4IC5A

Crystal structure of deg5
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
237
structure length
210
Chain Sequence
EELEEEEERNVNLFQKTSPSVVYIEAIELEGTGSGFVWDKLGHIVTNYHVIAKLATDQFGLQRCKVSLVDAKGTRFSKEGKIVGLDPDNDLAVLKIETEGRELNPVVLGTSNDLRVGQSCFAIGNPYGYENTLTIGVVSGLGREIPSPNGKSISEAIQTDADINSGNAGGPLLDSYGHTIGVNTATFVNFAIPIDTVVRTVPYLIVYGTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of Arabidopsis Deg5 and Deg8 reveal new insights into HtrA proteases
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords Protease Do-like 5, chloroplastic
total genus 43
structure length 210
sequence length 237
chains with identical sequence B, C
ec nomenclature ec 3.4.21.-:
pdb deposition date 2012-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ic5A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ic5A01
4A1XA 1OWDA 4MPXA 1C1PA 3V0XA 2ZDLA 3EE0B 3N7OA 2VWOA 4ZKOU 4ZAEA 1P05A 3FP8E 1AU8A 2A5IA 4B74A 3BV9B 2Z9KA 4NIVA 1C1OA 1A5HA 4A5TS 4FU8A 1RTLA 4ZUHA 1A2CH 2PUQH 4NCYA 4BAOB 1ELDE 1RRKA 3RLYH 1Z7KA 4DJZB 1O33A 1LVMA 2FI3E 5AF9H 3PO1C 1TQ0B 1TPAE 1MU6B 3FZDA 4GLYA 4GVUA 2WPHS 4B1TA 4BAMB 3RM2H 4XSKU 4KELA 2EI6A 2F3CE 1SGPE 1TPSA 1K22H 2XRCA 1SL3A 3M61U 1JIMA 1NN6A 2ZCLP 3S9AA 2BYAX 4NFEA 1ZTKA 1GL1A 1ZHMA 3ZVBA 4NGAH 1G2LA 2FO9A 2ODPA 4CRGA 1HIAA 3P70B 4FUFA 3VXEH 2DE8A 3TNTA 5EQRA 1AVXA 1DS2E 1T8NA 2VU8E 1Q31A 1C5TA 2M5TA 2V3OH 1C5MD 2VIPA 2BDCA 5T3HA 1XXFA 2XWAA 1UTQA 3TK5A 2FOGA 1MUEB 3G01A 3E8LA 1Y8TA 1BTYA 1O5BB 1HAXB 1DFPA 1O2SA 2QA9E 4OS5A 2SGQE 3BTDE 4IGDA 3W95A 1C2LA 1HAHH 1K28D 5I46H 3O8RA 2C8XB 3RXBA 3SUEA 2FOCA 4BTTB 2FOAA 3F9EA 4CRFA 3NWUA 3QTVH 1NZQH 1KTSB 5HM9A 4PROA 1UMAH 4FUHA 1KLJH 3LC5A 1NFXA 1ZMNA 1P8VC 3TH4H 2OINA 1F0RA 2TGTA 1HJAC 3D62A 1RTKA 1MAXA 2VINA 1RIWC 5FBIA 1MCVA 1EJAA 1GWAA 5HGGA 1CA0C 1UVPA 3ZZBA 6CHAC 1L1GA 2W3KA 1JIRA 2ZDKA 1HIAB 2FYRA 1O2GH 3MI4A 2VH6A 3SNEA 3RXSA 1FY8E 3SHCH 1T8LA 2C3SA 1C5QA 1AFQB 1EQ9A 1DVAH 1IQLA 4UFFH 4X2VA 1O5CB 2FMJA 3H5CB 3SU2A 1HXEH 5LPFA 2BDIA 3EGKH 1O3JA 1UCYK 2D8WA 2G5NA 3MTYA 2FX4A 1ELVA 1EX3A 3BG4B 2G4UA 3ITIA 2GD4B 1K2I1 1VCQA 2C90B 1AVGH 2BD4A 1SGRE 1WTGH 3GICB 3VB6A 3RXRA 1K1LA 3ZV9A 1GPZA 1TNJA 3TGJE 1FY5A 3RXPA 1ANEA 3E0PB 1HNEE 1EASA 3LKWA 1EZSC 1GBDA 1SLXB 2ZFRH 4NA8A 1GI2A 2ESTE 2ANKH 4CRBA 3GDUA 1GBHA 2TGAA 3L6PA 1C5LH 2LPRA 3ZZCA 1WU1A 4WMEA 5DP3A 4NZQA 3S9CA 3RC6A 3BF6H 1XUGA 2BQWB 1C2IA 2BDAA 1XM1A 2GZ7A 3VB7A 3MFJA 2NU2E 4U2WA 2GV6A 2DUCA 1O31A 4XBDA 1GJ8B 1HFDA 4FUDA 4FUCA 3T29A 3BSQA 2BTCE 3SNAA 3PM3A 3SORA 1P0SH 1P57B 4LXBH 1ZJKA 3U8TH 3LGUA 1J16A 1DY9A 3Q00A 4Y71A 4ABGA 2KAIB 1A61H 1K1OA 1IQJA 2VVCA 3SI3H 2OC1A 4X1RU 2ZHEH 1C5SA 4IC6A 1INCA 1YPEH 1XVOA 3SO3A 4ZMAH 1TFXA 1AQ7A 1ZHPA 5F03A 1YPJH 1C1NA 1O3FA 1FDPA 1C4V2 1MTUA 2GCHF 4YOIA 1RD3B 4BAQB 2VNTA 2FOHA 1DLKB 1SG8B 1HV7A 3P92A 1VGCB 2F83A 3MH4A 3ZVCA 2G81E 1T4UH 2A0QB 1J9CH 2GDEH 4IBLH 3ZYDA 1QL9A 1F0SA 2AS9A 3FZZA 3HPTB 2Z9GA 1NROH 2A5KA 1HCGA 2PSXA 1O2VA 5JBCS 2Y5HA 1TPPA 4TWYA 1QQ4A 1S5SA 1EZQA 2FDAA 2QN5T 1PPEE 4Z0KA 1GCTC 3HGNA 2XBVA 5BRRE 3VGCC 1NESE 3CP7A 3BTEE 3F1SB 4ISIH 4YO9A 3EAJA 4TPYA 5JB8S 4YZUA 1LVBA 1PPGE 1GJBB 5C1YA 3GCOA 1YLDA 5C5NA 2JETC 4ZHMU 1N8OC 1P04A 1Z8RA 3GY4A 1BMAA 4BAHB 2Q6DA 2PTCE 1KTTB 1GHXH 2AMQA 3A85A 4SGBE 4E7NA 2J34A 3UNSA 2K1QA 4B2BA 1ARBA 2Y7XA 3S69A 1P09A 4YLUA 3M5MA 2ZDAH 1O3CA 4ZXXH 1NS3A 5A8XA 1IQIA 1B0EA 2VH0A 1C2MA 1W12U 2A7HA 1C5NH 2VIDA 3K6ZA 1VJAU 2AIQA 3LONA 4OGYA 3W94A 1J15A 1BUIA 1O3HA 1D4PB 3FP7E 3RXKA 3ESTA 3UWIA 4ESTE 1PFXC 2H9HA 3Q3KA 1DANH 1CT2E 1SI5H 1ELFA 3BTQE 5CE1A 1MTNB 2WPIS 3M36A 1NM6A 3UREA 1BQYA 1C1QA 1OWEA 4AN7A 1S0RA 2OQUA 4J2YB 1DX5M 1AB9B 2HWLB 5JBTA 5F8TA 4I32A 1GBIA 1C4U2 4GHTA 5T6DA 2QCYA 3KHVA 3M37A 2FPZA 1DXWA 2NU1E 1O3OA 4Y0YE 5EXLA 3T27A 3NKKA 1Z8IB 1ZTLA 1ZMJA 4E06H 1NY22 4A1TA 2XW9A 4CBNA 1HAYB 4K60A 3BTTE 1W7XH 1YPHC 5T6FA 1O37A 3A8BA 4WY3A 3ATLA 1BBRH 1HUTH 6CHAB 1T32A 1SGYE 1C5WB 4B2CA 3ZZ7A 1BRCE 1KXEA 1UK2A 1GBJA 1O3GA 1HAOH 3A7WA 1MQ5A 1V2OT 2THFB 1LPKB 2O8UA 1O5AB 1V2LT 5ESTE 1BBRE 2ZCHP 1W14U 3M5OA 1GJ7B 1H8DH 4HFPB 1DWBH 1OP2A 1VGCC 2BX3A 1C2FA 1O38A 3RXHA 1EOJA 4A92A 2UWPA 1GI8B 4F49A 1CHOF 5B6OA 4X6MA 3VB5A 1TGTA 4NWLA 1VITF 4NSVA 2UWLA 2ZDMA 4AFQA 1GHYH 3S0NA 1FXYA 1ABJH 2BDHA 2ZFFH 1UVSH 2Q6GA 4D9QA 2F9VA 1N6XA 2RDLA 4WH6A 2B5TB 2V35A 6LPRA 3UQOA 2Z7FE 4RKJB 3AW0A 3GY3A 5EG4A 1CBWB 1P11E 2Y5FA 1EB1H 2NWNA 1L0ZA 4D7FA 1BT7A 1GCTB 2FXRA 3GCTG 4K1SA 3GCTF 4JCNA 3MNCA 1GBLA 2PGBB 3RUOA 2ZDVH 2ZHQH 2TGPZ 3NZIA 3O8CA 3SV2H 1V2UT 1O3KA 4JYVH 2HLCA 2I6SA 1SQOA 1CQQA 3Q3XA 4R0IA 5EPYA 1NRSH 1NTPA 3UQVA 1C1SA 4X8VH 2WPMS 3PB1E 1V2RT 2Y80A 4HI3A 4Q2KA 3MNXA 3KF2A 1O2IA 2IN2A 4ISHH 1QBOA 4IN1A 5DP9A 1A5GH 1GI5A 5LGOA 5TCAA 3SJIA 1P12E 1NU7B 3QTOH 4KP0A 2BQ6B 1DPOA 2AIPA 