4IBZA

Human p53 core domain with hot spot mutation r273c and second-site suppressor mutation t284r
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
193
structure length
193
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVCVCACPGRDRRREEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title Structural studies of p53 inactivation by DNA-contact mutations and its rescue by suppressor mutations via alternative protein-DNA interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 44
structure length 193
sequence length 193
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ibzA00
1KZYA 1UOLA 4LOFA 4AGLA 2VUKA 5KBDA 3WTSA 3TS8A 4HJEA 1HJBC 3D05A 4L0ZA 3D09A 5AOLA 5BUAA 1E50A 4L18A 5G4MA 3Q01A 3WTTA 2J6WA 1CMOA 3KMDA 3Q05A 5G4NA 2XWRA 2IOOA 4GUOA 3WTUA 4IBYA 4MZIA 2BIQA 3VD2A 3EXLA 2PCXA 1CO1A 5AOIA 2IOIA 5LGYA 3QYNA 4AGOA 5AOKA 2J21A 4G83A 3Q06A 2X0UA 2J1ZA 3D07A 4AGQA 2BIMA 5ABAA 4IBWA 2BINA 2BIOA 4XR8C 1EAOA 1IO4C 4IJTA 2J1XA 5G4OA 2X0VA 1TUPA 2AHIA 3WTXA 1TSRA 3ZMEA 4AGMA 5LAPA 4A63A 3US1A 3WU1A 3WTVA 4MZRA 2IOMA 2AC0A 3WTYA 3QYMA 3VD1A 4IBTA 2ADYA 1EAQA 3KZ8A 4LO9A 1LJMA 2H1LM 2J1YA 3EXJA 3D08A 1HJCA 4IBSA 2ATAA 3IGLA 4IBQA 4AGNA 2XWCA 1H9DA 5ECGA 2P52A 2BIPA 1GZHA 3US0A 4KVPA 5A7BA 2RMNA 1T4WA 4L0YA 3IGKA 2WGXA 1EANA 1YCSA 2YBGA 4QO1B 1GZHC 2MEJB 4GUQA 4G82A 3VD0A 2OCJA 4IBZA 1HU8A 5AB9A 2X0WA 3D0AA 4IBVA 2J1WA 2J20A 5AOMA 5AOJA 3WTWA 2GEQA 4LOEA 2FEJA 4IBUA 4AGPA 3D06A
chains in the Genus database with same CATH superfamily
4GRWF 4XVOA 3ETBF 5IBLD 4HJGB 1RK1A 5DJ6A 3T4AC 4XX1E 3EYUH 3LRHA 4A7VA 5ITBH 4BV1A 1RMFL 1FH5L 3LNHA 3MBXH 4BZ2A 5EOTB 4MJHA 1TZIB 1ORQB 1T0PB 5LBGA 2JKWA 5KS9E 1YYML 5J6SA 4TUKL 3MNMA 3QIBB 5AAPA 4Z8FL 4F37K 4NT6A 1F6LL 4MHHI 4ZFGH 2YBRA 5E0QA 1NDGA 1HI6B 4XPBH 1OP3H 5FYLE 2EIZA 4POZC 4APXB 1YEHH 2X1QA 1S3KH 2CO7A 1KIQB 2VN5A 2XJLA 4JJOA 4GXFA 3HVDA 3HRZB 3OSVA 1LILA 4LLMA 3QRBA 2FATH 4QCIB 1AJ7H 3C6SA 1OAJA 3LXCA 4LBAA 1L0YA 2WQUA 4V2CB 4MQSB 2W0FB 3GXNA 3QDJA 5A3ID 4D0CB 2FR4A 5HDWA 3BFWA 3QUZA 4Q74A 2EC9T 5F3BB 4TVPD 1IC1A 2DQUL 2VM9A 4MJ6B 1ES0A 1IFRA 5HYSB 3MAWA 3MRHB 2BRRL 4Q6IC 3ZSSA 1P84J 5I1HH 1D9KA 1CDUA 2KZ1B 1T2QH 4GQ9H 4ODSL 2IAMD 2D31A 5JQ6H 1B90A 5I71C 4F57H 4XNUL 4FTVA 5HHPA 1AXTL 1J8HD 4NZJA 2OJ1A 3TZVC 3UCRA 2V5RA 1KIRB 3I9IA 3CDCA 3G04B 4Q6YA 3TN0B 5K69A 4OZIE 1AKJB 5DD3L 3KG5A 4L8BA 3K1DA 3NCJH 5EOQH 4JFDA 4OZGF 5ICXA 5AAMA 5TTRA 4IJ3C 2ADYA 2A4EA 2DI8A 5HHOB 3AC0A 3KZ8A 4N2IA 4WF7A 2IBBA 4N2KA 1RJLB 3SPVA 1DVTA 1S2EA 1SVZA 2OL3B 4KJPC 4ZOAA 4IRZL 3FQXB 1G7IA 4Y2DC 4TN9A 4MQXD 4QNPE 4HOMA 1N4XH 3QIWC 3CDGB 2HG0A 1WC7B 3TPUB 3QJHA 1S9WB 3AB0C 2VN6A 2WNXA 3FB5B 3MLSH 4AJWA 2XXGA 1DVZA 3H3PH 1JZGA 5I9QC 1RZIA 1XGTB 2IBGA 3SQOL 3BT0A 2PW2B 3EH2A 4QWWD 3HKZA 4G9FD 3F64A 1G9ML 2RR3A 2BHFA 3IAGC 2FJUB 4G8AC 4LVOC 1P0SE 2BOBA 5IBUG 1ZXQA 4I3GA 3ZE1E 5IHZB 2ZWNA 4PEEA 1WE5A 1MH5B 4M7JL 4Y16D 5I66B 4YSEA 4NCC1 2WQ8A 3V52L 2N7AA 1XIWB 5GS1B 3HUJB 1DLHA 3HS8A 4AGPA 5C0FB 4NKQB 4ELMA 5E5UB 1DQMH 2DQFB 2L4OA 5AVSB 4JW3A 4OFYA 3OZKA 1MCHA 4GG8A 2Y3AA 4OB5L 3VNYA 4HUXA 1QZNA 3FZUC 2R2EB 2IPUK 1SM3H 1Z32X 2COVD 5D6DA 1KCWA 3EO1B 3ULSA 4RGMC 4TTGA 2F8XC 3QH3A 1S9XB 3CU7A 1UD3A 5AZUA 2CJSA 2W94A 2GJRA 3K81A 5B8CC 4BFBD 5H4ZA 5C0BE 1IQWH 3GXFA 4HIPA 5AG9A 4FQLL 4V33A 1F1GA 1J11A 3O3DA 6PAZA 3VTAA 2JELL 2RQ8A 2UY7B 5AW7B 3UTQB 3CFNA 2YLKA 3U0TB 1XH3A 1IGCL 3NAAL 1E8XA 3DETC 5B21A 1U8NA 4K7FA 4HKBB 4PJ8D 3IPFA 4U1JA 2JK5A 3SE3A 5IV2A 1AS7A 1BIHA 3L6FB 4K23L 1JZJA 4KTEL 3MJ7A 1W72H 2BP3A 4R2GC 2ZX8A 1RZJH 2BC4A 3H55A 3NCYP 4HS8L 4AMXA 4JRYD 5F7EH 1E6JL 4Z3TA 3KLHD 4NZRH 2R29H 5E51A 3P2BA 4RISL 2B3RA 4FQIL 1FNGA 1G9NL 2MIZA 4IMKC 1KGCE 3HC4H 3U6RA 2Z35A 1FNSL 2XVBA 4ES9A 1KENH 4JEGB 5JHLH 2YZ1A 4DVRH 1HE7A 1MCJA 5HGGS 3O4OB 4D9QD 4N0YH 4XP5H 5CEYA 3BPCB 1CG9B 1IC7L 1QFWI 3X3GH 5DRNB 2VMCA 5C0RH 4JY4A 5I8CA 5EZLB 3NSCA 5T8IA 2OTUA 3EIFA 2GT9A 4G70B 4GJTB 5IFJA 1KXQE 1A6TB 4X0NA 3IDYB 4OUUA 4AG4L 4Z7OB 4GW5B 1SDDB 3VD7A 2OXGA 3IFPB 4Z23A 3HC3L 4H26B 2YZ8A 1O75A 5EBGA 3IGFA 2NTFB 4AGNA 2XWCA 2WYHA 1CF8H 3VSUA 3GRWA 3QUXB 4U7SA 1XBDA 2FJFA 2MFNA 1R33A 4UU9B 4N2AA 2EE0A 2NUPB 4F9LC 4L05A 1R5WA 1NFDA 5EFIA 1T7XA 2F74B 3ULUC 2IDTA 4BM7A 5E4IA 1MCCA 1XWVA 4YEEA 4PJEE 1N19A 4KJQC 4L9LC 4P5TC 4OFIA 4RFNB 2R4RH 4FXKB 3WIHA 5HI5C 3O4LA 4UUJB 5EN2B 1RK0A 2DDQH 2WBJB 4FHKA 3ARGB 4ZFZB 3GZKA 1DP0A 4HHAB 4I9WD 1YEFH 2Q8AH 3JYBA 3CSFA 2NY3B 2WXRA 4OVUA 2DI7A 3P4MB 2WLZA 3BVXA 5AUMA 4NERA 2VUKA 3MI6A 3F7QA 4BWTA 1DYZA 1H8SA 1MF2H 4GBXB 1ZKAA 5LLIC 2V2XB 2YA2A 3DDGA 4JZJC 1NAMA 1UXSB 2I07B 4CC4C 5IOKA 4X0KB 1E90A 4NJAH 4OLVL 4C58B 2XRAH 5CSZB 1SF3A 4G42A 3K74B 3RTQB 3T77A 3GZQA 4UV7H 4P2YA 3SE4A 3GHEL 2P43B 1FL5A 3DPDA 3NIFF 2KDYA 5TF1H 3KXFA 4UILL 1V3KA 1ZK5A 1NBCA 1FYTD 4JM2F 1FE8L 1ZS2A 4MSWB 2R0LL 3VFWB 2B2XH 4GW1B 3PGCA 5KVEE 3D3VA 4TRPL 3SQBA 4YDLB 3CLEH 2QVFB 4W6XB 5HDOA 4R4ND 1WFOA 4WGWB 2E7LC 2MOQA 5MENE 15C8H 5BW7A 5EUKB 2Q87A 5E6RB 4CMHB 1BREA 3NCXA 3OGCA 1S7UA 4FFWD 6CGTA 1SJHB 1TJGL 5HYIA 3G6AA 5B39A 3WDIA 