA 2HT3C 1A6TA 4X80H 2AP2A 3KPPA 5JW3L 1MCIA 1T4KB 5GS1A 4GKLA 5JOEA 2R29A 3HVNA 1ZV2A 3FO9A 5FYKU 4ICXA 5I75B 1BGXL 1YPZE 3G6JF 4QRPB 1QLEH 3IPBA 3F58L 4WUUA 4UOW0 1P7QA 1T1ZB 1SHMA 5KUMA 2FHFA 3FB5B 2YGOA 3O6LH 1UA3A 1IGCH 4MSWB 4IKLA 1J0ZA 3ZE2B 5T3ZL 3ZDXB 4YLCA 4PB0L 2WTRA 3DRTA 4MCZB 5KAQF 5D72L 1JZJA 4MAYA 2J73A 4IRSB 5LQBH 3BAWA 3IJSA 2QPEB 1JXJA 3VCLA 5AFAA 4XPHH 1SVCP 4YSPA 4TVPE 1QR1A 2YPLD 1H0DA 5KSAB 3LNHA 4FCHA 4YXKH 3DWTA 5EU7E 2VXTL 1T2QL 2CJ3A 3WDIA 3CHPA 3PL6A 2C26A 3SIKA 5BNXD 4ADIA 1JK9A 2F7IA 4AEIL 5KS9A 2VGLM 2HMID 3HE7A 3L1OH 1T7WA 5AAWC 3FTZA 4RQQA 3LMJH 1I9IH 3TT3H 5CEZD 4PGDB 1JUFB 2V17L 4XNBA 1G1OA 3UYPA 2FO4A 2P24B 3MGAA 3SDYL 2ZJSL 3GMLB 3T09A 1T6VN 2YWZA 5AOZA 4ZOBA 1J1XH 4U3CA 4LSRH 5T1KB 5FYLL 4ODWB 5ANHA 2NY3B 3OPUA 4D7BA 3EXJA 2DIAA 4UT7L 4QDGA 1N5AA 4DHLA 3IU3B 3ZRSA 1OWWA 4OB5L 2OYPA 4JY4A 1V3JA 1LE5B 1JRHL 4ORZC 5F88A 3NZSA 1R3HB 2C9UA 3B1TA 1X5GA 5FYJU 1ZSDA 4FG6D 4AWJC 5KVMC 4MZ3A 3PDDA 3E2HC 3BAJA 2UZXA 2RIKA 3G6JB 1LK2B 1DFBL 2BSTA 2ZCHL 2V5YA 3VGAC 4YHLL 1SEQH 4X7TA 5GGTL 2X28A 2Y23A 3V4VB 3GBLA 3MRGA 5GGVY 5E5UB 2X4RB 3KXFB 3DK0A 4OD2B 4G9FE 4WU5A 1R34A 2PKDA 5TDNA 3EYUL 2YFOA 3QFJE 1T7VA 4UYQA 4V1DE 4BCXA 3DO7A 2LTQB 2IWFA 5I6LA 1R3KB 5HI3C 3V0VB 3BAXA 5AENA 3B1UA 1J1OH 4PP1D 5DFWH 4Q6IC 4N2BA 4EI5A 3BW9A 4HIIB 1QNZH 4X5RA 3N85L 2PXYC 4ZSOB 1TZ8A 2EIBA 3RX9A 2VAAB 3RIAF 1NCBH 3BHBA 4LF3A 1T04A 4AEHH 1RMFH 1RZQA 3U7YH 1UM5H 3IDUA 1PZSA 1WC7B 4DT2A 2PTUA 3QNZB 1WZKA 4HUXB 1T66D 3H6AA 3LNIA 2R15A 3MLSH 4PJHB 1U36A 3LN5B 3AREB 4TNEA 4HLEA 2QVFB 5E99L 3WDHA 4BDVA 1OD9A 2I07A 4YSAA 2BOCA 2WCPA 3QQ3A 1C16A 1YYLL 1U6AH 4L4TE 4R7XA 2Q1EA 4J5VA 4NO0D 4NNXA 1FNGB 5DJ0A 2UY7B 1N19A 2VH5L 3HS8A 8FABA 3BZ5A 1SEBB 2B4CL 5FDYA 3FU9A 3LPFA 1F42A 4YHMH 3BDYH 4M1GL 3HNTL 4JJ5B 2MRYA 3I6SA 1T22A 3MQIA 4X5XB 3WG7B 1NJ9A 4HK0B 4ZS6D 4RBPH 2ZCKH 4DVRH 1KJVA 4TV3A 1DVUA 3A4FA 2ODHA 3L5JA 4P99A 1B9ZA 4M1CD 3QJFB 5CINH 3GMPB 3O9WC 2NY3C 2NY4D 7FABL 5B1CA 3MROB 4MD0A 1ZJAA 5HP5A 5J1SC 4KTDH 4G8EA 2APXA 1CFTB 5HGAA 1RPKA 2JCCE 2H2SD 2A9MH 4BK5C 1RU9H 3RAJH 32C2B 5GXBB 2V3FA 2L3BA 4L3ED 4Z7UA 2F54E 5DGRA 5JMOC 1ADQH 3IDGA 4RMBA 4QJ3B 3CG8A 3HPLB 1IAOA 2NXZD 5L8JB 5F9AC 3UBXB 1XGRA 4CJ0A 4MAUH 1SN0A 5EF0A 5KBNC 1RXLA 3ARTA 3BGMA 3K6OA 4FQIL 4I5BA 3ARWA 4TL4A 4XE5B 3BPLC 3OKLA 4KTGA 5IW6B 1MIML 3DIDA 4LCWD 1E4XI 4PI0A 2Y0SA 4MMXA 4YHPA 1KIRA 5GRYA 4G2AA 3OKMA 3Q6GH 2VABA 5IMLA 2WCGA 3SDXA 3HG2A 1U3HB 4NPYB 2HX8A 3MBED 2YD3A 3H53A 4N2GA 2IANB 5HJGA 4NUPA 2Z8RA 4BWUA 4C4BA 2H3NA 1IAIL 2OLDA 4TQEH 4Q6KA 4ZI8A 2B5IB 1PLBA 3GXNA 4KROB 5I19L 2NRDA 5DUPH 1AD0B 1IJNA 4JRYB 3PIQB 5E1AB 1RUKH 3HS9A 2DRUA 4PRHA 4X6EB 1E3XA 2RGSA 4NI3A 4LXFA 2HG0A 4JRXE 5CJXA 4G82A 4OSUH 4LLVA 1H5BB 2IAMD 4QXGL 2NYZA 5E23A 3D39E 4FQXA 3C2AH 4AV0A 4QRQB 2MQCA 3OKOA 1NEPA 3LDBB 3MJ8B 4EZKA 4WFEE 3MJ9L 4X5WA 5K9KB 2IDQA 3DGGA 4H2AA 4Z1PA 5FHBL 3L7FB 3ZRCC 1S9YA 3LEVH 2EDXA 3NDZE 4PRAB 3H9ZA 4FYSA 4ZFGH 4U1NA 4B97A 2A9DA 2EYSB 3IYLW 4WI0A 2BY3A 1YVLA 4XO8A 2JK5B 1KDIA 4FFYH 3HE6A 3U0TA 5KJRH 3QRGH 4AY0A 4HUNB 4U1GC 4HXBL 4WV1B 1MFVA 3LHPL 4NQXB 1WH0A 3QA3B 2CDFA 3KWXA 3SEPA 1QA9A 4LSVH 3V6BR 2X4SB 3ECBB 1QSEA 2YMTA 4I7ZC 4QHLB 1MCOL 2BK8A 5C0CE 1N2RA 1S7WB 2EEFA 4A2MA 3OGCB 2FO4B 3A6CL 3S3DB 4UINH 2GJRA 1UCTA 5C3LD 1SLXA 4OLYH 2YJQA 4RFOL 1IZKA 4O4YL 5B38G 3ULVH 2DYPB 4GSDL 1WHOA 4WO4B 1A65A 5EOCH 3W9DA 5B1BB 1H6TA 2YD5A 3FTSA 12E8L 3NZHH 4NQEE 3ZL4L 1D5IH 4PTTA 1BZOA 4YPGB 3TNNB 2GJ6B 4GI8A 3NIFE 1FL5B 2IBZX 2ADYA 4HX1A 5I1DA 3R0NA 4JBSA 4OCSH 3D25B 4TNWF 5IG7B 1J10A 3MBWA 3DXAB 4PCTA 4DFHA 1D2PA 5IJKA 1HCYA 4Y89A 3UIYA 1R24B 2D31B 1BLNB 3FUIA 4JGMA 5F7DB 3ARFD 3L8QA 5LBSA 2AXFA 2HPTA 2YZ1A 1EHXA 2CO6B 2VDQH 3CFEA 1JN6B 1M05B 2VLJE 5AW4B 4OCYL 3QIBD 1XF5B 1VDGA 3Q9PA 3SQOL 4KQ0A 4HJEA 1BOGA 3V2AR 3VXRB 1BAFH 