1AZZA 4WWYA 4WVPE 3SGAE 1F5LA 2EI7A 3OU0A 4IC5A 3SJKA 2J38A 3I29A 1GHAG 4FVDA 1MTVA 2GT8A 1C5UA 3P8OA 1F92A 1QURH 1YPHE 4OGXA 3QZQA 2P8OB 3ZV8A 4AFSA 2C8YB 4Q7XA 2ZFPH 1GJCB 3E1XB 4Y79A 4OS6A 1WAYB 4Q7YA 1V6DA 3T26A 3BTKE 5AVDA 1BTPA 1DSUA 2ILNA 2P59A 1D3TB 2VIVA 1FI8A 3A8CA 1LVYA 1MKWK 2R2WU 4BNRA 1P03A 4GPGA 5EGMA 1P06A 1ZJDA 1ELEE 2PKAA 3SQHE 4RN6A 4UE7H 3RMOH 3V3MA 2GZ8A 3BIVH 3PV4A 4JYTA 1ZOMA 1PPHE 2FLBH 1TX7A 1KY9A 3QK1A 1V2PT 2QXJA 5DP8A 3BTFE 1DUAA 4BAKB 2FWWA 3UOPA 4BOHA 5BPEA 1LKBA 1O2MA 2Q6FA 2A4GA 1THSH 3SU1A 4KGAA 3DHKH 2UWOA 1XX9A 1O2ZA 3D23A 1EJMA 3BN9A 1QY6A 4XDEA 3A7XA 3SU6A 1N6YA 1PQAA 5EQQA 5JB9S 3FANA 1MKXK 4MDSA 4YT6H 4CREA 3BEIB 2QV1A 1O3MA 3O8DA 2P95A 2G52A 3F6UH 2XYAA 5E2PA 3U9AH 2PKAB 1ACBE 2AEIH 3QX5H 5L30H 5JBAS 1Z8JB 2EA3A 4WXVA 5T6GA 3VEQB 2PKSB 1OP0A 1TONA 3RDZA 1W3CA 1L2EA 2F9BH 3UIRA 2ZP0H 2A7CA 4INLA 3ATMA 4X1PU 2GT7A 2KAIA 2OD3B 2VGCB 3QO6A 2O9QA 3LT3A 1PPZA 1O3PB 4FU9A 8KME2 5CMXH 2Z9JA 1G37A 1QB1A 4ZH8A 2Z3DA 4E05H 5HXFA 1QB6A 3SU5A 1VJ9U 3LIWA 3LH1A 1CA8B 1JBUH 3RXUA 3HKJB 1ZSLA 2GTBA 2GZ9A 2NU4E 2XBYA 3NUMA 1BMNH 1HAGE 4TY7A 4HGCA 1GI0A 1FQ3A 3D65E 3E90B 3MU0A 1D3QB 2F9UA 2QGRA 5E2OA 4X2YA 1FIZA 4XOJA 4YLQH 1O2OA 4I8HA 1ETTH 1DWDH 1ZHRA 2C8WB 2PHBA 1V2VT 1HAPH 5EXNA 1S85A 2AGIX 3GYMA 1O3NA 1AGJA 4ZKNU 3ZVEA 4NIWA 2W7UA 2R0KA 4K69A 4X6NA 1D3DB 1FPCH 3Q76A 3PROA 1XUIA 1SLUB 3B23B 4MPUA 1NRRH 4YTAA 4CRDA 1DE7H 2ZGCA 1C1RA 5A0AE 1YKTA 3A88A 1S6HA 1TOCB 3QGJA 1FJSA 1UK4A 3ATKA 2P8OC 1BDAA 2ODYB 7GCHG 1WUNH 4DT7B 2HNTE 5A0CA 1OWKA 4HTCH 1ZSKA 4FU7A 1IQGA 1DOJA 4TY6A 3S7HB 1SGCA 1BOQA 1UVTH 3V12A 1BTXA 1GHWH 1TGSZ 3ENSB 1KXCA 2FEQH 1P9UA 5C67A 1XKBC 4GAWA 4SGAE 1EPTB 2W26A 3URDA 1F2SE 3MOCA 1OYTH 1TBRH 1QL7A 1TE0A 1ELAA 1TMTH 2Z6BD 4A6LA 3B8JA 1KLTA 2GGVB 1FV9A 2UUFB 3L3TA 3P95A 1C1VH 1QIXB 3CS0A 5EW1H 4THNH 2EI8A 2I6QA 4TWWA 5LPEA 1GBTA 5EPNA 4BXWA 1TA6A 3TLOA 5FCRA 3MNBA 1RGQA 2SGFE 4ABBA 1GBCA 1V2WT 2VGCC 4K1TA 2BOHB 1JOUB 1GI3A 2WV4A 1W2KH 3RXAA 1UJ1A 1MBMA 1UVUH 2IPHA 1EP6A 1KSNA 3RM0H 1GG6B 1W0ZU 4FUGA 3LC3A 2HRVA 4I31A 1O30A 1TNHA 2R3YA 1SGIB 1F5KU 1QL8A 4I8KA 4X0WU 1HGTH 2QF0A 4WH8A 2V3HH 1O2NA 4B2AA 1JRTA 1FPHH 3TIUA 1TGBA 3B9FH 4DIIH 1HJ9A 1ELBA 3WY8A 3TPIZ 1TBQH 1RS0A 2FP7B 2G51A 5FPSA 4J1YA 1NFWA 2XCFA 2J92A 2RA0A 3ZZAA 1O2LA 2PWXA 1O2XA 3SQEE 4FVBA 3EA9A 1EPTA 1C1MA 1DWCH 5CHAB 2IJOB 2SNWA 2PUXB 3U1IB 2J4IA 4FXGH 2VWLA 3IITA 1A4WH 1GBMA 2B8OH 2OLGA 5DJ7A 5L6NH 2HGTH 1PQ8A 5GCHG 1CU1A 1IQNA 2ANYA 3DT0H 2BLWA 2P3TB 1UTMA 3TNSA 3DD2H 1C4Y2 3KQDA 1XMNB 3RXVA 2ZFQH 1BTUA 2WPKS 1ZGVA 1GBKA 2ZU2A 4JZ1A 4OS4A 4U30A 1O5DH 2QF3A 3ZVAA 5EQSA 1GDQA 2BDGA 3P8NA 1Y3WA 4M7GA 1TNIA 3IWMA 4X8UH 1THRH 4CR5A 1FMGA 1C5ZB 4CH8B 2QXGA 3LU9B 1O2KA 2ODQA 3STJA 5I25A 4DGJA 1MKWH 4BXSA 2XC4A 3A7ZA 3U8RH 4F4OC 2G4TA 4XFQA 3P8GA 1BZXE 1TWXB 4BTIB 1O3EA 5ABWA 1FN8A 4I8JA 4YT7H 2Z3CA 1OOKB 3P6ZB 1SGDE 1DWEH 4XBCA 4X8TH 3SV6A 3SNBA 1MQ6A 3MU5A 1D6RA 1LTOA 2FM2A 1MBQA 4ABIA 3KEEA 4Y11E 2BD2A 1UO6A 3U98H 2GKVE 1OP8A 4ZXYH 4Y10E 4VGCC 2FI5E 1O2UA 1NRQH 1RTFB 3TGIE 5E0GA 1AFEH 3TJVA 1FN6A 3AAVA 4K8YA 1N1LA 3C1KA 1V2ST 1GG6C 1QBVH 4Q7ZA 1HXFH 3Q77A 4JZIA 1FY1A 4DG4A 1BMMH 1E34B 5L2ZH 4NG9H 3OX7U 1C5RA 1SGQE 2A2XH 2ZG0H 5IDKA 3E6PH 2QYIA 1MCTA 1LHFH 2BDBA 3A84A 3EDXB 4I8LA 2BVXH 1EJNA 1A7SA 5A0BA 3PWBA 3PLPA 1ZPCA 3M7UA 4CHAB 1HJAB 4AYYB 4KKDA 1E35B 1G3CA 1RIWB 5G4BA 1EATA 2EC9H 4GUXA 4DW2U 1O3BA 1JWTA 1NT1A 3M7TA 2A4QA 4K8BA 2FLRH 3ZZ9A 1FY4A 1ZLRA 4LOYH 4Y8ZA 1C9PA 2BY5X 3TH2H 2NU3E 2QC2A 4B76A 5HYOA 3A8AA 4ZHLU 4WMDA 3UPEA 1JMOH 3TK9A 3TJOA 2H9TH 1AD8H 3HGPA 3UNQA 1AFQC 3PLKA 4A7IB 2ZO3H 2HNTF 1Y3YA 1S6FA 1C5PA 3PYHA 3RU4E 1UTPA 1ELCA 2WINI 2BVRH 4AG1A 4UD9H 5J4SA 3Q3YA 1V2JT 2TGDA 4NA7A 1AIXH 1Z8GA 3R0FA 1AY6H 1PJPA 3U8OH 5FXLA 1DLEA 1YC0A 3V7TA 1O2TA 2ZU5A 4DIHH 1H4WA 2ZPRA 2B0FA 1ZZZA 1S0QA 4IN2A 2FOFA 1YPKH 1E38B 5E0JA 4O9VA 3TITA 3ZZDA 3LGVA 4ISLA 1KXFA 3TJNA 3RC4A 2Z9LA 1AVWA 1O32A 1WV7H 1CT4E 4YOJA 5L2YH 1D6WA 2R9PA 1GHVH 2CMYA 4UONA 1VR1H 3LJOA 1GMHF 1WCZA 3UR6A 1TRYA 1YCPH 2W3IA 1BHXB 3KNXA 1MH0A 5J4QA 1XVMA 3QZRA 3OTJE 3I78A 5LPRA 1C2HA 2ZU3A 1FLEE 4MNWA 3H7OA 2PW8H 1O2QA 7LPRA 5AHGH 3ATWA 1LMWB 2P94A 2SNVA 2BY9X 4JZEH 1O5GH 1GJAB 2RCEA 3RLWH 1F0UA 3M5LA 4ZKRU 1VZQH 2H5CA 1HBTH 2RA3A 1GL0E 1HLTH 1TNGA 4GCHF 2AH4X 3EQ0H 1YF4A 1X7AC 2ZGBH 2JH5D 2ZI2H 1V2MT 1P2JA 4VGCB 1ZSJA 2CXVA 1GHZA 4CHAC 4YM9A 2ANMH 1A5IA 1TYNA 2A7JA 2SGPE 1O2WA 3V13A 1EAUA 1UHBA 2O8MA 1K21H 5IYTA 1YCPK 3FVFB 1V2TT 2CF9H 3T28A 3MH5A 1QJ6B 2SGAA 1CHGA 2JH0D 1GBEA 3GY7A 1PQ7A 1QNJA 1TGNA 3UOUA 5C2ZA 1O2JA 2ZA5A 2ANWA 2UUKB 2AGEX 4ZROA 3GY6A 1AO5A 1HRTH 2P3UB 3VB4A 1L1JA 3A86A 3RMMH 3AAUA 1KXAA 1QTFA 4Y0ZE 1Z1JA 3MO9A 2AMPA 4UDWH 1TIOA 3SN8A 5ESBA 2F9PA 3L33A 2OXSA 3JZ1B 2ZECA 2FIRH 2Y7ZA 1P9SA 