4AX3A 4IOSA 4KKLC 3SYCA 2C3VB 5IROC 3V7AE 4RWYH 4QRRA 5M94B 4IJTA 1IEAB 5GGTA 2W9DH 1HKLH 5AW9B 1J0IA 3AUWB 2ESVA 3VG0H 1YECH 2G60L 2SEBB 2MQ3A 1Y6NR 2FL5A 1AE6L 1T2JA 5FLVA 1JMXA 3FT4B 4KUZL 3EOAB 4P05A 2QGBA 3MV8A 1SRDA 1A0QL 5DURD 3C6LA 2XZAL 8FABA 4M61B 3D9AH 3JWDL 3CNKA 4G2AA 3V4VH 4NO0B 1K4DA 3VVVA 4LARH 1KPUB 1ZS8A 3N1GC 2ENYA 2Q76B 1H5BA 4NRZA 4AVHA 3V9EA 3RY5A 2A9ML 4KMLB 2XIIA 5EF2A 2GIXA 3AADB 1HHJA 4MGXA 2XACC 1OHZA 1ZHLA 4XWOC 3VXPA 3L81A 3FO0L 1G1YA 4IHBA 2K3TA 2C5DC 3V6OA 5HHQA 3C5SA 4QHNA 4HSQA 4HJ0C 2WVVB 4QRPD 4PR5A 1KULA 1H6UA 3QPKA 2ZYSA 2GEEA 5C0EB 1S7SA 3TL5A 3GYRA 1FWXA 1CQKA 5I0VA 4M5ZH 4HXBH 2JCCF 3VFVA 3QIUC 4YWGH 5KSBB 1JPGB 1T1YB 4MAZA 5JIKA 4HEMA 4PJ9D 4C55A 4EZKA 5I8OH 3GJFK 3LD8C 4MAUL 3DA0A 1XGPA 4M5YL 4NYLB 4IEFB 2X7LA 4K5MA 4EI6B 2Q8BL 1G7MA 3QS2A 2CCLA 5FM5O 5FYLL 4QRTA 3VU1A 5J1SC 2QPSA 4NP4H 4YK4B 5JYMA 1MRDH 5FK9A 4Q6IB 4I48B 3ZBMA 5ADOL 4DP0X 4PVLA 3VMOA 1A1MB 5T3ZE 3CMOL 5FYKD 3ULUE 2IFGA 1M7DA 3VGDA 5I71B 43C9B 2JB6A 1XGQA 2JKNA 2BIQA 4YBQD 3TZVB 2FCBA 1C08A 4A2DA 1E27B 1IZJA 2EKSB 2AABL 1ZLDA 4MB4A 1T7YA 1KIPB 1C1EH 1MFCH 4PWKA 3IEAA 2Z7YA 2N7BA 5EC1A 1ZLSH 3I3BA 4DO4A 3OR6B 3HPLB 3ROOB 3FYEB 5IESL 4O2EA 3EGDB 1N0LA 1P53A 4XVJH 4ZMWA 4AQEA 2WKLA 4K3DH 4X8JA 1VADB 4M6OH 1ITCA 3E9UA 4PLJD 4OQTH 5EO9A 1S9YB 5FHBL 5IR1B 1A4KA 1PW3A 4JGUA 4KRMB 3PNWA 2LW3A 1RJYB 2XQ0A 2HLAB 2LTQC 3GT6A 3QEHA 4YDKL 2Z31C 2J8UE 5GISH 3SDXE 1ZHKB 2HXAA 4BZ1A 4GRLD 1YEIL 3MOBL 2NY7H 3LN9A 4LVOB 1FUNA 2XV3A 4NI6A 4UCFA 5TE4H 2JQAA 2NY6C 2PP7A 2X10A 2ZPKL 3FRUB 1DVFD 4BSVB 3GIZL 4FXTA 4LLVB 4P4RB 4PBVC 1WFJA 3HI6L 2B0SL 3F6LA 3A4DA 3ARZA 4XCCH 4OLZL 3I3DA 4O58H 4K8RH 1TPXC 4KDVA 1FLRL 1BFVL 5TD4A 4GRWE 1KCUH 2J56A 3L2MA 4OV5A 5FCUL 1J5OH 1GZHA 1YY9C 1TT6A 1FVEA 4L3CB 1NLBH 2QADC 1UOVA 4N26A 1CC3A 1QW8A 2HFFA 4P23B 3X3FH 3U7AA 1QKZH 3BSHA 4IK7A 1ID2A 3HN8A 3KPLA 5BOPA 1PLAA 4RGMB 4KOBA 2D9CA 4V11A 2EH8L 2EVHA 2X09A 2H2SD 1TETL 2AEQH 3FBKA 3QEGH 4GSRA 3TJHD 4X7FC 2YD1A 3QRGH 1F86A 3UP6A 3V0AC 1MHPL 2V9UA 3CZUB 1DBMH 4TQEL 5KVFE 4BA8A 3WN6A 2PYFA 1I8IA 4U0QB 3VDCA 1IT9L 1AI1L 2ICEA 2G3XA 3KLAB 1RFDL 4QTHA 3H3BC 4WZ9A 4FMVA 1RHFA 5IOPB 2V5TA 5E24E 1UUNA 2GEQA 1FO0A 2LE9A 4FC3E 4P5KB 1H3VA 5AKSA 2WQSA 2ERJC 1BBDH 2ZYRA 2L04A 4Z9KB 4MXQC 4J4PC 5E9DA 5TQ2H 4EN3D 4DNLA 1OB1A 1EEYA 1SEBB 2OYMA 4H8PA 1O7DC 2VGLM 5FGBC 2YD7A 4NGHH 1YEDB 4JFYB 3BWZA 2B59B 2X4SA 4YUEH 5HVHB 4JAMA 2GW5A 4OW6A 4AQ1C 4UIMA 4DP6X 2HN7A 1DDHA 5CAYB 3BH9B 2J6WA 4G3YL 4LCVA 4YXHL 5IB4A 3JT0A 1UA3A 1IL1B 2NT0A 4OZFA 5H4YA 1ZVSB 3FT0A 1KN4H 4M3KB 4MZIA 5HYJA 4KKBD 4QHMA 2MCAA 3T2QA 4LPWA 1AYRA 1OARL 4JFED 4NQTA 3NJNA 1UOWA 5EZOH 1UA7A 1AH1A 1BGXL 5D1QB 5E56A 5DUJA 1A6ZB 4PJDA 5ADPH 5IFAL 3LS4L 1RZKH 2WC7A 4MJ5A 4OZGE 2ATKB 3IVKB 1TTAA 4KO5A 2WUBH 3U2SB 1CURA 1BJ1H 4MA8L 5ACZB 3BP7B 3IU4H 1QSEB 1HXKA 1KB9J 1P7QB 2E86A 3DOHA 4I0PA 1MKFA 4L1SA 4PW9A 4QJ4B 5DC9B 1RPKA 4MQ7B 2FEDD 4N6QA 4HF5H 2Z9TA 4H25B 3W2DH 4XXDB 4GKSA 1JPSL 1LEKB 3GMPA 3L3OA 4YBLB 4U33A 1PKQB 4O2CA 5I6LA 4XI5C 4ZO7A 4GQQA 2DY2A 4FQXB 3V9FA 3WEXB 4W6WB 1PYWA 4MVBC 1HCYA 4ANVA 4KUCF 2APSA 3V6ZB 4YHOH 5C0IA 1KB5H 1Q9KB 1CDJA 2NNAA 4WU5A 4NNYA 1WCBB 4K55A 5BJTA 4N2HA 4KU1A 4QAWA 3EFFB 5HD8D 5DMIL 5EIIA 1DQQB 1B0GB 4FG2A 4X6DF 5E6IA 1EXHA 3SDYL 4WUUE 3UG3A 3VJ6B 2Y23A 2E3VA 5E4EB 1YEGL 2P28B 4NKDB 5MEOB 4PJGA 2FWOB 1FP5A 2F54B 4JZJB 1XEDA 3V8CA 1MNNA 1IFHL 4HCGA 2YPLE 1L7TL 4BKTC 4XMLL 2XWEA 5BMFL 3RWGB 3IXAB 5F21B 2LU3A 4HCRA 2VR8A 3OKDA 1D6VL 2VSCA 1U4EA 4OV6F 4EBQL 1UKQA 4YNYB 1NCAH 5C09D 1M05A 5HYSG 1SMAA 2G0KA 4LDOB 4QAMB 1J05A 1F4WH 1KBGH 3ECVA 5EBMA 1FA4A 2I9LA 3FMGL 3SKUD 5JHDD 3Q48A 4PJAB 5L88L 2YAMA 2JIXB 3FT3B 3O2WL 4L29A 3ZT5A 4A6YA 1EVTC 1SQ2N 4QHKI 5KYUB 2HFEA 2JSFA 3IDXL 2Z64C 3OTTA 5C08D 5G55A 2G30A 1HCFX 2GSIA 5KVDH 5EIQA 4DW2L 4NNXA 4LLDA 4ONOA 2PW1B 4JPKH 2QL1A 3VQ1C 1YMHA 4BWWA 5EZIH 2QQLH 2PO6A 3RFRA 4OGQC 2ICWJ 1N6QH 1K9TA 1FJ1B 1QG3A 3KDPB 4JFQB 3U2IA 5GJSH 3O9WD 1DBAH 3QUKA 4JHUA 4QF1B 4BCZA 5I8EA 4EQ3A 3QO1B 5CR8A 2H0EA 4MJ4A 2W1NA 2GJJA 3PP4H 2NY1D 2C7FA 4NQDA 1T3FA 2DV6A 3H6AA 4E9SA 4BQCA 1G1OA 4NKIL 1GYCA 2VRQA 4Z0BH 1U93B 4AK1A 1T1ZA 4Y5VC 3LNDA 1J1OL 5ABAA 3GSWB 4IRSC 1QR1A 3S3BB 4DFHA 1HTYA 3IJSB 3CVIL 4POYA 4LSRH 1SBSH 1LWRA 3WOVA 4M7ZC 3IFOB 3LB6C 3KNBA 4K73A 2F53D 2LAGB 5IEHA 1O7DE 3M6DA 1S5IL 4I3SH 2A9BA 3CFMA 1G4MA 3HKFA 4RIRA 3CTTA 3TTYA 5E23A 1QO3B 4M1GH 3RIFF 5HHMD 4AYID 1IAMA 1KLFB 3PL6D 4FZEH 2HT3D 3BZDA 2CXGA 3CFCH 3RJOA 1BF8A 4JVWA 4XBGB 5CJXC 3CN1A 4MASA 4XO4A 3T0DA 1MREL 1FH2A 1B2YA 2VABB 3O0LA 3T1WA 1MAMH 3VFTB 4JY5L 2HRPH 4LP8A 3EJZC 4TQHA 3VFPB 5HPMA 2WP3T 1QSVA 2W65A 3FQNA 3MA9H 2IMMA 4QLRA 2OX5B 1DFXA 1S7QB 4MXVF 3NEOA 1UGNA 4KMTL 3U30C 1I8UA 2Z8SA 4DIXA 3QNYA 2VXQA 1EHLH 2V2WA 2F8OA 1RH8A 2AEPL 4XCYB 1F1DA 1XO8A 4AH2B 2A83A 1GRWA 5DHVB 1W6WA 3AXIA 3NIFE 2WKGA 3BGMB 2WXPA 3PGDA 2WTOA 4GMTH 3AM8A 3DUHA 3RKDD 4QGYA 1BLIA 4NBYB 2UXTA 5TDPB 1DQLH 2EEAA 5GRUL 1T0OA 3MUJA 2ZSVA 5L4IA 5CSGA 3GMLA 4ZXBB 2YO3A 5ELIA 3U1SH 3BE1L 2QVKA 1AR1D 3FN0L 4ODHH 5T3ZL 