4IC5A

Crystal structure of deg5
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
237
structure length
210
Chain Sequence
b'EELEEEEERNVNLFQKTSPSVVYIEAIELEGTGSGFVWDKLGHIVTNYHVIAKLATDQFGLQRCKVSLVDAKGTRFSKEGKIVGLDPDNDLAVLKIETEGRELNPVVLGTSNDLRVGQSCFAIGNPYGYENTLTIGVVSGLGREIPSPNGKSISEAIQTDADINSGNAGGPLLDSYGHTIGVNTATFVNFAIPIDTVVRTVPYLIVYGTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease Do-like 5, chloroplastic
publication title The structures of Arabidopsis Deg5 and Deg8 reveal new insights into HtrA proteases
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 43
structure length 210
sequence length 237
chains with identical sequence B, C
ec nomenclature ec 3.4.21.-:
pdb deposition date 2012-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ic5A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ic5A01
1VCWA 3P6ZB 3MNSA 4R8TB 2KAIB 4JZFH 1FMGA 2CXVA 2GX4A 3MO3A 1UVTH 2BLVA 3TJNA 3ATIA 1MTSA 1PYTC 1Y8TA 2F3CE 4KKDA 2Y6TA 4FU7A 1HAIH 1C2FA 4IMZA 5C20A 2A1DB 1BUIA 4GSOA 1OWDA 4DIIH 4JYUH 4A7IB 1TMBH 1AZZA 4KP0A 2H5DA 2AEIH 1MMJN 3SHCH 2ZDVH 2GMTC 3SNAA 3RXGA 3SU1A 1FJSA 5I25A 1GHYH 1Z8RA 1HAHH 2BDCA 2K1QA 2VIDA 3VFEA 1V2UT 2BY6X 4MPXA 4AG1A 5K7RA 1JIMA 1P3CA 1SR5C 4AN7A 3KIDU 1EB2A 1OYTH 1P04A 4BNRA 1ELDE 1U6QA 1ZRKA 2B0FA 3MNBA 1FN6A 1O30A 4X1RU 1G2MA 2PR3A 3E91A 3GY7A 1IQGA 2F9BH 4UFGH 3DA9B 1HJAC 4LZ1H 2BLQA 2BDAA 1Z7KA 3QTOH 1RGQA 5FXLA 1GBEA 1OXGA 1QURH 1Y59T 1DLKB 4ZHLU 3MNCA 5DP3A 5LGOA 1SHHB 4KELA 4R0IA 1GDUA 2TBSA 1G2LA 1LHCH 3MU5A 3O8CA 2WUBA 1GHVH 4B71A 1YPGH 4Z0KA 1DFPA 1DDJA 4ZXYH 3ZVDA 1GHBF 2TGAA 2VIPA 1J14A 1GI9B 2FLBH 4AB8A 3A7XA 1SQTA 1ZPCA 1WCZA 1TNHA 3NZIA 2Y82A 4AORA 1O2MA 1O32A 2WYJA 4ISNA 1EAUA 4K60A 1TBZH 2XBXA 1O38A 2I6SA 3IWMA 1SGFG 1QBNA 1EPTB 5ABWA 4B2BA 4CRCA 5DGJA 2ODQA 1FIWA 2A2QH 4GLYA 1DX5M 1EQ9A 5DPAA 5J4QA 1K1NA 1C2JA 4OS4A 1W10U 2FEQH 3GY2A 2FS8A 5BPEA 2DUCA 4K8YA 3SGQE 1PPFE 4FUEA 1O2LA 2BVSH 1G32B 2BB4A 2XWBI 2Z9GA 4X0WU 1RXPA 1OOKB 5EOKA 1FLEE 2C8ZB 5E8EH 1VCQA 1FAXA 1WYKA 2FI5E 1LDTT 1W12U 2Q6FA 1UTLM 3RC4A 1BBRH 3SV8A 3TGJE 2Z3EA 2O8UA 4B1TA 2NU2E 2ZFSA 4ABGA 3Q00A 3F1SB 6GCHG 1YLCA 2GZ8A 2BZAA 3I29A 1HAPH 2GDEH 1N8OB 3BTWE 1P10A 1W8BH 1BMMH 1S85A 3T5FH 2EEKA 1THPB 2VB0A 1JRSA 1KYNA 2P94A 2H5CA 3PMBB 4O9VA 2RG3A 2ZG0H 1BRUP 2VVUA 1ANBA 3BSQA 2FP7B 4BOHA 1ETRH 1O31A 1O3EA 2ZU4A 1XUGA 2ODYB 3U1JB 5FPSA 1NRPH 1MKXK 2CN0H 4ABAA 4NA9H 3TK9A 3H5CB 1UTNA 2HRVA 1DE7H 4WJG2 3P92A 3F68H 2ZHEH 1GBCA 2CGAA 1NN6A 2GV7A 3SI4H 3T62A 1C5ZB 1Z6JH 4IC5A 4AFZA 3MFJA 1IQJA 3KCGH 1N6XA 5HGGA 1K1OA 1TGCA 2Z94A 3LGWA 1OWHA 4U30A 1NRNH 3RM2H 1UTPA 4HTCH 1TRMA 1OSSA 1MU8B 3GCHB 3I77A 1QL7A 2BVRH 2HNTE 5DP7A 2H9HA 1ZGVA 1TA6A 3VGCB 4X8SH 5LH8A 5A0BA 4Y0ZE 1GWAA 3D23A 1D3DB 4X6NA 1G3BA 1ESTA 1ANEA 1AVGH 1EOLA 3MH5A 4K5ZA 1FI8A 1TPPA 2VH6A 3SNCA 2C93B 5E0JA 2VWOA 1FPCH 3T27A 1TX6A 4OS2A 5EGMA 3KF2A 1MCVA 5CMXH 1S84A 2PKSB 1FAKH 3KQCA 2ANWA 4FUBA 3OY6U 2OQUA 4INHA 4CBOA 1ETSH 3RC5A 1WQSA 2ZFRH 3ZZ6A 4CRFA 4DVAU 4YESB 1TONA 3TVJB 4UD9H 2VH0A 2GCHG 1GJ5H 2G81E 4XE4A 1V2PT 4GPGA 2D2DA 2UUFB 1P2JA 2XBYA 1MKXH 2EI6A 3KNXA 2WYGA 2A5KA 4ZMAH 3LGYA 3SJ9A 2ZFPH 1GJ4H 2ALPA 1HPGA 4CH8B 4U2WA 2OBQA 2G5NA 1IHTH 2PLXA 1GDQA 1HAXB 4Q2KA 1A1RA 1EPTC 1NFXA 4XOJA 3ATLA 3ZVAA 3LGUA 4CREA 3SUDA 3ATKA 4NA7A 1GHAG 4ESTE 1ELTA 4FUJA 3T29A 1TGTA 3K2UA 3A80A 1LPKB 1ACBE 1FIZA 2ZTXA 1DT2A 1YPLH 5DK1A 3ZVGA 3LH1A 3QTVH 2Y81A 2OC1A 3TH4H 1G36A 2ASUB 1QGFA 4CH2B 1H9HE 3P17H 3V0XA 1AHTH 3EA7A 5I46H 1BTHH 1B0EA 1V2KT 2G52A 2XC0A 1G9IE 4CHAB 1TBRH 1LHFH 1C2EA 2J38A 2RCEA 2FM2A 3MI4A 1GBIA 2ZNKH 4OS5A 3ZZBA 1UVPA 2ZIQH 1C5QA 5TCAA 1Y3YA 2AIQA 1WQVH 1MKWH 1P2KA 3PM3A 1N8OC 1YYY1 3BG4B 3ZZ4A 1ZSJA 3LJOA 1PQ8A 2WPLS 1O2JA 4UDWH 1D9IA 3DFLA 2UUKB 1UCYK 2G55A 1MTUA 1TNIA 4Y11E 3UNRA 3M5MA 1TA2A 1MZAA 3S9BA 4JYVH 3MO9A 3M5NA 1GL0E 1HBTH 1O5EH 4ZXXH 4BAQB 3MU1A 4JMYA 1O2UA 4DURA 1RS0A 3HKJB 1SFIA 3P8NA 4INKA 4WXVA 1G3CA 2CV3A 1UK4A 5IDKA 1W3CA 1TFXA 4NIVA 2C8WB 2ULLA 1NFYA 3GDSA 8ESTE 1FY8E 2C8YB 2R0LA 4LOYH 4NIXA 3A8CA 1ZTLA 1AI8H 5JB9S 4A1VA 3P70B 4IW4E 4A1XA 1A0JA 1AU8A 1BTWA 1GJBB 1ID5H 3A86A 1JOUB 2FLRH 1K1JA 3SU3A 1V2WT 1DUEA 2J92A 5ESTE 1C9TA 3U8RH 3UOUA 2ZGJA 1YM0A 9ESTA 1GVKB 4E05H 2JH0D 5LPEA 3GCHC 2G51A 2QY0B 1GI8B 2ZFQH 3A7TA 4TPYA 3BTHE 1TNLA 1IQEA 1TIOA 3VGCC 2JKHA 1FZZA 3MH6A 2IN2A 4I31A 6LPRA 1AZ8A 1GMDG 1QQUA 2BDBA 4CBNA 1AGJA 2BD5A 1CGIE 2P16A 1DPOA 4IN2A 1KTSB 3URCA 1CSOE 5SGAE 1ELGA 1QL8A 3BN9A 4AFSA 3RU4E 5EPNA 2XBWA 1H1BA 2ZP0H 2UUYA 4IS5A 2XCNA 2PKSC 1INCA 3FVFB 1E35B 1C5OH 1BJVA 1P0SH 2J95A 1KXDA 2QN5T 2STAE 2O8MA 3QLPH 1CHGA 1ELBA 4Y71A 2ZHWH 2Q6GA 3P8GA 2Z3DA 2JH5D 1ZMLA 4UEHH 1T31A 1C5RA 1Y5BT 1E0FD 1LQDB 3KQEA 4GCHG 3S7HB 2WINI 3A84A 1DITH 1KLIH 4AYYB 1ZJKA 3RXLA 1O5FH 4Y6DA 1HAYB 4NCYA 3SQHE 1LKAA 4X1PU 4Q7XA 2ZC9H 4D7FA 1A46H 1ARBA 3QGJA 1FY3A 1BT7A 4LXBH 3KEEA 3SJKA 2HNTC 5PTPA 4RSPA 3G01A 3UNSA 5GCHG 3HGPA 2TPIZ 1IQIA 1ELCA 1TPSA 4X8VH 1ETTH 5HMAA 3WY8A 4DJZB 5E0HA 1PPGE 1GG6B 4WH6A 1JXPA 1BA8B 3F9FA 1MUEB 3ZVEA 2HPPH 1C2DA 1P9UA 2BVXH 1LTOA 1TNJA 