1BB0B 1IQHA 3A7TA 5F8XA 4AYVB 1V3XA 1ARCA 5F6MA 2BZ6H 5EODA 1CHOG 4XE4A 1G2MA 4YOGA 1OSSA 1NFYA 4WXIA 2BMGB 5GCHF 5A8YA 5DP6A 5C1UA 2AGGX 1KXDA 4K1EA 1MMJN 2FOEA 1EPTC 3NXPA 1O5FH 1LVOA 1VITH 1UTOA 3T25A 1GVZA 4KTUA 1QGFA 4BTUB 1TX6A 1HAVB 3S7KB 1K1JA 5C5OA 1Y5BT 2BY8X 1B7XB 1K1MA 2GCTB 3PO1B 1GI1A 1A1RA 2F9OA 3SV9A 1J17T 1C2DA 4ABEA 1GJ6A 1XUFA 1SLWB 2A2QH 1TMUH 4ZHAA 2FOMB 4Y76A 1GCDA 3RXGA 1E37B 6ESTA 2ULLA 4LZ4B 1LHDH 1EKBB 4R8TB 3RXJA 2H9EH 1SR5C 3LGIA 3SI4H 1TNLA 1P2KA 2DE9A 4INHA 5DP5A 2VWNA 4GCHG 2BD9A 3ODDA 3FAOA 3T2NA 1XKAC 3A8DA 2D1JA 1G3EA 3SBKA 3A80A 1DSTA 1AE8H 1FUJA 4NZLA 3ATIA 3OYPA 3MYWA 1T4VH 4UFEH 1XUHA 1ETSH 2ZQ1A 2A45B 5JDUB 3TK6A 1UK3A 3QLPH 2WPLS 3BTHE 5JPMH 2O8TA 1Z1IA 5FPYA 4KTCA 1PYTC 1BRUP 1RJXB 5CHAC 3TH3H 1ZTJA 1OWJA 2FOBA 3NCLA 4DCDA 1Z6EA 3OSYA 1W0YH 3GY5A 3JZ2B 4OS7A 3UWJH 4Y6DA 1YPGH 1AB9C 1BRBE 4GSOA 1D3PB 1VCPA 1IQFA 1GGDC 1P10A 1F5RA 5DGJA 2G55A 1LQEA 1O2RA 4JZFH 1OPHB 2XWBI 4H42U 2ZFTA 2C93B 3SU4A 4K3JA 1WYKA 1CT0E 1Z6JH 3MU8A 4NWKA 3RMLH 1YLCA 1WQVH 4MLFB 5ETXA 3DFJA 2Z9IA 4U32A 4ABAA 1QQUA 2XNIA 4IS5A 1BTHH 1UCYH 3TJUA 3CENA 1OKXA 3K65B 5JBBS 1AUTC 5HM2A 9ESTA 2GX4A 3E3TA 2ZQ2A 1BRAA 5F8ZA 1MD7A 4UFGH 2XC5A 2ZTYA 1JRSA 1Q2WA 1C2KA 1EZUC 2CV3A 4CH2B 1C5VA 1FAKH 1CSOE 2HVXA 1CBWC 4MQAA 2V0BA 1C2EA 3MWIU 1LHEH 1W10U 1IQEA 2GCTC 2BHGA 1LPZB 2ZFSA 5A2MH 8GCHF 1TAWA 5EU8A 3QDZB 1C5YB 1P2QA 1S81A 1MU8B 1DT2A 1DY8A 1WTHD 3SOSA 1ESTA 2BD5A 2Z3EA 2WYGA 1H9LB 1ID5H 2ZHWH 5EXMA 3SU0A 3SGQE 2BLVA 3PTBA 3BG4C 1MTSA 1FAXA 4H4FA 3SV7A 1LHCH 3BTWE 2CF8H 2VIQA 3EA7A 2OUAA 3A81A 3SU3A 2WPJS 1C1WH 1SFQB 3S9BA 1XXDA 2YNBA 2CHAC 2AYWA 1K9OE 1ZPBA 1A0JA 3E91A 4JYUH 2FTLE 4X1QU 1IOEA 1WOFA 1Y3UA 4AB8A 1TB6H 1A3EH 4CBOA 1QRXA 1S83A 1IHTH 1TRNA 4INKA 3T5FH 2BX4A 4ISNA 3UY9A 3LOXA 3VXFH 3NK8A 1QFKH 1W11U 4H6SB 5FHTA 3A83A 9LPRA 1ABIH 3RXOA 3SNDA 8ESTE 2QXIA 3F9GA 2STAE 1ZRBA 2Y5GA 5K7RA 1QA0A 3PMBB 2Y6TA 1O2PA 3LH3A 1HYLA 1YGCH 3A89A 1OWIA 1SHYA 4X8SH 1S84A 3SJ9A 1G3BA 3SNCA 4D9RA 3D49H 1YPLH 5K0HA 1QRZA 1A0HB 2PLXA 3AW1A 2F91A 1QR3E 3BIUH 2ZTXA 3QUMP 3KN2A 1GVKB 1V2QT 4AB9A 1C2GA 5DO4H 2GDDA 3FFGA 3RXLA 1UTLM 3EA8A 4AG2A 3K2UA 2P16A 3LDXH 4A1VA 3GDSA 1PYTD 8GCHG 1P02A 4HZHA 1AMHA 2BQ7B 4X2XA 3GY8A 2Y81A 2WUBA 1GJ5H 2VVUA 5EOKA 2HPQH 3M3TA 3KQCA 1IQKA 1P2NA 3URCA 2J9NA 1IHSH 1LO6A 3RXQA 1BA8B 1W13U 2GP9B 2Q1JA 1TALA 1GI6A 1FY3A 1C1UH 3TU7H 1SC8U 1F7ZA 2XC0A 2ZGXH 4NSYA 1ELGA 1W8BH 3KQEA 2BD3A 3T62A 2J95A 2ZGJA 2CN0H 1DXPA 3PMJA 3PTNA 1THPB 1DUEA 1BJUA 3GCHB 4I7YH 1CGHA 2TPIZ 3A7YA 1CO7E 5DK1A 1T7CA 1DDJA 1ESAA 2CJIA 3SJOA 3UNRA 1TRMA 2F9NA 3CS7A 1H9IE 4IMQA 2ZHDA 1UTKA 1IQMA 3HK3B 2G5VA 3A87A 3OY6U 2BVSH 2BLOA 3RC5A 2D26C 1L4ZA 1O0DH 1AKSB 1GBAA 1TA2A 4JZDH 1N8OB 2CGAA 2QXHA 1ELTA 2XXLA 3SGBE 4MPWA 7ESTE 1F0TA 3VPKA 1GMDG 4O3UA 1SLVB 5FPTA 2BD7A 3ZYEA 3RU4T 3RXTA 1O3DA 2FS9A 1U6QA 2H1UA 4AZ2B 4DY7B 1MKXH 1AKSA 1YYY1 5GXPA 4MG3A 2GMTB 2ZC9H 1K1IA 1O39A 4ABJA 2FODA 5FAHA 2W7SA 1KYNA 3HKIB 1H9HE 5DKMA 4GHQA 2OC8A 1G36A 4WMFA 1GGDB 1E36B 5TCCA 1C5OH 1ZGIA 3HATH 4Y7AA 3EYDA 3KQBA 1HJ8A 4MNXA 2ZTZA 3I77A 3PMHB 3MO6A 4ISOA 4AFZA 1QHRB 4DOQA 1NRNH 1SGTA 3U69H 1A46H 4K5ZA 1GVLA 3BEUA 1ZMLA 5SGAE 1UHBB 2PR3A 1K1PA 3ELAH 1AE5A 3O8BA 4UEHH 1HDTH 3RU4D 4TPIZ 3A7VA 4AFUA 1YPMH 3STIA 3DFLA 3SUDA 3F9HA 2B9LA 3UTUH 4D76A 1B0FA 2ZF0H 3H7TA 1AHTH 1EXFA 2H6MA 3KL6A 1UVOA 4FUIA 2O8LA 2YOLA 3UFAA 2O8WA 4KTSA 1NC6A 1J8AA 3ZZ4A 2ZKSA 2J94A 1OX1A 2W5EA 1O5EH 2FYQA 1H8IH 5DP7A 6GCHG 2A4OA 1BCUH 2H5DA 1Y5AT 1EUFA 1OS8A 3R3GB 1GHAF 2D2DA 4B71A 3AASA 3F68H 5AFYH 7KMEH 1QJ7B 4YESB 2PGQB 1O2YA 1AZ8A 1QJ1B 3P17H 1NFUA 2ZEBA 1SGEE 3ZZ8A 5DG6A 2BXUH 5A8ZA 1PQ5A 5C20A 2QAAA 3GISB 2UUJB 1GJ4H 4UFDH 1C5XB 2UUYA 1NPMA 4X6PA 1EAIA 1OYQA 2BM2A 1J14A 4X6OA 2OBOA 1LQDB 2VWMA 1WBGB 1PPCE 1E0FD 2Z94A 3AVZA 2NU0E 4LK4A 2WV5A 1OXGA 2AERH 3GDVA 1GBBA 1P3EA 3MH6A 1O2HA 1GHBF 2WYJA 7GCHF 1GHBG 2VIOA 1MD8A 1B5GH 4JMYA 2ZHFH 2YNAA 1HB0B 4ABFA 3ZZ3A 1IAUA 2BB4A 2OC0A 3LGWA 4RSPA 4B73A 4K2YA 2PFEA 3K9XB 1AWFH 1SGFG 1Y5UT 4DURA 2FI4E 2OP9A 5DPAA 4LZ1H 1ZYOA 1MTWA 2ZWLH 1S82A 4WJG2 4X1SU 1FZZA 5AFZH 5E8EH 2BDYA 3ZVDA 2BY6X 3LGYA 4Y7BA 1DICA 1A3BH 1CGIE 1UTNA 4DVAU 3BEFB 3VFEA 3M3SA 2FS8A 1GMDF 2ALPA 3RP2A 4BANB 1H1BA 1W7GH 1BBRK 3TGKE 4WF8A 5C1XA 1EP5A 3P8FA 5H4IB 4Z6AH 1YP9A 1P3CA 4IMZA 1KXBA 2LNCA 3GYLB 1AN1E 1BMLA 3HK6B 2BXTH 4OS2A 4FUBA 5A09A 1WQSA 2GVFA 1TGCA 1TOMH 1SHHB 1O34A 3TVJB 2ZDNA 5GPIB 2R2MB 3MMGA 2OBQA 1T8MA 1Q3XA 1P01A 1D9IA 1L1NA 1FIWA 1QCPA 1G32B 1TMBH 1BHXF 2ZIQH 4FUJA 5E0HA 3VGCB 1SGFA 1CA0B 2HALA 2XBWA 2BZAA 1GI7B 4ZKSU 2FESH 2JKHA 4FUEA 1TNKA 3LPRA 1RFNA 2JETB 1TQ7B 1BJVA 4CR9A 3GOVB 1O3LA 2HNTC 3ZZ5A 1GBFA 5GJ4B 5FX6A 3QWCH 2P3FH 1CVWH 1GJDB 2AFQB 2PSYA 1AI8H 4NFFA 2VB0A 2OTVA 1G30B 1NU9A 1V2NT 