2JTYA 3K0WA 2AS5M 15C8L 2QQKH 1ZIAA 4LFHG 1XGPA 5ABAA 5IJCC 3RWCB 2HG5B 1LP9E 3BE1H 1CYXA 3Q44A 2Y7NA 1HE8A 1NKOA 4J3OH 1FYTD 1QBMH 4FKHA 3BISA 1RK1B 5BCAA 2J5LC 4JG9A 3U0PA 3N43F 4PJBA 3LDBC 3UP6A 1YQ2A 4GRLA 3O2DL 1QACA 3KDPB 2JJTC 3O3AB 2XIDA 3QYMA 1KCSH 2WWOA 2VDKL 1G7IB 3WFHB 3JV0A 2GUOA 1F3JB 1MH5B 3UPCA 1MIEL 3FCUB 3QXAB 4ZD3L 5IESL 4I1PA 3DIFB 3O6FA 4PG9A 4U1HA 2H3KA 5L4FA 2DKUA 3S96B 2P24A 1XIWC 3GRBA 5CZRA 4BDVB 4AV5A 2VDQB 3MU3A 2MSPA 3NJNA 4BD4A 5I8OH 2NPLX 1KBKA 4H5SA 3T0VA 2FATH 3HEIB 5DJ0B 3F00A 1ND0A 5AUMB 2IAMC 4M4PA 1P1ZA 4Q4IA 1N5YL 2DL2A 3MFFA 1QRKA 3U0WH 3LQAL 3BP6A 3M17A 3RIFF 4IRJA 3MLPA 2FJUB 1DQQB 3KMDA 1LE5A 2YGQA 1IGMH 1KJVB 3LZLA 4LHUD 4S1DD 4PJ5D 1M6OB 1U33A 2JFCA 1T4WA 4UV7H 4DWHA 3HRZC 5KW9H 2EH8L 3DX7B 3ETBF 4PVBA 1RJLA 3VWKD 1AR1C 3IGKA 4JO4H 5CZKA 1OAYH 1XWVA 3K91A 4ZFOB 4WSKA 4XH2B 1XH2A 2YK1L 3ARPA 1OK0A 3Q8FA 4LNRB 2WXJA 2YPKB 4U31A 4B7IA 2VDNB 4J3UA 4WI7A 3DTXB 4ALAL 3CBRA 4LARH 3WUWA 1D5ZA 4DW2H 2HVBA 3V6FB 5EH1A 2F68X 3N9GH 2QZQA 2AI0L 2QKIC 3BGMB 3CX5J 2IG2H 4K3EL 4ZOCA 1PZ2A 4P5RA 2WIIA 2VMEA 4NRZB 3BEVB 4RFNC 3TBTB 5EEVA 1H8NA 4FQ2H 1QVOA 5J56B 4U3SB 3X1GA 4MRCA 4Z7OE 4P07A 1A5FH 3BAYA 4E0RA 4P04A 2M2DA 1EV2E 4FC3E 5ILTL 3GRGA 5CJQL 3MNZB 1DBAL 1AFVH 4ADGA 3F12B 2AJZB 3RWDB 1TKWA 4QHUB 5EOQL 2P5ED 3GKZA 3A22A 5BV7L 4QXUH 1HESA 1COBA 4LLUB 4HKXB 2FX9H 4KK8D 1UJTA 2QSCL 3GM0A 3P2TA 5IHUH 4NHCH 1D9KC 4HIXH 3WKNA 4XPFH 3W0WB 3WIHH 2GC7C 5AOMA 3ZE1B 1HCFX 5EBLB 1F00I 1GOHA 1TJXA 3S3PA 4TNGA 3RPBA 3GSVB 4OVVA 1NCBL 3EO1B 2ZUQC 1WJ3A 4Y1AA 1PQZA 3EJZC 1P4LA 2DQHH 3O41A 1M3IA 4LPCA 4ZAKB 2XDHA 1L7TH 4G43B 1KBBA 2BHYA 3ECQA 4U3XA 5L2JA 3RWEB 4F3FB 1OB1A 1PAMA 2XFXB 4Y4HA 1CVRA 1XX9C 3S5YA 5FEBA 4FULA 3O2DH 4CBZA 5BZDA 3U2JA 1X7SA 3KG5A 4QKTA 5EUOF 1QP1A 2E9IA 2O5YH 4N24A 5DD3L 2BY1A 3IN2A 3K1KC 4U6VH 1EEYA 2X9XA 4RESB 1W8NA 1HXYA 2B1OA 1T66C 2VR5A 1LE9A 3UTOA 4AV4A 8CGTA 1Z6JT 1E9PA 4NQXA 1BF5A 1JYXA 1HN1A 4PBDA 3BDYL 2YMXL 5DMIH 4XMUA 4G7RB 4MCYB 1LO0L 4HUKB 4F7PA 1OM9A 1QFWH 2YEZB 2GIMA 1IQDB 2NY7L 2O5ZH 3KW8A 1XGRB 2DMGA 3TPUB 4ERSH 1X5MA 2R69A 1PF3A 2AEPL 5IW6A 1XF4B 3RWIB 1HEZB 3DJSA 3GBMH 1A0QL 1KTBA 3ESNA 2VABB 3WFCL 3ZDWA 2UXVA 1LLAA 5IMLB 5I5MA 2FGZA 4MDIA 4PEEA 1D5XA 3BUQA 1E8XA 4N0YH 2OV0A 1OZTG 4R7VA 2NY5C 3SGDH 3MUJA 4GFXA 1AGFB 4YDMA 1A2YB 3RJOA 5JLZA 5C0BA 3LZPA 3TTSA 1VFOA 1SJVA 4XZUA 1H6FA 1UD8A 3LNDA 4KKBD 5C6PB 2FWUA 1L6PA 1KT2A 1E9OA 1M71B 2X4NB 4KRMB 2D03H 4PJIA 3TA3B 5GS1C 2AQSA 2MWCA 3MNDA 5FKAA 3DXAA 5FYJL 4QXTB 2CR6A 3Q6GL 5DLLA 1LO5B 5ESQB 1AZBA 4D8PB 4L9LB 5IHLB 4Z7IA 2RD0A 3JYCA 3MODH 4JY6A 4OFYA 3T0EE 4E41B 4WK0B 3REVA 2VXQH 3MZGB 1U42A 1HNGA 4XNDA 3FSZA 2DIBA 1WLHA 4ODXB 3S35X 3WO3B 5ESVB 4GOSA 1LMKA 3RGVC 2CO7A 3ZZLA 4G6ML 5C92A 3SPVB 1UHVA 1Q94B 2EXSA 4C55A 4DTGH 5H2BA 4F8OA 3OKDA 2BMKB 2Y5QA 3G6JA 1S7TA 4A2LA 3QXUA 4FI8A 4GJTB 2PO6B 4WFHD 1UZ8A 4NB7A 4XZ4A 3JT0A 1CT8B 4N0UB 3GXFA 1MVYA 2Z92B 4FLRA 3MRGB 1OPGH 4YO0A 5HHPB 4NAQA 1BM7A 3WGUB 1AFVL 4KJQC 5I19H 5A7BA 2NY1B 4X9YA 3C6EA 4NS0A 5EBMB 2JELH 5D1QA 5M95B 2FIRT 2IVFC 5IB3B 4BH8B 3L3DA 1UYWL 2WXMA 4PP1C 3T0ED 4N28A 1R3KA 4P46C 3SODB 3B2UD 5C07B 5I26A 4A7TA 3QWOB 3R1GH 5B7EA 5MEQB 5CGBA 1HYSD 2RTTA 3HLAB 2EE3A 3FQNB 3LSOB 2DI7A 5I1EH 3BZDA 1J05B 5F7KC 2ENPA 2FB4L 2ORBL 2LTQC 1O7DE 2GIXA 2W0KA 4NCC1 1IM9A 3SQBB 1UOWA 1SHSA 3B37A 5DT1L 2TSBA 3P73B 5IBLC 3E9UA 1MQ8A 5EA0H 3T0DA 3FQUB 1WBXB 3QUXC 2VERN 1QAWA 5CAYB 3NCJL 5I5IA 1EPFA 3KGUA 2I07B 1Q9KB 2FSDA 5F9OH 5BRPA 2XN1A 2YRPA 2R1WA 2EUZA 4HPHA 3GSQB 4PRNA 3SGKA 2UWEA 5E00A 3ZTNH 4MNGA 1BYOA 4G1MA 2J21A 3PABB 4XXWC 4RETB 4ZOAA 4XO4A 3S88L 1T7XA 3CFBA 3IRCA 2X4OA 5CNHA 5F9WB 1JOIA 4GW1B 4IK7A 1J8RA 1OGTA 3A6BH 3FQYA 3BPNB 1UZGA 3RGVD 3VQLA 1NPJA 4GKSA 1MFCL 3FQXB 1RY7B 1DQVA 4UT6H 5DJ8B 5D1QE 2BM3A 4IS6A 2CKBH 1PTZA 3EYOA 1IGYB 