3HZKB 1KBKA 5FGCB 4E9QA 1MFAL 1RD6A 2RALA 4AYGA 3ULUL 1YYLL 5DJDB 1RZGA 2K1MA 4P2AA 3SKOA 2FB4H 1BD2E 3RA7L 1V7MH 1R5IB 3BZ4A 5AWNL 5J6HB 2Z6FA 4ZX5A 1JXDA 5C0DB 1YJDC 1U3NA 3CLWA 4IRJA 5KZCD 1OE2A 4ABUA 4P2RD 2V2TA 5GS3A 1HH9B 3NGBB 4TSCL 5F6IB 2VLLB 2P46B 2Z31B 3MJ8A 4XO8A 4WFFE 4XP6L 5I16B 1PIGA 2EH7L 1S6NA 1HSAB 4KZDL 3GPEA 5JMOC 1IQDB 5JW4N 5BQ7A 3UJIL 3Q06A 1JS4A 1U8HA 2BINA 4DO6A 3Q2WA 1TPXB 1SYSB 2EECA 4R0LB 3VWKA 2VXVH 3IAQA 5TFSH 2NY4C 3DMMB 4OF8A 1CF1A 2OPCA 4TNVF 3ET9F 2LGNA 3MZTA 3TNMA 3S2AA 4PRIE 1YEEL 4KI5C 4RBPK 4JHAL 3ZK0A 1MDAA 2QADB 3Q8FA 5FHAL 1MCOL 1RIHH 4Z5RA 5I1IH 1NOAA 1D5XB 1GOFA 2IH9A 3ESVF 5IY5B 1UJ3A 1SMOA 1JWSA 2AF2A 4Y4KC 3CFQA 1OAYH 1SZNA 1Q4NX 1VFAA 3BVNA 5CJBA 1OM3H 2WJ7A 5C9KA 4YC2C 1ZANL 4IRZA 4RAVB 4K8RD 4EEEA 4NBXB 2JCCE 3HR6A 4FG6D 2J1YA 3D08A 3FOLB 4LVHC 3VFMA 4DKFH 3QCTL 5AZEL 4HGKC 5IQ7L 1A7BA 1NCNA 5I1JH 3IMWA 2ERJB 4V1DD 5B1BB 2UY6A 5GRVL 1CBVH 1ESOA 1LK2A 3SBRA 1TIUA 1UWEH 4ALAL 2R56H 3CC5A 1U9KA 3JTTB 3MLYH 4QRUA 3F12B 1U92A 3M07A 1IM3A 5CIPA 2HCZX 4KXDA 1ZGLB 3QEQD 3GLEA 2A6KA 5LQBL 2WVUA 4JZNA 4AQ1B 5EOCH 1YUKB 2W59A 4WO4B 2HTLC 4BFGA 3CH1A 3BQUD 2VR6A 1NGYB 2G4GA 4TTDC 2NXYD 1OV8A 3I02B 3G5XA 2OXHB 2EYRB 2WOYA 5F97E 2D7TH 4AEHH 1JZ6A 3UTTA 3UXFA 2FO1A 4NM8H 2K70A 1X7QA 2XN2A 3IKCB 3W3BA 5L2KB 2XXFA 4LHJB 3VRJA 4LHUB 4U4IA 1BX2A 1QBLH 4L9DA 3QUYB 3LKOA 1H3UA 4PJFF 4U1KB 3ZQ9A 5C3LD 1QLEH 4IDLA 4OLUH 1F90H 2BPBA 3K6OA 1WZLA 4KY1H 2F7RA 4I89A 4G8GD 4L4TE 4BFNA 3MLRH 2MNWA 4U1NB 1DBBH 2WGNB 2P42B 3MRDB 2EE6A 4DGUA 3BDYH 2WK2A 2VR9A 2C3XA 3RWDB 5CU5A 2CO1A 2JKXA 2KBGA 2OMNA 1X9RA 2BNRB 1RU9L 3Q5OA 3KS0J 3S5ZA 3VXRE 3WY4A 1BLNA 4OIFA 5I1LA 5F6HI 3OR7B 2Y07H 4WNSA 1T03L 2WXHA 3ARTA 3IYLW 1NIEA 3E6HB 5E00A 3WXVH 2ZJSL 5CD3B 2NLJA 5G5DB 3IBOA 3MCYA 5TDNA 3DHUA 4ZW8A 1F8TL 2W5PA 3MRKA 3EOTH 3SD2A 4ZZFA 3O3UN 5KANG 4D0DB 3WD5L 3N42B 2WXLA 4PYGA 5KVMC 3D18A 1N3NA 2B1HL 2ALWA 1GW6A 4DJMA 1L3NA 4HA1A 5CGYD 3WI9A 1P5UB 3QHFH 1P4UA 3QIBD 4R7NA 3EYFB 3TBVA 1JNNH 4HUUB 2ZUVA 2EDOA 3RIAK 1J8RA 2OQJB 1N8OE 5ANHA 5ESAA 5C07E 4ZMNA 4QRAA 2NCEA 5KYWA 2K4WA 1FYHB 3CX5J 4DEPC 2UXFA 4CKQA 3HMWL 4Z7WF 1RUMH 3AG3B 4L1LA 1JHTB 3EJYC 3IDGB 3A6CH 1AY1H 2AJSH 2ZSWB 3FB8A 3BUYA 2PYEB 2RCSH 2WP3O 1M3JA 3M7OA 3WE6A 1UB5B 2WLIA 2X6MA 2H7WA 3P0YH 2X9XA 4LFHG 2MPVA 3FSOA 5D4IA 5HPOA 5I75C 1U58B 1OP5H 1IAIM 1JZIA 1DE4A 4DUWA 3MRIA 3QQDB 1UWXK 2YUZA 3C8KB 1AZUA 3DX2A 5DK3A 3OZ9L 3P40A 3TBCA 4NQCA 3CXHK 4HAFA 4GQRA 4E9YA 1AKJD 2JXMB 5AALA 3SCMC 2OJZL 1XCQB 3BAYA 3IDJB 3ESOA 4JHVA 5K39A 3ROLA 1W0WA 2VR3A 2UZXA 1UGKA 3DV4A 3GZOA 5HHXL 3WNMA 5K59F 1BQHB 4Q4EA 4B9JA 3B3BA 4Z7QF 2IDUA 4DP8X 2BVOB 5EUOB 3MUY1 4UNUA 2WTPA 3BH8B 5J6GB 4Y5VB 3ATBA 1NWPA 3GSUB 1C7SA 1XB3A 4H8HA 2AKRA 2YEVB 1IE4A 4DUXA 3EDJA 2OP4H 1I9JL 3KPTA 1I9IH 1KN2L 2EDFA 3BVDB 5T1LA 3BKYH 1HZLA 3GFUA 2KZBA 4B5EA 4ETQB 1CMOA 4CW1A 1GIGL 3AFLA 4XVUD 2WJ5A 3EGSB 3M17A 4UT9L 2LR4A 5AEAA 2D3NA 4B3EA 3AT0A 1KLGA 3M86A 4HKZA 1Q0YH 3VW3L 4JO4L 1P7KA 5C0ND 1ET5A 1N0XL 3GXTA 3MV9A 5L4FA 3K8MA 1L7IH 1XIWD 1NOLA 3FTXA 1ASPA 3UIZA 1UM6L 2X1PA 1AXSB 3WHXA 2YJQA 3SJVA 5IHLB 2GPZA 4AQOA 3NJLA 4J2QA 2MSPA 2O6CA 1JG9A 3IMSA 5FO7A 5F9DC 3V5KA 1I1CA 1HN1A 3NIGB 4UTCA 2VDQL 4QJ5B 4X6DE 1UKTA 5ISZE 1JV5A 3THMH 1N68A 4DPCX 1H6FA 1ACYL 4PJIB 5JORA 1JTPA 4MJID 5DJAA 3ZDXB 3GBMH 1XR8A 1H6TA 3VWJA 1SXNA 2FO4A 2Y9RT 4AIZA 4EIUA 2QKIC 3MV7A 4MXWH 4Z7UA 3JVFC 4X6EA 5LJYH 2D03H 3ECBA 5GGVL 4P9HH 3TYGH 2PMZA 4F7PB 4X80L 5F7FA 2AXJA 2P5EE 3T3PB 3VD1A 2Y2TA 4JKMA 1E9QA 2YGPA 3EBIA 4GEJA 2GUOB 4M9PA 4RMVA 3FFDB 4OGXL 5HGHB 5FX3A 4ORGA 2GTZA 1KJVB 1IBGL 4PP2A 3KPRA 1CDIA 5BVPH 4G7YL 4R7VA 1OY3B 5E1AA 2AQNA 3QWQB 4FQJL 4JMXA 4HWEL 4GSDL 3M1CA 3WO3B 1CIDA 3LCYA 2VXUL 4D9RE 4ZNEE 5F6HJ 4W9IC 2WVSA 4D8PA 1F0LA 2HFTA 5IWLC 4X4XA 3F7YB 5DMGC 3OX8A 4XNQB 1NFIA 2F2HA 1I7UB 3GHBH 3SDDA 2P26A 4MCMA 4PJ7B 3EDKA 2OYKA 4GFXA 4JMNA 5AOMA 1JGIA 1IX2A 2VXTL 2Y0SA 5E5MA 2BOCB 3P11H 3RE0A 2DLFL 5L6YL 3MCLH 1P84K 3PWLB 2PXYA 3POCA 3PAUA 4KRPB 1CFSA 1WH0A 3FU7B 4XWGL 5DEZA 1AZCA 2XVKA 4H5SB 3TS8A 4GAGL 4AW7A 5ANMA 5GXBB 1DQTA 3MNWA 3QUXD 4ZQTA 4QYOB 5ID1B 5DTFB 4ZAKA 2YPKA 3NSXA 2YQ3A 3ZJAA 4APQC 4CU8A 5FFOA 1GGIL 5JOFA 4R83A 3VE0B 4OJAA 1GAFH 1OCZB 5D1XC 1DBJL 4PBWD 3MRPB 4K4KA 3U4BH 3GRWH 4WNQA 2OA9A 2EVFA 1LD9B 4LCCA 3QJFB 3TIEA 2WBJD 5ESVA 3ARGD 3OB0H 3QZWA 3RAJL 1R19A 1GTNA 2EXYC 2XTSA 3DRTA 1FRGH 5LKNA 2NY3D 5JIDA 4PRDA 4RFOH 3TFBA 3CZKA 5JNYB 3WIHH 3FCSA 4JKPL 4F58L 3L54A 5D2NA 5BRZA 1G94A 1T5KA 3FUDA 4GBXD 3HE7D 2NY0D 1ZWIB 3LDBB 3WKMH 4IKLA 4JS7A 2ROXA 2PF6A 2B15A 5B38A 1Z5HA 2MHAB 1E2ZA 3LRSA 1YPZB 2IGFL 1MNUH 1N8ZB 4GSQA 5E1QA 5IMMA 4ACTA 1O7VA 3RTQD 1JWMB 5D9SA 4MXVE 5FAAA 1YNTF 3FN3A 3WSQL 4OVVA 4JFPB 4RMTA 1Z0NA 1MFDL 2VDKB 2PP8A 1NA8A 2EYTB 3BUTA 3GMNB 4EVNA 2CBPA 2IJ0C 3QRLA 4BHUA 3NFSL 1GGYA 3GJEA 1YN7B 3WMQA 1U3HD 2D4DA 3FAWA 4WCYL 4NQEB 3BP5B 3T0EA 2APTA 2E46A 1EPFA 1P4BL 1KUMA 2Z65C 5D72H 3UDWC 4O4YH 5CINL 1N2RA 1MWAL 1DUZB 2IALB 1KBPA 4KZCA 4R8WL 1U30A 2E6PA 1T0MA 1DQDH 3DOSA 3QULA 4RQQB 1NCTA 4Z76B 