1PPFE 1ZR0A 2G00A 1ANBA 1LKAA 4I8GA 3U1JB 3ZZ6A 2IOTA 3SW2B 3E16B 3GCHC 3UUZA 4O3TA 2TBSA 1SOZA 4JK5A 2ZU1A 2CHAB 2XCNA 1UTJA 4RKOB 3RXFA 1PPBH 4OS1A 2PTNA 1DITH 3M5NA 3RXDA 2P93A 3SZNA 2VJ1A 6GCHF 4QT8C 1XUKA 2HPPH 5HMAA 2H2ZA 1MTNC 1MAYA 1M9UA 3SUGA 4MVNA 3K6YA 3ZVGA 1YM0A 2OC7A 3PWCA 3QGNB 4MPVA 2XTTB 3DA9B 3KIDU 1TBZH 3BTME 1KDQB 3RXMA 2BD8A 5LH8A 1GI4A 2SFAA 5JYIA 2FX6A 3RXEA 4ASHA 4O97A 2AMDA 1O35A 4E7RG 3IG6B 1L4DA 2WUCA 3LGTA 1NRPH 5FBEA 2ZU4A 1HAIH 1FNIA 2J2UA 1KDQA 1SFIA 2PV9B 2B7DH 2XBXA 1VITG 2ZCKP 1HPGA 2FZZA 2TIOA 4NIXA 1MZAA 1HAZB 2QIQA 2GCHG 5FCKA 1SQTA 1V2KT 2ZGHA 3MU1A 3E0NB 4AORA 2HOBA 1KIGH 2R0LA 1TABE 2C8ZB 4D7GA 4I33A 2V6NA 3RXIA 3SJ8A 2VIWA 8LPRA 1UCYE 1O3IA 1GDNA 3MU4A 5GWZA 4Y8YA 1QBNA 4ABHA 1LDTT 2JH6D 5FX5A 3MH7A 4TYDA 3BG8A 4H6TA 4AOQA 2A32A 1SSXA 4ABDA 4MNVA 2VVVA 3VB3A 1GMCG 1CE5A 2EEKA 1ANDA 1GI9B 1C9TA 1QB9A 1GDUA 3PMAB 1P2OA 4X2WA 3OY5U 3ZVFA 4Q80A 1ANCA 4CRAA 3SHAH 1O3AA 2QY0B 1QA7A 1YBWA 1EOLA 2TRMA 2ZPQA 3SV8A 2A4RA 3C27B 1NO9H 1A0LA 1SB1H 1ESBA 1SVPA 2OCVB 4NIYA 1RXPA 3MHWU 1LCYA 4U01A 3SUFA 2R3UA 3QN7A 1K1NA 1AUJA 4AX9H 4O03A 1BTZA 2RG3A 2OQ5A 3BTGE 2PKSC 3PLBA 3KCGH 4XBBA 1ZRKA 1VCWA 2ZNKH 1SPJA 1XUJA 3GCNA 1OWHA 1BTWA 1Y3XA 4Y8XA 1EAWA 1SMFE 1O36A 3A82A 5DP4A 2GMTC 1YCPM 1TPOA 3KGPA 4AGJA 1Z71A 1CGJE 2SGEE 1WSSH 2BOKA 1P2MA 5C3NA 4IW4E 3FP6E 4MNYA 2STBE 4X1NU 1BITA 1GMCF 3UR9A 2GV7A 4CRCA 5PTPA 1ZPZA 1KLIH 1LPGB 2A31A 2SGDE 3GY2A 5TJXA 1SOTA 1AWHB 1G9IE 1TX8A 2ZZUH 5EW2H 2A1DB 3NPSA 1P2IA 2Y82A 1Y3VA 4D8NA 2BLQA 2G8TA 4JK6A 1SGNE 4MTBA 1SQAA 1DM4B 5GDSH 3RXCA 4B75A 2FTMA 3DUXH 2ALVA 3LJJA 3M3VA 1ETRH 3RMNH 3ODFA 1LHGH 2BY7X 2A5AA 1EB2A 3F9FA 1ORFA 1GMHG 3M7QA 1C1TA 1FONA 1GJ9B 1EZXC 1T8OA 1SBWA 1EAXA 1JXPA 4NA9H 1C2JA 5GIBA 3MNSA 1T31A 4AGKA 3M35A 2ZPSA 1HAVA 1Y59T 1G3DA 1BIOA 3MO3A 2C4FH 1MZDA 1QRWA 2ASUB 1TLDA
chains in the Genus database with same CATH superfamily
4A1XA 1OWDA 4MPXA 1C1PA 3V0XA 2ZDLA 3EE0B 3N7OA 2V3MA 2VWOA 4ZKOU 4ZAEA 1P05A 3FP8E 1AU8A 2A5IA 4B74A 3BV9B 2Z9KA 4NIVA 1C1OA 2KM0A 1A5HA 2YMSB 4A5TS 4FU8A 1RTLA 4ZUHA 1A2CH 2PUQH 5KGOA 4NCYA 4BAOB 1ELDE 1RRKA 3RLYH 1Z7KA 4YXWD 4DJZB 1O33A 1LVMA 2FI3E 5AF9H 3PO1C 1TQ0B 1TPAE 1MU6B 3FZDA 4GLYA 4GVUA 2WPHS 4B1TA 4BAMB 3RM2H 4XSKU 4KELA 2EI6A 2F3CE 1SGPE 1TPSA 1K22H 2XRCA 1SL3A 3M61U 4I86A 1JIMA 3KYGA 1NN6A 2ZCLP 3S9AA 2BYAX 4NFEA 1ZTKA 1GL1A 1ZHMA 3ZVBA 4NGAH 1G2LA 2FO9A 2ODPA 4CRGA 1HIAA 3P70B 4FUFA 3VXEH 2DE8A 3TNTA 5EQRA 1AVXA 1DS2E 1T8NA 2VU8E 1Q31A 1C5TA 2M5TA 2V3OH 1C5MD 2VIPA 2BDCA 5T3HA 1XXFA 2W6JD 1UTQA 2XWAA 2FOGA 1MUEB 3TK5A 3G01A 3WWBA 3E8LA 1Y8TA 1BTYA 1O5BB 1HAXB 1DFPA 1O2SA 2QA9E 3AK5A 3PRDA 2SGQE 4OS5A 3BTDE 4IGDA 3W95A 1C2LA 1HAHH 1K28D 5I46H 3O8RA 2C8XB 3RXBA 3SUEA 2FOCA 3WWFA 4BTTB 2FOAA 3F9EA 4CRFA 3NWUA 3QTVH 1NZQH 1KTSB 5HM9A 4PROA 1UMAH 4FUHA 1KLJH 1BMFD 3LC5A 1NFXA 1ZMNA 1P8VC 3TH4H 2OINA 1F0RA 2TGTA 1HJAC 2EQNA 3D62A 1RTKA 1MAXA 2VINA 1RIWC 5FBIA 2KCPA 1MCVA 1EJAA 1GWAA 5HGGA 1CA0C 1UVPA 3ZZBA 6CHAC 1L1GA 2W3KA 1JIRA 2ZDKA 1HIAB 2FYRA 1O2GH 3MI4A 2VH6A 3SNEA 3RXSA 1FY8E 3SHCH 1T8LA 2C3SA 1C5QA 1AFQB 1EQ9A 1DVAH 1IQLA 2J97A 4UFFH 1O5CB 4X2VA 2FMJA 3H5CB 3SU2A 1HXEH 5LPFA 2BDIA 3EGKH 1O3JA 1UCYK 3PV2A 2D8WA 2G5NA 3MTYA 2FX4A 1ELVA 1EX3A 3MQKC 3BG4B 3WW7A 2G4UA 3ITIA 2GD4B 3F0OA 1K2I1 1VCQA 2C90B 1AVGH 2BD4A 1SGRE 1WTGH 3GICB 3VB6A 3RXRA 1K1LA 3ZV9A 1GPZA 1TNJA 3TGJE 1FY5A 3RXPA 1ANEA 3E0PB 1HNEE 1EASA 2QE7D 3LKWA 1EZSC 1GBDA 1SLXB 2ZFRH 4NA8A 1GI2A 2ESTE 2ANKH 4CRBA 3GDUA 1GBHA 1S6LA 2TGAA 3L6PA 1C5LH 2LPRA 3ZZCA 1WU1A 4WMEA 5DP3A 4NZQA 3S9CA 3RC6A 3BF6H 1XUGA 2BQWB 1C2IA 2BDAA 1XM1A 2GZ7A 3VB7A 3MFJA 2NU2E 4U2WA 2GV6A 2DUCA 1O31A 4XBDA 1GJ8B 1HFDA 4FUDA 4FUCA 3VG8A 3T29A 3BSQA 2BTCE 3SNAA 3PM3A 3SORA 2OK5A 1P0SH 1P57B 4LXBH 1ZJKA 3U8TH 3LGUA 1J16A 1DY9A 3Q00A 4Y71A 4ABGA 2KAIB 1A61H 1K1OA 1IQJA 2VVCA 3SI3H 2OC1A 4X1RU 2ZHEH 1C5SA 4IC6A 1INCA 3DCLA 1YPEH 1XVOA 3SO3A 4ZMAH 1TFXA 1AQ7A 1ZHPA 3FOAA 5F03A 1YPJH 1C1NA 1O3FA 4B6FA 1FDPA 1C4V2 1MTUA 2GCHF 4ZCNA 4YOIA 1RD3B 4BAQB 2VNTA 2FOHA 1DLKB 1SG8B 1HV7A 3P92A 1VGCB 2VBCA 3F0PA 2F83A 3MH4A 3ZVCA 2G81E 1T4UH 2A0QB 1J9CH 2GDEH 4IBLH 3ZYDA 1QL9A 1F0SA 2AS9A 3FZZA 3HPTB 2Z9GA 1NROH 2A5KA 1HCGA 2PSXA 1O2VA 5JBCS 2Y5HA 2J98A 1TPPA 4TWYA 1QQ4A 1S5SA 1EZQA 2FDAA 2QN5T 1PPEE 5FL7D 4Z0KA 1GCTC 3HGNA 2XBVA 5BRRE 3VGCC 1NESE 3CP7A 3BTEE 3F1SB 4ISIH 4YO9A 3EAJA 2IJD1 4TPYA 5JB8S 4YZUA 1LVBA 1PPGE 1GJBB 5C1YA 3GCOA 1YLDA 5C5NA 1E1RD 2JETC 4ZHMU 1N8OC 1P04A 1Z8RA 3GY4A 1BMAA 4BAHB 2Q6DA 1H8ED 2PTCE 3ZIAD 1KTTB 1GHXH 2AMQA 3A85A 4SGBE 4E7NA 2J34A 3UNSA 2K1QA 4B2BA 1ARBA 2Y7XA 3S69A 1P09A 4YLUA 3M5MA 2ZDAH 1O3CA 4ZXXH 3UB0A 1NS3A 5A8XA 1IQIA 1B0EA 1H8HD 2J98B 2VH0A 1C2MA 1W12U 2A7HA 1C5NH 2VIDA 3K6ZA 1VJAU 1W0JD 2AIQA 3LONA 