1Q0YL 2YAEA 3ZE1F 1CBVH 1BG1A 4PJ8A 1IBDA 1P84J 2OQJB 5C0DB 2ZF9A 5IOPB 1NMBH 5EU3B 4XP4L 4U1MB 2Z64C 1I8IA 1M1SA 5KSUA 1U93A 4I5BB 4WHTB 4Y8DC 4M62L 4WI3A 1FZOA 3UDWA 2CJTA 4PJIF 1AC6A 2YAQA 4BZ2H 4P05A 4ZFOL 2Z0UA 3DDGA 3M88A 1N70A 2HKAA 1QBML 4QTHA 4QD2E 5EBGA 2KKQA 4NWUH 4OLYL 4QWWD 3PDOA 1G7PA 2P49B 1JGUH 4MA1C 2WLZA 1LNUB 2F74A 4HSQA 1HZKA 3MRFB 4ZXBC 4MJ2A 4OGYL 5D71L 5H37H 1AJ7L 3TT1H 2BJMH 4IRJB 3O41B 3DUHA 2WZ6A 4TLKA 3STZA 3VXSA 4L8DA 3QJTB 1IGFH 3VI3B 1GCFA 2FX8H 4JRXD 1XGTA 1PGRB 1WVZA 3FNKA 5LO7A 5HGHB 2XCMC 2UV3A 2W9EL 3DMMC 4M8QA 2VZUA 2VUKA 4NHUA 4CVZA 4P5MA 3CUPB 3D3VE 3HBGA 2LLGA 1HXYB 4F8QA 1LE9B 3R4DA 5DD6A 2NDFA 3FC8A 4AT6B 1AKJD 1F8TH 1C08B 4NN6C 2A74C 3EIFA 2Q86B 1H9DA 2NUPB 4JE0A 3CC5B 4XGZA 2Y1YA 4GAGH 4K8RH 4RMUA 1BVLB 2CE6A 5J4MA 5C9KA 3LRGA 1QWNA 4JKKA 1OAUH 1F2QA 1LO3H 2HN7B 4YDNA 4ODTH 4U4IA 4KI5E 2VRAA 4JANA 3ETSA 4PLKD 3VACA 5DQJB 4BRVA 3LOWA 4Y5VA 1DQKA 2QR0A 4B9YA 4BFOA 3DVFA 3G5VB 3VFSB 3IVKA 5DWUL 3VGFA 2HKHL 1HKLL 2AK1L 2ARJQ 4S0SD 3S6CA 4ZMZA 5FUZH 1PIGA 2W0PA 4XCCL 1FPTL 4Y2NA 2G75B 5B8CB 1OAYL 3Q2LA 4FLOA 3X14A 5DJAA 5IBUB 6FABH 2DDQH 2B14A 1I3GH 5CD3B 1MWAA 4I0PD 3MTRA 1TJGL 3O3BB 1WS7A 1VFBB 5GGSY 3WLBB 3WU1A 5FHBH 2CBOA 3CN2A 5DZJA 3CDGB 4YDVA 5KJ7E 1A21A 5CSGA 4Z5RB 3BSZA 3UTTD 1CD1A 4NWTL 1OP3K 3AB0B 2PWDA 3LQAH 2E4FA 5IFJA 1A14H 3FBKA 1AY1L 4JREC 5I73B 1L7IL 3IAGC 2W80C 3D69A 3HNVL 1AOZA 3H9SD 1VACA 2FT7A 5JUEL 3V0FA 1ZANH 4F7TB 4HWZB 3RVTC 2EDKA 4M6ML 1NEZB 1Q1PA 3DDFA 5DK2A 4ZTEA 5LCVA 1XTMA 3SPCA 2JIXD 3TO4C 3KNBB 1NM4A 1QSFA 4LGPB 1O6SA 3ULSB 5D9SA 1Q1JH 1Q72H 1BEYH 4N0UE 4UTCA 1VGKB 1AD9A 2G9HB 5F9JA 4BELD 1ERNA 1OAQH 2G0KA 3KGTA 1ONQB 4LU5L 3KD4A 3VXNB 3ULVE 2YPVA 3JV5A 3VFTB 1D5BA 4PJBB 5MEQA 1FBIL 4IJ3B 4JQVC 3Q9QA 2W8CA 4Y8AA 3MCKB 2ZXQA 2WINB 3MOQA 3QULB 5MEOB 1P9MA 4I0PB 3QEUA 4LCUA 2O93L 3ZYIA 1M1XB 2ZUYA 3CMGA 3FFOA 5DRZA 1VKXB 1H3XA 4LB8A 2XVLA 5L0QC 1XIWD 4KO6A 4F1ZA 1EHNA 3CH1B 4Q7DA 5AKSA 5DQ9A 2DKSA 4J4PD 5K69A 1C8PA 1OSYA 2L8AA 3WIIH 1L9QA 1KJ3H 3JWNG 1Z5HA 4KTDL 2D8KA 4Y16D 1P84K 3GXMA 3OKKA 3A4AA 1OLZA 4X6CF 2OMNA 4TULH 1G87A 5I6MA 3PQYE 3ZMRA 1BAFL 4QRUB 3QUMB 2X41A 3NESA 2ZOKA 3CPUA 5GRVL 4H4NA 2E6JA 2IGFH 2GI0A 3CFJB 5J0BA 1SDDA 1BJMA 1CLZL 4MX7B 3CFBB 3HI6L 5BZXA 5DTFA 3OHXA 1A0QH 1IARB 3CLWA 1NL0L 5IEHA 1N64L 5DUML 1N0LB 1B0GB 5F21B 1ZHLA 2APTA 4DPRA 4YHZL 1IFHH 5JHBA 1YEJH 1AZVA 1CDHA 2OMWB 1XGYH 2GBUA 2R9HC 2IPTL 3N44B 2YUZA 3GRWL 3VQ1C 1SN2A 1JRHI 1S7QB 1VSCA 3D0VA 3IDMA 4P2OB 5GGSB 3KH4A 3RE0A 4N2KA 1FAIH 1XVSA 2HKFL 4IDJL 5F0LB 4YSEA 1RHFA 7PAZA 5K9JL 1EWHA 2PF6A 1KN4H 2XWTA 3GXTA 1TLKA 5D1QB 1KLGA 1YDPB 4GBXC 4IRJD 3UAJD 3L7EA 1ZTMA 1OSEA 2H47C 3TV3L 3DURA 4KPHH 4MNHA 2PR9A 1QVOB 5C08B 4DSYA 4MNQE 3S4SG 3AMKA 3F7LA 3FQ1A 4FMVA 4B96A 3E7JA 5AWNH 1VAHA 3A24A 1JNJA 3ES6B 1SYVB 4YDIL 3KLHD 3BXNA 3KYAA 4E41E 2GSGA 1LDSA 2COVD 4JFWA 3EJZD 1NGZA 4BFGA 1B88A 4OCRH 1JPSL 3CU1A 1M57B 1R6VA 1L7IH 1IM3D 1MKFA 5HDWA 1NM9A 4H20L 1EXHA 5KBDA 1QI3A 4QHMA 4HIJA 4M93C 3VFWA 4HVBA 5DJZB 1T2QH 1JPGA 4PD4K 3QCTL 3QBTB 2R1WB 5B4MC 2CLVB 2AERT 1MFUA 1NWPA 3QDMD 3O3UN 5DR5L 3R18A 4M7LH 5DUJA 2VITA 5HXMA 1V7NH 4M7ZC 1GC1H 4X8XA 3TO4D 1YNTB 2BSRB 4ONFH 1MWAH 2X4UA 3ARQA 1QW8A 2YPVL 3K7UA 1G1YA 1Q9WA 1BPVA 5C0CA 4HGMA 4JO3H 2J8UB 3I6KA 3NZ8A 4M3KB 5GRJL 2CKNA 3EYQD 2WWKO 3IJHB 4DTGL 5SX5K 4XO5A 3PHAA 4G1EA 2A9AA 2ED8A 4EMZA 2OSLB 4Z0XA 1TZIB 4Z3TA 1KTCA 4LCYA 4Y4FD 4HJGB 2N1TE 4OB5H 3BVXA 5LDUA 3UMTA 2JF1A 2O26U 1JPST 3O4LE 4OZHB 4HYTB 5DMKA 2OYLA 1TVHB 3RTQC 3O9WB 5C0DA 5IOPA 4FOMA 4LLDB 4APQA 1KTRL 2OXHA 1IEAB 3VG9B 4BXVA 1OD7A 4KVCH 3KJ6H 4ES9A 5D1XB 4KKBC 3ZL1A 2Z8VC 4FTVE 4ZX5A 4IKNA 3T71A 4NZUH 1XIWA 4YR6A 5FA3B 1A6ZB 3CE1A 4KJPC 2IPUG 3IF1B 2ZX5A 3T2LA 2NOYA 4NN5B 4MS8D 1ZT7A 3QJOA 3AREC 4LASL 4QHKJ 3A4EA 4OCYH 4E9TA 3PJSA 1P4BH 