3ODFA 3RC6A 3AVZA 2XW9A 3SNDA 3VB3A 4BAKB 2J4IA 2VU8E 3BTEE 2ZFTA 3PMHB 1O3IA 2GGVB 1ZTJA 4AZ2B 3PB1E 3E1XB 1HAVB 3STIA 3A8BA 1O2TA 1OPHB 3NPSA 1O3AA 1TOMH 4CHAC 4Y7AA 3EA9A 1C1MA 1HNEE 1TOCB 7GCHG 3M5OA 2FX6A 3MU8A 5EODA 2Z9IA 5IYTA 1IHSH 3BG4C 2R0KA 1AD8H 1QIXB 4D76A 1HUTH 1SBWA 1QA0A 1WTHD 1DM4B 1YPEH 3KQDA 4YT6H 2O8WA 2A7HA 8GCHG 3AASA 2C8XB 1Y5UT 1V2LT 1AUTC 1IAUA 2B8OH 1GI3A 2QCYA 4DGJA 1P12E 2FDAA 3RXJA 1C5YB 1S6HA 3RMNH 3ZV8A 2DE8A 2CF9H 2OC7A 1P01A 1V2MT 2PUXB 4H4FA 4I33A 4X8UH 2TRMA 1BTYA 3NKKA 1TX7A 5EG4A 3TK5A 1C2KA 1TABE 1DY9A 1GDNA 4OGXA 4YTAA 1O0DH 1Y5AT 3TJUA 1F5RA 5FBEA 3BIVH 2VNTA 2QYIA 1DXWA 1JBUH 4SGAE 2ZDMA 4X2WA 3EQ0H 1RJXB 1FY5A 2ZTYA 1DWCH 5EXMA 4Y79A 4ZHMU 1XUHA 2FOAA 5HXFA 4FUCA 3DHKH 1VITH 1UJ1A 1HJ8A 3M7TA 1EATA 1D4PB 1V2OT 2F9OA 1BRCE 3DT0H 3GISB 1GBTA 1SMFE 1YPMH 4DOQA 3SGBE 1CQQA 5JBCS 4Q7YA 2ZKSA 1V2JT 4E7RG 4WVPE 1GBDA 2OUAA 5A8ZA 3NK8A 1C2LA 3RM0H 1V2TT 3A7WA 2IJOB 3QGNB 2OD3B 3P95A 3M3SA 1GGDB 3SGAE 3ZYEA 2ZF0H 3T2NA 1MBQA 1RTLA 1TQ0B 5F6MA 2A5IA 4F49A 2ZO3H 5JB8S 2B5TB 3PMJA 5E0GA 1NFWA 1GBLA 2W5EA 2D8WA 4WH8A 5FPTA 2XNIA 1DANH 3M37A 1C5LH 1G3DA 3C1KA 4E06H 1MQ5A 2BY8X 5JBTA 3V13A 3CS0A 3KN2A 2A4RA 1SOTA 4UONA 2WUCA 3QN7A 3A8AA 2EC9H 5TCCA 3K6YA 1Q2WA 2BTCE 4U32A 4WXIA 2OC0A 4NGAH 1BBRK 1FDPA 2YOLA 4BTIB 3OY5U 2AGGX 1CT0E 1O3BA 1BTXA 2FOBA 1S5SA 4B73A 1O3CA 3P8OA 3GYMA 1LPGB 1FONA 1A3BH 3JZ2B 4XBDA 3V3MA 1F92A 1YF4A 2NU3E 3STJA 1UTKA 3O8BA 1GJAB 1W14U 1BCUH 1PJPA 1GBAA 1K21H 1F0TA 1C1OA 2GZ9A 2VIVA 1NS3A 4AGKA 1D6RA 1GG6C 5LPRA 3E90B 1IQFA 1LVBA 1SLWB 1Z6EA 1YBWA 1AB9B 3EE0B 3ELAH 5FCRA 1O3FA 5J4SA 2BXUH 5AFZH 1J17T 2SGDE 1RTFB 3TH2H 3ZZAA 1J15A 4ABDA 1LPZB 4B2CA 3PO1B 3UY9A 3S0NA 1C4U2 3BTKE 3LONA 4JZEH 5EQSA 5C67A 1YKTA 3SJOA 1FUJA 3FZDA 1F5KU 1T8LA 2FYQA 4ZH8A 1LQEA 3RXVA 3O8RA 1QJ6B 2PSXA 2H6MA 2BDIA 1BMAA 2B7DH 1TGSZ 1EZQA 1O3PB 5FBIA 1QBVH 1HDTH 1CHOG 2PWXA 2O8TA 1AE8H 2EI8A 3TGKE 4Q7ZA 2O8LA 2VIWA 1A3EH 3Q3KA 4I8KA 3A88A 2KAIA 3TK6A 1CA0B 2Q6DA 3M7QA 4UFFH 4ZKOU 1DSUA 1EZSC 3H7TA 1H9IE 1DICA 1LVMA 2JETB 3ATMA 1WUNH 2STBE 1OX1A 1YPJH 1F0RA 2PW8H 1GPZA 4GUXA 4D9QA 3ZZ7A 3ZZ3A 5C1YA 1AUJA 1HIAB 1MTWA 1XVMA 2V35A 2AFQB 1DVAH 2HWLB 2ALVA 4WMFA 2ZDNA 3QO6A 3TU7H 2GT8A 5B6OA 1BZXE 5GPIB 1TPOA 3UR9A 1EUFA 1TPAE 3SNBA 2EI7A 5L2YH 1X7AC 2FX4A 2ILNA 1NZQH 1L1GA 3A89A 3RXBA 1O2YA 1LKBA 4XSKU 4MDSA 4YOGA 5E2OA 3SN8A 5A8XA 3QX5H 4OGYA 1RTKA 2A45B 3M3VA 1C1NA 1RRKA 4YM9A 3RXTA 3QZRA 1CBWB 1P57B 2BX4A 5DKMA 2XC4A 2OP9A 3GY3A 4UFEH 1C1UH 1OP0A 1CT4E 4NWKA 1IQLA 1AWHB 1THSH 5C1XA 3CP7A 1GGDC 1ORFA 1V2QT 4MPUA 1PPBH 2AMQA 2PGQB 2AERH 3F9GA 4YOIA 1C1PA 1ZHPA 5DG6A 5H4IB 4MNXA 1O2WA 5LPFA 2ZTZA 1AKSB 2PTCE 5F8TA 1TWXB 2VWMA 4CR9A 3QK1A 4RKJB 1E36B 1P03A 3T26A 1WAYB 2AS9A 4AG2A 2R2WU 3E16B 1ZZZA 1GHBG 5EQRA 2FTMA 2PV9B 4B75A 1WV7H 2ZEBA 3IITA 4NIWA 2Z9JA 1F7ZA 4J2YB 4F4OC 2BX3A 1DUAA 1XXFA 2A4QA 5BRRE 1AIXH 1P05A 3LC5A 3Q77A 1KXCA 3M5LA 6ESTA 3NUMA 1DXPA 1BRAA 5T6GA 3BTQE 3HK3B 2AGEX 3TNTA 1B7XB 4CRAA 1EPTA 3ZZ9A 1GMCF 1SGCA 3JZ1B 4SGBE 2Y5HA 2BD3A 2O9QA 2R9PA 1P2MA 3MOCA 1MKWK 2W3IA 1Z1JA 5EXLA 3T28A 3ZYDA 2OQ5A 3SW2B 1L1JA 2BYAX 5HM2A 1E34B 4YOJA 1PPCE 5DO4H 1QFKH 1AB9C 1DOJA 2HGTH 2NU0E 3H7OA 3VXEH 1MBMA 3BTFE 2ZQ2A 1D3PB 3UNQA 1K9OE 1SOZA 1NM6A 3A7YA 3PO1C 3BF6H 4TWYA 4KGAA 4UFDH 1PQ7A 1KTTB 3VEQB 1NESE 4I7YH 1RD3B 5F8XA 4QT8C 3K65B 2ZU1A 4MVNA 1BITA 1O2OA 2A7JA 4DW2U 2OXSA 3GOVB 2OTVA 3ZVCA 2ANMH 2GV6A 1SGFA 2XYAA 2R2MB 1CA8B 4ZKRU 4NSYA 4A1TA 5FHTA 1C1WH 3TLOA 1C4V2 1F0UA 1HIAA 1Z71A 2OCVB 1MZDA 1TAWA 3PTNA 1DSTA 2FI4E 2ZZUH 1ZOMA 1H8IH 2FZZA 1O3LA 4NA8A 1GI6A 4I8LA 3SU6A 3RU4D 3A7VA 4Y8XA 3BTGE 2ANYA 3KHVA 3SU0A 1BMNH 1NRQH 1O3NA 1UK3A 2FESH 5FPYA 1CA0C 1XXDA 3ITIA 2A7CA 4ISIH 1L4ZA 1YCPH 2JETC 1ZYOA 1C5UA 1NT1A 2H2ZA 5EPYA 4CR5A 1OS8A 4FU9A 1ZSLA 3RXRA 1QJ7B 1PPHE 3RP2A 4BTUB 1OWJA 3ODDA 2FOCA 3RXUA 1YC0A 1O5BB 3M61U 1S6FA 3P8FA 4TY7A 1LHDH 3GY6A 1EZUC 2TIOA 3VB5A 5A8YA 2P8OB 1P2OA 1O3HA 1QTFA 4GAWA 4BAOB 3AAVA 1NU7B 1GHXH 2FIRH 1XKBC 1Q3XA 4O3TA 2J34A 3SUGA 1RIWB 1GHWH 2ZGBH 2CF8H 5F8ZA 1BHXF 3TGIE 1WOFA 2XXLA 1OP8A 3M36A 4ZHAA 3RXIA 1JIRA 3GCTF 1CBWC 1O3GA 1TLDA 1ELFA 3RMMH 2CHAB 4RKOB 1IQHA 5GWZA 4ASHA 5FCKA 4M7GA 4DY7B 2AGIX 4FVDA 1O3KA 1EAXA 3MU0A 4WF8A 2P3UB 1K28D 3VB6A 1LHEH 2G8TA 5GJ4B 3SHAH 3L3TA 3PWCA 3DFJA 2XWAA 1OKXA 3RLWH 1GMCG 3PLPA 1TGBA 1C5PA 3R0FA 1THRH 1ELEE 3FP7E 3RXPA 3HK6B 1QBOA 4XFQA 1F5LA 4AOQA 2NWNA 2J9NA 1E38B 2H9TH 1GVLA 2ZDAH 3AW0A 4MPVA 1GI1A 2QC2A 5AFYH 1L0ZA 7ESTE 1P2QA 3ZZCA 4NG9H 3A81A 2QIQA 1DY8A 2ZPRA 1AVXA 3F9EA 4LZ4B 4TYDA 3RXQA 1GJ7B 3PYHA 1C4Y2 1ZLRA 2BOHB 2XRCA 5C1UA 4TY6A 1SLUB 1SGPE 1EAWA 3ESTA 4A6LA 4GHTA 4JYTA 1O3JA 3BEIB 4KTSA 1A0LA 2A31A 2BY5X 4K3JA 1ZPZA 4B76A 4X6MA 2RA3A 2B9LA 4MNVA 4O03A 3SV9A 2ZGHA 1GMHF 1UHBB 3VXFH 3UTUH 2ZHQH 4NIYA 1XUJA 1EXFA 2BHGA 1ABIH 3PV4A 2QXIA 1S81A 3U9AH 2D26C 4ABBA 3MH7A 2AMPA 2P93A 1S0RA 4ABIA 1UTOA 4AFQA 2FOFA 4U01A 2BY7X 2VIQA 4LK4A 4I8JA 4K2YA 1WU1A 1BIOA 3QZQA 4ISHH 1ELAA 1KXEA 3EA8A 3TJOA 1KXFA 1V3XA 3SQEE 1MD8A 5AHGH 5FX5A 3NWUA 4INLA 2XTTB 1BDAA 1BB0B 