5KSUB 3RL2A 5KANI 5D2LB 2PWGA 5HY9B 2FUQA 1A7PL 5GGTH 2WZPA 1H19A 1P4IL 2K7PA 3FS9A 4HIEB 1CR9L 2R8SL 3WEOA 3IF1B 1GSKA 3GSQB 4NRXB 5C0BA 1KLUB 4WSJA 5I0XA 1NBVH 3IU3B 5GGSY 4G6JL 3T4YA 4URKA 4NO0D 5I17B 5LGJB 4IM8A 4F7MB 4P59H 5DJZA 3QEUA 3K4DA 4NWTH 3ARDB 1CK0H 2PPAA 1CL7H 5F71A 2HVJB 2V7NB 3AS2A 3UACA 5KEZA 1F13A 1OCWH 2Q86A 2IBZY 2X4RA 5T5NG 3KL0A 4DESA 3IJYA 3PPSA 5D7LE 1ET7A 4JR9H 4N0CC 1EO8L 4X50A 1KTLA 1RVFL 2VUYA 3PXLA 3QORD 3AY2A 2CIIA 3QXVA 4XP1L 2PCFB 3SOBH 5KSAC 4ZOBA 4AYFB 4NHUB 1DQJA 4GO6B 1MJ8L 1CTMA 3OGOE 4XTRD 5HJGA 3T4AA 4YHYB 1NMCB 3OKMA 1YSOA 2DQTH 3GC3A 4G8EA 3KPMA 3H9SE 3NH7L 2BNQE 4P9MH 4D3CL 1AGFB 1WFMA 2AV7B 4F2FA 3FF7A 5DEJA 4J1UA 4FNLL 4DEPB 1U3YA 1G6RB 2GHWB 1HZHL 1A4JB 2W07A 4QDGA 4QKTA 4ATTA 4P4KC 2ZWYA 2PABA 1JYVA 3CVHB 4LEXH 3UP1A 3MUHL 5J8OA 1MW0A 4U1MA 5KVGE 4HK0A 2BO0A 5T33L 3IN2A 3LIZL 5IQMA 2WWNA 3DSFL 2BSDA 4B6ZA 5K5YA 3QJQB 3WFDL 1WIUA 2NDGA 2X05A 4ZDHA 4GI9A 4J8RA 3PS6A 4XBEH 3LEVH 3F7LA 3MGOB 1S7RB 2FJHA 3G5VA 3SDCB 2QELA 3HG0A 4LFHD 4E68A 1UB6A 2AV1A 2QFRA 4HQQL 3SGEI 3L5JA 2PCPA 2QPFA 1TVHB 2F5BH 4PJEA 3U6XS 2ZOLA 1FFQA 1FZKB 1Z6JT 1AQKL 1GA2A 5EV7A 1QATA 2OKMA 4YQXL 3WLBB 1E5BA 1SHXA 3P73B 1ZLVK 3V4LA 4XNZB 1OE1A 3HJEA 1TJHH 2OMBA 1QYGH 4IS6A 1O6SB 3BH4A 3DURA 2O5YH 3QDJD 5JA8B 5DD6B 2FNWA 4JJHA 3QUZD 4PJFE 5F9WB 4Y19E 5ALCH 3VFOA 5K9JH 1L9OA 4GXUM 1AZBA 3BVWA 5F96H 5TGBB 3S34H 2EDKA 3H2QA 4OI8A 1KIUA 3BRGC 1INEL 2EXTA 4MNQB 3OPUA 1I8AA 4H0GA 1BM3L 1JPTL 4Y2DA 2R2BB 4M48H 3VD9A 3QIWA 4YDVB 1LK3L 4HK3J 3L1OH 4BSWB 2IANE 1CIUA 3OHMB 5I2IB 5HVWA 1JHLH 3K6NA 4JL2A 4OF3A 2WXQA 3O6FB 5M7QA 3F58L 3RFZC 3S8GB 1JYNA 1SLVA 4QOKA 4ZPVB 2Q6WB 3B3IA 2HX7A 4UTAL 2BHYA 5IMLB 2XDHA 3QJUB 1JGEA 2KHAA 3S5YA 1JHKL 5MENA 2HJLB 1IAOB 4XMPH 4P23D 3LQAH 4N24A 1GGCH 1KC5H 3LKRA 2FIKB 1ETB1 4G5ZH 1RZFL 1J8SA 5FYKU 3L3IB 4NKOB 1W0YT 5IVZA 4LQFL 1EQWA 1ZT7B 3AS0A 1GH7A 4RRPG 3ZZLA 2JB5H 3UTZB 2FQGA 3LN4A 2OMWB 2QKIB 2B7DT 4F7KA 1MCRA 1U8KB 3T5WA 2OR9H 1MCWM 2V3DA 1J1PH 1AD0A 4NSKA 1H6EA 3ILPA 1OOWA 5B8CA 5HYQB 5EF3A 1BQLH 1UM4H 1YMMB 4Z7WE 1Y6KR 3LPFA 4PI2A 3UL4A 3VDAA 1GKOA 3DRQA 4K9EH 2CBMA 4LCWB 3TWCL 3VXME 3KEHA 3FB6A 4EKXA 3ZDYF 3TYFB 4N0UB 2AJVH 3HZ3A 4R9HA 1ECYA 1JXFA 2FBJL 5ACLA 4RWHA 3BDBA 3MNVB 4HGWA 4Y5XC 2DEWX 3LKSA 4LHUG 2VL5B 5IM7B 1QWUA 2CO3A 3HNVL 4AMKH 1P2CA 2Z4QA 3CFEA 5HJBA 1AQ8A 2XLLA 4WHYH 1VESA 1E9PB 2HT4D 3Q8CA 4JLRA 5D1QD 3FKUS 4E9LA 2DPKA 4LPCA 4PIRF 4DKEL 4M1CC 2W95A 5IB3A 5K59E 1XB6A 2X1XR 3FTGB 5E8EA 4Z7QE 4ISVB 4PY7B 5FWQA 3PAYA 1OPGL 1TO4A 1ROWA 2XYBA 5JMRA 1E6OL 2DQHH 5E2WL 3GBEA 1KWKA 1CLOH 3M1BA 3BZFB 5AVYB 4L8DA 4XRCB 1AHWB 2Z93A 5AKRA 4M4PA 2AJZA 4K15A 4U6HA 5SX5K 2P3YA 3RX5A 3H4FA 1PJWA 2XWZA 5JXAL 2TAAA 3G5WA 4FQXD 3UC0L 3VD0A 2XIBA 4OBSA 4JN1H 1OQOA 3ZN6A 1AGBA 3CHPA 4X6FA 4P2QA 4O2FA 4AW4A 1B4JH 1XMEB 4F9LA 1T5XB 3H9HA 5KW9H 5KS9B 2GITA 4X5WA 2QQKH 1PU0A 4N3UA 2YKKA 4CU7A 3I75B 4JUSA 1TZGH 2WZ5A 3CU1A 2Z92B 4L9LA 3DJRA 2WQXA 4P5TA 4XN8A 2JH2A 1TQCC 4R26L 5CGTA 2EIMB 1AAJA 4JPIB 1I4FB 4YO0B 4PRHE 4MCYB 3EJTA 1UCTA 3ABGA 4LT7A 2LQRA 3GTVA 4Y5YC 1X5GA 2ZUQC 4WV1C 2VISB 3GXUB 2VDRL 1PG7X 2Y36H 3LKPB 5T1KA 4YDNA 1X5KA 2DLTA 2J57A 2EZ0C 3GSRA 2NY5H 3P0GB 4KVNL 4S1QL 4W68A 3B2UD 3FRPB 3X13B 4CC4A 2Y5TB 4OUOA 2I7SA 1ZA3B 3O4LD 1TZOA 4PHZA 4ATWA 4DFIA 2QMKA 3EO9L 1MJUL 4NQVA 4FX5A 3SDXA 4ZFFB 1E7VA 2VH5H 5JHMA 1IJNA 2IWGA 2C26A 4FXGB 1A22B 1D5IH 3VXSE 4OZIB 2K8MA 3Q2NA 1SFHA 1IGIL 3JTSB 5DYOB 3U6XA 2QV2A 5K9QG 2G9HA 3QQ3A 4WEBL 2VRAA 3OD3A 2MQ0A 2E7LA 1KGXA 1FDLH 2RH0A 5H35A 5IB2B 5EH1A 1BQHG 1OCRB 1AS8A 4XOBA 4A6YH 5KYYB 4CBZA 3F7PC 1HSBA 4R7DA 5CBAA 1IBDA 1IC5H 1A6WL 2K45A 2KS0A 2JJUA 4AUUA 5K9KB 4Y88A 3EOBA 2HRLA 1O5PA 2ZKWA 3KXFD 4FG0A 4EE2A 1LO3H 1CT8B 1NM9A 4HS3A 1ZTXH 4AE1A 4HIXL 3OF6D 3NPSB 1HINH 4ZYKA 1T7VA 4DHLA 1ERNA 3MLXL 4UIKH 5CD5C 2ED7A 2H1XA 3GJFB 3I2CH 3TM6A 1XT5A 2L7EA 3L8QA 4OAWA 3SHSA 1BQKA 3CJJA 4AI7A 3TO4B 2WGXA 4KTDL 4AXWB 2KQNA 2FT8A 3Q2LA 3C08L 2VQ4A 4U1IB 1T20A 5DK0B 2IH3A 2ZYIA 5BV7H 2F19H 5F89B 5I1DB 5IIEA 3VG9C 1HHKA 4KRLB 2XTJE 1KB9K 1XSJA 4X9GA 5GGRY 3DJZA 3FHEA 3HEIB 5EO1B 3GS7A 1HL8A 4FQCH 3MV8D 4JO1L 3T0BA 2Z1KA 5ITFA 3C6LD 5IQNA 3U1PA 3OVUB 4JJ5B 4AQ8C 1KT2A 1M1XA 5LO7A 2HWZL 1T1WB 3FC8A 2JKTM 3MR9A 3EAKA 5KYXB 4P4KB 3ZYIA 1N7MH 4E9WA 1SQMA 1PG7H 3QIUA 4OZGA 5EU5A 4P57B 4OI7A 1RXLA 4P49A 5TE6L 2WLJA 3FSWA 2IWKA 5EEWA 2UZIH 2CRMA 4H20H 1HFUA 4HIJB 2GJZA 1JPST 2D3LA 4RGOL 5AZ2L 3U0WL 1HL9A 1VFMA 1ZOXA 1F3JA 2WXKA 4XB3A 3ZDZF 4AJ0A 5DJ8B 1BBJB 4LF3B 3VD2A 1ZE3C 3CDZB 2XZCL 2Q0ZX 1OF2A 7PAZA 2VXQH 2VW6A 3GUTA 1VACA 4AZUA 1XF3B 4QTFA 2FQEA 3L3KA 5DO2C 4MJJA 5KVGL 1MI5E 3KHOA 3LZQA 1DTUA 4N25A 3QXDA 5FPIA 4XAKD 2KLSA 5I15L 4B5ZA 4X9IA 4ZXBD 2O93L 2YC1B 4AL8C 3QVAA 3PIQB 3FUIA 1DFBL 4JDEB 5DZPA 1UZ6F 3L3HA 4YHML 2NRDA 4GKNA 3NJKA 1G7QB 5IG7A 4IIQC 1B4LA 1ADQH 1DN2A 1VPOH 4JDTH 4TUKH 4Z8FH 3KD4A 4C8XA 2H6OA 1AZZC 4WUUA 4E9RA 5IW6A 1PX3A 5B1JC 5I0ZA 4RMSA 4YDJA 3WL9B 4JHBA 4QXUL 1HK6A 4ZS6D 35C8L 4M8VA 5C6TL 3G08B 3ZL1A 4F7TA 4MS8D 5AW0B 2GY5A 2JVUA 2CMRL 2D0HA 