3NCYS 1UXLA 1XSOA 1IE4A 4TVUA 2FGWL 2FECI 4EOWL 3C5XA 1JS4A 5J6GA 3TBYA 2IFFH 3T0EB 4XI5C 3FTUA 2WJ5A 3WJLA 1ZSHA 3FRUB 4P48A 4H40A 3X2QB 1I9RL 1NFDB 4X7DC 1C9SA 3MO1B 4WUUB 1JGLH 3S0PA 5L7XL 5I76B 1MG3C 4J7RA 3NYKA 1UD3A 4OUUB 1I1FB 3GS0A 3ROLB 5FWRA 1NCAL 4EDXA 1QLRB 4J3XA 3QZBA 4R9HA 3BKYH 4H0HB 4FZ8L 3SPVA 2BJML 5FF6A 4U1KB 1NC4A 4JMNA 3PHOA 1YY8B 4RZKA 3GSOB 2XG5A 2ATKA 3LIZL 1LP9B 4E41D 1NLDL 3F3HA 3T04D 2HN7A 4HIPA 1S3KH 3ELAT 5I8EB 1VB9A 1J5IA 2ZAGA 3L95A 2E27L 5H8DA 4YN3A 3HRZB 1JZHA 4EUPH 1KENL 2E5EA 3OC5A 3MLTB 2NY5L 5EPMA 2ZAIA 5PCYA 4WEBL 4E9RA 5F96L 1JHTA 1J8HB 1U8HB 3DKHA 5DJCB 3G6DL 2HTLD 3UYPB 1KZYA 5IZ7A 2J55A 2EDHA 4G8FB 4UM9D 3MLYL 1G0YR 3ZDXF 5HGBA 3INUL 3OR6B 4GRLC 2A9ML 5D55A 4L0PB 5CMAA 1VCBC 1VEOA 3NIDF 1GJIA 3CK0L 2Y5TA 3IB4A 4NQCE 3KEDA 3LH2L 3BYYA 3QO1B 3P73A 4GAJH 3GJEA 1OXYA 1T3FA 2A77L 1UGNA 3ZYJA 1CURA 1CR9L 2RFXA 4JFEA 5JW4N 4IOIA 2FBOJ 4BV1A 2ZWKA 2NR6D 2E4TA 4FNQA 2VKXA 3K2IA 1IILE 4D9RD 1AIFB 4AW4A 1JWUA 4GMSH 5CHNB 3UTTB 3JZ7A 1JGVH 3MLZH 5JPNC 1S7XB 1TZOA 5IT2L 1NWOA 2Z8SA 4G1MB 2NCEA 2HT2C 3QRBA 3FTYA 2QV4A 3UPRB 2XHNA 1ZJBA 2XKNB 2OYKA 1G6RH 2AEWA 2PPAA 5GRUH 5BO0D 1GGTA 5HSFA 3C6LC 4A7GF 2P28B 3UC0L 1E5CA 4PJ7A 1RD6A 3QO0B 3OKLB 1DEDA 3R1GL 4YLQT 2XWTB 4HMCA 5TDNB 2NR6C 1L0XA 3U1SL 3VE0B 4FQ1L 1Q0EA 4E5XB 1ONQA 4IS6B 4LSPL 3L4VA 5I15H 5E6RB 5DT1H 2O6PA 3DX2A 3TXAA 5FB8B 1X5XA 2OQJA 1WFNA 4JFQB 4FXKA 2WMPB 4ABWA 3HA0A 3MRCB 1SYVA 1U8JA 2VAAA 3WY3A 1WCBA 1D5RA 2XYCA 3QZWG 4PCSA 4PWKA 4JKNA 4D0CB 2P5EB 4B60A 2BSSB 3FHAA 4KZ0A 4ODSH 2JLPA 3V5DB 3MCLH 3OD3A 1KIUB 2N3JA 4FL4C 1KGUA 1ZA3A 1MF2L 1JNHB 4KK5D 1Z9MA 4GG6A 2PNDA 2H1XA 3VGGA 5AD0A 4LIQL 1CICC 4MXWL 2UX6A 1V7ML 4NERA 5IQLA 1FNGA 4UV4L 1MCRA 2CLVA 3S9DB 4J6RL 4JFOB 4WFFE 4YSCA 1A66A 1CFQA 5A2CA 3IPEA 4CU6A 3K71B 3OLIA 4JJ5A 5C0FB 1QFWI 1WAAA 3ESVF 4GXUM 3SBRA 4JRXB 4PJXE 2OR9H 2PTTA 4B27A 5GZOA 1XZWA 2J56A 3U4EB 3MA7A 3TO2B 2F8XC 4FYQA 1ZHLB 3BVVA 2Y5EA 2WQAA 1PSKL 3HNVH 5TJWK 2H0FA 4QO1B 3W39B 4PJ9B 4K7PL 1EJOH 3P02A 5BOJA 1MLCB 1PNCA 5GZND 1JF1A 2ZYSA 4FFVD 32C2A 4KK9D 1NBQA 1E4HA 4K71C 4PIRF 4S11A 4AMWA 4F1SA 3OKNB 2CGYA 1OT2A 2EDYA 3EYVA 4FL4B 1QRNA 4I3RL 3EJCA 2VZSA 3SE9L 3PU7A 2A6IA 4JGJA 4UMSA 1OAZL 3FU7B 1KIRB 3W9DB 4OIAA 1H5BC 3IF1A 1VCAA 5F70A 3BMVA 1UOLA 5GS0H 4UCFA 4CN4A 4XMKH 3UYOD 3TNNA 2AGJL 5CZXC 4JN2A 3OAUL 3QWQB 3TWCL 2ROYA 1RMFL 4PS3A 3NJLA 1KTDA 3RY6A 2ZSWB 2AJXL 2QPUA 4OLZL 3VFNA 3W81A 2D7PA 4AQEB 5LHDA 4O02A 3WFEL 4TVPD 2BVYA 4AZUA 3I02A 3CVHH 3BE1L 4M5SA 1JFQL 1IIKA 1JXKA 2HJLA 4MA3B 3VSUA 1I4FB 3RGVB 4RGMB 2ZUTA 4PGJA 1A4CA 1X5KA 3FRUA 4MAZA 3RWJB 2EYTA 2P80A 3P77A 1GHFL 1JN6A 1A9EA 2ZWLT 2BOBB 1R3JB 1ZHKA 2VSMB 4X6EA 4ONHA 5JIIA 1AG6A 4Z3HA 3WLBA 3QEQE 4YAQA 1UA7A 4FNLH 3CLFH 2GK2A 2HH0H 2EEBA 2WVVA 3DOSB 4K73A 4NJ9L 3RWCA 4MVBD 3H0TB 4J8RA 5C8JB 5K9KA 2CA3A 3S3JA 2G9KA 4JHWH 4M7ZB 1M53A 2ZKXA 1HWHB 1OE3A 1RK1A 3QE5A 4NLHA 4P23A 4GS7B 3GSUB 4MJ5B 3TBVA 3D51A 3CDCA 1T2JA 1NGPH 3UZEA 3ZZQA 1R0AH 3TURA 1C5CL 3QR2A 5EF3A 3UZQB 4HHWA 4V1DB 1YAZA 5T1DL 3JWNH 1BCIA 2X6UA 2GUOB 4KKCD 1P7QD 4ZS7L 1HHKB 2VERA 2OFQA 2VR4A 3H42H 3LRSB 4XN8A 4WV1A 3QXAA 3S36L 3AM8C 1PZCA 4HJGA 4TQEL 3F84A 2DYRB 5KSBA 1F6FB 3DXAD 3P30L 4GRWF 3GDBA 1FFOB 3VFRB 2XXGA 3IFLH 1ULVA 4OI8A 3WL9A 2F0CA 3EUDA 5C0ND 1EZVX 1TG8A 5FXCH 5MENE 2NW3B 1PBYA 4BUHA 4XC1L 1TR7A 2JJSC 4JKPH 5A2LH 1CE6A 4WO4D 2DYPD 3FUEA 2OJEA 2VXSL 3QWRA 5CMAB 2OW6A 1EH9A 1MW0A 4OR1A 4YUEH 2AKRA 2AXGA 1U8NB 2WXQA 4X9GA 1T21B 3MBXH 2MFNA 2UX7A 1PLCA 1T3FB 2J57A 1I85A 1ES0A 3QQ4B 3VRJB 1EO8H 2CHZA 4O02H 2HJFA 5GJTL 2CNZA 1F86A 3NEEA 1KYAA 1AZZC 1KB5H 3L9BA 4JGUA 2HFFA 1EGJL 4HXAH 3EDFA 4A2FA 2BY0A 1R24A 5L0QB 4IBUA 3UYRL 3HHSB 4FLQA 4RDQF 3ZQXA 4UT7H 4JPSA 2NTFB 4Y4KA 2LT9A 1UCBH 3BZFA 3LB6D 3PWVB 4HHAB 2EXTA 5BRQA 3GO1H 5AYQA 3K6IA 4MNQA 4LPTA 