4OGYA 3W94A 1J15A 1BUIA 1O3HA 1D4PB 3FP7E 3RXKA 3ESTA 3UWIA 4ESTE 1PFXC 2H9HA 3Q3KA 1DANH 1CT2E 1SI5H 1ELFA 3BTQE 5CE1A 1MTNB 2WPIS 3M36A 1NM6A 3UREA 1BQYA 1C1QA 1OWEA 4AN7A 5KECA 1S0RA 2OQUA 4J2YB 1DX5M 1AB9B 5EJ1A 2HWLB 5JBTA 3OE7D 5F8TA 4I32A 1GBIA 1C4U2 4GHTA 5T6DA 2QCYA 3KHVA 3M37A 2FPZA 1DXWA 2NU1E 1O3OA 4Y0YE 5EXLA 3T27A 3NKKA 1Z8IB 1ZTLA 1ZMJA 4E06H 1NY22 4A1TA 2XW9A 4CBNA 1HAYB 4K60A 3BTTE 1W7XH 1YPHC 5T6FA 1O37A 3A8BA 4WY3A 3ATLA 1BBRH 1HUTH 6CHAB 1T32A 1SGYE 1C5WB 4B2CA 3ZZ7A 1BRCE 1KXEA 1UK2A 1GBJA 1O3GA 1HAOH 3A7WA 1MQ5A 1V2OT 2L6OA 2THFB 1LPKB 2O8UA 1O5AB 1V2LT 5ESTE 1BBRE 2ZCHP 1W14U 3M5OA 2K8IA 1GJ7B 3KQ5A 1H8DH 4HFPB 1DWBH 1OP2A 1VGCC 2BX3A 1C2FA 1O38A 3RXHA 1EOJA 4A92A 2UWPA 1GI8B 4F49A 1CHOF 5B6OA 4X6MA 3VB5A 1TGTA 4NWLA 1VITF 4NSVA 2UWLA 2ZDMA 4AFQA 1GHYH 3S0NA 1FXYA 1ABJH 2BDHA 2ZFFH 5CHBA 1UVSH 2Q6GA 4D9QA 2F9VA 1N6XA 2RDLA 4WH6A 2B5TB 2V35A 6LPRA 3UQOA 2Z7FE 4RKJB 3AW0A 3GY3A 5EG4A 1CBWB 1P11E 2Y5FA 1EB1H 2NWNA 1L0ZA 4D7FA 1BT7A 1GCTB 2FXRA 1W0KD 3GCTG 4K1SA 3GCTF 4JCNA 3MNCA 1GBLA 2PGBB 3RUOA 2ZDVH 2ZHQH 2TGPZ 3NZIA 3O8CA 3SV2H 1V2UT 1O3KA 4JYVH 2HLCA 2I6SA 1SQOA 1CQQA 3Q3XA 4R0IA 3W1EA 5EPYA 1NRSH 1NTPA 3UQVA 1C1SA 4X8VH 2WPMS 3PB1E 1V2RT 2Y80A 4HI3A 4Q2KA 3U28C 3MNXA 3KF2A 4RT1A 1O2IA 2IN2A 4ISHH 1QBOA 4IN1A 5DP9A 1A5GH 1GI5A 5LGOA 5TCAA 3SJIA 1P12E 1NU7B 3QTOH 2L74A 4KP0A 2BQ6B 1DPOA 2AIPA 3DSPA 1AZZA 4WWYA 4WVPE 3SGAE 1F5LA 4M9FA 2EI7A 3OU0A 4IC5A 3SJKA 2J38A 3I29A 1GHAG 4FVDA 1MTVA 2GT8A 1C5UA 3P8OA 1F92A 1QURH 1YPHE 4OGXA 3QZQA 2P8OB 3ZV8A 4AFSA 2C8YB 4Q7XA 2ZFPH 1GJCB 3E1XB 4Y79A 4OS6A 1WAYB 4Q7YA 1V6DA 3T26A 2HLDD 3BTKE 5AVDA 1BTPA 1DSUA 2ILNA 2P59A 1D3TB 2VIVA 1FI8A 3A8CA 1LVYA 1MKWK 2R2WU 4BNRA 1P03A 4GPGA 5EGMA 3F2HA 1P06A 1ZJDA 1ELEE 2PKAA 3SQHE 4RN6A 4UE7H 3RMOH 3V3MA 2GZ8A 3BIVH 3PV4A 4JYTA 1ZOMA 1PPHE 2FLBH 1TX7A 1KY9A 3QK1A 1V2PT 2QXJA 5DP8A 3BTFE 1DUAA 4BAKB 2FWWA 3UOPA 4BOHA 5BPEA 1LKBA 1O2MA 2Q6FA 2A4GA 1THSH 3SU1A 4KGAA 3DHKH 2UWOA 1XX9A 1O2ZA 3CNRA 3D23A 1EJMA 3BN9A 1QY6A 4XDEA 3A7XA 3SU6A 1N6YA 1PQAA 5EQQA 5JB9S 3FANA 1MKXK 4MDSA 4YT6H 4CREA 3BEIB 2QV1A 1O3MA 3O8DA 2P95A 2G52A 3F6UH 4Q4LA 2XYAA 5E2PA 3U9AH 2PKAB 1ACBE 2AEIH 3QX5H 5L30H 5JBAS 1Z8JB 2EA3A 4WXVA 5T6GA 3VEQB 2PKSB 1OP0A 1TONA 3RDZA 1W3CA 1L2EA 2F9BH 3UIRA 2ZP0H 2A7CA 4INLA 3ATMA 4X1PU 2GT7A 2KAIA 2OD3B 2VGCB 3QO6A 2O9QA 3LT3A 1PPZA 1O3PB 4FU9A 8KME2 5CMXH 2Z9JA 1G37A 1QB1A 4ZH8A 2Z3DA 4E05H 5HXFA 2KX4A 1QB6A 3SU5A 1VJ9U 3LIWA 3LH1A 1CA8B 1JBUH 3RXUA 3HKJB 1ZSLA 2GTBA 2GZ9A 2NU4E 2XBYA 3NUMA 1BMNH 1HAGE 4TY7A 4HGCA 1GI0A 1FQ3A 3D65E 3E90B 3MU0A 1D3QB 2F9UA 2QGRA 5E2OA 4X2YA 1FIZA 4XOJA 4YLQH 1O2OA 4I8HA 1ETTH 1DWDH 1ZHRA 2C8WB 2PHBA 1V2VT 1HAPH 5EXNA 1S85A 2AGIX 3GYMA 1O3NA 1AGJA 4ZKNU 3ZVEA 4NIWA 2W7UA 2R0KA 4K69A 4X6NA 1D3DB 1FPCH 3Q76A 3PROA 1XUIA 1SLUB 3B23B 4MPUA 1NRRH 4YTAA 4CRDA 1DE7H 2ZGCA 1C1RA 5A0AE 1YKTA 3A88A 1S6HA 1TOCB 3QGJA 1FJSA 1UK4A 3ATKA 2P8OC 1MABB 1BDAA 2ODYB 7GCHG 5EIYA 1WUNH 4DT7B 2HNTE 5A0CA 1OWKA 4HTCH 1ZSKA 4FU7A 1IQGA 1DOJA 4TY6A 3S7HB 1SGCA 1BOQA 3SZEA 1UVTH 3V12A 1BTXA 1GHWH 1TGSZ 3ENSB 1E1QD 1KXCA 2FEQH 1P9UA 5C67A 3FKSD 1XKBC 4GAWA 4SGAE 1EPTB 2W26A 3URDA 1F2SE 3MOCA 1OYTH 3F3BA 1TBRH 1QL7A 1TE0A 1ELAA 1TMTH 2Z6BD 4A6LA 3B8JA 1KLTA 2GGVB 1FV9A 2UUFB 3L3TA 3P95A 1C1VH 1QIXB 3CS0A 5EW1H 4THNH 2EI8A 2I6QA 4TWWA 5LPEA 2QF4A 1GBTA 5EPNA 4BXWA 1TA6A 3TLOA 5FCRA 3MNBA 1RGQA 2SGFE 2EY4C 4ABBA 1GBCA 1V2WT 2VGCC 4K1TA 2BOHB 1JOUB 1GI3A 2WV4A 1W2KH 3RXAA 1UJ1A 1MBMA 1UVUH 2IPHA 1EP6A 1KSNA 3RM0H 1GG6B 1W0ZU 4FUGA 3LC3A 2HRVA 4I31A 1O30A 1TNHA 2R3YA 1SGIB 1F5KU 1QL8A 4I8KA 4X0WU 2QF0A 1HGTH 4WH8A 2V3HH 1O2NA 4B2AA 1JRTA 1FPHH 3TIUA 1TGBA 3B9FH 4DIIH 1HJ9A 1ELBA 3WY8A 3TPIZ 1TBQH 1RS0A 2FP7B 2G51A 5FPSA 4J1YA 1NFWA 2XCFA 2J92A 2RA0A 3ZZAA 1O2LA 2PWXA 1O2XA 3SQEE 4FVBA 3EA9A 1EPTA 1C1MA 1DWCH 5CHAB 1EFRD 2IJOB 2SNWA 2PUXB 3U1IB 2J4IA 4FXGH 1E79D 2VWLA 3IITA 1A4WH 1GBMA 2B8OH 2OLGA 5DJ7A 5L6NH 2HGTH 1PQ8A 5GCHG 1CU1A 1IQNA 2ANYA 3DT0H 2BLWA 2P3TB 1UTMA 3TNSA 3DD2H 1C4Y2 2WV9A 3KQDA 1XMNB 3RXVA 2ZFQH 1BTUA 2JIZD 2WPKS 1ZGVA 1GBKA 2ZU2A 4JZ1A 4OS4A 4U30A 1O5DH 2QF3A 3ZVAA 5EQSA 5KEDA 1GDQA 2BDGA 3P8NA 1Y3WA 5DSFA 4M7GA 1TNIA 3IWMA 4X8UH 1THRH 2QF5A 4CR5A 1FMGA 1C5ZB 4CH8B 2QXGA 5EJZA 3LU9B 1O2KA 2ODQA 3STJA 5I25A 4DGJA 1MKWH 4BXSA 2XC4A 2WSSD 3A7ZA 3U8RH 1WDIA 4F4OC 2G4TA 5EJLA 4XFQA 2JJ2D 3P8GA 1BZXE 1TWXB 4BTIB 1O3EA 5ABWA 1FN8A 3FO8D 4I8JA 4YT7H 2Z3CA 1OOKB 3P6ZB 1SGDE 1DWEH 4XBCA 4X8TH 3SV6A 3SNBA 1MQ6A 3MU5A 1D6RA 1LTOA 2FM2A 1MBQA 4ABIA 3KEEA 4Y11E 2BD2A 1UO6A 3U98H 2GKVE 1OP8A 4Q63A 4ZXYH 4Y10E 4VGCC 2FI5E 1O2UA 1NRQH 1RTFB 3TGIE 5E0GA 2KCOA 1AFEH 3TJVA 1FN6A 3AAVA 4K8YA 5HIYA 1N1LA 3C1KA 1V2ST 1GG6C 1QBVH 4Q7ZA 1HXFH 3Q77A 5C0UA 4JZIA 1FY1A 4DG4A 1BMMH 