1C5VA 4ABEA 1LO6A 4Y7BA 1ZGIA 1TGNA 2P3TB 3SNEA 3PWBA 2BQ7B 1KLJH 2QAAA 1FNIA 1SVPA 2WPJS 4E7NA 3AW1A 1GI2A 5JDUB 2BDHA 5HYOA 1SQOA 2GZ7A 1O2IA 2SGPE 2Z3CA 1SGYE 1VZQH 3SORA 1TYNA 2BD9A 1T8MA 1EASA 1E37B 1VCPA 4YZUA 1P09A 2ZGCA 1GBBA 1SHYA 3RXMA 3MNXA 2OINA 2BD2A 4X6PA 2FO9A 2ANKH 5EW1H 1QJ1B 2QF0A 2FS9A 1YPKH 2BMGB 1L2EA 3ENSB 2LNCA 1D6WA 2ZU2A 5G4BA 4Y8YA 2A32A 2OLGA 1F0SA 2ZA5A 5EXNA 2P8OC 3LPRA 3AAUA 1N6YA 4MNWA 3OYPA 2Y5GA 1GI7B 1YPHE 4MTBA 3SUFA 2BDYA 1RIWC 1GI5A 1GBJA 5EQQA 5A0CA 5EW2H 2ZU3A 1O5DH 3E0NB 1CT2E 3S9CA 3BTTE 1SGNE 1XM1A 2GTBA 4HFPB 2CHAC 8KME2 1NTPA 4IBLH 1ZMJA 2J94A 1W2KH 4BXSA 4Y8ZA 1TX8A 1SGRE 2FOGA 2HLCA 1QRWA 1GI4A 1DWEH 4MG3A 3A8DA 3LIWA 1ZHMA 5ETXA 2BY9X 1W0YH 4DT7B 2Y7ZA 1HRTH 2GKVE 3N7OA 3A82A 1L4DA 1C1TA 1K2I1 2RA0A 1C2HA 3L33A 3F9HA 1WSSH 2SGEE 2V6NA 2BZ6H 1SGEE 2BQWB 1J9CH 2W3KA 1XUIA 1BJUA 2VWLA 3OSYA 1UMAH 2YNAA 1HFDA 1GL1A 1M9UA 1O2QA 3E6PH 1V2ST 1IOEA 4B74A 3RXSA 1C5TA 1CU1A 2Y7XA 4NFFA 1ZR0A 1LHGH 1T7CA 4MQAA 3UUZA 2D1JA 2H9EH 3UQVA 4AYVB 2VWNA 3SUEA 2F9UA 1GJDB 1HB0B 4IGDA 2VJ1A 2ZWLH 2V3OH 3TPIZ 5JPMH 1GJ8B 1PPZA 4DIHH 3W94A 3SJ8A 2Z7FE 5C2ZA 1O2SA 1O2ZA 3BIUH 2BM2A 2BDGA 1EZXC 2PKAB 1GVZA 5DJ7A 3E3TA 1ZSKA 3R3GB 4YLQH 1XMNB 2UWLA 1H8DH 2GD4B 1Z8JB 3EGKH 2V3HH 6GCHF 4O3UA 1GBKA 1TNKA 4Z6AH 1WTGH 4BANB 1LMWB 1QCPA 1UCYE 2F9VA 1HAVA 3GY8A 1Q31A 4JCNA 3SBKA 1MTNB 4X1SU 1A61H 1AFEH 4BAMB 1LVYA 1SGIB 1T4VH 2PFEA 1T8NA 2TGPZ 3Q3YA 1UO6A 3K9XB 3RXDA 1S83A 3D65E 2C90B 3C27B 4ISLA 4FUFA 1HXFH 2V0BA 3B23B 3SU5A 1SFQB 3GICB 2ZCLP 1EJAA 2QGRA 1CGJE 1ARCA 1KDQB 2OBOA 1VITF 1Y3WA 1YGCH 4WY3A 2VVCA 5CE1A 2ZQ1A 1OWIA 2W7UA 1CGHA 2A4GA 5CHAB 5A0AE 1C5MD 2Z9KA 5FX6A 1P02A 5HM9A 3FP6E 3TNSA 3ZZ5A 1QY6A 4CRBA 4Q80A 1C9PA 3LU9B 2BQ6B 2ZDLA 3M3TA 4ISOA 3U1IB 1EJMA 1B0FA 2BLWA 1TE0A 1NPMA 4FU8A 1TB6H 1TMTH 1SL3A 4X2XA 1P2NA 2GCTB 1AWFH 4OS6A 2P3FH 2QXJA 5DP5A 3SU4A 1O2XA 3HGNA 4AGJA 2JH6D 1GCTB 2FXRA 1TALA 3U98H 4Y0YE 1PQAA 2G00A 3FAOA 1GJ6A 4KTUA 3GDVA 7LPRA 1TRYA 4FUDA 4K1SA 1GJCB 1K22H 1KXAA 1SQAA 2HNTF 1NU9A 5ESBA 1ZPBA 1OP2A 1OYQA 1XUKA 2GVFA 4IMQA 1NO9H 3V7TA 4J1YA 1SPJA 1P9SA 5C3NA 1EKBB 1YCPM 3KL6A 1ELVA 3SOSA 5GXPA 4IN1A 4H6SB 4K69A 3E0PB 2IOTA 4I8HA 4MNYA 2GCHF 1MD7A 1VJAU 3LC3A 2XBVA 1ZJDA 1NROH 3SV2H 4BTTB 3PLKA 2AH4X 3GDUA 1AQ7A 2ZCHP 1B5GH 4X6OA 3OTJE 1C5WB 2ZGXH 1YLDA 2SNVA 3B8JA 3L6PA 4A5TS 1K1IA 4UE7H 2BOKA 1SGDE 4HZHA 1ABJH 1A5HA 1GBMA 1C2MA 1QRZA 1AMHA 3LGTA 1W7GH 2PKAA 3O8DA 1S0QA 1CVWH 3K6ZA 2FYRA 3ZZDA 1XUFA 1GCDA 1V2NT 3RXAA 4I8GA 2WPHS 3FFGA 1P2IA 2A0QB 2ZDKA 1GHAF 3D62A 3RMLH 3CENA 1T32A 4GHQA 3VB4A 1YPHC 2AYWA 2VGCB 1O2KA 1C1VH 4AFUA 4D9RA 1ZTKA 1FPHH 4NZQA 1K1PA 2M5TA 1J8AA 2R3YA 1O3DA 1PFXC 2SGQE 3W95A 2UWPA 2ZPQA 1SC8U 2H1UA 3ATWA 3IG6B 3SU2A 3RXFA 2Z9LA 1QRXA 2BLOA 1O5AB 2HPQH 3GY5A 3Q76A 3RLYH 1AO5A 3DUXH 1C5SA 2YNBA 3TITA 1A2CH 1TNGA 3FZZA 4OS7A 1SLVB 1UVSH 2ZECA 3GY4A 1MU6B 1OWEA 4H42U 1P11E 1MQ6A 2CMYA 1FQ3A 2FWWA 3T25A 5T6DA 4O97A 1KDQA 1O37A 1VITG 3LKWA 1Y3XA 2SGFE 1EAIA 2QXHA 1ESBA 5JBAS 1C2GA 2W7SA 1FY1A 1AFQB 1YCPK 1MTNC 4Y76A 4TWWA 1GI0A 1P06A 2A2XH 1EOJA 1DWDH 4X2YA 2WPIS 1PYTD 1VJ9U 1WBGB 2F9PA 1QB9A 1O2NA 1SB1H 2IPHA 4FUIA 1QR3E 2CJIA 2FMJA 5DP6A 3TJVA 1KIGH 3S9AA 2F91A 4BAHB 1JRTA 4IC6A 3UFAA 5K0HA 1HAGE 3ZVFA 1HLTH 4ZAEA 3MYWA 3A83A 2RDLA 4X1NU 1T4UH 1W13U 5DP8A 3U8TH 3KQBA 4JZDH 1EX3A 1O3OA 5CHAC 4NZLA 3PROA 1G3EA 1YP9A 2XC5A 1EB1H 1HAOH 1VR1H 4ZROA 3RUOA 1UTMA 2TGTA 1NFUA 3DD2H 4MLFB 5L6NH 1QB1A 2TGDA 2SFAA 2QXGA 4K1EA 4K8BA 3UR6A 4X1QU 1SSXA 4AB9A 3S7KB 1KLTA 2GCTC 2NU4E 1Z8GA 1VGCB 3BEUA 3Q3XA 2FTLE 3BG8A 5F03A 1O2HA 3LH3A 4FUGA 1GCTC 2QV1A 1GMDF 2OC8A 3GCOA 4AX9H 2ESTE 1SG8B 3LT3A 1V2VT 2Z6BD 1O2GH 3SV6A 3UWIA 1QA7A 3NXPA 2PUQH 3UQOA 1C5NH 2F9NA 2F83A 1HYLA 4ABHA 2Q1JA 1IQMA 1UTJA 1LCYA 3CS7A 4JK6A 5C5NA 1BTPA 1BTUA 3A7ZA 3MMGA 2UWOA 1BOQA 3SI3H 3RMOH 1O5CB 1J16A 2PSYA 1IQNA 3BV9B 1DWBH 2ZPSA 1HV7A 2VVVA 1CO7E 1A5GH 1GHZA 1JMOH 1QHRB 2QF3A 1Z8IB 1ANCA 1MCTA 4GCHF 1O34A 1QB6A 2R3UA 4PROA 3QWCH 1W0ZU 1FN8A 3MHWU 1BBRE 1TQ7B 6CHAB 2NU1E 4FUHA 2FOHA 1AY6H 1ESAA 2BXTH 4DG4A 1AKSA 3MO6A 3ZVBA 1D3QB 4FXGH 2AMDA 1NY22 1TBQH 4NSVA 4VGCB 1C2IA 1ZMNA 3FANA 5GCHF 1UVOA 3F6UH 4A92A 1O36A 1XX9A 3D49H 1O2PA 2VGCC 2FODA 4XBCA 3MU4A 1T8OA 5JBBS 1KY9A 3KGPA 1FV9A 4NWLA 3EYDA 4D7GA 4BXWA 1GBHA 3FP8E 1CE5A 3LGVA 1SGQE 3RDZA 5AF9H 4OS1A 1SGTA 5T6FA 3RU4T 2A5AA 1A0HB 3OX7U 5L30H 3ZV9A 2HVXA 2ODPA 5C5OA 1NC6A 1HXEH 4HGCA 1S82A 3I78A 4Y10E 1UTQA 2DE9A 1K1LA 1JWTA 4TPIZ 3LDXH 7GCHF 5A2MH 9LPRA 1AN1E 4WWYA 5DP9A 3S69A 1N1LA 1XKAC 1L1NA 1KXBA 1BRBE 2WV5A 1AFQC 3B9FH 4WMEA 1F2SE 5DP4A 8GCHF 1EP6A 1LVOA 1DLEA 4KTCA 1DS2E 1W11U 1C1QA 3UPEA 2GDDA 1O35A 4ZUHA 1TRNA 1QL9A 3OU0A 3URDA 3UWJH 2C3SA 5L2ZH 4RN6A 2VIOA 2FI3E 1A5IA 1FY4A 3PTBA 2ZI2H 1GJ9B 2VINA 2ZHDA 4H6TA 1MH0A 1HCGA 3SJIA 1IQKA 1Y3UA 4YLUA 3MTYA 4THNH 1A7SA 3M35A 1PPEE 2PGBB 3TH3H 1V2RT 1C1RA 2HALA 2BD8A 2J2UA 5A09A 2C4FH 4K1TA 1UCYH 1SLXB 2GMTB 5EU8A 4XBBA 3A85A 2GP9B 1D3TB 3A87A 1P3EA 1EP5A 2THFB 3PMAB 1NRRH 2EA3A 3EAJA 1HAZB 3BTDE 1VGCC 1C5XB 5GIBA 1Z1IA 2FOMB 2HOBA 2Y80A 