3UBGA 4FLSA 5LLIC 4JAMA 1F11B 2JI3A 5FK9A 3HB3C 4P5KA 4ZFZA 2X4PB 1UVQB 4HDIB 4YX2L 3HC0B 4P5TB 5IY5B 3T0BA 2Y24A 2FLBT 3B9KC 5I1HH 3M1BA 1UXMA 4WNQA 3VYOA 4FX5A 4DERA 1NC4B 5ALBL 4ZUSA 5SX5H 1CE1L 3U7AA 4KNSA 4WFFD 3SPHA 5E2WH 3GSOA 4QGTA 2QPFA 3FN9A 2EC9U 4PY8J 3JWOL 1XD0A 1U95B 2R2EB 4YBQD 3W37A 5DCCA 1BM3L 1BBDH 3LY6A 3TA4D 1DFXA 3S35H 4N22A 2YBRB 4AZ8A 1WGVA 4LESA 1X7TA 1BQKA 4JRYD 4Q9RL 4HKXA 5E8PB 3CZJA 1W72L 5AAWA 2BDNH 2DBJA 2FWSA 3D5OF 4KRPC 5T3XH 1H3UA 1BG9A 1QBAA 3FU3A 3BDBA 2R0ZH 1KYUA 1Z9OA 2LFGA 4PRBA 1F90H 4ZO6A 4ERSL 4J8QA 5EZIL 4ACTA 4JCLA 2OS7A 4OGAC 4UAHA 3ARGC 3RG1C 2X2YA 2C7UB 2ZUXA 2V2XB 3P4NA 4Z23A 3V5HB 3HI6H 3CZLA 4W4OA 2MH4A 4D7PA 4KXAA 5BRZB 2BIHA 1RK7A 5CJBA 4NQDE 3ZKXB 3DGDA 3GGWB 1I75A 3M17B 5J13C 4N0FA 1BMGA 3F05A 2ZT9C 4F20A 2WW8A 2NT0A 5MEPA 4HUVB 1AE6L 5FO9B 1DANT 3AS3A 2C34A 2J88L 4H8HA 1KV3A 4QHMB 2DEWX 3KAAA 5IMOA 2DBLL 4ZAKD 2HVKA 4HV8B 5HHMB 1JE6A 1FL3B 1XH3A 4L23A 5TE6L 2FLRT 4F9PC 5J9PA 2QVMA 3IE4A 1A4JB 2B9AA 3QS3A 4NP4H 3RTQB 1ZE3C 5F2FA 2EDNA 1WBYA 1IRAY 1KCKA 1BFVH 2ZXDA 3OGOE 4KDTC 3APCA 5H37G 4FCAA 3CHQA 4ZX6A 1UUSA 3EBHA 1Q90A 3TPUA 1KMGA 1SOSA 1B0WA 3FYEB 5AB0A 5TQ2H 4MMZA 2HT2D 4YH6A 5D1ZC 2WKOA 1IBGH 4KJWC 1P5UB 4O2EB 4JKPL 4JREB 3HBZA 4OCWL 5E2UL 4AMKH 4QHPA 4X6CE 4QRBA 3G7TA 4S1DC 3LIZH 4X7SH 2R9HD 3IFOA 4YZWA 4A38A 4LQFH 4E0RB 1E27B 1LO4H 5MP6L 3FOMB 2J2ZB 1MCEA 3V79C 4FYTA 5CBAB 3FO9B 4MHHG 2BC4B 4JM2B 2AABL 1X44A 1LO5A 4RIRA 5ESQA 4X99B 4QRPA 1EDYA 3EJTA 5J12C 4WUKL 3SE6A 1VERA 2JCCA 2CALA 1O9VA 3X3GH 3EOBA 3GJFK 2ATAA 1KELL 4BK4A 1EHLL 4HSAC 2D0GA 3PJSB 1V8HA 5E6UB 1M56B 4WHYH 4MCZA 3ARDB 2H6UA 4J3OD 1XQ4A 1BFTA 1SYSB 2A83A 4M03A 2YPVH 3DOSA 2WQXA 4RRPA 4XOEA 2Q87A 4L1LA 4QNPF 3V5KA 2G2RA 5IQ9B 2I27N 1W8OA 1S7RB 5L4JA 3FT2A 1UZ8B 4N2MA 4LHUB 3M7FB 2X09A 3A0OA 5E2WL 2F1BA 4TNFA 3DX8B 1L0PA 4HKBA 3CHOA 3U4EA 4G8GD 2OR7A 3KXFD 2C9QA 3R7QA 3PHQB 2XT1B 3NJXA 3P0YL 1ROWA 4TVSa 1DQJB 3VB8A 3CV5A 2W94A 2KLSA 1K4DB 4NAJA 1E9PB 3L3HB 2AJ3A 2P4AB 4M8RA 1KJ2L 3WD5H 4ALAH 4RSVA 4LEBA 1XCQB 5CBEB 3ROOB 3BZEB 1JUFA 1JSYA 5EHFA 1Z9PA 5JA9A 2XWEA 4TSBH 2NXYB 2AF2A 1TFHA 2FJFB 2Z65C 4MXWH 1FH2A 5JQ6H 4NEHB 1ET7A 5E8DH 3IDXH 1XF4A 3RWIA 2QBWA 3FU7A 1EMTL 4EQ2A 3ZE0B 4PWJA 5I16A 2JKNA 4PV9B 4JHUA 3MJ9A 3FZUC 2NY4C 2NY3D 3GMQA 4FQJL 1P4UA 4LEEA 1R3LB 4PJDF 5T1KD 2VQTA 2DQ6A 4FHKA 2HSIA 4PHZA 4MWFA 3MNWB 3NP3A 4YDJA 1J0JA 5DA0B 1FG2A 4F57L 4Y2DA 1FNHA 3FTVA 4X6DB 5ID0B 4WSJA 4XZUB 1K8DB 1JZ5A 1B6DA 1QI4A 2F15A 4UDUA 4CU8A 2HA1A 4HUUA 5D2LA 1FNEB 3QI9C 4EPSA 5F1IA 1FDLH 2VDML 4DGVH 5D72H 3WUZA 3VXRD 2PXYA 4FDWA 3PYCA 4KUZH 2AQNA 1MCJA 5FLVA 4RGOH 1GH7A 3QIBB 1E3ZA 1EZUA 2IBBA 2WNGA 5KSAD 3NZUA 3BFQG 2R69L 2EDLA 2C4FU 3KPMB 3FN3A 5I17B 5I1CH 4KNTA 2ITFA 3ARFB 1KN2H 4JJOA 1AGCB 1GMIA 1GZQA 5DMGC 1OP9A 1CXHA 1ZHBA 3V4PB 2AQPA 4IRSD 2GBTA 2ILLA 2VE6B 3AQXA 1E7VA 4EEEA 2QKSA 5DF0A 2BERA 1OQXA 3KLAA 5AL8A 4BSWB 1EVUA 2WLYA 2EKSA 4LQFL 4YC2C 4ZO8A 5EU3A 2VSCA 1HIML 5EU6B 1KYOJ 4ZX3A 4YO0B 3BRGC 4XVUD 2HPOA 2B59B 2QHRL 1GYVA 5F7YC 4NO2B 3E8UH 4AK2A 2HFTA 1JDCA 1RZ8B 4B9ZA 3D09A 4JHWL 4KX9A 2H2SC 5CXPA 3GIVB 3HCVA 4MD5A 1WE5A 2VXUL 3TEXA 2A6DA 3AS1A 4PVLA 4RWYL 4NQSB 4FNUA 3GKWL 1KCWA 3T6XA 2DIJA 3WFCH 2R51A 2AEOA 3T4YB 4QRRD 2AQQA 1YEHH 3AB0C 4U3HA 1QI5A 2PYFA 3ZKNC 4L4VE 3QC5X 2PYEA 4WW1B 5I1GH 2JB5L 4LCCA 2EDJA 3ATEA 3BWAA 4IBTA 1ZGLP 4G80B 3KPOB 4GKOA 1FYTE 1UT9A 2QPDB 1J88A 3BAEL 4UAOC 1QSFE 4HZLA 1FFPB 1T1ZA 3STLB 3LEXA 4TUJB 1BVZA 4N2HA 1DVSA 5JXAL 5I6NA 4MB3A 1HXKA 5IT2H 2HP4A 4DPCX 4CVZB 1HYRC 4LDCA 5ABZA 1FNLA 5EV7A 5DSCA 4FKKA 1W91A 1CVSC 3QQDA 4X9FA 2IH3A 1NC2B 2V9QA 3DUUA 4CADA 4GG8A 4TNVK 2F5BL 2BW5A 1ESOA 2Z7YA 4WJG3 2G5BB 1NANH 3SDDD 3ZRFC 1ZD6A 1GAFH 3W2DH 2YR3A 4PJAE 4XB7A 4XX5A 5AVQB 5C0FA 1KJ2H 5CUSH 3KJ6L 2WXHA 3NRPA 5EF1A 1QO3A 5CJOL 1KZQA 