1E34B 5L2ZH 4NG9H 2RFKC 3OX7U 1C5RA 1SGQE 2A2XH 2ZG0H 5IDKA 3E6PH 2QYIA 1MCTA 1LHFH 2BDBA 3A84A 3EDXB 4I8LA 2BVXH 1EJNA 1A7SA 1COWD 5A0BA 3PWBA 3PLPA 1ZPCA 3M7UA 4CHAB 1HJAB 4AYYB 4KKDA 1E35B 1G3CA 1RIWB 2XOKD 5G4BA 1EATA 2EC9H 2KZ4A 4GUXA 4DW2U 1O3BA 1JWTA 1NT1A 5CDFE 3M7TA 2A4QA 4K8BA 2FLRH 3ZZ9A 1FY4A 1ZLRA 4LOYH 4Y8ZA 1C9PA 2BY5X 3TH2H 2NU3E 2QC2A 4B76A 5HYOA 3A8AA 4ZHLU 4WMDA 2KR7A 3UPEA 1JMOH 3TK9A 3TJOA 2H9TH 1AD8H 3HGPA 3UNQA 5IK2D 1AFQC 3PLKA 2GJGA 4A7IB 2ZO3H 2HNTF 5HKKD 1Y3YA 1S6FA 1C5PA 3PYHA 2J5UA 3RU4E 1UTPA 1ELCA 2WINI 2BVRH 4AG1A 4UD9H 5J4SA 3Q3YA 1V2JT 2TGDA 4NA7A 1AIXH 1Z8GA 3R0FA 1AY6H 1PJPA 3U8OH 5FXLA 2WHXA 1DLEA 1YC0A 3V7TA 1O2TA 2PP6A 2ZU5A 4DIHH 1H4WA 2ZPRA 2B0FA 1ZZZA 1S0QA 4IN2A 2FOFA 1YPKH 1E38B 5E0JA 4O9VA 3TITA 3ZZDA 3LGVA 4ISLA 1KXFA 3TJNA 3RC4A 2Z9LA 1AVWA 1O32A 1WV7H 1CT4E 4YOJA 5L2YH 1D6WA 2R9PA 1GHVH 2CMYA 4UONA 1VR1H 2XNDD 3LJOA 1GMHF 1WCZA 3UR6A 1TRYA 1YCPH 2W3IA 1BHXB 3KNXA 1MH0A 5J4QA 1XVMA 3QZRA 3OTJE 1NBME 3I78A 5LPRA 2V7QD 1C2HA 2ZU3A 4XD7D 3OEED 1FLEE 4MNWA 3H7OA 2PW8H 1O2QA 7LPRA 5AHGH 2M2AA 3ATWA 1WXRA 1LMWB 2P94A 2SNVA 3NRLA 2BY9X 4JZEH 1O5GH 1GJAB 2RCEA 3RLWH 1F0UA 3M5LA 4ZKRU 1VZQH 2H5CA 1HBTH 2RA3A 1GL0E 1HLTH 1TNGA 4GCHF 2AH4X 3EQ0H 1YF4A 1X7AC 2ZGBH 2JH5D 2ZI2H 1V2MT 1P2JA 4VGCB 1ZSJA 2CXVA 1GHZA 4CHAC 4YM9A 2ANMH 1A5IA 1TYNA 2A7JA 2SGPE 1O2WA 3V13A 1EAUA 1UHBA 2O8MA 1K21H 5IYTA 1YCPK 3FVFB 1V2TT 2RDEA 2CF9H 3T28A 3MH5A 1QJ6B 2SGAA 1FX0B 1CHGA 2JH0D 1GBEA 3GY7A 1PQ7A 1QNJA 1TGNA 3UOUA 2HVYB 1SKYE 5C2ZA 1O2JA 2ZA5A 2ANWA 2UUKB 2AGEX 4ZROA 3GY6A 2KCYA 1AO5A 1HRTH 2P3UB 3VB4A 3FN8A 1L1JA 2KCAA 3A86A 3RMMH 3AAUA 1KXAA 1QTFA 4P00A 4Y0ZE 1Z1JA 3MO9A 2AMPA 4UDWH 1TIOA 3SN8A 5ESBA 2F9PA 3L33A 2OXSA 3JZ1B 2ZECA 2FIRH 2Y7ZA 1P9SA 1BB0B 1IQHA 3A7TA 5F8XA 4AYVB 1V3XA 1ARCA 4RI0A 2BZ6H 5F6MA 5EODA 1CHOG 4XE4A 1G2MA 4YOGA 1OSSA 1NFYA 4WXIA 2BMGB 5GCHF 5A8YA 5DP6A 5C1UA 2AGGX 1KXDA 4K1EA 1MMJN 2FOEA 1EPTC 3NXPA 1O5FH 1LVOA 1VITH 1UTOA 3T25A 1GVZA 4KTUA 1QGFA 4BTUB 1TX6A 1HAVB 3EE7A 3S7KB 1K1JA 5C5OA 1Y5BT 2BY8X 1B7XB 1K1MA 2GCTB 3PO1B 1A1RA 1GI1A 2F9OA 3SV9A 1J17T 1C2DA 4ABEA 1GJ6A 1XUFA 1SLWB 2A2QH 1TMUH 4ZHAA 2FOMB 4Y76A 1GCDA 3RXGA 1E37B 6ESTA 2ULLA 4LZ4B 1LHDH 1EKBB 4R8TB 3RXJA 2H9EH 1SR5C 3LGIA 3OAAD 3SI4H 1TNLA 1P2KA 2DE9A 4INHA 5DP5A 2VWNA 4GCHG 2BD9A 1OHHD 3ODDA 3FAOA 3T2NA 1XKAC 3A8DA 2D1JA 1G3EA 3SBKA 3A80A 1DSTA 1AE8H 1FUJA 4NZLA 3ATIA 3OYPA 3MYWA 1T4VH 4UFEH 1XUHA 1ETSH 2ZQ1A 2A45B 5JDUB 3TK6A 1UK3A 3QLPH 2WPLS 3BTHE 5JPMH 2O8TA 1Z1IA 5FPYA 4KTCA 1PYTC 1BRUP 1RJXB 5CHAC 3TH3H 1ZTJA 1OWJA 2FOBA 3NCLA 4DCDA 1Z6EA 3OSYA 1W0YH 3GY5A 3JZ2B 4OS7A 3UWJH 4Y6DA 1YPGH 1AB9C 1BRBE 4GSOA 1D3PB 1VCPA 1IQFA 1GGDC 1P10A 1F5RA 5DGJA 2G55A 1LQEA 1O2RA 4JZFH 1OPHB 2XWBI 4H42U 2ZFTA 2C93B 3SU4A 4K3JA 1WYKA 1CT0E 1Z6JH 3MU8A 4NWKA 3RMLH 1YLCA 1WQVH 4MLFB 5ETXA 3DFJA 2Z9IA 4U32A 4ABAA 1KMHB 4ACAA 1QQUA 2XNIA 4IS5A 1BTHH 5B6LA 1UCYH 3TJUA 3CENA 1OKXA 3K65B 5JBBS 1AUTC 5HM2A 9ESTA 2GX4A 3E3TA 2ZQ2A 1BRAA 5F8ZA 1MD7A 4UFGH 2XC5A 2ZTYA 1JRSA 1Q2WA 1C2KA 1EZUC 2CV3A 4FETA 1C5VA 1FAKH 4CH2B 1CSOE 1K0HA 2YMSC 2HVXA 1CBWC 3OEHD 4OM9A 4MQAA 2V0BA 1C2EA 3MWIU 1LHEH 1W10U 1IQEA 2GCTC 2BHGA 1LPZB 2ZFSA 5A2MH 8GCHF 1TAWA 5EU8A 3QDZB 1C5YB 1P2QA 1S81A 1MU8B 1DT2A 1DY8A 1WTHD 3SOSA 1ESTA 2BD5A 2Z3EA 1H9LB 2WYGA 1ID5H 2ZHWH 5EXMA 3SU0A 3SGQE 5F53A 2BLVA 3PTBA 3BG4C 1MTSA 1FAXA 4H4FA 3SV7A 1LHCH 3BTWE 2CF8H 2VIQA 3EA7A 2OUAA 3A81A 3SU3A 2WPJS 1C1WH 1SFQB 3S9BA 1XXDA 2YNBA 2CHAC 2AYWA 1K9OE 1ZPBA 5HIZA 1A0JA 3E91A 4JYUH 2FTLE 4X1QU 1IOEA 1WOFA 1Y3UA 4AB8A 1TB6H 1A3EH 4CBOA 1QRXA 1S83A 1IHTH 1TRNA 4INKA 3T5FH 2BX4A 4DT4A 4ISNA 3UY9A 3LOXA 3VXFH 3NK8A 1QFKH 1W11U 4H6SB 5FHTA 3A83A 9LPRA 1ABIH 3RXOA 3SNDA 8ESTE 2QXIA 3F9GA 2STAE 1ZRBA 2Y5GA 5K7RA 1QA0A 3PMBB 2Y6TA 1O2PA 3LH3A 1HYLA 1YGCH 3A89A 1OWIA 1SHYA 4X8SH 1S84A 3SJ9A 2LELA 4P02A 1G3BA 3SNCA 3F2GA 3D49H 4D9RA 1YPLH 5K0HA 1QRZA 1A0HB 2PLXA 1UW7A 3AW1A 2F91A 1QR3E 3BIUH 2ZTXA 3QUMP 3KN2A 3F2FA 1GVKB 1V2QT 4AB9A 1C2GA 5DO4H 2GDDA 3FFGA 3RXLA 1UTLM 3EA8A 2IPQX 4AG2A 3K2UA 2P16A 2WZQA 3LDXH 4A1VA 3GDSA 1PYTD 8GCHG 1P02A 4HZHA 1AMHA 3KYFA 2BQ7B 4X2XA 3GY8A 2Y81A 2WUBA 1GJ5H 2VVUA 5EOKA 2HPQH 3M3TA 3KQCA 1IQKA 1P2NA 3URCA 2J9NA 1IHSH 1LO6A 3RXQA 1BA8B 3N7EA 1W13U 2GP9B 2Q1JA 1TALA 1GI6A 1FY3A 1C1UH 3TU7H 1SC8U 1F7ZA 2XC0A 2ZGXH 4NSYA 1ELGA 1W8BH 3KQEA 2BD3A 3T62A 2J95A 2ZGJA 2CN0H 1DXPA 3PMJA 3PTNA 1THPB 1DUEA 1BJUA 3GCHB 4I7YH 1CGHA 2TPIZ 3A7YA 1CO7E 5DK1A 1T7CA 1DDJA 1ESAA 2CJIA 3SJOA 3UNRA 1TRMA 2F9NA 3CS7A 1H9IE 4IMQA 2ZHDA 1UTKA 1IQMA 3HK3B 2G5VA 3A87A 3OY6U 2BVSH 2BLOA 3RC5A 2D26C 1L4ZA 1O0DH 1AKSB 1GBAA 1TA2A 4JZDH 1N8OB 2CGAA 2QXHA 1ELTA 2XXLA 3SGBE 4MPWA 7ESTE 1F0TA 3VPKA 1GMDG 4O3UA 1SLVB 5FPTA 2BD7A 3ZYEA 3RU4T 3RXTA 