4ZKSU 2BD4A 2WPMS 2Y5FA 3GYLB 4JZ1A 1SI5H 2P59A 4B2AA 1O39A 2G5VA 3NCLA 1TMUH 3QDZB 4JK5A 7KMEH 1O33A 1OWKA 3SZNA 2ZHFH 2GT7A 1AE5A 1W7XH 1HJAB 4CRGA 2PTNA 3GCTG 2WPKS 3SO3A 2G4UA 4MPWA 3ZZ8A 3BTME 3HATH 5T3HA 3RXOA 4D8NA 1V6DA 2PHBA 3LGIA 1BTZA 3MWIU 3GCNA 1MTVA 1BMLA 3U69H 2LPRA 5AVDA 3RXKA 1AVWA 3TIUA 1O2VA 1C1SA 6CHAC 3U8OH 3UREA 1UK2A 4I32A 1O5GH 2FOEA 2ZU5A 4VGCC 4ABJA 3UIRA 4DCDA 3RXHA 1ZHRA 1BQYA 2P95A 4CRDA 3PLBA 1GBFA 3QUMP 4YO9A 1MAXA 1UVUH 3RXCA 1BHXB 2I6QA 1XVOA 1NRSH 2SNWA 3M7UA 3LOXA 1Y3VA 1A4WH 3SV7A 2XCFA 2G4TA 4NFEA 3V12A 4JZIA 1KSNA 2UUJB 1MAYA 4YT7H 1H9LB 5GDSH 5JYIA 1HGTH 1P8VC 5E2PA 2ZCKP 1G30B 1EJNA 4FVBA 1HJ9A 1G37A 3RXEA 2SGAA 1H4WA 3VPKA 2WV4A 1ZRBA 1ANDA 3VB7A 3BEFB 2BD7A 5FAHA 2A4OA 3LJJA 4ZKNU 2QA9E 1GMHG 2AIPA 1UHBA 1K1MA 3HPTB 2W26A 1PQ5A 2FPZA 4X8TH 3EDXB 1RFNA 4GVUA 4XDEA 2ZFFH 3HKIB 3MH4A 1O2RA 1QQ4A 3UOPA 8LPRA 4ABFA 1CHOF 1FXYA 1QNJA 4HI3A 4X2VA 4WMDA 3E8LA 1O3MA 5TJXA
chains in the Genus database with same CATH superfamily
5C94A 1VCWA 3P6ZB 3UAIC 3MNSA 4R8TB 2KAIB 4JZFH 1FMGA 2CXVA 2GX4A 3MO3A 1UVTH 2BLVA 4Q4LA 3TJNA 2RFKC 3ATIA 1MTSA 1PYTC 1Y8TA 2F3CE 4KKDA 2Y6TA 4FU7A 1HAIH 1C2FA 4IMZA 5C20A 2A1DB 1BUIA 4GSOA 1OWDA 4DIIH 4JYUH 4A7IB 1TMBH 1AZZA 4KP0A 2H5DA 2AEIH 1MMJN 3SHCH 2ZDVH 2GMTC 3N7DA 3SNAA 3RXGA 3SU1A 1FJSA 5I25A 1GHYH 1Z8RA 1HAHH 2BDCA 2K1QA 2VIDA 3VFEA 1V2UT 2BY6X 5EIYA 4MPXA 4AG1A 5K7RA 1JIMA 1P3CA 1SR5C 3DSOA 4AN7A 3KIDU 1EB2A 1OYTH 1P04A 4BNRA 1ELDE 1U6QA 1ZRKA 2B0FA 3MNBA 1FN6A 1O30A 4X1RU 1G2MA 2PR3A 3E91A 3GY7A 1IQGA 2F9BH 4ZCNA 4UFGH 3DA9B 1HJAC 4LZ1H 2BLQA 3ZIAD 1W0JD 2BDAA 3DSPA 1Z7KA 3QTOH 1RGQA 5FXLA 1GBEA 1OXGA 1QURH 1Y59T 1DLKB 4ZHLU 1EFRD 2IJD1 3MNCA 5DP3A 5LGOA 1SHHB 4KELA 4R0IA 1GDUA 2TBSA 1G2LA 1LHCH 3MU5A 3O8CA 2WUBA 1GHVH 4B71A 1YPGH 4Z0KA 1DFPA 1DDJA 4ZXYH 3ZVDA 1GHBF 2TGAA 2VIPA 1J14A 1GI9B 2FLBH 4AB8A 3A7XA 1SQTA 1ZPCA 1WCZA 1TNHA 3NZIA 2Y82A 4AORA 1O2MA 1O32A 2WYJA 4ISNA 1EAUA 4K60A 3WWFA 1TBZH 2XBXA 3NRLA 1O38A 2I6SA 3IWMA 1SGFG 1QBNA 2RDEA 1EPTB 5ABWA 5KEDA 4B2BA 4CRCA 5DGJA 2ODQA 1FIWA 2A2QH 4GLYA 1DX5M 1EQ9A 5DPAA 1NBMD 5J4QA 1K1NA 1C2JA 4OS4A 1W10U 2FEQH 3GY2A 2FS8A 5BPEA 2DUCA 4K8YA 3SGQE 1PPFE 4FUEA 1O2LA 2BVSH 1G32B 2BB4A 1BMFD 2XWBI 2Z9GA 4X0WU 1RXPA 1OOKB 5EOKA 1FLEE 2C8ZB 5E8EH 1VCQA 1FAXA 1WYKA 2FI5E 1LDTT 1W12U 2Q6FA 1UTLM 3RC4A 1BBRH 3SV8A 3TGJE 2Z3EA 2O8UA 4B1TA 1S6LA 2NU2E 4XRNA 2ZFSA 4ABGA 3Q00A 3F1SB 6GCHG 1YLCA 2GZ8A 2BZAA 2GJGA 3I29A 1HAPH 2GDEH 1N8OB 3BTWE 1P10A 1W8BH 1BMMH 1S85A 2K8IA 2EEKA 3T5FH 1THPB 2VB0A 1JRSA 1KYNA 2P94A 2H5CA 3PMBB 4O9VA 2RG3A 2ZG0H 1BRUP 2VVUA 1ANBA 3BSQA 2FP7B 4BOHA 1ETRH 1O31A 1O3EA 2ZU4A 1XUGA 2ODYB 3U1JB 5FPSA 1NRPH 3MQKC 1MKXK 2CN0H 4ABAA 4NA9H 3TK9A 3H5CB 1UTNA 2HRVA 1DE7H 4WJG2 3P92A 3F68H 2ZHEH 1GBCA 2CGAA 4ASUD 1NN6A 2GV7A 3SI4H 3T62A 1C5ZB 1Z6JH 4IC5A 4AFZA 3MFJA 1IQJA 3KCGH 1N6XA 5HGGA 1K1OA 1TGCA 2Z94A 3LGWA 1OWHA 4U30A 1NRNH 3RM2H 1UTPA 4HTCH 1TRMA 1OSSA 1MU8B 3GCHB 3I77A 1QL7A 2BVRH 2HNTE 5DP7A 2H9HA 3U28C 1ZGVA 1TA6A 3VGCB 4X8SH 5LH8A 5A0BA 4Y0ZE 1GWAA 3D23A 1D3DB 4X6NA 1NBME 2HLDD 5EJLA 1G3BA 1ESTA 1ANEA 1AVGH 1EOLA 3MH5A 4F48B 4K5ZA 1FI8A 1TPPA 2VH6A 3SNCA 4YXWD 2C93B 4FETA 5E0JA 2VWOA 1FPCH 3T27A 1TX6A 4OS2A 5EGMA 3KF2A 1MCVA 4HG6A 5CMXH 1S84A 2PKSB 1FAKH 3KQCA 2ANWA 4FUBA 3OY6U 2OQUA 4INHA 4CBOA 1ETSH 3RC5A 1WQSA 2ZFRH 3ZZ6A 4CRFA 4DVAU 4YESB 1TONA 3TVJB 4UD9H 2VH0A 2GCHG 1GJ5H 2G81E 4XE4A 1V2PT 4GPGA 2D2DA 2UUFB 1P2JA 2XBYA 1MKXH 2EI6A 3KNXA 2WYGA 2A5KA 4ZMAH 3LGYA 3SJ9A 2ZFPH 1GJ4H 2ALPA 1HPGA 4CH8B 2JJ2D 2OBQA 2G5NA 4U2WA 1IHTH 2PLXA 1GDQA 1HAXB 4Q2KA 1A1RA 1EPTC 1NFXA 5T1VA 4XOJA 3ATLA 3ZVAA 3LGUA 2KM0A 4CREA 3SUDA 3ATKA 4NA7A 1GHAG 4ESTE 1ELTA 4TSFD 4FUJA 1E1QD 3T29A 1TGTA 3K2UA 3A80A 1LPKB 1ACBE 1FIZA 2ZTXA 2EQNA 1DT2A 1YPLH 5DK1A 3ZVGA 3LH1A 3QTVH 5B6LA 2Y81A 2OC1A 3TH4H 1G36A 2ASUB 1QGFA 4CH2B 1H9HE 4Z1MD 3P17H 3V0XA 1AHTH 3EA7A 5I46H 1BTHH 1B0EA 1V2KT 2G52A 2XC0A 1G9IE 4CHAB 1TBRH 1LHFH 1C2EA 2J38A 2RCEA 2FM2A 3MI4A 1GBIA 2ZNKH 4OS5A 3ZZBA 1UVPA 2ZIQH 1C5QA 5TCAA 1Y3YA 2AIQA 1WQVH 1MKWH 1P2KA 3PM3A 1N8OC 1YYY1 3BG4B 3ZZ4A 1ZSJA 3LJOA 1PQ8A 1OHHD 2WPLS 1O2JA 4UDWH 1D9IA 3DFLA 2UUKB 1UCYK 2G55A 1MTUA 1TNIA 4Y11E 3UNRA 3M5MA 1TA2A 1MZAA 3S9BA 4JYVH 3MO9A 3M5NA 1GL0E 1HBTH 1O5EH 4ZXXH 4BAQB 3MU1A 4JMYA 1O2UA 1H8HD 4DURA 1RS0A 3HKJB 1SFIA 3P8NA 4INKA 4WXVA 1G3CA 2CV3A 1UK4A 5IDKA 1W3CA 1TFXA 4NIVA 2C8WB 2ULLA 1NFYA 3GDSA 5HIYA 8ESTE 1FY8E 2C8YB 2R0LA 4LOYH 4NIXA 3A8CA 1ZTLA 1AI8H 5JB9S 4A1VA 3P70B 4IW4E 4A1XA 1A0JA 1AU8A 1BTWA 1GJBB 1ID5H 3A86A 1JOUB 2FLRH 1K1JA 3SU3A 3DSGA 1V2WT 1DUEA 2J92A 3FN8A 5ESTE 1C9TA 3U8RH 3UOUA 2ZGJA 1YM0A 9ESTA 1GVKB 4E05H 1W0KD 2JH0D 5LPEA 3GCHC 2G51A 2QY0B 1GI8B 2ZFQH 3A7TA 4TPYA 3BTHE 1TNLA 1IQEA 1TIOA 2QF4A 3VGCC 2JKHA 1FZZA 3MH6A 2IN2A 2LELA 4I31A 6LPRA 1AZ8A 1GMDG 1QQUA 2BDBA 4CBNA 1AGJA 2QE7D 2BD5A 1CGIE 2P16A 1DPOA 4IN2A 1KTSB 3URCA 1CSOE 5SGAE 1ELGA 1QL8A 3BN9A 4AFSA 3RU4E 5EPNA 2XBWA 1H1BA 2ZP0H 2UUYA 4IS5A 2XCNA 2PKSC 1INCA 3FVFB 1E35B 1C5OH 1BJVA 1P0SH 2J95A 1KXDA 2QN5T 2STAE 2O8MA 3QLPH 