2OULB 4UIKL 2ZSVA 1S9WA 4IHOA 2Q8AL 3D7PA 3M1BB 3RIKA 1E4KC 1HSBA 2I9LA 3JWDH 4K8RD 2VZ3A 2Y7SA 1TJGH 1EMTH 3V0DA 5I1AB 1UM5L 4AKOA 2E7LA 3VU1A 3M6DA 1T5WB 4LK4A 2UXFA 1ACXA 2IAND 4KKRA 3F64A 4NQTA 3EW3B 2B7DT 4Z78B 4XAWL 3TIDB 1WPCA 3KZ8A 4DW2L 2KDGA 1W72A 1KPVA 3CCHA 3JV6A 4XMVA 2YXVA 5DHVB 5EULV 2JSFA 3OHMB 4L4TA 4XNUL 3BKMH 5D2LF 4JG5A 5DDHB 4AL8C 4OW6A 4DVBA 4PRIB 5T33H 1UWEL 3D4YA 1N6UA 2EE9A 2C3HA 4V33A 3WS3B 4D0DB 4R5TA 3AFLA 2K7QA 3S5LB 2D0FA 2NY0D 3OG6B 5SWSA 1F13A 3PHSA 2EO1A 1CD1B 4DZBA 3QR1A 1R3HA 5KS9E 4JFXA 2OR9L 1QMUA 4OZFG 4H44C 1GSMA 3ZDYF 3I02B 2A83B 5HGGS 3FH5A 2WM0A 4JFHE 4LKXA 2DQDL 5CZVH 1JNLL 3GSWA 3W11C 3T2QA 3EDJA 3RPIB 2ATPA 3HZVB 3QUZA 4HULB 1BP3B 4WI0B 1NCGA 2V7NA 3AVEA 2KC0A 4FEMA 4ETYA 1UQSB 5JPNA 4TM9A 1Z66A 1F45A 1PDKA 4QTIH 2GY7B 4WU5B 3S8GB 4WHYG 4WUUE 5CEXB 3C6SB 3IWVA 1YPZA 5EIIA 2VWEE 4JZJB 2R1XB 5BJTB 4YEFA 3DO7B 3L4CA 1ZLUK 5DD6B 3BIKA 1NAML 4I2XE 1N67A 5GS0D 3KPSD 4MKMA 3VXRE 1EZSA 1I8UA 1M7DB 3ARED 1XMWA 4IMKA 4LRNL 3BZ4A 2PPDA 2VISB 1XGUA 5HHNB 3MTXA 4PHXA 4QGYA 3ELQA 2FX7H 2UXGA 4NQUA 4P9ML 3BPLB 5LGHH 4Y5YA 3MRJB 1NFDF 1ZVSB 3GEFA 3PWPA 3DSNB 3UAAA 4UBDC 1R3LA 3KWWA 2XI9A 1BAGA 1DQTA 1W0VB 2YD4A 3K6NA 3LZRA 2A74B 1GXEA 1NL0H 3WL9B 1G6VK 4L48A 4K15A 1E8YA 4HK3J 3PWPD 3N0PB 5CBAA 2NY1C 2XTJE 3RZCC 4RX4D 3RYMA 4XWOC 3EJJX 4AW7A 1GJUA 3QCVL 4X6CB 1ZXQA 4MTMA 2OJEB 3SGJC 2DWXA 3LPOA 4LBEA 3VA6A 4J3OG 2HH0L 4NJ9H 4PTUB 2EEDA 4F8PA 3NFNA 3DRQA 1K85A 4BKLB 5CSZA 1NBZA 5EO9B 4PJEB 1WTGT 4WENB 3ZW3A 2NUTA 3MRQB 5B1JC 4Z3GA 4JFPB 2QTVA 3A67L 1HHGB 3K6SA 2DWSA 4KTYA 5DD5H 3LN4A 3HI5H 4JY5H 5GHWL 4Q0XH 2XZCH 3BUDA 3TIEB 4LHUA 2DQTL 4RMRA 2HLFD 5FO7A 1AS6A 1N59B 1NMAL 2MNUA 2OXGA 4NQVB 1X9RA 4JKMA 2X4TB 3C5ZD 4DP8X 4CA4A 5DJDB 1T03H 1EUTA 5GGQL 4DZ8A 2P9RA 1AR2A 2OMUB 3AAZA 3QQ9C 4MA8L 3NJJA 4HU2A 4W9JC 1CCZA 2F1AA 3NIDB 4L4JA 4L4TD 2ADFH 1F1GA 1FGNL 4CMMB 1UJ3C 3L3HA 2QEJA 1DJWA 1O6SB 2EXYD 2KH2B 3RNQB 3BZEA 4Y5VC 3ASNB 4P4KA 4NPYA 1BXUA 4ANWA 4R4FL 2MCMA 4GXUN 4PJ7E 3IMWA 3U36B 1G9MC 4U6HB 2ZXWB 3ABGA 5EO0A 3ZK0A 1U0QA 2E76C 1NDGB 3QJHB 4HJJL 4KRNA 3TCXA 3BJ91 1YMHB 4HQQL 1G1KA 5DO2C 3RPKA 1GZPA 3GZPA 2C9PA 3MR9A 3VSQA 1EO8L 3GMQB 1BWMA 2OSYA 2BIQA 2WTOA 2PR4L 3TC9A 3GHEL 3IDJA 4NUQA 5KSBF 4L8CB 3ETTA 5E1AA 3ABKB 2QADC 4DOHB 3MUY1 4RNRA 1DVQA 3B9KA 2C9SA 4HAGA 4MS8C 2FTAA 3RVWD 3CVHB 1MLBB 5D93C 5D5ME 3MGOA 1RZ7H 4QRQA 4WW2B 2VM9A 3EFFB 1AGBA 4KVNL 2P52A 4I1NB 2Y07L 1MVUB 1U21A 3H3KA 4YIQB 2E7BA 2MMXA 2XN0A 1A3QA 2HJKB 5TD4A 2PW2A 4KK8C 4OFQA 3QIUD 2K9UA 2GITA 1BYPA 5CS7A 1FG9C 1NGXB 4WCYL 3RQ3A 4EUPB 3S8FB 4W1TA 2HRPL 1NLBH 2HLEB 3ARVA 4EDWH 1CFBA 4L3AA 3BT0A 3CN0A 1XR8A 4JFTA 4X8JB 1BM3H 4WLCA 1B9KA 4P9HC 2AMUA 2CLRA 2VE6A 3MV9D 4OZGA 3K80A 5LN8A 4N2CA 1FN4A 5K39B 5B38A 2UZYB 1ADQA 2FEEI 4BSWA 2HX9A 2HYMA 2J1ZA 2NQCA 3UBFA 1M4KA 2F19H 1RFDL 1ZVHA 2P5WE 4LEOA 3RWDA 4D8OA 2IFGA 3E80A 3N1MC 2EABA 3D0AA 2XBTA 3ULUE 3FFCB 4Z7NB 5F1KC 2DMBA 3VB9A 2X70B 3T5WA 4AEFA 4WWKB 3ASWA 2FATL 4NQED 2C4FT 1RULH 4MYPA 1TYRA 3HN3A 3P0GB 4OLXL 2A6KB 2W5PA 4OCMC 3KGRA 3UGEA 4E9VA 3Q2NA 1MAMH 1DSFL 3GXDA 2GEQA 5MHSE 1E27A 3NSJA 4NXSA 4L05A 2R4RL 1RUQH 4XNZB 1XD1A 4G70B 4HALA 4LCCB 3WIFB 1S78D 5DJ6B 1DBBH 4ODUA 4Q14A 1PG7W 3TBBA 1SF5A 1T2XA 3MLSL 1KGCD 4W9ZA 4NNYA 3GKWH 5EWIH 3IGAB 4HEME 4WDIB 2VC2B 2A5UA 1YNLL 1G7QA 3P3YA 4HIJB 3EUUA 2EDFA 3DBXB 1T20A 3FCSA 1ML0A 3LNFA 1AP2B 3MOAH 4GLRI 5ESAB 3TBWB 4AXWA 3U4BH 1MFEL 2AK4A 3LV3B 3WSQL 1BF8A 1I8KB 4RRPM 4XB8A 4OQ1A 5K9JH 1A3ZA 2NY5H 5IR1A 2X1PA 4S1SL 3EGSA 4JPWH 1A8ZA 1C12A 1FGNH 5EZJB 2ZCLL 3VFUB 3B9AA 3VUAA 3AY4A 5HJ3A 4MQTB 4LGSB 4WEEA 3MV7E 1CXEA 2EO9A 2QSVA 1M7DA 3RWGB 1YEJL 2QV2A 2N56A 3FHEA 2HT4C 3ARBD 3ZXAC 3MV7A 1CF8H 1YMMD 3NQIA 1H3GA 3POHA 1I9JH 1Z3RA 3TJHD 3LPPA 2EE6A 4BFEA 5BV7C 1MZYA 3PWPB 5F3BB 3LZQA 4M7LT 3WJMB 5ERWB 