3M88A 1BZ9B 3HZYA 4EUPH 5INDA 4TUOB 4ZK8A 5F7LB 3FO1A 4U6XA 2VOTA 1AJ7L 5I1AA 2BWDA 1WFIA 4KK5C 3ZTEA 1A7NH 4YXLH 3B2VL 3DMMD 2P52A 5BZDB 3PDOB 2R1YB 2WQRA 3HHRB 2Z1PA 2WQWA 2YGVA 1F58L 1G7HB 4YHIB 1Q90A 3O6KL 4QXTB 4ODSH 4W70A 2MEJB 4PQXA 3II2A 5I1HL 4XNUH 2OCJA 1R5VA 1L9NA 1T2QL 1A1OB 1AXTH 2ZOOA 5SWZB 1AHMA 2Q7AA 3D0AA 3TBWB 4N4YB 4IBVA 1E3XA 1WGOA 5DRZB 4F57L 2AFNA 4P2OC 3TEWA 1TYEB 5DD3H 2DMCA 4I88A 5AOJA 1G5AA 5HXMA 1NPNA 1J5HA 2GJPA 4IGBC 5AVQB 2BSSB 3SIKA 3MRGA 5EOQL 3N44B 1FVDB 3QBTB 4B3VA 4ECNA 1S9VA 4PGDA 3TGXA 3MFFB 1ZHBB 1BVNP 5FUZL 3F6JA 5AOZA 4IRZH 4UT9A 1WA2X 1JP5A 5ES4B 1QTYT 1IBZA 2D3VA 5KWYC 1N4XL 3KYAA 4B96A 3L4TA 5AG8A 1JN6A 4WTZA 3UZEC 1PZ5A 4LSPL 4O02B 5JR1L 3MLSL 3FPXA 4WO4D 1S78D 1M71B 2YSSB 4J4PA 5ERWA 3EGXB 3HNTL 4Z77B 1G9MH 1Z9SB 4N87A 2HMID 2YXFA 3N1FC 2IXQB 3OJ2C 5CIPH 3T1FB 5DS8A 3S96A 5FGBA 4XHQA 4WHTA 5EZPA 5J9PB 4M7JH 3W0WA 5L2KD 2KPWA 1A3LH 4LHUD 4OZHF 3QUYD 4LIQL 1MHCB 2OMVA 1H0DB 4OB5H 5CBEA 1IEBA 3N40F 3TESA 5EC2B 5E9DD 5E8OB 2F18A 4C4KT 3FUEA 5DDHA 1MEXL 3F3HA 1SM3L 1WDAA 1MY7A 1QHQA 1WK0A 5AVWB 3OAWA 5EU3A 3JV6A 5BZZA 1G1KA 3VXUE 2OCCB 2ZKXA 5D1ZC 1QA9A 2A6DB 1IQWL 2NX5B 1S46A 1P9MC 3FB7A 3LKQB 4AT6B 1CXKA 4W9LC 1UT2A 1FFPB 2E7MA 5AVVB 1IGCH 3NAAH 3HFML 1PVHA 3HI5L 4XMZA 1LEGB 1Q1PA 2C3HA 5ICZB 4M03A 4DK6A 1BZDA 4DQOL 4BGLA 4X7TA 2WLYA 4K23H 4KTEH 2M1KA 2AK4B 1Z5LB 1WF5A 1TZHA 4HS8H 2C9SA 4M4RB 3JWNH 3UAJD 1E6JH 1GZQA 3GUFA 3QWRA 1W72L 1KEGL 4FQIH 1J8KA 3BP6B 4B9FA 1G9NH 1M7IA 1KY6A 3DO7B 1Q38A 2GABA 4HU2A 4NZRL 3T65B 1FNSH 2OCFD 1ACZA 4XN9A 4MX7A 2VLRB 2ZT9C 1BZ7A 1KENL 4MLSA 5BOZG 1FGVL 1PFOA 1JIBA 1LTXA 4Y5YB 4WV1B 3AU1A 2VLKA 2P5WB 4OGZA 4KNSA 3X3GL 5K9QI 2MCG1 1BD2A 1ZDSA 4R96B 3GQFA 4LL1A 3QJOA 4FYTA 3HB3C 4DP9X 4HUVB 4AG4H 3A6OA 3OKOB 5EU6B 4UTBH 4GXVL 3T8XA 2VLMD 4QGTA 1EGJL 1VLXA 2ZTBA 4AGLA 1PKOA 2VMFA 3IXTB 3HTLX 2GITB 1EFXA 4ZO6A 3MU3A 1ND0A 3PDGA 3VTMA 1HC1A 1VGKA 1EXUB 1VCBC 4FNSA 1F11A 3EYVA 4XNBA 2DBLL 5DFAA 4RETB 4I1RA 4YHZL 3KPPB 3IDIB 3FO2B 3ZDYE 3I9GL 4NC2B 3D85A 4OLXH 2EDTA 2NY2C 3CH8A 4M29A 5IBTL 3DARA 3REWA 3MRMB 3B8SA 4PRIA 4E2OA 1OO2A 4LPTA 1PLCA 4I8DA 2R4RL 3ALWA 1E2VA 3L2LA 2DWTA 4F5CA 1Z3GL 2IPUG 3CZEA 4CC1A 3GI8H 3TA3C 1QUNA 1K4CB 1YEFL 1DSFL 2GQHA 3FULA 4PJ5A 3K72A 5D4QA 2Q8AL 3VFUA 4PI0A 3WBDA 2RQEA 4YIQA 3ARWA 2J8UB 3CFDA 1IV8A 1QX1A 4WKXA 2EXWC 5GS0C 2IGTA 1TDQA 2LU5A 5E95B 5JOPE 1KPVB 4ZMXA 4Z3EA 3HC0B 4FS0A 1AC6A 3GHPA 5DQ9A 3C5JB 3U79A 2XRAL 3I9AA 3ECUA 1NANI 4IRSA 2JE8A 3GHEH 4PBDA 4HWZA 4UM9B 1GKEA 2PO6D 4UV7L 3VXTA 3I6LD 1FE8H 3FNKA 4WLCA 3I84A 3VG9B 4I5BB 2OL3H 3O41B 5KVDE 1KTDB 1EK3A 4UQAA 4OLYL 2R69H 1MWAA 1H8NA 2IMNA 2X38A 4X5PA 5L0QC 1R3KB 4RNRA 2YMXH 3LY6A 3ZT7A 1AR2A 2X2JA 1M4KA 1TJGH 1ZV9A 3MOAL 4GRMB 2X4QA 1RULL 3RWJB 3U4AA 4RDBA 3FJTA 3L16A 1DZ0A 4NOFA 3KE0A 5KSVB 4G8FB 4TUJB 3WN5C 1XCXA 3NN8A 5EDSA 4C83A 3HAEA 5LAXB 3W57A 5CJXA 1HAWA 2QHLA 5INCB 5C0AB 2G60H 1WSST 2HKAA 2ENJA 2W9DL 2X4OB 4JM4L 4LVNC 1AE6H 3C09C 5IW1B 1YECL 4UINH 4L4VE 1X9QA 4AYBA 2MNJB 4KUZH 2EC9U 2J20A 4L4TA 5HI3D 3QNFA 4UOZA 2WO2B 1A0QH 3UAAA 5JIIA 4N2CA 2CA3A 3ULVF 3ZZ1A 3VFNA 1OP4A 3RWFA 5DHEA 3QFJA 1CFNB 5IQ9A 3D9AL 3S9DB 1IB5A 2I24N 4FP8H 4JHZA 5TH2B 3V4VL 3ZRFC 4UT7H 3N43B 4FQHB 2YEZB 2ZONA 2W0PA 4LARL 1E28A 4HJEA 3CX5K 1QFWM 2HPTA 1NGXA 3QWOA 4R90L 3FO0H 2CJTA 3LVEA 1R3HA 1BIIB 9CGTA 1JWUA 1T6BX 2MCMA 4AZ8A 1W91A 1IMHC 3DTDA 1PLGH 5F1NB 5J0BA 4KJYA 3BC9A 1MCIA 1RZ7L 1X7SA 5E8DL 3TIDA 2VSKB 1OVZA 2KZKA 5MEQA 3ARFA 2OS7A 1TU2A 2IDQA 4EKJA 3LIZA 1K3IA 4KI1A 4KRPD 3HJ0A 3ZHDA 2XC8A 2R7EB 2WUCL 4HV8B 3ZR5A 5I8OL 2DLEA 3VD5A 4JRLA 4C56A 5BXFA 5FYLH 1UOKA 4GKLA 3DX4A 3L9RA 1PJ9A 4ZFOB 1R3JA 4MRCA 5H94A 1F56A 5DUMH 1ZLUH 5F7HA 5ACMA 1MCWW 5JO5A 1MRDL 1CICB 5J12C 32C2B 4LKCA 4L48A 4KKRA 4RGNC 3CMOH 4IYKA 3FUFA 4J3OH 1GJIA 5E1IA 1DJXA 4UQ3A 3CFJA 4IKKA 3NZHL 4IRJD 4ZS7L 4P2OB 2DQEL 4M3HA 3NJXA 1CZ8L 5TDOB 4R7XA 2AABH 2YPLB 2LAAA 3CE1A 4PTTA 3V5DA 4IGBB 1WZKA 3FONA 3MYJA 5HP5A 1OTTD 4K0OA 5DA4A 3TBYB 3FQWB 4A2GA 1KFAL 3ZHKA 1UVQA 1ZAGA 3PWPA 3QZLA 4Y4KA 3FUJA 1JSYA 3PQYE 3MMEA 5IBLC 4JB9L 3P77B 2HG5B 5IESH 3V0VA 5K33A 3KWWA 3LMJH 4PJCA 3FRPG 4QYAA 2QBWA 3SGJC 3KDMA 4B9CA 1QWHA 4LCYA 4NC1C 4XVJL 1YCSA 3WYRA 1ONQB 3G9VA 3ML8A 4Y2OB 4K3DL 5FHBH 4KXZI 3U0PA 4M6OL 2I9TB 5DHXB 2H1PL 2ORBL 2WWOA 4OQTL 2R59A 2HLFD 4YDKH 4XC1H 1HILA 3DHMA 3DV6A 4UTAA 4DEWA 1C5BH 1DUYA 3FSVA 4JFXA 3FQTA 3X11B 2IADA 1AD9A 2X4PB 1OAKL 3DXAA 4QY8A 5GISL 3QHZL 4H13C 5T3XL 3ZDZE 2Q9OA 2VR7A 4NQED 3S6CA 2ZPKH 4BEIA 1Z9PA 3ME0A 2NY7L 1FVCB 1WEJL 5TE4L 3ARBB 1V27A 4NENA 4OLZH 4XNMA 2UWEA 2JKJA 3MROA 4DQAA 4YDMA 4NDMB 4L1HA 2FEEI 2ZNWA 4DOHE 2VLJE 3C60B 3QXAA 5A3IC 4O58L 1USZA 2KDGA 4BRJA 3F7VA 4OD3L 1CYXA 3SKNB 4DH2A 5DJ2B 3K6SB 4ONFL 4LRIC 1UZ6E 3C2SA 3IJEB 3RURA 4R7LA 4B60A 3ARUA 1NZRA 4R6UA 1TR7A 1TETH 3WENA 1L9QA 4XP9L 4X6DA 2YOAA 3OLGA 5ISZA 3TVMB 4YPGB 2IAMC 3RVUD 3OPZL 1P6WA 5KN5A 2YQBA 1IT9H 1AI1H 2FHFA 5D1ZB 1VKXA 1EJ8A 2PCXA 1RFDH 4XXCC 4H8WC 4HZLA 5LGYA 2QR0B 2HRHA 5A2KH 3B2MA 5BRQA 3A22A 1QFPA 3GKWL 2B4CC 