1CHGA 1ELBA 4Y71A 2ZHWH 2Q6GA 3P8GA 2Z3DA 2JH5D 1ZMLA 4UEHH 1T31A 1C5RA 1Y5BT 1E0FD 1LQDB 3KQEA 2IPQX 4GCHG 3S7HB 2WINI 2J5UA 3A84A 1DITH 1KLIH 3H09A 4AYYB 1ZJKA 3RXLA 1O5FH 4Y6DA 1HAYB 4NCYA 4XD7D 3SQHE 1LKAA 4X1PU 4Q7XA 2ZC9H 4D7FA 1A46H 1ARBA 3QGJA 1FY3A 1BT7A 4LXBH 3KEEA 3SJKA 2HNTC 5PTPA 4RSPA 3G01A 3UNSA 5GCHG 3HGPA 2TPIZ 1IQIA 1ELCA 1TPSA 4X8VH 1ETTH 5HMAA 3WY8A 4DJZB 5E0HA 1PPGE 1GG6B 4WH6A 1JXPA 1BA8B 3F9FA 2J97A 1MUEB 3ZVEA 2KFWA 2HPPH 1C2DA 1P9UA 2BVXH 1LTOA 1TNJA 3ODFA 3RC6A 3AVZA 2XW9A 3SNDA 3VB3A 4BAKB 2J4IA 2VU8E 3BTEE 5C17A 2ZFTA 4I86A 3PMHB 1O3IA 2GGVB 1ZTJA 3WW7A 4AZ2B 3PB1E 3E1XB 1HAVB 3STIA 3A8BA 1O2TA 1OPHB 3NPSA 1O3AA 1TOMH 4CHAC 4Y7AA 3EA9A 5HIZA 1C1MA 1HNEE 1TOCB 1YLNA 7GCHG 3M5OA 2FX6A 3MU8A 5EODA 2Z9IA 5IYTA 1IHSH 3BG4C 2R0KA 1AD8H 1QIXB 4D76A 1HUTH 1SBWA 1QA0A 2WSSD 1WTHD 1DM4B 1YPEH 3KQDA 4YT6H 2O8WA 2A7HA 8GCHG 3AASA 2C8XB 1Y5UT 2KCAA 1V2LT 1AUTC 1IAUA 3OE7D 2B8OH 1GI3A 2QCYA 4DGJA 1P12E 2FDAA 3RXJA 1C5YB 1S6HA 3RMNH 3ZV8A 2DE8A 2CF9H 5C0TA 2OC7A 1P01A 1V2MT 2PUXB 4H4FA 4I33A 3DCLA 4X8UH 2TRMA 1BTYA 3NKKA 1TX7A 5EG4A 3TK5A 1C2KA 1TABE 1DY9A 1GDNA 4OGXA 4YTAA 1O0DH 1Y5AT 3TJUA 1F5RA 5FBEA 3BIVH 2VNTA 2QYIA 1DXWA 1JBUH 4SGAE 2ZDMA 4X2WA 3EQ0H 1RJXB 3F2GA 1FY5A 2ZTYA 1DWCH 5EXMA 4Y79A 4ZHMU 1XUHA 2FOAA 5HXFA 4FUCA 3DHKH 1VITH 1UJ1A 1HJ8A 3M7TA 1EATA 1D4PB 1V2OT 2F9OA 1BRCE 3DT0H 3GISB 1GBTA 1SMFE 1YPMH 4DOQA 3SGBE 1CQQA 5JBCS 4Q7YA 2ZKSA 1V2JT 4E7RG 4WVPE 1GBDA 2OUAA 5A8ZA 3NK8A 1C2LA 3RM0H 1V2TT 3A7WA 2IJOB 3QGNB 2OD3B 3P95A 3M3SA 1GGDB 3SGAE 3ZYEA 2ZF0H 3T2NA 5F53A 1MBQA 1RTLA 1TQ0B 5F6MA 2XOKD 2A5IA 4F49A 2ZO3H 5JB8S 2B5TB 3PMJA 5E0GA 1NFWA 1GBLA 2W5EA 2D8WA 4WH8A 5FPTA 2XNIA 1DANH 3M37A 1C5LH 1G3DA 5GNDA 3C1KA 4E06H 1MQ5A 2BY8X 5JBTA 3V13A 3CS0A 3KN2A 2A4RA 1SOTA 4UONA 2WUCA 3QN7A 3A8AA 2EC9H 5TCCA 3K6YA 1Q2WA 2BTCE 4U32A 4WXIA 2OC0A 4NGAH 1BBRK 1FDPA 2YOLA 4BTIB 3OY5U 2AGGX 1CT0E 1O3BA 1BTXA 2FOBA 1S5SA 4B73A 1O3CA 3OAAD 3GYMA 3P8OA 1LPGB 1FONA 1A3BH 3JZ2B 4XBDA 3V3MA 1F92A 1YF4A 2NU3E 3STJA 1UTKA 3O8BA 1GJAB 1W14U 1BCUH 1PJPA 1GBAA 4RI0A 1K21H 1F0TA 1C1OA 4P00A 2GZ9A 2VIVA 4B6FA 1NS3A 4AGKA 1D6RA 1GG6C 5LPRA 3E90B 1IQFA 1LVBA 1SLWB 1Z6EA 1YBWA 1AB9B 3EE0B 3ELAH 2JJ1D 5FCRA 1O3FA 5J4SA 2BXUH 5AFZH 2LP6A 1J17T 2SGDE 1RTFB 3TH2H 3ZZAA 1J15A 4ABDA 1LPZB 4B2CA 3PO1B 3UY9A 3S0NA 1C4U2 4ACAA 3BTKE 3LONA 4JZEH 5EQSA 5C67A 1YKTA 3SJOA 1FUJA 3FZDA 1F5KU 1T8LA 2FYQA 4ZH8A 1LQEA 3RXVA 3O8RA 1QJ6B 2PSXA 2H6MA 2BDIA 1BMAA 2B7DH 1TGSZ 1EZQA 1O3PB 5FBIA 1QBVH 1HDTH 1CHOG 2PWXA 2O8TA 1AE8H 2EI8A 3TGKE 4Q7ZA 2O8LA 2VIWA 1A3EH 3Q3KA 4I8KA 3A88A 2KAIA 3TK6A 2KCYA 1FX0B 1CA0B 2Q6DA 3M7QA 4UFFH 4ZKOU 1DSUA 1EZSC 3H7TA 1H9IE 1DICA 1LVMA 2JETB 3ATMA 1WUNH 2STBE 1OX1A 1YPJH 1F0RA 2PW8H 1GPZA 4GUXA 2YMSD 4D9QA 3ZZ7A 3ZZ3A 5C1YA 1AUJA 1HIAB 1MTWA 1XVMA 2V35A 1K0HA 2AFQB 1DVAH 2HWLB 2ALVA 4WMFA 2ZDNA 3QO6A 3TU7H 2GT8A 5B6OA 1BZXE 5GPIB 1TPOA 3UR9A 1EUFA 1TPAE 3SNBA 2EI7A 5L2YH 1X7AC 2FX4A 2ILNA 1NZQH 1L1GA 4TT3D 3A89A 3RXBA 1O2YA 1LKBA 4XSKU 4MDSA 4YOGA 5E2OA 3SN8A 5A8XA 3QX5H 4OGYA 1RTKA 2A45B 3M3VA 1C1NA 1RRKA 4YM9A 3RXTA 1H8ED 3QZRA 1CBWB 1P57B 2BX4A 5DKMA 2XC4A 2OP9A 3GY3A 2KCPA 4UFEH 1C1UH 1OP0A 1CT4E 4NWKA 1IQLA 1AWHB 1THSH 5C1XA 3CP7A 1GGDC 1ORFA 1V2QT 4MPUA 1PPBH 2AMQA 2PGQB 4RT1A 2AERH 3F9GA 4YOIA 1C1PA 1ZHPA 5DG6A 5H4IB 4MNXA 1O2WA 5LPFA 4DT4A 2ZTZA 1AKSB 2PTCE 5F8TA 1TWXB 5KGOA 2VWMA 4CR9A 2AHME 3QK1A 4RKJB 1E36B 1P03A 3T26A 1WAYB 2AS9A 4AG2A 2R2WU 3E16B 1ZZZA 1GHBG 5EQRA 1VKYA 2FTMA 2PV9B 4B75A 1WV7H 2ZEBA 3IITA 4NIWA 2Z9JA 1F7ZA 4J2YB 4F4OC 2BX3A 1DUAA 1XXFA 2A4QA 5BRRE 1AIXH 1P05A 3LC5A 3Q77A 1KXCA 3M5LA 6ESTA 3NUMA 1DXPA 1BRAA 4FOUC 5T6GA 3BTQE 3HK3B 2AGEX 3TNTA 1B7XB 4CRAA 1EPTA 3ZZ9A 1GMCF 1SGCA 3JZ1B 4SGBE 2Y5HA 2BD3A 2O9QA 2R9PA 1P2MA 3MOCA 1MKWK 2W3IA 1Z1JA 4RT0A 5EXLA 3T28A 5EJ1A 3ZYDA 2OQ5A 3SW2B 1L1JA 2BYAX 5HM2A 1E34B 4YOJA 1PPCE 5DO4H 1QFKH 1AB9C 1DOJA 2HGTH 2NU0E 3H7OA 3VXEH 1MBMA 3BTFE 2ZQ2A 5CDFE 1D3PB 3UNQA 1K9OE 1SOZA 1NM6A 3F0PA 3A7YA 3PO1C 2KCOA 3BF6H 4TWYA 4KGAA 4UFDH 1PQ7A 1KTTB 3VEQB 1NESE 4I7YH 1RD3B 5F8XA 4QT8C 3K65B 2ZU1A 4MVNA 1BITA 1O2OA 2A7JA 4DW2U 2OXSA 3GOVB 2OTVA 3ZVCA 2ANMH 2GV6A 1SGFA 2XYAA 2R2MB 1CA8B 4ZKRU 4NSYA 2F4LA 4A1TA 5FHTA 1C1WH 3TLOA 1C4V2 1F0UA 1HIAA 1Z71A 2OCVB 1MZDA 1TAWA 3PTNA 1DSTA 2FI4E 2ZZUH 1ZOMA 1H8IH 2FZZA 1O3LA 4NA8A 1GI6A 4I8LA 3SU6A 3RU4D 3A7VA 4Y8XA 3BTGE 2ANYA 2V7QD 3KHVA 3SU0A 1BMNH 1NRQH 1O3NA 1UK3A 2FESH 5FPYA 3SYJA 1CA0C 1XXDA 3ITIA 2A7CA 4ISIH 1L4ZA 1YCPH 2JETC 1ZYOA 1C5UA 3F0OA 1NT1A 2H2ZA 5EPYA 4CR5A 1OS8A 4FU9A 1ZSLA 3RXRA 1QJ7B 1PPHE 3RP2A 4BTUB 1OWJA 3ODDA 2FOCA 3RXUA 1YC0A 2YMSB 1O5BB 3M61U 1S6FA 3P8FA 4TY7A 1LHDH 3GY6A 1EZUC 2K0QA 2TIOA 3VB5A 3GS9A 5A8YA 2P8OB 1P2OA 1O3HA 1QTFA 4GAWA 4BAOB 3AAVA 1NU7B 1GHXH 2FIRH 1XKBC 1Q3XA 4O3TA 2J34A 3SUGA 1RIWB 1GHWH 2ZGBH 4M9FA 2CF8H 5F8ZA 1BHXF 3TGIE 1WOFA 2XXLA 1OP8A 3M36A 4ZHAA 3RXIA 2M2AA 1JIRA 3GCTF 1CBWC 1O3GA 1TLDA 1ELFA 3RMMH 2CHAB 4RKOB 1IQHA 5GWZA 4ASHA 5FCKA 4M7GA 4DY7B 2AGIX 4FVDA 1O3KA 1EAXA 3MU0A 4WF8A 2P3UB 1K28D 3VB6A 1LHEH 