1MY7A 2AZAA 3LPWA 4DAGL 4E9YA 1OT1A 5AZEL 3RUGB 3KVDD 4JE4B 5K9OA 1UADC 2AVGA 1CDUA 4KFMA 2C3GA 3TYFB 2CDEA 4F33A 4D8PA 1P1ZB 5D1ZD 1GAFL 5J6HB 4PGZA 5LXVA 2Y1VA 3ESOA 1H3PL 4N2DA 3TN0B 3MNWA 1Y7VA 3MNMA 2AJYL 3KPSB 3UAFA 1GS7A 1VENA 1E4JA 1GW6A 1NBZB 1WWWX 3VXUA 1BD2B 1I31A 4OLWH 5FOBA 1E7UA 3FL7A 5JOFA 4DUXA 1SGKA 4HWBL 5F3HB 4U7KA 3VFPA 3EYSH 1DVTA 2C3XA 4JQXC 4YEEA 1TT6A 5E1IA 3AG1B 2BMKA 4LIQE 4LLYA 4P59L 4NQCB 3V6OC 2FT6A 3LHPH 4K3GA 3GSWB 5E03A 4X4XB 2SODB 3QARA 4XBPA 1A7BA 4LNRA 2KQMA 2ZUWA 3ZHFA 3PGFH 4A68A 1MCOH 2H9GA 3KLQA 1KV7A 2W38A 4H8PA 5IB2A 2OTWB 4A67A 3EFDL 3L3KA 3WE6B 4POZD 2DTMH 2HVJB 4NWTH 3U82B 4G42A 5BUPA 3L3DB 1NUFA 1F18A 2QQNL 4N0CD 4DH2A 5JNYB 3RFRA 2WLIB 3NQKA 2A99A 1B3JA 2GTQA 1E28B 3IDYB 1YY8A 5TE4L 2HAZA 1INEH 5IVXA 2WBJC 2XV0A 4L2LA 1VA9A 4FQ2L 1UB6B 5DEFA 2W0FA 4PRID 3VDAA 1SUJA 5D7IE 3E6FA 1TQSA 1NBCA 2IDTA 2WP3T 3VU2A 1IM9B 3SQBA 3VI4A 3T4AC 1XB8A 1CU4H 1WD8A 5IFAH 1EXGA 3JXAA 4OZIA 2GCYB 3DV6B 3PNWB 1ITCA 4H8QA 4LLUA 1YY9C 4JO5A 2X87A 4N0CC 3MLXH 3HKZA 5H35B 1OCWL 1OAQL 5LAXA 4ZW7A 1J8HA 4DPBX 2I24N 2A6JA 5EOQH 3E9TA 4FYRA 4RNRB 2P8MA 4FNPA 3F04A 1IKFL 2BSEA 5BQ7B 2WO3B 3IRPX 3CNKA 1X9QA 5TH2A 3QIWA 1HQ4B 2UWEB 5EUKA 2FIKB 2DQGL 3TVMA 4BEIA 1YN6A 5EDXA 5EU5B 3C08H 5CGMA 3BFOA 5LGJA 2MCPL 3ULVD 3GJEB 5HYJB 3V6ZB 1DEEB 2ZXAA 3KVQA 3MA7B 3TO2A 2H32B 4XPTH 1QFUL 1ZDSA 3BKJH 4Q52A 3H9SA 5K9QI 3SDDB 4G7YL 5FM5M 3QJUB 5INDA 4GRWH 4AX3A 4Z8FH 3ZLQC 1NC2D 1DJXA 5CZXD 1AQKH 1O7SA 4HBCL 3EYVB 3QXDB 4PJ8B 1H8SA 1GTNA 1W15A 4G6AD 4PYHA 5DJDA 2ZKHL 3VD5A 5FYKE 4GP8B 4LKCB 4DP6X 2W65A 5GISH 2QMJA 3VXMA 3ZT6A 2D4FA 3WNLA 3BLKA 4BJLA 4FFZH 4PWHA 3QQXA 2YAHA 3SDYH 2IO5A 1IGTB 3BD3A 1UD2A 5T1LB 5DI8A 1KTKE 2QZ5A 5GSRB 1KEMH 4M4RB 1HYSC 2N59A 4J2XA 3T0WA 4LMQE 4QRRB 5D7KD 6CGTA 1V5JA 2FSEA 1L6XA 1PY0A 4H1LH 1TXKA 2V5SA 4Z78A 3JV4B 1DUZB 3JWOC 5DD5L 1OM3L 1CFSA 4RGNE 3ZGHA 3PIQA 3GMMB 3ML9A 3WGVB 4AQ1A 4N4YB 4QWWC 4Z7UE 3VXSB 4PR5A 4WY7L 2D3NA 3VI3A 4R7DA 4PJ8C 4U7MA 3ERXA 3V5DA 3VYPA 1W9XA 1CJYA 4YAQB 1KPRB 1MREL 2XBDA 3NRFA 1TQBB 4FABL 5JHDB 2ZOUA 4YHML 4K94L 1I8MA 2X0UA 1ED3B 1YYCA 5C8JA 2VDOL 2PPEA 5HDOA 1CR9H 4LVHB 1X5YA 3LRKA 1G9ML 5C0NC 2PR4H 5BPPA 2G2PA 5FCUL 1RV6X 4YOKA 3SDAB 2B8OT 2EYSA 2DJUA 4P3CH 4BZ1H 4JVWA 4X6BA 4IGBC 2CBQA 3U0TB 3AG4B 4O58H 3QHZL 5EOTA 5BMFL 5A6IA 1I7UB 4QXWA 1RZ7L 3KW7A 1TYJA 4I2XA 1SJEB 4MBRA 1P1VA 1YPZB 2E46A 5KAQG 4R90L 4XVSL 3D4GA 2E59A 1NGWA 4NO0A 2QFPA 4H13C 3MLRH 5EBWA 5DK0A 1N2RB 4CGUB 4KY2A 3QPQC 4F37K 2NZ9D 3Q3GB 4HAKA 1A9BA 2ARJB 4NHCL 4PRDA 1E6JH 2ID5A 3NJMA 1OW0C 1T5XA 1Y6MR 4FA8A 3OZ9L 3O4OC 4IMLB 1HEJC 2XQBL 1MCWM 4K3EH 4GO9A 1T0PB 3LXBA 3TYFA 4NZTH 3LKRA 2OA9A 1BX2A 1LWHA 3U1PA 2P45B 4ATTA 1TJIH 2BP8B 2H7WA 3K3QA 4OI7A 4YC2B 4NKIL 1SMDA 4ODSL 5TDOA 2CJSA 4CSPA 2OP4H 2WZ5A 1GIGH 4NKOB 1MF2H 2VR7A 4QTIL 4QT5B 3WE1A 4H1LG 2J1KA 5BV7H 4HKZA 3BGFC 1RZKH 4G72B 4LBEB 5BXFA 4LSTH 1ZTXE 3QDGB 4X7TB 3K6DA 1D7FA 1NEZA 4N5EC 3IDNA 3MXWH 1BZ9A 4H26B 3TU6A 3ULUF 5ICYA 2G60H 5JDSA 2X4OB 4ZFZB 4EOWH 5L2KB 1M7IA 1I8KA 4XP9L 4H8WL 5LG1A 3Q8CA 1VFAB 4QKXB 1R19A 3NCMA 4DO4A 4Z7VF 1OP5H 4X7EC 1C5BL 1X5FA 1CFVH 1D5BB 5TPWL 4NUMA 2B20A 1Z7JA 3KYOA 5IVXB 4NKQB 3RB7A 2Q10A 1QSZA 2PP9A 2HFEA 3V0HA 1IQWH 3PPEA 4BQCA 1F1AA 1IL1B 1CBVL 3QRFM 4JFFB 4KKLD 4OFKA 1XFPA 4G8IA 2BNQB 2GAZB 2ZWZA 3RNQA 2GCYA 4XCEA 1R3IL 4ELKA 3ZSTA 3C2SA 5ICZB 1FLRH 2ZP9A 3H8NA 1DVXA 2GJ6E 2P46B 4M56A 4PS4L 4YHIB 4PLNC 1U3JA 5GZNA 3QFJB 3N44F 4YBQC 3UTSB 1MHHB 4F58L 3F7KA 3QIWB 3RWHA 3CLFL 3VFOB 4AMKL 1AANA 1J12A 5E9DE 3LH8A 3CJJA 1GZHC 2W92A 1D7BA 2JB6B 2ZYIA 3VDBA 4HGWA 5GHWH 3KPSA 4OGZA 3VXUB 3WNJA 2W07A 4CUCA 3CZFA 1ZVYA 2IC2A 2R29H 4J28A 3VFPB 1E5BA 1S4IA 1DBBL 3RTQD 4DK5A 1R0AL 1AXTL 4W6WB 1G43A 2CK0H 2VR3A 3US0A 1FVDB 1OAJA 1CXLA 4NXKA 4WZ9A 3MLRL 5IM7B 1ETZA 5HHMD 5E4EB 