4BKLB 1MHEB 1Y0LB 2DMHA 4YGVA 2P5EA 3UTTD 4S10A 3A23A 3ZL4L 3HW7A 5IHHA 3IRZA 3LAFA 2FECL 4MQXC 1QSFB 2X0VA 4HEPG 5HI4D 2K6YA 5CJOL 2DS4A 1NAKL 1LGVA 4IDJL 1ZT4B 5DFVD 1NEUA 4YUEL 3MBWA 4YXHH 3N41F 1DQKA 2PR9A 1JGLL 5HHNB 1KGWA 1RQ5A 3DYMA 3MCG1 3MLZL 1UD6A 4QWWC 4MAYB 4ZNEA 2JJVA 5E8PB 1OARH 2EADA 3GSNB 3QFDA 4BUGA 4NN6C 4AKOA 3IJHB 1AGDA 1WYJA 4UAHA 1FV1A 4Y89A 3KWUA 3RWCB 4Y16C 3CFKB 1EFQA 4L3EE 3GWJA 5EULV 4MA8H 1RZKL 1VF5C 3UYRL 4A7SA 2WTRA 3C2AL 4LEOB 2WUBL 4NAQA 1I1YA 3DX7A 4MNGE 2FBOJ 4KVPA 1TFPA 2XY1A 3EH1A 3IMUA 4JM2B 4NUMA 5CU9A 2CLRA 3T8MA 3L7EA 3UPAA 1HQ4A 3I85A 1QZ1A 3VXNA 5ABZA 4CGUB 2N1KA 3JWOC 2P8MA 5E03A 4HH9A 4UDTA 4HWBH 4JFOB 4PV9A 3WS6C 2EDLA 4I2XB 1EZVY 4G9DB 4JFHD 3VD4A 4Y8AA 4ELDA 3U9UA 4XAWL 3UTPD 4DGIL 4PJ8C 3LPOA 3Q9QA 5DMIH 5DRWB 3PWNA 1F1AA 4KWUA 4P3DB 1Y18A 2X4NA 3EFDH 3GSOA 3MREB 4YAQB 3WNPA 5E70A 4AY0A 4PRPE 4OZHE 3SCMA 1ACXA 5IF0A 2E9IA 3AT8A 1PS3A 5IZ7A 4AV5A 2N01B 1IFHH 2F15A 1L7TH 4PYHA 2XJKA 3G7TA 2VN3A 3UJTL 4NC1E 3E6FB 2J43A 2QHRL 3DC0A 2DMGA 4N5ED 1W15A 3H0TB 2AAVA 4EBQH 1LQBC 4NQCD 3LX9A 2BMKA 4GI8A 4KH9A 3O6FD 1IBBA 2CLZA 2EDBA 5JIPA 3ULVC 4BK8A 1JUFB 2R4SH 1FNLA 1KXTB 5L0QB 1F4WL 1KBGL 2DH2A 3FMGH 4HFWA 5L88H 3O2WH 3ZMNA 4K7PY 1MZYA 1QUNB 3LQMA 3T6ZA 1CUOA 3FU5A 3IDXH 1OXYA 3FTWA 3ARPA 3TONA 1T89C 4W9GC 4YMPA 5CZKA 4DW2H 3QB7C 1JZ3A 1N59B 3B7RL 2JCCB 5KVDL 2GSMB 4FTVE 2X12A 4JPKL 1U8QA 5T1LD 1A6PA 3STZB 4HZ1A 4LNRA 3JZYA 5DZVA 1UZ8A 5EZIL 3PWUB 1TYRA 2QQLL 4JFDE 2EIBA 3AWFA 3C09B 1HQRB 2DTML 1N6QL 2DLGA 2VR5A 4GUPA 5GJSL 3BGFC 1DBAL 3IE4A 1E30A 4OU3A 3KBHE 5E4AA 4A2EA 4PGEA 4R5VA 3ZTJG 3B6SA 4PJXA 4NKIH 1YMMD 3MV9D 1Q72H 4GXUN 3BZEA 4NCDA 4WKZA 4UQ2A 2BCKA 1J1OH 2H47C 1GZPB 1T4KA 5FKPB 4FNPA 3FU9A 4LCWD 3SJVD 5PCYA 3TO2A 4A2HA 2Z7ZA 4X6CF 4XCEB 1H9DA 5JW5A 4PJBA 3EBGA 2CU9A 4OD1L 4ZSOB 1TQVA 5EZJB 1HHGB 3N40P 1V05A 3EYOB 1EUTA 5EEUA 2BSEA 2YUVA 4LSRL 1LP9B 1XTLA 5B3JF 1S5IH 1MFBH 1WWCA 1XZWA 4FFVC 1YY8B 5C0CB 4YSTA 1FN4A 2DYPB 3VI3F 3S48A 2X41A 4RMWA 3MV7D 3WFHB 4YE0A 3CFBA 3FFCB 1LO0H 1TKWB 4Y1AE 1XBRA 2OSYA 4G80B 4DP1X 3LNFA 3RILA 2VB5A 3IDMA 4M1GL 3IPEA 2AVGA 3QRFM 2GAZB 4R4NC 5IWLA 4FZEL 3BP4A 3H9SA 4PJGF 1MREH 2NDFA 3CFCL 5D71H 4CN4A 3RRQA 2ARJA 3U4EB 2BSRA 2B08A 3K8KA 3KHQA 1U8LA 1S7TA 1NEZA 4GKOA 3RJQB 4ELKB 4GP5B 4KTGA 1MAML 2P7TA 4Y8DC 2HRPL 4LKXB 3VXRB 4BFRA 3IMVA 4ORZC 1CLZL 1W9XA 2EEFA 3MA9L 4CC0A 3MO1A 4KMTH 2X6AA 2QTEA 1IVLA 2EDXA 5AVRB 1TXKA 1AQMA 5FKAA 4PGBA 2DWEA 1CTNA 2H32A 4UT6H 3EHBB 4D94A 3V0WL 1PEZA 3NABH 5AFAA 3HE6A 1BMWA 3OAYH 1QQDB 2ZUTA 3FQ2A 3SDDD 1XDTT 4APQA 4PSRA 2BRQA 2Y2WA 4LLAA 4GMTL 3E1F1 1IIIA 4YFEA 1AIFB 5D1XA 1DQLL 4IBWA 1QEWA 5C07B 3ERXA 4EI5B 2BP0A 3BE1H 4GG6B 2EYSA 3FN0H 3JV4B 1PZ3A 4XPTH 4DGYH 2F7IA 3NT0A 3UPRA 1MELA 2DBJA 3K71B 1QBBA 5IKCB 1EMTL 2XX0A 3L3GB 5F88B 1BXXA 2DW5A 2JKLA 3QDGE 4B7LA 2X70B 4YSUA 3I6GB 4PGCA 3RA7H 5AWNH 3ARQA 3T3MF 5HGDB 5C2BL 1EZLA 3JQOB 1Y1UA 2FB4L 1A7RL 4GY4A 4PJFA 1KCLA 5CEXA 1NBQA 4UOW0 4Y19A 1QMUA 3RL1B 3WIFB 1J86A 1SOKA 4WW2C 2C1OA 2ZOTA 4L8SC 4NUJA 4TSCH 3IMBA 1FFOB 4BHUI 4LO9A 2EH7H 5KJ4A 4KZDH 3UJIH 4U3HA 5GS0L 2CE6A 3ULVE 1LO2L 1DBKH 3B56A 2IANA 2P9RA 3MCKB 4G8IA 4N90D 5ENWB 5IK3A 3D30A 4OGAD 5CF3A 1J7VR 5DXWA 4ONGL 1CI3M 5BRZD 4PJHA 2CM5A 3QJVB 3KBPA 5IB1A 4PRAA 3G5YA 1CQYA 2VXVL 3AZUA 4G6KL 4N5UA 5TFSL 1R9FA 4Q7DA 5KUMA 1FNEB 1ZHNA 1HL5A 2DL2A 3LRKA 1MCOH 3P0VH 2HT2D 3RI5K 1WBYB 1VENA 3KJ4C 3TX4A 3Q13A 3UDWA 3ZOAA 2FHBA 2XZQH 2X6CA 1U8PB 3P3SA 1G7PA 3UGEA 4HIHA 4PLNC 3QJTB 5JLZA 1CFQB 1IAII 5LG1A 5JDSB 1ZANH 1J8HB 3BFOA 3DX6B 4YBQC 3QNZA 2WANA 5IHUH 2R39A 3P02A 3QAZB 3CQPA 4HBCL 4I0CC 4ZUTB 3BPNC 3QCTH 4QO1A 5AZEH 4EIGB 2XXCB 1FSKC 3R19A 4DKFL 5E4OA 4MA3A 3V5HA 3ES6A 4B97A 3QUHA 2RJMA 3TO4D 1JNHB 3SYPA 4PRBA 5GSVA 2OJEB 2I32A 4F7EB 5CHNB 1JVLA 1CGTA 3L5HA 4E41A 3SY0A 4PLJC 2YRLA 3KMDA 4WEUD 4N8VA 4H8UA 4OCMC 1W0VA 5EU4A 1NMAL 3WO4B 5EBWB 5GIRB 2Y1YA 4LE8A 1OAUL 2L7QA 2WZPD 2A74C 2KMWA 2AGJL 1PBYA 4G6FD 4GRLC 1K72A 5AOKA 4ENEC 5C0BD 3D4CA 5KSAA 2VAAB 1DVFC 1V55B 4Y16B 4QRRE 1RI8A 3QP3A 2IDFA 4CNIA 2MTPA 4MMXA 5DQJB 1A9BA 1JPFA 1OP5K 3P2TA 5IB5B 3ZHNA 1S4IA 4NQSA 1FGNL 1QLEL 1WBXA 4G59C 2HJKB 5BCAA 1OLLA 4DERA 3CPLB 4KY1L 1L0XA 4XO9A 2A6IA 3SEPA 5CCKL 4S0HA 2Y72A 2OTWA 3LPPA 2GBAA 1T22A 4RLDA 3MLRL 5DEFB 2IOMA 3TJHC 1DBBL 2IH1A 1KGCD 2EILB 4NPYB 1E42A 3BDYL 1W8EA 4UQEA 1RU9H 5K1JA 4CGTA 5IVXB 5LDSA 5DO8A 1W72A 3SKJH 2AJXH 1U42A 1E4JA 2WMPA 3KPSE 4MWFB 1T03H 4FOMA 4N28A 1UQSB 4S1SL 1AZVA 4FEIA 1KNOB 4F8PA 3MVSA 5FW8A 2VDOB 4JDZA 1BG1A 3MRNA 1F8TH 1KG0A 3QJSB 1QRNB 5DEGB 3WXVL 3KCPA 3OHXC 4Z3FA 3WD5H 4RAUB 2BIPA 2Q3XA 3QDAA 4EN3C 2B1HH 4JRYB 5JHBA 4L0YA 2DQDL 1HOEA 3LKNB 1L5GB 1KPRA 3T0AA 3UTSE 4J5VA 4YGAB 5F7DA 2EUWA 3QUML 1JNNL 4J3VA 2ZWZA 1U8JA 3D25A 4MMYA 3HI1A 2C8NA 5HDQH 5K9OA 1EGJA 4CJ1A 1CN4A 2V9RA 1DQVA 1A3RL 3HMWH 3QZBA 2NR6A 1EV2E 4KKBC 1LL1A 3B34A 4MD0A 2IQAB 4Z95L 4N0FB 4F24A 4HLZH 3IMTA 3S36X 4Y4HB 5CS7A 1RUML 4DTGL 2FAUA 3BVUA 2K7QA 3A6CL 4OJEH 1I7TA 2P8LA 5C71A 3K6IA 2CDGB 1R34A 1FI8C 4N2NA 4OR1A 3RFZA 4JZOB 