1O3DA 2FS9A 1U6QA 2H1UA 4AZ2B 4DY7B 1MKXH 1AKSA 1YYY1 5GXPA 4MG3A 2GMTB 2ZC9H 4HG6A 1K1IA 1O39A 4ABJA 2FODA 5FAHA 2W7SA 1KYNA 3DSOA 3HKIB 1H9HE 5DKMA 4GHQA 2OC8A 1G36A 4WMFA 2LP6A 1GGDB 1E36B 4ASUD 5TCCA 1C5OH 1ZGIA 3HATH 3N7DA 4Y7AA 3EYDA 3KQBA 1HJ8A 4MNXA 2ZTZA 3I77A 3PMHB 3MO6A 4ISOA 4AFZA 1QHRB 4DOQA 1NRNH 1SGTA 3U69H 5DN6D 4FOUC 1A46H 4K5ZA 1GVLA 3BEUA 1ZMLA 5T1VA 5SGAE 1UHBB 2PR3A 1K1PA 3ELAH 1AE5A 3O8BA 4UEHH 1HDTH 3RU4D 4TPIZ 3A7VA 2JDID 4AFUA 1YPMH 3STIA 3DFLA 3SUDA 1YY3A 3F9HA 2B9LA 3UTUH 4D76A 1B0FA 2ZF0H 3H7TA 1AHTH 1EXFA 2H6MA 1YWUA 3KL6A 1UVOA 4FUIA 2O8LA 2YOLA 3UFAA 2O8WA 4KTSA 1NC6A 1J8AA 3ZZ4A 2ZKSA 2J94A 1OX1A 1NBMD 1O5EH 2FYQA 1H8IH 2W5EA 5DP7A 2A4OA 6GCHG 1BCUH 2CK3D 2H5DA 4F48B 1Y5AT 1EUFA 1OS8A 3R3GB 1GHAF 2D2DA 4B71A 3AASA 3F68H 5AFYH 7KMEH 1QJ7B 4YESB 2PGQB 1O2YA 1AZ8A 1QJ1B 3P17H 1NFUA 2ZEBA 1SGEE 1QZ8A 3ZZ8A 5DG6A 2BXUH 5A8ZA 1PQ5A 5C20A 2QAAA 3GISB 2UUJB 1GJ4H 4UFDH 1C5XB 1SQRA 2UUYA 1NPMA 4X6PA 1EAIA 1OYQA 2BM2A 1J14A 4X6OA 2OBOA 1LQDB 2VWMA 5C0TA 1WBGB 1PPCE 1E0FD 2Z94A 3AVZA 3OTPA 2NU0E 3N99A 4LK4A 2WV5A 1OXGA 2AERH 3GDVA 1GBBA 1P3EA 3MH6A 3PRBA 1O2HA 1GHBF 1YLNA 2WYJA 7GCHF 1GHBG 2VIOA 1MD8A 1B5GH 4JMYA 2ZHFH 2YNAA 1HB0B 4ABFA 3ZZ3A 1IAUA 2BB4A 2OC0A 3LGWA 4RSPA 4B73A 4K2YA 2PFEA 3K9XB 1AWFH 1SGFG 1Y5UT 4DURA 2FI4E 2OP9A 5DPAA 4LZ1H 1ZYOA 1MTWA 2ZWLH 1S82A 4WJG2 4X1SU 1FZZA 5AFZH 5E8EH 2BDYA 3ZVDA 2BY6X 3LGYA 4Y7BA 1DICA 1A3BH 1CGIE 1UTNA 4DVAU 3BEFB 3VFEA 3M3SA 2FS8A 1GMDF 2ALPA 3RP2A 4BANB 4Z1MD 1H1BA 1W7GH 1BBRK 3TGKE 4WF8A 5C1XA 1EP5A 3P8FA 5H4IB 4Z6AH 1YP9A 1P3CA 2YMSD 4IMZA 1KXBA 2LNCA 3GYLB 1AN1E 1BMLA 3HK6B 2BXTH 4OS2A 4FUBA 5A09A 1WQSA 2GVFA 1TGCA 1TOMH 1SHHB 1O34A 3TVJB 2ZDNA 5GPIB 2R2MB 3MMGA 2OBQA 1T8MA 1Q3XA 1P01A 1D9IA 1L1NA 1FIWA 1QCPA 1G32B 1TMBH 1BHXF 2ZIQH 4FUJA 5E0HA 3VGCB 1SGFA 1CA0B 2HALA 2XBWA 4B6EA 2BZAA 1GI7B 4ZKSU 2FESH 2JKHA 4FUEA 1TNKA 3LPRA 1RFNA 2JETB 1TQ7B 1BJVA 4CR9A 3GOVB 1O3LA 2HNTC 3ZZ5A 5C17A 1GBFA 5GJ4B 5FX6A 3QWCH 2P3FH 1CVWH 1GJDB 2AFQB 2K0QA 2PSYA 1AI8H 4NFFA 2VB0A 2OTVA 1G30B 1NU9A 1V2NT 1PPFE 1ZR0A 2G00A 1ANBA 1LKAA 4I8GA 3U1JB 3ZZ6A 5GNDA 2IOTA 3SW2B 3E16B 3GCHC 3UUZA 4O3TA 2TBSA 1SOZA 4JK5A 2ZU1A 2CHAB 2XCNA 1UTJA 4RKOB 3RXFA 1PPBH 4OS1A 2PTNA 1DITH 3M5NA 3RXDA 2P93A 3SZNA 2VJ1A 6GCHF 4QT8C 1XUKA 2HPPH 5HMAA 2H2ZA 1MTNC 3DSGA 1MAYA 1M9UA 3SUGA 4MVNA 3K6YA 3ZVGA 2WPDD 1YM0A 2OC7A 3PWCA 3QGNB 4MPVA 2XTTB 3DA9B 3KIDU 1TBZH 2JJ1D 3BTME 1KDQB 3RXMA 2BD8A 5LH8A 1GI4A 2SFAA 5JYIA 3PV5A 2FX6A 3RXEA 4ASHA 4O97A 2AMDA 1O35A 4E7RG 3IG6B 1L4DA 2WUCA 3LGTA 1NRPH 5FBEA 2ZU4A 1HAIH 1FNIA 2J2UA 1KDQA 1SFIA 2PV9B 2B7DH 3OFND 2XBXA 1VITG 2ZCKP 3UAIC 1HPGA 2FZZA 3GS9A 2TIOA 4NIXA 1MZAA 1HAZB 2QIQA 2GCHG 1VKYA 5FCKA 1SQTA 1V2KT 2ZGHA 3MU1A 3E0NB 4AORA 2HOBA 1KIGH 2R0LA 1TABE 2C8ZB 4D7GA 2W6ID 4I33A 2V6NA 3RXIA 3SJ8A 2VIWA 8LPRA 1UCYE 1O3IA 1GDNA 3MU4A 5GWZA 4Y8YA 4F55A 1QBNA 4ABHA 1LDTT 2JH6D 3SYJA 5FX5A 3MH7A 4TYDA 3BG8A 4H6TA 4AOQA 2AHME 2A32A 1SSXA 4ABDA 4MNVA 2VVVA 3VB3A 1GMCG 1CE5A 2EEKA 1ANDA 1GI9B 1C9TA 1QB9A 1GDUA 3PMAB 1P2OA 4X2WA 3OY5U 2KFWA 3ZVFA 4Q80A 1ANCA 4CRAA 3SHAH 1O3AA 2QY0B 3H09A 1QA7A 1YBWA 1EOLA 2TRMA 2ZPQA 3SV8A 2A4RA 3C27B 1NO9H 1A0LA 1SB1H 1ESBA 1SVPA 2OCVB 4NIYA 1RXPA 3MHWU 1LCYA 4U01A 3SUFA 2R3UA 3QN7A 1K1NA 1AUJA 4AX9H 4O03A 1BTZA 4TSFD 4AC9A 4RT0A 2RG3A 2OQ5A 3BTGE 2F43B 2PKSC 3PLBA 3KCGH 4XBBA 1ZRKA 1VCWA 2ZNKH 1SPJA 1XUJA 3GCNA 1OWHA 1BTWA 1Y3XA 4XRNA 4Y8XA 1EAWA 1SMFE 1O36A 3A82A 5DP4A 2GMTC 1YCPM 1TPOA 3KGPA 4AGJA 1Z71A 1CGJE 2SGEE 1WSSH 2BOKA 1P2MA 5C3NA 4IW4E 3FP6E 4MNYA 2STBE 4X1NU 1BITA 1GMCF 3UR9A 2GV7A 2F4LA 4CRCA 5PTPA 1ZPZA 2A31A 1KLIH 1LPGB 2SGDE 3GY2A 5TJXA 1SOTA 5C94A 1AWHB 1G9IE 1TX8A 2ZZUH 5EW2H 2A1DB 3NPSA 1P2IA 2Y82A 1Y3VA 4D8NA 4TT3D 2BLQA 2G8TA 4JK6A 1SGNE 4MTBA 1SQAA 1DM4B 5GDSH 3RXCA 4B75A 2FTMA 3DUXH 2ALVA 3LJJA 3M3VA 1ETRH 3RMNH 3ODFA 1LHGH 2BY7X 2A5AA 1EB2A 3F9FA 1ORFA 1GMHG 3M7QA 1C1TA 1FONA 1GJ9B 1EZXC 1T8OA 1SBWA 1EAXA 1JXPA 4NA9H 1C2JA 5GIBA 3MNSA 1T31A 4AGKA 3M35A 2ZPSA 1HAVA 1Y59T 1G3DA 1BIOA 4ACBA 3MO3A 2C4FH 1MZDA 1QRWA 2ASUB 1TLDA
chains in the Genus database with same CATH topology