2G8TA 5GJ4B 3SHAH 3L3TA 3PWCA 3DFJA 2XWAA 1OKXA 3RLWH 1GMCG 3PLPA 1TGBA 1C5PA 3R0FA 1THRH 1ELEE 3FP7E 3RXPA 3HK6B 1QBOA 4XFQA 1F5LA 2KX4A 4AOQA 2NWNA 2J9NA 1E38B 2H9TH 2QF5A 1GVLA 2ZDAH 3AW0A 4MPVA 1GI1A 2QC2A 5AFYH 1L0ZA 7ESTE 1P2QA 3ZZCA 4NG9H 3A81A 2QIQA 1DY8A 2ZPRA 1AVXA 3F9EA 4LZ4B 4TYDA 3RXQA 1GJ7B 5FL7D 3PYHA 1C4Y2 1ZLRA 2BOHB 2XRCA 5C1UA 4TY6A 1SLUB 1SGPE 1EAWA 3ESTA 4A6LA 4AC9A 4GHTA 4JYTA 1O3JA 3BEIB 4KTSA 1A0LA 2A31A 2BY5X 4K3JA 1ZPZA 4B76A 4X6MA 2RA3A 2B9LA 4MNVA 4O03A 3SV9A 2ZGHA 1GMHF 1UHBB 3VXFH 3UTUH 2ZHQH 4NIYA 1XUJA 1EXFA 2BHGA 1ABIH 3PV4A 2QXIA 1S81A 3U9AH 3KYGA 2D26C 4ABBA 3MH7A 2AMPA 2P93A 1S0RA 4ABIA 1UTOA 4AFQA 2FOFA 4U01A 2BY7X 2VIQA 4LK4A 4I8JA 4K2YA 1WU1A 1BIOA 3QZQA 4ISHH 1ELAA 1KXEA 2W6ID 3EA8A 3TJOA 1KXFA 1V3XA 3SQEE 1MD8A 5AHGH 5FX5A 3NWUA 4INLA 2XTTB 1BDAA 1BB0B 1C5VA 4ABEA 1LO6A 4Y7BA 1ZGIA 1TGNA 2P3TB 3SNEA 3PWBA 2BQ7B 1KLJH 2QAAA 1FNIA 1SVPA 2WPJS 4E7NA 3AW1A 1GI2A 5JDUB 2BDHA 5HYOA 3FOAA 1SQOA 2GZ7A 1O2IA 2SGPE 2Z3CA 1SGYE 1VZQH 4ACBA 3SORA 1TYNA 2BD9A 1T8MA 1EASA 1E37B 1VCPA 4YZUA 1P09A 2ZGCA 1GBBA 1SHYA 3RXMA 3MNXA 3FKSD 2F43B 2OINA 2BD2A 4X6PA 2FO9A 2ANKH 5EW1H 1QJ1B 2QF0A 2FS9A 1YPKH 2BMGB 2YMSC 1L2EA 3ENSB 2LNCA 1D6WA 2ZU2A 5G4BA 4Y8YA 2A32A 2OLGA 1F0SA 2ZA5A 5EXNA 2P8OC 3LPRA 3AAUA 1N6YA 4MNWA 3OYPA 2Y5GA 1GI7B 1YPHE 4MTBA 3SUFA 2BDYA 1RIWC 1GI5A 1GBJA 5EQQA 5A0CA 5EW2H 2ZU3A 1O5DH 3E0NB 1CT2E 3S9CA 3BTTE 1SGNE 1XM1A 2GTBA 4HFPB 2CHAC 8KME2 1NTPA 5KECA 4IBLH 1COWD 1ZMJA 2J94A 1W2KH 4BXSA 4Y8ZA 1TX8A 1SGRE 2FOGA 2HLCA 1QRWA 1GI4A 1DWEH 1SKYE 4MG3A 3A8DA 3LIWA 1ZHMA 5ETXA 2BY9X 1W0YH 4DT7B 2Y7ZA 1HRTH 2GKVE 3N7OA 3A82A 1L4DA 1C1TA 3PV2A 1K2I1 2RA0A 2KZ4A 1C2HA 3L33A 3F9HA 3UB0A 1WSSH 2SGEE 2V6NA 2BZ6H 1SGEE 2BQWB 1J9CH 2W3KA 1XUIA 1BJUA 2VWLA 3OSYA 1UMAH 2YNAA 1HFDA 1GL1A 1M9UA 1O2QA 3E6PH 1V2ST 1IOEA 4B74A 3RXSA 1C5TA 1CU1A 2Y7XA 4NFFA 1ZR0A 1LHGH 1T7CA 4MQAA 3UUZA 2D1JA 2H9EH 3UQVA 4AYVB 2VWNA 3SUEA 2F9UA 5IK2D 1GJDB 1HB0B 4IGDA 2VJ1A 2ZWLH 2V3OH 3TPIZ 5JPMH 1GJ8B 1PPZA 4DIHH 3W94A 3SJ8A 2Z7FE 5C2ZA 1O2SA 1O2ZA 3BIUH 2BM2A 2BDGA 1EZXC 2PKAB 1E1RD 1GVZA 5DJ7A 3E3TA 3KQ5A 1ZSKA 3R3GB 4YLQH 1XMNB 2UWLA 1H8DH 2GD4B 1Z8JB 3EGKH 2V3HH 6GCHF 4O3UA 1GBKA 1TNKA 4Z6AH 1WTGH 4BANB 1LMWB 1QCPA 1UCYE 2F9VA 1HAVA 3KYFA 3GY8A 1Q31A 4JCNA 3SBKA 1MTNB 1YWUA 4X1SU 1SQRA 1A61H 1AFEH 4BAMB 1LVYA 3OEED 1SGIB 1T4VH 2PFEA 3N99A 1T8NA 2TGPZ 3Q3YA 1UO6A 3K9XB 3RXDA 1S83A 3D65E 2C90B 3C27B 4ISLA 4FUFA 1HXFH 2V0BA 3B23B 5CHBA 3SU5A 1SFQB 3GICB 2ZCLP 1EJAA 2QGRA 1CGJE 1ARCA 1KDQB 2OBOA 1VITF 1Y3WA 1YGCH 4WY3A 2VVCA 5CE1A 2ZQ1A 1OWIA 2W7UA 1CGHA 2A4GA 3N7EA 5CHAB 5A0AE 1C5MD 2Z9KA 5FX6A 1P02A 5HM9A 3FP6E 3TNSA 3ZZ5A 1QY6A 4CRBA 4Q80A 1C9PA 3LU9B 3OFND 2BQ6B 2ZDLA 3M3TA 4ISOA 3U1IB 1EJMA 1B0FA 2BLWA 1TE0A 1NPMA 4FU8A 1TB6H 1TMTH 3F2FA 3SZEA 1SL3A 4X2XA 1P2NA 2GCTB 1AWFH 4OS6A 2P3FH 2QXJA 5DP5A 3SU4A 1O2XA 3HGNA 2EY4C 4AGJA 2JH6D 1GCTB 2FXRA 1TALA 3U98H 4Y0YE 1PQAA 2G00A 3FAOA 1GJ6A 4KTUA 1MABB 3GDVA 7LPRA 1TRYA 4FUDA 4K1SA 1GJCB 1K22H 1KXAA 1SQAA 2HNTF 1NU9A 5ESBA 1ZPBA 1OP2A 1OYQA 1XUKA 2GVFA 4IMQA 1NO9H 3V7TA 5HKKD 4J1YA 1SPJA 1P9SA 5C3NA 1EKBB 1YCPM 3KL6A 1ELVA 3SOSA 5GXPA 4IN1A 4H6SB 4P02A 4K69A 3E0PB 2IOTA 4I8HA 4MNYA 2GCHF 1MD7A 1VJAU 3LC3A 2WZQA 2XBVA 1ZJDA 1NROH 3SV2H 4BTTB 3PLKA 2J98B 2AH4X 3GDUA 1AQ7A 2ZCHP 1B5GH 4X6OA 3OTJE 1C5WB 2V3MA 2ZGXH 1YLDA 2SNVA 3B8JA 3L6PA 4A5TS 1K1IA 4UE7H 2BOKA 1SGDE 4HZHA 1ABJH 1A5HA 1GBMA 1C2MA 1QRZA 1AMHA 3LGTA 1W7GH 2PKAA 3O8DA 1S0QA 1CVWH 3K6ZA 2FYRA 3ZZDA 1XUFA 1GCDA 1V2NT 3RXAA 4I8GA 2WPHS 3FFGA 1P2IA 2A0QB 2ZDKA 1GHAF 3D62A 3RMLH 3CENA 1T32A 4GHQA 3VB4A 1YPHC 2AYWA 2VGCB 1O2KA 1C1VH 4AFUA 4D9RA 1ZTKA 1FPHH 4NZQA 1QZ8A 1K1PA 2M5TA 1J8AA 2R3YA 1O3DA 1PFXC 2SGQE 3W95A 2UWPA 2ZPQA 1SC8U 2H1UA 3ATWA 3PRDA 3IG6B 3SU2A 3RXFA 2Z9LA 1QRXA 2BLOA 1O5AB 2HPQH 3GY5A 3Q76A 3RLYH 4B6EA 1AO5A 3DUXH 1C5SA 2YNBA 3TITA 1A2CH 1TNGA 3FZZA 4OS7A 1SLVB 1UVSH 2ZECA 3GY4A 2OK5A 1MU6B 1OWEA 4H42U 1P11E 1MQ6A 2CMYA 1FQ3A 2FWWA 3T25A 5T6DA 4O97A 1KDQA 1O37A 1VITG 3LKWA 1Y3XA 2SGFE 1EAIA 2QXHA 1ESBA 5JBAS 1C2GA 2W7SA 1FY1A 1AFQB 1YCPK 1MTNC 4Y76A 4TWWA 1GI0A 1P06A 2A2XH 1EOJA 1DWDH 2JDID 4X2YA 2WPIS 1PYTD 1VJ9U 1WBGB 2F9PA 1QB9A 1O2NA 1SB1H 2IPHA 4FUIA 1QR3E 2CJIA 2FMJA 5DP6A 3TJVA 1KIGH 3S9AA 5DN6D 2F91A 4BAHB 1JRTA 4IC6A 3UFAA 5K0HA 1HAGE 3PRBA 3ZVFA 1HLTH 4ZAEA 3MYWA 3A83A 2RDLA 4X1NU 1T4UH 1W13U 5DP8A 3U8TH 3VG8A 3KQBA 4JZDH 1EX3A 1O3OA 5CHAC 4NZLA 3PROA 1G3EA 1YP9A 2XC5A 1EB1H 1HAOH 1VR1H 4ZROA 3RUOA 1UTMA 2TGTA 1NFUA 3DD2H 4MLFB 5L6NH 1QB1A 2TGDA 2SFAA 2QXGA 4K1EA 4K8BA 3UR6A 4X1QU 1SSXA 4AB9A 1WXRA 3S7KB 1KLTA 2GCTC 2NU4E 1Z8GA 3F3BA 1VGCB 3BEUA 3Q3XA 2FTLE 3BG8A 5F03A 1O2HA 3LH3A 4FUGA 1GCTC 2QV1A 2J98A 1GMDF 2OC8A 3OTPA 3GCOA 4AX9H 2ESTE 1SG8B 3LT3A 1V2VT 2Z6BD 1O2GH 3SV6A 3UWIA 1QA7A 3NXPA 4F55A 2PUQH 3UQOA 1C5NH 2F9NA 2F83A 1HYLA 4ABHA 2Q1JA 1IQMA 1UTJA 1LCYA 3CS7A 4JK6A 5C5NA 1BTPA 1BTUA 3A7ZA 3MMGA 2UWOA 1BOQA 3SI3H 5EJZA 1O5CB 3RMOH 1J16A 4OM9A 2PSYA 1IQNA 3BV9B 1DWBH 2ZPSA 1HV7A 2VVVA 1CO7E 1A5GH 1GHZA 1JMOH 1QHRB 2QF3A 