2YRLA 3CK0H 3A21A 4PY7B 3BQUA 3CPLA 3P30H 2O5XH 2YN5A 2MHAA 1K5NA 5DURB 2F54D 4X7CC 1T89C 2UZIL 4JAMB 2G5UA 5CN3A 4G42B 2C9XA 3HUJA 3NK3A 2F7OA 5DFVD 3QNXB 2UWEF 3GLEA 1U3HA 4XBEH 2VL5B 1E67A 3BIBX 4HLZG 4Y4FC 3QEQD 1D9KA 1DBKH 1OCZB 4I48B 2BXZA 3RFZC 2FJHA 5CU5A 4OLVL 4WI9A 4ZD3H 2PETA 1YJDL 1M42A 3JSSA 3B2MA 4I3GA 2DQDH 4U1LA 3DVNB 3GI8H 2FQFA 3HIZA 2EDWA 3N1GC 4NOBA 3RZCA 3FCTA 1NGYA 1BAWA 2J43A 1YN7B 3QPXH 2YEQA 4LCWE 1OGAA 3ARGD 3GS7A 2VDQL 2OI9B 1GJWA 3EJYD 2WZPD 3CIQA 5F3FA 3ZKMD 3KR3L 5GQBA 2X2IA 3QDMA 2XA3A 1FIGH 3LZFH 3FUFA 5GIRB 4Q2ZA 1A7OL 1VZHA 2G2RB 3HN5A 3O6ML 4FLHA 4LCIH 4P5TD 5IQ9A 3WIFA 4DKAA 1OWRM 4HHGA 3VXME 5GGRY 3LKQA 4ZUVA 4BINA 1FYHB 4JVPA 1VACB 3MV9E 4B5EA 1IZJA 2LVEA 1Q9WB 4NNYB 4XVOA 1C5BH 3C5ZA 1I1YB 5ADOL 1OP4A 4JHAL 3UJIH 2VDKB 2YD7A 1BZ7A 4BA8A 3FU8A 1FL3A 1XH3B 3SYPA 1RZJH 2YARA 1FL6A 1RAMA 4EKJA 1WFUA 1HOCA 4LLQA 5GSVA 2NLJA 2YEZA 3D30A 4EBQH 4RGOL 1VGKA 1C12B 5EBWB 4RAHA 3VFUA 4JFED 2DMHA 5HJ3B 1YEKH 1S7WA 5D1XA 2W1NA 5KWYC 1T0OA 2EDBA 1YYMH 2Q3XA 4XR8C 3UAJA 5F0MB 2WINA 1DBJL 4MDRA 4XCFH 4E9XA 3QG6B 2PYED 3EJPA 1MEXL 2NX5B 4MQ7A 3WV0A 1D7DA 3HE7C 1BX2B 2EE2A 3ZDYE 1NOLA 5IHBA 4YPGA 5ELIA 5F7FA 1ZHNB 2BPBA 3ZO9A 3LKOB 4R96A 4G7YH 4LSUL 5EU4A 1CXFA 1M71A 3IN0A 4NRYB 3GK8L 2HZHA 3FPXA 3GS4A 3OKKB 2VLMD 5CEZE 4S0HA 3B2VL 1XGQA 4OFVA 1EXUA 2XN9B 2VJXA 3ZTCC 4GUQA 1P7QB 3B5HA 1G7HB 4PJCA 3KJ4C 3MV8B 2IF7A 1BVNP 4U1IB 4V1DD 3TEUA 3FSAA 4A7VA 5JORA 3QDGA 1J48A 1M05A 4HIEA 3FS9A 1SDDB 1HL5A 1UH4A 1BXVA 1C1EL 3KPNB 1MY5A 1OAKL 4M00A 4XNMB 3UMNA 1JV2A 5C0EA 3RY6C 3RU8H 1MJUL 1UXSB 4CL7A 4JHVA 2GTZB 4BFNA 2JE8A 4UOQA 1DVZA 4CDGC 4OFPA 1UKQA 3HUJF 3ZTJH 1XL6A 2BVQA 4OQTH 3BAEH 2AEQL 2JKRM 3VFMB 5JO5A 3BKJL 2XG5B 3AQYA 4U33A 4ONOA 3S3BB 5HHPA 1K2DA 1T7YA 1H3TA 5TF1L 3SE8L 1ZGLM 5AZUA 4FZEH 2IV8A 3AWGA 4POYA 3VXTB 1DL7H 2J8UF 5DEGA 2E75C 4TOYL 3BP4A 3BVNB 4GS7C 5CCHE 1FAIL 4D9LL 3GMRB 4MD4B 4NYLB 3GI8L 4RQQB 4F91B 1USQA 3GIVA 5TQ2L 1ZT4B 5FUOL 3WO4C 1SOKA 2PCYA 1U4EA 1K6QH 4P3CL 1S7SA 1B2WH 1Z9SB 2X4QB 5DRXB 2ZIDA 4FHBD 3PL6C 5G4OA 3T4YA 5IGXL 2DAVA 5IVZA 4TN9A 4H8UA 4Y9EA 1XF3B 4CVXB 3QUYC 1DUYA 1J1PL 2E9BA 1DP0A 4ZS7H 3JWDL 2GSGB 1MELA 4G80A 2LVCA 2R2HB 4KY1L 4PJFA 4Z7QB 2WN3A 3M1CA 1JPTH 1U91A 2VN5A 4MBOA 3DX6B 5AW1B 1YEFH 3TGXA 1NCIA 1UUNA 3NJKA 5I30H 5I1KH 1OB0A 1E6OH 5KZCB 3N43B 3NEXA 2A6JB 1GTFA 3J7HA 3VH8A 5IW1A 1ZLEA 5KYUB 1A25A 1AIFA 2A73A 3EHBC 2UY6A 1DDHA 5DHEA 3H3PL 5KJRL 2YAMA 1F58H 4FQXD 3NTCL 5A6MA 4AI7A 1FV1A 2B2XL 3TEZA 2IAMA 4PLKC 4OZIE 2VC2H 4NBZB 3TPKA 3WEOA 4ZMQA 3U46A 1RKRA 3VH8G 4FP8L 1MG2C 3MV11 4KXCA 2FL5A 4PJAB 4CILA 2CR0A 3V6FA 4PN6A 1NCCH 5I8KL 2ESVB 4LDEB 3ARFC 4Y9FA 3M7OA 2A1WH 3U2SB 5HI5D 2WIIB 1DJIA 1AG0A 4PCYA 4E5XA 3G6AB 4PJXB 1NCNA 4JO3L 4JFZL 3QUKB 3HS0C 3KDMB 3MLWH 3NUKA 1RLWA 2OMVA 2QFRA 3OZLA 2ITEA 2XY1A 4LSUH 1AHWA 2EKSB 4PM1A 4V2BA 3MRNA 4LAJH 4X98A 1SFHA 1S7UB 1IAKB 3F85A 2VTFA 3WFBH 1HAWA 2X42A 4N86A 4DP5X 5DZNA 3L5XL 1JF5A 1SEQL 5GJSH 4QHUA 4ZMWA 1IKFH 2FBJH 5E6IC 4UMGA 2VMFA 4LVEA 1Y0LB 2DZEA 3UP1A 3E2HB 1PEWA 1WITA 1CE1H 3P9WB 1GGIH 1JDAA 2E7CA 3S5LA 1SBSL 1CB4A 2ZUQB 4LRNH 2FSEB 1G4MA 4Y2DC 2BINA 4KUCF 2UY7A 2VLJA 5KUKA 4TUOB 2WKGA 4EI6A 4Z7WF 3N6YA 3QS2A 3FXIC 3CMOH 4JFOA 2ZX6A 4A6YL 4S1SH 4PJDE 5L8LB 3K46A 1LXMA 1VADB 2Z4QB 2DWEB 2E0PA 2R83A 3A47A 2V2WB 3B9VA 5L2KE 5INCA 3MRDB 1I8AA 3RBGA 1NCWH 3LEXB 3FO1A 4LGRB 2VXVH 4OM1L 1U9KA 5IMMB 4O51A 5EZIH 2E9JA 1E5UI 5HGAB 1BW8A 1U8QB 3DYOA 4X0KB 3PP3K 5I24A 3H1ZA 3W39A 3TZVD 2BS9A 4I77H 3DMMD 1BDYA 4HWNA 3KCPB 1NC2A 3PPSA 1NPNA 2WO2B 4XXCA 4ZUWB 3EFOA 5IROD 2JJTA 4XE0A 4I9XA 4QOKD 3KVPA 1DJGA 1N3NA 4HMEA 4JR9H 4PRPD 4QRSB 5IBTH 3BQUC 1J1PH 1E42A 1ZLDA 4YHPB 4HWEL 5AWNL 4JZOA 4ZW3A 2R8SH 3F65A 4P2QE 1JK9B 4KO7A 3FUKA 4XPAL 3HZYA 4UTAH 2YD9A 1QATA 4P2AA 1HSBB 4MLIA 1C7TA 2K0RA 4QLRA