5G4MA 2AK1L 2G4EA 3B1UA 1ZEAH 3PWVB 4JKWA 1RZ8B 4Y4FA 2E59A 2XQYA 3CN3A 1X9UA 1ETA1 3RZWA 2R23B 5DS2A 2OJZH 4HOZA 3LSOB 1U6AL 3WKQA 4ODXA 2KYIA 1AXIB 3BGFB 1T6VN 2CA4A 3LS5L 2VQ1A 3O3EA 4P3CH 3E7JA 1O7SA 1GC1C 4NEHB 1Q9LA 1SLWA 1DN0A 3EFOB 1R0AL 5HD8C 3TBTB 3ZRCC 2CKBB 5I82A 3MGAA 1T66C 1GXEA 4OJFH 1K5NB 5FA3B 4B0MM 5KBLA 1JGVL 4NO2A 5TQ0H 4EMZA 4YSSA 1I9JH 5MEND 2Z8WC 2PPDA 1KN2H 2VW7A 2QVMA 5JXED 1HH6A 3I50L 4X7DC 3WG7B 5FF6B 1GIGH 3BKYL 3BW9A 3PJSA 4IQHA 5DVNA 2EDQA 4H8WL 1GS6X 2Z91B 4QR7A 2WB1A 5C6PB 1FZOB 2R1XB 3D2UB 2B4CL 1N0XH 4TNWK 4CAGA 1Q0YL 1XZ0B 3C75A 4MNHA 2VDPB 2EIJB 2H6PB 1FYTB 3F83A 1XD1A 3C5ZB 3K1KC 1SN2A 2BY2A 3REVA 4KO6A 1L7IL 2FD6H 5H2BA 3NMEA 3NP4A 2ZXGA 4Y5XA 1S7WB 4KKAD 5MP6H 1RV6X 3D39E 4X4ZA 3SPHA 3WNIA 4DF9A 4F15B 2ITCA 1N5AA 2VDQH 5I19L 1A47A 1UFUA 1H15A 4EO5A 4PV8A 1P7HL 2CIKB 1ACYH 2E7CA 5I76A 1NL0H 3LN5B 5J7CC 5JPMC 1U8MA 4KK6D 3THML 2Y7MA 3GBML 4HKXB 4LXFA 4E0RA 4R2GD 2PP9A 4U49A 3P4OB 4Y7MA 1D2OA 4Z3JA 3S36H 2GTWB 3L5WA 1ZVHA 2D03L 4M8QB 4P9HL 4ZUWB 3O9WC 3TYGL 3V4VA 5D7LB 4QHLA 4B9ZA 4J6IA 4CSPA 3AQDA 2OSWA 4E9TA 1NPJA 4W9EC 2NY1C 4BH8B 2XWJB 1YNTA 5DURB 5F8RC 2BZDA 5E9AA 1QVOA 1P5VA 1TVBB 5GZND 4LAQL 3FOMA 3ZSTA 3NJFA 1MI5A 1D7BA 4UZSA 2BNQB 1OHQA 2H8PA 3MLUL 1NCOA 2MH4A 4FQJH 4EDXA 4K9JA 4JKLA 4YHNA 3VFRB 1E4XI 4BQ8A 1AGCB 4M5SA 4F27A 4K3EL 2C1PB 3JWOL 5ICUA 4HPYL 2OMZA 1U8OA 4IU3A 5HYJE 4MRBA 3K3QA 1YUHB 2BVPB 2EKJA 1IEHA 4HX1A 4QRPB 1YDPA 4DKAA 3EZJB 5FDWA 5J13C 3W5NA 4H0LC 3ESPA 3QCVL 3MX0B 2Z4TA 4L8SB 3IS0X 3MA7B 4YR6B 5L6YH 3UABA 4S1RL 2HT3C 2XETA 2OTPA 4MMZA 5EPMA 5T3ZD 3GB7B 3IJ7A 3MCLL 4XWGH 2GUYA 2PUQT 2Y4SA 1R75A 3ULUD 3OKLA 4W4OA 4PJ9B 3VD3A 2ITDA 4TV3A 3E1ZA 2RIKA 2IDSA 2BZCA 4X6CE 5L4MA 4ZUSB 1NQBA 4LGPB 4MDJB 3ULAB 1NGZA 3HNSL 4E5XA 1GGIH 3WCYA 3TBSB 1ZMYA 2W9LA 1O0VA 4FNQA 4KO7A 1I1FA 3KYNA 5G2NA 5B3JE 1Q9WB 2P80A 1GAFL 1NIBA 3ULVL 1BZOA 2WSDA 1B88A 3BPLB 4Z0XB 2UZYB 3CVCA 1ORSB 3RAJH 4N2DA 3VI3E 5I73C 5JA9A 1J5IA 3L3DB 4ZMPA 2CDEB 3KLDA 5DS1A 5AVZB 1P4LB 3R06B 3WUWA 3RKDC 3O45B 1LDPH 1FFNA 3TV3H 1A5FH 1E9OA 1CFTB 2X40A 3NTCH 4Q9RL 3OKKA 4F58H 1UADC 2O61A 3V0EA 1HHIB 1I3RA 1W16A 4RFOL 3VU2A 4PJGE 4M02A 5CLZA 4OQTA 4Z7UF 2MTAA 2FYVA 1AR1C 5FECB 2EJ1A 4U1HA 4QRSB 3VUAA 1UM5H 4KQ4L 1N10A 4LLYB 4LBEA 3ARYA 4RSVA 2ZWKA 1QFWL 3UBXB 2FX9H 4N6RA 5BS0E 1MNUL 3A6BL 2WXGA 3O0RH 4NOBA 5DMKA 3N1QC 3WY3A 1WISA 1D7FA 1FZJA 2DI9A 1OZTG 2V6HA 3NFSH 5BRZE 3NFPA 2Z7UA 4M7KL 3C9NA 4GRLB 2R0ZL 4IKNA 3KLLA 3OXRA 1P4BH 5A2CA 1CPUA 4JE0A 4OTXL 2UYLA 4JDVA 5A2LH 3W9DB 1MWAH 3P30H 2NUTB 4K3GA 5D72L 3CX2A 4O4YL 1Q9OB 1QI5A 1IM9B 1EJOH 2CGRL 3DWTA 3F7KA 2WLLB 3QDME 5IBUB 3W5MA 2YD9A 1OSZA 1ZTXE 3DUUB 4B41A 2XWTB 3F5WB 4Z7WB 2H41A 3LZOA 4NUGL 3CHRA 5F9JB 3CFIC 5BPPA 3HS0A 1P4IH 4LSDA 3T3ME 3HAEH 3KWVA 2XIDA 4PCSA 3VXMB 3ABKB 4H1LA 4NQDE 1CR9H 2C34A 2FJGA 4CADB 1L6PA 1U91A 1D5BB 2XNAA 4BDVB 3DX8A 4KKNA 1BFOA 1IGYB 4F2MB 4WWNA 3BXNA 2OMXA 4Z7OF 1NBVL 4J3OF 4X99A 1JDCA 1JZ5A 1LNUB 3FQYA 4FG6C 4F7TB 4MD5B 1CCZA 4FQ2L 4P59L 3RG1C 4OF0A 2ICWB 1DEEB 3UEQA 4X6BA 3OHXB 1CK0L 1M2VB 1CL7L 2EDJA 3SPIA 3P9LA 1OCWL 1RHHB 5A2BA 1NANH 1EO8H 1RVFH 3LXBA 3GI9L 3FH8A 4XP1H 3KYKL 4GQPH 3MQIA 3BX7C 1K2DB 4BUQA 5JQHC 4P48A 1VFBA 5A16B 4A63A 1MJ8H 1J9RA 2W88A 4R4BA 4Z7QB 2X4UA 2ZXDA 5FO8B 3MUGB 1OM9A 3A67H 3NH7H 3ZW3A 3N9GL 2GK0B 4IIQA 4D3CH 1V3MA 2VDMB 1OGTB 1YLBB 2DQTL 3ARVA 3BQUC 3IAPA 5AENA 2NXYC 5GRXG 4FNLH 3LEYL 1DSWA 3NYKA 4JFZL 4PWJA 2G0LA 1HZHH 2JQZA 3GMRA 1E4KA 1FZMA 4Q58C 2GJ6B 2CR0A 5B1JA 4I1NB 5MEPB 4OQ1A 2QKSA 1G7JA 3FQRB 1JGDB 4TOYH 3EUUA 1BOGA 2H26A 3LIZH 1T5WB 4WWKA 2A9NL 3DSFH 1YJDH 5C0JB 3PRZA 3QK0A 3HR5B 5FYJH 2CJ3A 4MTMA 4ZW6A 1CICD 2NXZD 4XCNB 2ZAHA 4G82A 5FV2A 1JK8A 3AQXA 3D69A 4XBEL 4WUUD 1SLXA 2XFXB 3HLAA 4U1LA 3JTBA 3RDTC 3ZTNH 5A43C 4FQQB 3RHWF 4F91B 3OM3B 4PRHB 4HQQH 1BVZA 3MTRA 2QSCH 4DZBA 3T2OA 3POHA 5IMOA 2P5PA 4KJWD 4ZQKA 2YPLD 1XF2A 1U2CA 5J56B 3KPNB 3ZU8A 1AQKH 1F6AB 4JANA 4F33A 4TNEA 4OZ4A 4X2UA 3ARRA 5KUKA 3TNNB 3DTXA 4CVZA 1OCOB 3ETBJ 3LV3A 3BEWB 4ODWB 5DJ0A 3HG1A 1B0RA 4Z7VB 1I7ZB 3IGAB 5CGYC 2ID5A 1OPOA 3QIBC 4N2EA 5K9JL 1IUZA 1INEH 4LP5A 4MCZA 4G1EA 3S34L 4P06A 4ZTPL 3MXWL 3VXSB 1RJCA 1JPTH 3DVFA 2J8OA 1BOYA 3ARXA 2P49B 2A73A 5J11B 3GGWB 2ADFL 2PNDA 5HDBF 3HRZC 4OLEA 43CAA 3OXSB 1I8KB 2XN9B 3UZEA 3ARBD 3F58H 3U7YH 3ZL2A 3UC2A 4UTAH 4IMLA 4M00A 1EEQA 3C60D 2OMYB 4ODUA 5AD0A 4YZFF 2CALA 1P6FA 2J1KA 2O26U 1JHKH 2Y7SA 2YARA 3DVGB 3MZGB 4RFEB 5JHDB 3ZKXC 5DJCB 1PPIA 1NCJA 5CCGE 1T6WA 4W9ZA 5C08B 4CUCA 1L6XA 4XMPL 4D2NA 2GC7C 4Z78B 4NKMA 3GXIA 1N67A 3RNKB 4LQFH 3W39A 1BP3B 1I75A 2G5RA 1BQSA 2B1OA 1ZLWH 2EVJA 2FSEB 3GMOA 5KSBF 1WAEA 1G7LA 1OGAE 2DWDB 4OD2B 1CE6A 3NZ8A 1HESA 2Y7QB 2MPAH 4QHUA 4ZODA 1S8DA 2NY1B 3RZCA 1IBYA 5MERB 2VJ8A 3AG1B 5SV3A 1UM4L 2AS5M 4ZFQA 4XN4A 2W9EH 1P9MA 2R1WA 3TWCH 3CFUA 1M6OA 4PG2C 4K9EL 1HXYB 1FHNA 1JZEA 4S0TD 4U6VL 4QRBA 2UVFA 5E7BA 1DCEA 2GIMA 3BI9X 5SWSE 3O8XA 3L95A 3V95A 2VITA 4IOIB 2M26A 4U4BA 5D7IB 1AGEB 4YZWA 4XVUC 4MAYD 3BRFA 1LE9B 3RX8A 1JZ4A 2R9HD 3DIVA 4ZBJA 5GGRB 