1Z8IB 1ANCA 1MCTA 4GCHF 1O34A 1QB6A 2R3UA 4PROA 3QWCH 3CNRA 1W0ZU 1FN8A 3MHWU 1BBRE 1YY3A 1TQ7B 6CHAB 2NU1E 4FUHA 2FOHA 1AY6H 1ESAA 2BXTH 4DG4A 1AKSA 3MO6A 3ZVBA 1D3QB 4FXGH 2AMDA 1NY22 1TBQH 2VBCA 4NSVA 4VGCB 1C2IA 1ZMNA 3FANA 5GCHF 1UVOA 3F6UH 4A92A 1O36A 2JIZD 1XX9A 3D49H 2WPDD 1O2PA 2VGCC 2FODA 4XBCA 3MU4A 1T8OA 5JBBS 1KY9A 3KGPA 1FV9A 4NWLA 3EYDA 4D7GA 4BXWA 1GBHA 3FP8E 1CE5A 3LGVA 1SGQE 3RDZA 5AF9H 3WWBA 4OS1A 1SGTA 5T6FA 3RU4T 2A5AA 1A0HB 3OX7U 5L30H 2XNDD 3ZV9A 2HVXA 2WV9A 2ODPA 5C5OA 1NC6A 1HXEH 4HGCA 1S82A 3I78A 4Y10E 1UTQA 2DE9A 1K1LA 1JWTA 4TPIZ 3LDXH 7GCHF 5A2MH 9LPRA 1AN1E 2CK3D 4WWYA 5DP9A 3S69A 1N1LA 5DSFA 1XKAC 1L1NA 1KXBA 1BRBE 2WV5A 1AFQC 3B9FH 4WMEA 1F2SE 5DP4A 8GCHF 1EP6A 1LVOA 3EE7A 1DLEA 4KTCA 1DS2E 1W11U 1C1QA 3UPEA 2GDDA 1O35A 4ZUHA 1TRNA 1QL9A 3OU0A 3URDA 3UWJH 2C3SA 5L2ZH 4RN6A 2VIOA 2FI3E 1A5IA 1FY4A 3PTBA 2ZI2H 1GJ9B 2VINA 2ZHDA 4H6TA 3AK5A 1MH0A 1HCGA 3SJIA 1IQKA 1Y3UA 4YLUA 3MTYA 4THNH 1A7SA 3M35A 1PPEE 2PGBB 3TH3H 1V2RT 1C1RA 2HALA 2BD8A 2J2UA 5A09A 2C4FH 4K1TA 1UCYH 1SLXB 2GMTB 5EU8A 4XBBA 3A85A 2GP9B 1D3TB 3A87A 1P3EA 1EP5A 2THFB 3PMAB 1NRRH 2EA3A 3EAJA 1HAZB 3BTDE 1VGCC 1C5XB 5GIBA 1Z1IA 2FOMB 2W6JD 2HOBA 2Y80A 4ZKSU 2BD4A 2WPMS 1UW7A 2Y5FA 3GYLB 4JZ1A 1SI5H 2P59A 4B2AA 1O39A 3PV5A 2G5VA 3NCLA 1TMUH 3QDZB 4JK5A 7KMEH 1O33A 1OWKA 1E79D 3FO8D 3SZNA 2ZHFH 2GT7A 1AE5A 1W7XH 2KR7A 1HJAB 4CRGA 2PTNA 3GCTG 2WPKS 3SO3A 2G4UA 4MPWA 3ZZ8A 3BTME 3HATH 4Q63A 5T3HA 2HVYB 3RXOA 2PP6A 4D8NA 1V6DA 2PHBA 3LGIA 1BTZA 3MWIU 3GCNA 1MTVA 1BMLA 3U69H 2LPRA 5AVDA 3RXKA 1AVWA 2WHXA 3TIUA 1O2VA 1C1SA 6CHAC 1KMHB 3U8OH 3UREA 1UK2A 4I32A 1O5GH 2FOEA 2ZU5A 4VGCC 4ABJA 3OEHD 2L6OA 3UIRA 4DCDA 3RXHA 1ZHRA 1BQYA 2P95A 4CRDA 3PLBA 3W1EA 1GBFA 3QUMP 4YO9A 1MAXA 1UVUH 3RXCA 1BHXB 2I6QA 1XVOA 1NRSH 2SNWA 3M7UA 3LOXA 1WDIA 1A4WH 1Y3VA 2L74A 3SV7A 2XCFA 2G4TA 4NFEA 3V12A 4JZIA 1KSNA 2UUJB 1MAYA 4YT7H 1H9LB 5GDSH 5JYIA 1HGTH 1P8VC 5E2PA 2ZCKP 1G30B 1EJNA 4FVBA 1HJ9A 1G37A 3RXEA 2SGAA 1H4WA 3VPKA 2WV4A 1ZRBA 1ANDA 3VB7A 3BEFB 2BD7A 5FAHA 2A4OA 3LJJA 4ZKNU 2QA9E 1GMHG 2AIPA 1UHBA 1K1MA 3F2HA 3HPTB 2W26A 1PQ5A 2FPZA 4X8TH 3EDXB 1RFNA 4GVUA 4XDEA 2ZFFH 3HKIB 5C0UA 3MH4A 1O2RA 1QQ4A 3UOPA 8LPRA 4ABFA 1CHOF 1FXYA 1QNJA 4HI3A 4X2VA 4WMDA 3E8LA 1O3MA 5TJXA
chains in the Genus database with same CATH topology
1VCWA 3P6ZB 3MNSA 4R8TB 2KAIB 4JZFH 1FMGA 2CXVA 2GX4A 3MO3A 1UVTH 2BLVA 3TJNA 3ATIA 1MTSA 1PYTC 1Y8TA 2F3CE 4KKDA 2Y6TA 4FU7A 1HAIH 1C2FA 4IMZA 5C20A 2A1DB 1BUIA 4GSOA 1OWDA 4DIIH 4JYUH 4A7IB 1TMBH 1AZZA 4KP0A 2H5DA 2AEIH 1MMJN 3SHCH 2ZDVH 2GMTC 3SNAA 3RXGA 3SU1A 1FJSA 5I25A 1GHYH 1Z8RA 1HAHH 2BDCA 2K1QA 2VIDA 3VFEA 1V2UT 2BY6X 4MPXA 4AG1A 5K7RA 1JIMA 1P3CA 1SR5C 4AN7A 3KIDU 1EB2A 1OYTH 1P04A 4BNRA 1ELDE 1U6QA 1ZRKA 2B0FA 3MNBA 1FN6A 1O30A 4X1RU 1G2MA 2PR3A 3E91A 3GY7A 1IQGA 2F9BH 4UFGH 3DA9B 1HJAC 4LZ1H 2BLQA 2BDAA 1Z7KA 3QTOH 1RGQA 5FXLA 1GBEA 1OXGA 1QURH 1Y59T 1DLKB 4ZHLU 3MNCA 5DP3A 5LGOA 1SHHB 4KELA 4R0IA 1GDUA 2TBSA 1G2LA 1LHCH 3MU5A 3O8CA 2WUBA 1GHVH 4B71A 1YPGH 4Z0KA 1DFPA 1DDJA 4ZXYH 3ZVDA 1GHBF 2TGAA 2VIPA 1J14A 1GI9B 2FLBH 4AB8A 3A7XA 1SQTA 1ZPCA 1WCZA 1TNHA 3NZIA 2Y82A 4AORA 1O2MA 1O32A 2WYJA 4ISNA 1EAUA 4K60A 1TBZH 2XBXA 1O38A 2I6SA 3IWMA 1SGFG 1QBNA 1EPTB 5ABWA 4B2BA 4CRCA 5DGJA 2ODQA 1FIWA 2A2QH 4GLYA 1DX5M 1EQ9A 5DPAA 5J4QA 1K1NA 1C2JA 4OS4A 1W10U 2FEQH 3GY2A 2FS8A 5BPEA 2DUCA 4K8YA 3SGQE 1PPFE 4FUEA 1O2LA 2BVSH 1G32B 2BB4A 2XWBI 2Z9GA 4X0WU 1RXPA 1OOKB 5EOKA 1FLEE 2C8ZB 5E8EH 1VCQA 1FAXA 1WYKA 2FI5E 1LDTT 1W12U 2Q6FA 1UTLM 3RC4A 1BBRH 3SV8A 3TGJE 2Z3EA 2O8UA 4B1TA 2NU2E 2ZFSA 4ABGA 3Q00A 3F1SB 6GCHG 1YLCA 2GZ8A 2BZAA 3I29A 1HAPH 2GDEH 1N8OB 3BTWE 1P10A 1W8BH 1BMMH 1S85A 3T5FH 2EEKA 1THPB 2VB0A 1JRSA 1KYNA 2P94A 2H5CA 3PMBB 4O9VA 2RG3A 2ZG0H 1BRUP 2VVUA 1ANBA 3BSQA 2FP7B 4BOHA 1ETRH 1O31A 1O3EA 2ZU4A 1XUGA 2ODYB 3U1JB 5FPSA 1NRPH 1MKXK 2CN0H 4ABAA 4NA9H 3TK9A 3H5CB 1UTNA 2HRVA 1DE7H 4WJG2 3P92A 3F68H 2ZHEH 1GBCA 2CGAA 1NN6A 2GV7A 3SI4H 3T62A 1C5ZB 1Z6JH 4IC5A 4AFZA 3MFJA 1IQJA 3KCGH 1N6XA 5HGGA 1K1OA 1TGCA 2Z94A 3LGWA 1OWHA 4U30A 1NRNH 3RM2H 1UTPA 4HTCH 1TRMA 1OSSA 1MU8B 3GCHB 3I77A 1QL7A 2BVRH 2HNTE 5DP7A 2H9HA 1ZGVA 1TA6A 3VGCB 4X8SH 5LH8A 5A0BA 4Y0ZE 1GWAA 3D23A 1D3DB 4X6NA 1G3BA 1ESTA 1ANEA 1AVGH 1EOLA 3MH5A 4K5ZA 1FI8A 1TPPA 2VH6A 3SNCA 2C93B 5E0JA 2VWOA 1FPCH 3T27A 1TX6A 4OS2A 5EGMA 3KF2A 1MCVA 5CMXH 1S84A 2PKSB 1FAKH 3KQCA 2ANWA 4FUBA 3OY6U 2OQUA 4INHA 4CBOA 1ETSH 3RC5A 1WQSA 2ZFRH 3ZZ6A 4CRFA 4DVAU 4YESB 1TONA 3TVJB 4UD9H 2VH0A 2GCHG 1GJ5H 2G81E 4XE4A 1V2PT 4GPGA 2D2DA 2UUFB 1P2JA 2XBYA 1MKXH 2EI6A 3KNXA 2WYGA 2A5KA 4ZMAH 3LGYA 3SJ9A 2ZFPH 1GJ4H 2ALPA 1HPGA 4CH8B 4U2WA 2OBQA 2G5NA 1IHTH 2PLXA 1GDQA 1HAXB 4Q2KA 1A1RA 1EPTC 1NFXA 4XOJA 3ATLA 3ZVAA 3LGUA 4CREA 3SUDA 3ATKA 4NA7A 1GHAG 4ESTE 1ELTA 4FUJA 3T29A 1TGTA 3K2UA 3A80A 1LPKB 1ACBE 1FIZA 2ZTXA 1DT2A 1YPLH 5DK1A 3ZVGA 3LH1A 3QTVH 2Y81A 2OC1A 3TH4H 1G36A 2ASUB 1QGFA 4CH2B 1H9HE 3P17H 3V0XA 1AHTH 3EA7A 5I46H 1BTHH 1B0EA 1V2KT 2G52A 2XC0A 1G9IE 4CHAB 1TBRH 1LHFH 1C2EA 2J38A 2RCEA 2FM2A 3MI4A 1GBIA 2ZNKH 4OS5A 3ZZBA 1UVPA 2ZIQH 1C5QA 5TCAA 1Y3YA 2AIQA 1WQVH 1MKWH 1P2KA 3PM3A 1N8OC 1YYY1 3BG4B 3ZZ4A 1ZSJA 3LJOA 1PQ8A 2WPLS 1O2JA 4UDWH 1D9IA 3DFLA 2UUKB 1UCYK 2G55A 1MTUA 1TNIA 4Y11E 3UNRA 3M5MA 1TA2A 1MZAA 3S9BA 4JYVH 3MO9A 3M5NA 1GL0E 1HBTH 1O5EH 4ZXXH 4BAQB 3MU1A 4JMYA 1O2UA 4DURA 1RS0A 3HKJB 1SFIA 3P8NA 4INKA 4WXVA 1G3CA 2CV3A 1UK4A 5IDKA 1W3CA 1TFXA 4NIVA 2C8WB 2ULLA 1NFYA 3GDSA 8ESTE 1FY8E 2C8YB 2R0LA 4LOYH 4NIXA 3A8CA 1ZTLA 1AI8H 5JB9S 4A1VA 3P70B 4IW4E 4A1XA 1A0JA 1AU8A 1BTWA 1GJBB 1ID5H 3A86A 1JOUB 2FLRH 1K1JA 3SU3A 1V2WT 1DUEA 2J92A 5ESTE 1C9TA 3U8RH 3UOUA 2ZGJA 1YM0A 9ESTA 1GVKB 4E05H 2JH0D 5LPEA 3GCHC 2G51A 2QY0B 1GI8B 2ZFQH 3A7TA 4TPYA 3BTHE 1TNLA 1IQEA 1TIOA 3VGCC 2JKHA 1FZZA 3MH6A 2IN2A 4I31A 6LPRA 1AZ8A 1GMDG 1QQUA 2BDBA 4CBNA 1AGJA 2BD5A 1CGIE 2P16A 1DPOA 4IN2A 1KTSB 3URCA 1CSOE 5SGAE 1ELGA 1QL8A 3BN9A 4AFSA 3RU4E 5EPNA 2XBWA 1H1BA 2ZP0H 2UUYA 4IS5A 2XCNA 2PKSC 1INCA 3FVFB 1E35B 1C5OH 1BJVA 1P0SH 2J95A 1KXDA 2QN5T 2STAE 2O8MA 3QLPH 1CHGA 1ELBA 4Y71A 2ZHWH 2Q6GA 3P8GA 2Z3DA 2JH5D 1ZMLA 4UEHH 1T31A 1C5RA 1Y5BT 1E0FD 1LQDB 3KQEA 4GCHG 3S7HB 2WINI 3A84A 1DITH 1KLIH 4AYYB 1ZJKA 3RXLA 1O5FH 4Y6DA 1HAYB 4NCYA 3SQHE 1LKAA 4X1PU 4Q7XA 2ZC9H 4D7FA 1A46H 1ARBA 3QGJA 1FY3A 1BT7A 4LXBH 3KEEA 3SJKA 2HNTC 5PTPA 4RSPA 3G01A 3UNSA 5GCHG 3HGPA 2TPIZ 1IQIA 1ELCA 1TPSA 4X8VH 1ETTH 5HMAA 3WY8A 4DJZB 5E0HA 1PPGE 1GG6B 4WH6A 1JXPA 1BA8B 3F9FA 1MUEB 3ZVEA 2HPPH 1C2DA 1P9UA 2BVXH 1LTOA 1TNJA 3ODFA 3RC6A 3AVZA 2XW9A 3SNDA 3VB3A 4BAKB 2J4IA 2VU8E 3BTEE 2ZFTA 3PMHB 1O3IA 2GGVB 1ZTJA 4AZ2B 3PB1E 3E1XB 1HAVB 3STIA 3A8BA 1O2TA 1OPHB 3NPSA 1O3AA 1TOMH 4CHAC 4Y7AA 3EA9A 1C1MA 1HNEE 1TOCB 7GCHG 3M5OA 2FX6A 3MU8A 5EODA 2Z9IA 5IYTA 1IHSH 3BG4C 2R0KA 1AD8H 1QIXB 4D76A 1HUTH 1SBWA 1QA0A 1WTHD 1DM4B 1YPEH 3KQDA 4YT6H 2O8WA 2A7HA 8GCHG 3AASA 2C8XB 1Y5UT 1V2LT 1AUTC 1IAUA 2B8OH 1GI3A 2QCYA 4DGJA 1P12E 2FDAA 3RXJA 1C5YB 1S6HA 3RMNH 3ZV8A 2DE8A 2CF9H 2OC7A 1P01A 1V2MT 2PUXB 4H4FA 4I33A 4X8UH 2TRMA 1BTYA 3NKKA 1TX7A 5EG4A 3TK5A 1C2KA 1TABE 1DY9A 1GDNA 4OGXA 4YTAA 1O0DH 1Y5AT 3TJUA 1F5RA 5FBEA 3BIVH 2VNTA 2QYIA 1DXWA 1JBUH 4SGAE 2ZDMA 4X2WA 3EQ0H 1RJXB 1FY5A 2ZTYA 1DWCH 5EXMA 4Y79A 4ZHMU 1XUHA 2FOAA 5HXFA 4FUCA 3DHKH 1VITH 1UJ1A 1HJ8A 3M7TA 1EATA 1D4PB 1V2OT 2F9OA 1BRCE 3DT0H 3GISB 1GBTA 1SMFE 1YPMH 4DOQA 3SGBE 1CQQA 5JBCS 4Q7YA 2ZKSA 1V2JT 4E7RG 4WVPE 1GBDA 2OUAA 5A8ZA 3NK8A 1C2LA 3RM0H 1V2TT 3A7WA 2IJOB 3QGNB 2OD3B 3P95A 3M3SA 1GGDB 3SGAE 3ZYEA 2ZF0H 3T2NA 1MBQA 1RTLA 1TQ0B 5F6MA 2A5IA 4F49A 2ZO3H 5JB8S 2B5TB 3PMJA 5E0GA 1NFWA 1GBLA 2W5EA 2D8WA 4WH8A 5FPTA 2XNIA 1DANH 3M37A 1C5LH 1G3DA 3C1KA 4E06H 1MQ5A 2BY8X 5JBTA 3V13A 3CS0A 3KN2A 2A4RA 1SOTA 4UONA 2WUCA 3QN7A 3A8AA 2EC9H 5TCCA 3K6YA 1Q2WA 2BTCE 4U32A 4WXIA 2OC0A 4NGAH 1BBRK 1FDPA 2YOLA 4BTIB 3OY5U 2AGGX 1CT0E 1O3BA 1BTXA 2FOBA 1S5SA 4B73A 1O3CA 3P8OA 3GYMA 1LPGB 1FONA 1A3BH 3JZ2B 4XBDA 3V3MA 1F92A 1YF4A 2NU3E 3STJA 1UTKA 3O8BA 1GJAB 1W14U 1BCUH 1PJPA 1GBAA 1K21H 1F0TA 1C1OA 2GZ9A 2VIVA 1NS3A 4AGKA 1D6RA 1GG6C 5LPRA 3E90B 1IQFA 1LVBA 1SLWB 1Z6EA 1YBWA 1AB9B 3EE0B 3ELAH 5FCRA 1O3FA 5J4SA 2BXUH 5AFZH 1J17T 2SGDE 1RTFB 3TH2H 3ZZAA 1J15A 4ABDA 1LPZB 4B2CA 3PO1B 3UY9A 3S0NA 1C4U2 3BTKE 3LONA 4JZEH 5EQSA 5C67A 1YKTA 3SJOA 1FUJA 3FZDA 1F5KU 1T8LA 2FYQA 4ZH8A 1LQEA 3RXVA 3O8RA 1QJ6B 2PSXA 2H6MA 2BDIA 1BMAA 2B7DH 1TGSZ 1EZQA 1O3PB 5FBIA 1QBVH 1HDTH 1CHOG 2PWXA 2O8TA 1AE8H 2EI8A 3TGKE 4Q7ZA 2O8LA 2VIWA 1A3EH 3Q3KA 4I8KA 3A88A 2KAIA 3TK6A 1CA0B 2Q6DA 3M7QA 4UFFH 4ZKOU 1DSUA 1EZSC 3H7TA 1H9IE 1DICA 1LVMA 2JETB 3ATMA 1WUNH 2STBE 1OX1A 1YPJH 1F0RA 2PW8H 1GPZA 4GUXA 4D9QA 3ZZ7A 3ZZ3A 5C1YA 1AUJA 1HIAB 1MTWA 1XVMA 2V35A 2AFQB 1DVAH 2HWLB 2ALVA 4WMFA 2ZDNA 3QO6A 3TU7H 2GT8A 5B6OA 1BZXE 5GPIB 1TPOA 3UR9A 1EUFA 1TPAE 3SNBA 2EI7A 5L2YH 1X7AC 2FX4A 2ILNA 1NZQH 1L1GA 3A89A 3RXBA 1O2YA 1LKBA 4XSKU 4MDSA 4YOGA 5E2OA 3SN8A 5A8XA 3QX5H 4OGYA 1RTKA 2A45B 3M3VA 1C1NA 1RRKA 4YM9A 3RXTA 3QZRA 1CBWB 1P57B 2BX4A 5DKMA 2XC4A 2OP9A 3GY3A 4UFEH 1C1UH 1OP0A 1CT4E 4NWKA 1IQLA 1AWHB 1THSH 5C1XA 3CP7A 1GGDC 1ORFA 1V2QT 4MPUA 1PPBH 2AMQA 2PGQB 2AERH 3F9GA 4YOIA 1C1PA 1ZHPA 5DG6A 5H4IB 4MNXA 1O2WA 5LPFA 2ZTZA 1AKSB 2PTCE 5F8TA 1TWXB 2VWMA 4CR9A 3QK1A 4RKJB 1E36B 1P03A 3T26A 1WAYB 2AS9A 4AG2A 2R2WU 3E16B 1ZZZA 1GHBG 5EQRA 2FTMA 2PV9B 4B75A 1WV7H 2ZEBA 3IITA 4NIWA 2Z9JA 1F7ZA 4J2YB 4F4OC 2BX3A 1DUAA 1XXFA 2A4QA 5BRRE 1AIXH 1P05A 3LC5A 3Q77A 1KXCA 3M5LA 6ESTA 3NUMA 1DXPA 1BRAA 5T6GA 3BTQE 3HK3B 2AGEX 3TNTA 1B7XB 4CRAA 1EPTA 3ZZ9A 1GMCF 1SGCA 3JZ1B 4SGBE 2Y5HA 2BD3A 2O9QA 2R9PA 1P2MA 3MOCA 1MKWK 2W3IA 1Z1JA 5EXLA 3T28A 3ZYDA 2OQ5A 3SW2B 1L1JA 2BYAX 5HM2A 1E34B 4YOJA 1PPCE 5DO4H 1QFKH 1AB9C 1DOJA 2HGTH 2NU0E 3H7OA 3VXEH 1MBMA 3BTFE 2ZQ2A 1D3PB 3UNQA 1K9OE 1SOZA 1NM6A 3A7YA 3PO1C 3BF6H 4TWYA 4KGAA 4UFDH 1PQ7A 1KTTB 3VEQB 1NESE 4I7YH 1RD3B 5F8XA 4QT8C 3K65B 2ZU1A 4MVNA 1BITA 1O2OA 2A7JA 4DW2U 2OXSA 3GOVB 2OTVA 3ZVCA 2ANMH 2GV6A 1SGFA 2XYAA 2R2MB 1CA8B 4ZKRU 4NSYA 4A1TA 5FHTA 1C1WH 3TLOA 1C4V2 1F0UA 1HIAA 1Z71A 2OCVB 1MZDA 1TAWA 3PTNA 1DSTA 2FI4E 2ZZUH 1ZOMA 1H8IH 2FZZA 1O3LA 4NA8A 1GI6A