3NIDB 3KPQA 2JFCA 5C0NC 4LOEA 2NCMA 4I18A 1BVNT 5HHMB 5D7JB 2HYMA 5CWSB 1GHFL 1XIWC 5CN1A 5GS1C 1DL7L 3ZGIA 3PL6B 3HPJB 3TH2T 4OKVB 2HLEB 4UV4H 4P5MA 3MLTA 1NUDA 4UDUB 4W9HC 3SE8L 5GHWL 3QWRD 4JM2D 2ZCHL 3F01A 1ZT1B 5E2WH 2PTTA 3Q2VA 2YXVA 4I77L 4AYEC 1NJ9B 1NIFA 1EDQA 1OF0A 2DQHL 4OCSL 1CLOL 3JUZA 5JXAH 3UC0H 3JWNE 1CFVL 1JAEA 1L6ZA 1ODUA 4G8GE 4XN2A 2Z0UA 4M6ML 3KGSA 4X9HA 5DC0A 1PEWA 4U1SA 2XKNB 2HJFB 1IAKA 2XBDA 2R83A 1XGUA 2R15A 1CLVA 2BP8A 4JRXE 5EBLB 3Q6FA 3L4UA 1JZ2A 1GCYA 1GCFA 2MQCA 3ZZQA 5F93C 3ILDA 3VRIB 5SWQA 4XZUB 4Z7AA 4OSUL 1TZGL 4ZJ9A 3ZTDC 1RPQA 3SY6A 1EFXD 1T83C 4WFFD 1L9MA 4JO8A 4F8TA 3BSZL 4KQ0A 3LZFH 2NW2B 3TA3A 3BHBB 2OSLB 4CDHA 2AQPA 3O4OC 2A6JA 1TCRB 3HRPA 3DX9B 1B6UA 2VDRH 4WU7A 5FOBB 3LVTA 3RBGA 1ACCA 1L9TA 4GW4B 5C8JA 4KVNH 4S1QH 4H44C 2XU9A 4PRID 4OCWH 4JHWH 5T1JA 5KZCB 3MRCB 3S5LB 2VYRE 5IFHL 4P2RB 1TQUA 4GLRI 3IDYC 3PHQB 4QMEA 5DC4B 5EORL 3RP1A 2VC2B 3UYOD 3VFSA 1RUPL 3IDNB 1OSEA 3NQKA 2JMRA 4KVCH 3KLQA 4LLWA 5HJDA 2G75B 1UYWH 1H3WM 2YD5A 2H45A 1IGJA 4FG4A 3RGVB 4X4YB 1JNLL 4BFIB 1IGIH 3L4VA 3RYMA 1A9VA 3QUXC 3RPIB 1D5IL 4X7EC 2K9UA 1BF2A 1W6LA 1F6FB 2GSGA 4L8CB 2VLJA 3CCHB 3WNJA 2BY0A 2MKLC 4OH2A 3FSZA 1HHHA 4XH2B 2APXA 1FAIL 4U6YA 2DOCA 3BWAB 4ERSL 1KACB 4RFNC 1KJMB 1A6WH 3CFTA 3DBXA 4FXKC 5L8JB 4BH7A 2WBJC 3ARGC 3DSNA 3QC6X 2FX7L 1JF1A 3IK2A 3V0IA 2FEJA 3W56A 2BY1A 3AQZA 4HIXH 3LB6D 1LO3L 2NY3C 4UM8A 4FI8A 4L37B 1ZTXL 1J0HA 4DVBA 3TP4A 3MLXH 1BHGA 5HHOE 2MRYA 3VNZA 3S3PA 3EG9A 1WUZA 4GBXC 3DROB 4EXKA 1T21B 4FF9A 3HE7C 4B53A 3LNIA 1J9TA 2NY0C 3I2CL 4FMKA 4V1DB 1RP9A 3D0LB 5E2UL 4KTDH 3FK3A 3RNQB 1EVUA 2XWBB 3C08H 3L2NA 2GTQA 1U8CB 2DYPD 3RTQC 3KLSA 2OW6A 1KJ2B 1XCTB 2AJUH 2D7QA 4WW1B 3OMAB 1EA9C 2BSTA 2YN3A 5D96B 4YX2H 4XGZB 2J73A 4OF7A 3NFNA 4L4TD 1CXEA 3BQVA 3CZGA 4YDLC 4GQZA 4WK0B 2F1AA 4JO1H 4QT5A 3RQ3A 4BRVA 3VXOA 1JCKA 2NXYB 2VDNB 1U3HC 3EOYG 3R8BB 4UYQA 3V4PL 5DUBB 2HWZH 1HX0A 3VXUB 5C86A 1JK9A 1BXAA 3MRLB 1TTUA 5BUPA 2HKFH 5E1GA 3H6JA 3ETSA 5AYTA 3PCYA 3SGDI 1Y7VA 4AE0A 3U36B 3VXRD 2CQVA 4YSAA 1EAPA 2VO5A 4J28A 2X2HA 4AOFA 4L3EA 3DVNA 1MG3C 3QG6B 4PAZA 1C5DB 4WDIA 3GK8L 1PG7L 4Z7UE 1J0KA 4K2UH 1HYSD 4GSUA 1NCWL 3BIKA 3L3JB 3RU8L 4AKQA 1SUJA 3EHBD 5AZ2H 3SKMA 3K5RA 1WAAF 2Y24A 4FL4B 4FNTA 1AO7B 4H20L 1ILUA 5F0JB 4J3XA 1XD0A 2ODIA 2XZCH 4UNVA 1ZA6B 1B9KA 5KVGH 4PN6A 3KBEA 1A65A 2PLTA 3PJLA 3HCVA 1I1AB 3EXJA 2VW4A 3KPRE 3ARFD 3WIAA 5I15H 4LASL 1ED3B 1SYVB 3SO3B 1WZ1L 5C07D 4EI5D 4MQTB 1G4RA 1DFBH 1PZAA 5CILL 3QUMA 4JN2B 4RX4A 4KXAA 4YHMH 4L3AA 3WEMA 2L0DA 2XG4B 4R97B 3FUNA 3ZVVA 2BIIA 4PG9A 1EEZA 1NBYB 2YA1A 3WFEL 3MBEA 2EE9A 1ADQL 4PRPA 2NNCA 4JFFA 1VPOL 4IHOB 4JDTL 3QORC 4OZHA 1TQBB 3G5ZA 4OM0L 3Q9PA 4GYBA 2DN7A 5CP7B 4DKTA 4L3FA 1WZAA 2V7HA 1INQB 4XTRC 5CZRA 1CE1H 1FL6A 1S5HB 4QXUH 5DR5H 2AI0L 35C8H 4M93C 5C6TH 1KB5B 1SY6L 4XBPA 5DVPA 2NY4D 3DIFA 2R51A 1WBZA 1PD0A 3IETA 3GDBA 2CMRH 1N12A 9PCYA 2AXFB 4R3SA 1PY4A 3MRBA 5ANME 1ILSA 2BS9A 4QUOA 4MCNA 3DX3A 3VI4B 4EAEA 4Z7OE 4IBLT 2MQGA 4N2BA 3B2VH 1S7VB 4YSPA 1HJBC 4XMVA 1XSIA 2BW5A 4CMMA 3U9PH 1A7NL 2E4TA 4JQXC 4YXLL 2C7UA 3QGVA 4WIQA 1T0NA 2XPGB 3CDFA 1NC4B 4YK4C 1F58H 3ZKXB 2H3NA 2AXGB 2AJ3A 1SXBA 2YD8A 3O6KH 5DU7A 3WTTA 3BAKA 2QJDA 1U4FA 2FYYA 4HDIA 4G7SB 5B7FA 1RJZA 1QRKA 5IJVA 1W2KT 5T5NF 4O9HL 4LNVA 5ESQB 4D0BA 5FFGA 2CRIA 3ZRSA 4LRIA 1ZPUA 3RUGB 2G5BB 5D2NE 6PCYA 1MHHB 3UBXG 2VDLH 1D5MA 2IAMA 2Y6TE 2YD6A 1I8MB 4I4WB 5FUZH 3FCTA 2XXMB 3GO1L 1MCPL 1CGWA 7CGTA 5KG9B 3E8VA 1VERA 1OT2A 3VB8A 1BVLA 2ZX5A 4XXCA 4DZ8B 2OMTB 4KUCD 4HS6B 3WNOA 4TM9A 1NGWA 3QUZC 4P46A 4CJ0A 1HAUA 3IT8D 2D2OA 3UYPB 3SBPA 3APMA 4JPQA 3BEVA 4LSPH 4JCLA 5JR1H 2ZF9A 2Y1AA 3US9A 2M2DA 3HNTH 2DD8L 1BVKB 1A9EB 1D7DA 3O3BA 5F3HB 3OKEA 1IFGA 3PNRB 1YEWA 5L2JA 3L17A 4P8QA 5CMAA 1A6AB 3P1VA 1NFAA 2B39A 1YNLL 5T1MB 3T0EE 2BHZA 3QNXB 2FK9A 3GJFH 2ZXBA 3KPOB 1VGEL 5EA0H 1G5GA 1MUJA 3EJQA 3PV6A 3QQ4A 2J25A 2KT6A 2V3EA 4MD4B 4NO5A 4YE4L 4LIQH 2WYTA 4Y1AA 1C12B 1KCSL 1A3LL 1O5DT 1PDKB 4L4VB 2N56A 4G9FA 4HPHA 5I6MA 1U3ZA 2E6JA 3MSPA 4NS0A 1INDH 2F8VA 3GSVB 1W8NA 5HJ3A 3UGUA 1MEXH 3IE9A 3FT2A 2P24A 4P23C 1IGTB 3HZMA 2ENSA 1IAIH 2EC8A 3GMMB 4G72B 2AQ2A 1CGUA 4LLUB 4M3JA 2CDFB 4MJIB 1A1NA 5IMKA 1AQDA 5FO9B 2VMDA 1AOZA 3CPUA 3RWHB 5HGAB 4HMCA 4D9RD 3HFMH 3HI5H 4CA4A 3HA0A 3SDAA 3HBPA 4DQOH 2F0CA 2A99A 5HDBE 3G6JA 3NRFA 1QRND 1UUSA 3QYCA 3GMQA 3MGTB 1PQZB 1WD8A 2CRYA 2JLPA 4Q2ZA 4BSJA 4X5QA 1KEGH 2F58H 4G11A 3WS6A 1FHGA 4HIIB 3A4FA 4A38A 2M83A 3I6KB 1HL4A 1CU4H 1ETZA 4X7SH 4YZFE 3N50A 3UO1L 2WSKA 1WFUA 1DJGA 1PCSA 4PJ8A 2N7SA 5HVHC 4PP1D 2Z8RA 1FGVH 3I3EA 2OAAA 5D6DC 1FL3B 2ZUSA 3AAZB 2XWRA 5K1VA 5LWYL 4GI6A 2IV9A 2FLMA 3TOPA 2BK8A 3VQLA 1R24B 2CBQA 3MRJB 2WKOF 3QDGA 4RRPM 2XG5B 5D6CA 2IOIA 5IEKA 3D2TA 2WIMA 1EAJA 1Z1WA 1HCZA 4H0HB 1PZ2A 4Y4HD 2HT4C 4ONHA 5D1QC 3BISA 4NQXA 4GXVH 5KSBE 3RWIA 1NC2B 1EGJH 2O6DA 3QR2A 1WICA 1ZGLM 4UTBL 2J2ZA 3S4SA 1LWHA 2CO6A 5I6NA 1GY2A 2DBLH 2FX8H 1HEZA 4CSZA 4OY9A 1LLAA 4YHZH 1SLUA 3EYSL 5DQDL 4HPOL 2ZWSA 2ZWLT 3I9GH 2G2RB 1NIDA 3PAZA 1Q0EA 3OJDB 4LQ1A 4DCQA