4A1XA 1OWDA 4MPXA 1C1PA 3V0XA 2ZDLA 3EE0B 3N7OA 2VWOA 4ZKOU 4ZAEA 1P05A 3FP8E 1AU8A 2A5IA 4B74A 3BV9B 2Z9KA 4NIVA 1C1OA 1A5HA 4A5TS 4FU8A 1RTLA 4ZUHA 1A2CH 2PUQH 4NCYA 4BAOB 1ELDE 1RRKA 3RLYH 1Z7KA 4DJZB 1O33A 1LVMA 2FI3E 5AF9H 3PO1C 1TQ0B 1TPAE 1MU6B 3FZDA 4GLYA 4GVUA 2WPHS 4B1TA 4BAMB 3RM2H 4XSKU 4KELA 2EI6A 2F3CE 1SGPE 1TPSA 1K22H 2XRCA 1SL3A 3M61U 1JIMA 1NN6A 2ZCLP 3S9AA 2BYAX 4NFEA 1ZTKA 1GL1A 1ZHMA 3ZVBA 4NGAH 1G2LA 2FO9A 2ODPA 4CRGA 1HIAA 3P70B 4FUFA 3VXEH 2DE8A 3TNTA 5EQRA 1AVXA 1DS2E 1T8NA 2VU8E 1Q31A 1C5TA 2M5TA 2V3OH 1C5MD 2VIPA 2BDCA 5T3HA 1XXFA 2XWAA 1UTQA 3TK5A 2FOGA 1MUEB 3G01A 3E8LA 1Y8TA 1BTYA 1O5BB 1HAXB 1DFPA 1O2SA 2QA9E 4OS5A 2SGQE 3BTDE 4IGDA 3W95A 1C2LA 1HAHH 1K28D 5I46H 3O8RA 2C8XB 3RXBA 3SUEA 2FOCA 4BTTB 2FOAA 3F9EA 4CRFA 3NWUA 3QTVH 1NZQH 1KTSB 5HM9A 4PROA 1UMAH 4FUHA 1KLJH 3LC5A 1NFXA 1ZMNA 1P8VC 3TH4H 2OINA 1F0RA 2TGTA 1HJAC 3D62A 1RTKA 1MAXA 2VINA 1RIWC 5FBIA 1MCVA 1EJAA 1GWAA 5HGGA 1CA0C 1UVPA 3ZZBA 6CHAC 1L1GA 2W3KA 1JIRA 2ZDKA 1HIAB 2FYRA 1O2GH 3MI4A 2VH6A 3SNEA 3RXSA 1FY8E 3SHCH 1T8LA 2C3SA 1C5QA 1AFQB 1EQ9A 1DVAH 1IQLA 4UFFH 4X2VA 1O5CB 2FMJA 3H5CB 3SU2A 1HXEH 5LPFA 2BDIA 3EGKH 1O3JA 1UCYK 2D8WA 2G5NA 3MTYA 2FX4A 1ELVA 1EX3A 3BG4B 2G4UA 3ITIA 2GD4B 1K2I1 1VCQA 2C90B 1AVGH 2BD4A 1SGRE 1WTGH 3GICB 3VB6A 3RXRA 1K1LA 3ZV9A 1GPZA 1TNJA 3TGJE 1FY5A 3RXPA 1ANEA 3E0PB 1HNEE 1EASA 3LKWA 1EZSC 1GBDA 1SLXB 2ZFRH 4NA8A 1GI2A 2ESTE 2ANKH 4CRBA 3GDUA 1GBHA 2TGAA 3L6PA 1C5LH 2LPRA 3ZZCA 1WU1A 4WMEA 5DP3A 4NZQA 3S9CA 3RC6A 3BF6H 1XUGA 2BQWB 1C2IA 2BDAA 1XM1A 2GZ7A 3VB7A 3MFJA 2NU2E 4U2WA 2GV6A 2DUCA 1O31A 4XBDA 1GJ8B 1HFDA 4FUDA 4FUCA 3T29A 3BSQA 2BTCE 3SNAA 3PM3A 3SORA 1P0SH 1P57B 4LXBH 1ZJKA 3U8TH 3LGUA 1J16A 1DY9A 3Q00A 4Y71A 4ABGA 2KAIB 1A61H 1K1OA 1IQJA 2VVCA 3SI3H 2OC1A 4X1RU 2ZHEH 1C5SA 4IC6A 1INCA 1YPEH 1XVOA 3SO3A 4ZMAH 1TFXA 1AQ7A 1ZHPA 5F03A 1YPJH 1C1NA 1O3FA 1FDPA 1C4V2 1MTUA 2GCHF 4YOIA 1RD3B 4BAQB 2VNTA 2FOHA 1DLKB 1SG8B 1HV7A 3P92A 1VGCB 2F83A 3MH4A 3ZVCA 2G81E 1T4UH 2A0QB 1J9CH 2GDEH 4IBLH 3ZYDA 1QL9A 1F0SA 2AS9A 3FZZA 3HPTB 2Z9GA 1NROH 2A5KA 1HCGA 2PSXA 1O2VA 5JBCS 2Y5HA 1TPPA 4TWYA 1QQ4A 1S5SA 1EZQA 2FDAA 2QN5T 1PPEE 4Z0KA 1GCTC 3HGNA 2XBVA 5BRRE 3VGCC 1NESE 3CP7A 3BTEE 3F1SB 4ISIH 4YO9A 3EAJA 4TPYA 5JB8S 4YZUA 1LVBA 1PPGE 1GJBB 5C1YA 3GCOA 1YLDA 5C5NA 2JETC 4ZHMU 1N8OC 1P04A 1Z8RA 3GY4A 1BMAA 4BAHB 2Q6DA 2PTCE 1KTTB 1GHXH 2AMQA 3A85A 4SGBE 4E7NA 2J34A 3UNSA 2K1QA 4B2BA 1ARBA 2Y7XA 3S69A 1P09A 4YLUA 3M5MA 2ZDAH 1O3CA 4ZXXH 1NS3A 5A8XA 1IQIA 1B0EA 2VH0A 1C2MA 1W12U 2A7HA 1C5NH 2VIDA 3K6ZA 1VJAU 2AIQA 3LONA 4OGYA 3W94A 1J15A 1BUIA 1O3HA 1D4PB 3FP7E 3RXKA 3ESTA 3UWIA 4ESTE 1PFXC 2H9HA 3Q3KA 1DANH 1CT2E 1SI5H 1ELFA 3BTQE 5CE1A 1MTNB 2WPIS 3M36A 1NM6A 3UREA 1BQYA 1C1QA 1OWEA 4AN7A 1S0RA 2OQUA 4J2YB 1DX5M 1AB9B 2HWLB 5JBTA 5F8TA 4I32A 1GBIA 1C4U2 4GHTA 5T6DA 2QCYA 3KHVA 3M37A 2FPZA 1DXWA 2NU1E 1O3OA 4Y0YE 5EXLA 3T27A 3NKKA 1Z8IB 1ZTLA 1ZMJA 4E06H 1NY22 4A1TA 2XW9A 4CBNA 1HAYB 4K60A 3BTTE 1W7XH 1YPHC 5T6FA 1O37A 3A8BA 4WY3A 3ATLA 1BBRH 1HUTH 6CHAB 1T32A 1SGYE 1C5WB 4B2CA 3ZZ7A 1BRCE 1KXEA 1UK2A 1GBJA 1O3GA 1HAOH 3A7WA 1MQ5A 1V2OT 2THFB 1LPKB 2O8UA 1O5AB 1V2LT 5ESTE 1BBRE 2ZCHP 1W14U 3M5OA 1GJ7B 1H8DH 4HFPB 1DWBH 1OP2A 1VGCC 2BX3A 1C2FA 1O38A 3RXHA 1EOJA 4A92A 2UWPA 1GI8B 4F49A 1CHOF 5B6OA 4X6MA 3VB5A 1TGTA 4NWLA 1VITF 4NSVA 2UWLA 2ZDMA 4AFQA 1GHYH 3S0NA 1FXYA 1ABJH 2BDHA 2ZFFH 1UVSH 2Q6GA 4D9QA 2F9VA 1N6XA 2RDLA 4WH6A 2B5TB 2V35A 6LPRA 3UQOA 2Z7FE 4RKJB 3AW0A 3GY3A 5EG4A 1CBWB 1P11E 2Y5FA 1EB1H 2NWNA 1L0ZA 4D7FA 1BT7A 1GCTB 2FXRA 3GCTG 4K1SA 3GCTF 4JCNA 3MNCA 1GBLA 2PGBB 3RUOA 2ZDVH 2ZHQH 2TGPZ 3NZIA 3O8CA 3SV2H 1V2UT 1O3KA 4JYVH 2HLCA 2I6SA 1SQOA 1CQQA 3Q3XA 4R0IA 5EPYA 1NRSH 1NTPA 3UQVA 1C1SA 4X8VH 2WPMS 3PB1E 1V2RT 2Y80A 4HI3A 4Q2KA 3MNXA 3KF2A 1O2IA 2IN2A 4ISHH 1QBOA 4IN1A 5DP9A 1A5GH 1GI5A 5LGOA 5TCAA 3SJIA 1P12E 1NU7B 3QTOH 4KP0A 2BQ6B 1DPOA 2AIPA 1AZZA 4WWYA 4WVPE 3SGAE 1F5LA 2EI7A 3OU0A 4IC5A 3SJKA 2J38A 3I29A 1GHAG 4FVDA 1MTVA 2GT8A 1C5UA 3P8OA 1F92A 1QURH 1YPHE 4OGXA 3QZQA 2P8OB 3ZV8A 4AFSA 2C8YB 4Q7XA 2ZFPH 1GJCB 3E1XB 4Y79A 4OS6A 1WAYB 4Q7YA 1V6DA 3T26A 3BTKE 5AVDA 1BTPA 1DSUA 2ILNA 2P59A 1D3TB 2VIVA 1FI8A 3A8CA 1LVYA 1MKWK 2R2WU 4BNRA 1P03A 4GPGA 5EGMA 1P06A 1ZJDA 1ELEE 2PKAA 3SQHE 4RN6A 4UE7H 3RMOH 3V3MA 2GZ8A 3BIVH 3PV4A 4JYTA 1ZOMA 1PPHE 2FLBH 1TX7A 1KY9A 3QK1A 1V2PT 2QXJA 5DP8A 3BTFE 1DUAA 4BAKB 2FWWA 3UOPA 4BOHA 5BPEA 1LKBA 1O2MA 2Q6FA 2A4GA 1THSH 3SU1A 4KGAA 3DHKH 2UWOA 1XX9A 1O2ZA 3D23A 1EJMA 3BN9A 1QY6A 4XDEA 3A7XA 3SU6A 1N6YA 1PQAA 5EQQA 5JB9S 3FANA 1MKXK 4MDSA 4YT6H 4CREA 3BEIB 2QV1A 1O3MA 3O8DA 2P95A 2G52A 3F6UH 2XYAA 5E2PA 3U9AH 2PKAB 1ACBE 2AEIH 3QX5H 5L30H 5JBAS 1Z8JB 2EA3A 4WXVA 5T6GA 3VEQB 2PKSB 1OP0A 1TONA 3RDZA 1W3CA 1L2EA 2F9BH 3UIRA 2ZP0H 2A7CA 4INLA 3ATMA 4X1PU 2GT7A 2KAIA 2OD3B 2VGCB 3QO6A 2O9QA 3LT3A 1PPZA 1O3PB 4FU9A 8KME2 5CMXH 2Z9JA 1G37A 1QB1A 4ZH8A 2Z3DA 4E05H 5HXFA 1QB6A 3SU5A 1VJ9U 3LIWA 3LH1A 1CA8B 1JBUH 3RXUA 3HKJB 1ZSLA 2GTBA 2GZ9A 2NU4E 2XBYA 3NUMA 1BMNH 1HAGE 4TY7A 4HGCA 1GI0A 1FQ3A 3D65E 3E90B 3MU0A 1D3QB 2F9UA 2QGRA 5E2OA 4X2YA 1FIZA 4XOJA 4YLQH 1O2OA 4I8HA 1ETTH 1DWDH 1ZHRA 2C8WB 2PHBA 1V2VT 1HAPH 5EXNA 1S85A 2AGIX 3GYMA 1O3NA 1AGJA 4ZKNU 3ZVEA 4NIWA 2W7UA 2R0KA 4K69A 4X6NA 1D3DB 1FPCH 3Q76A 3PROA 1XUIA 1SLUB 3B23B 4MPUA 1NRRH 4YTAA 4CRDA 1DE7H 2ZGCA 1C1RA 5A0AE 1YKTA 3A88A 1S6HA 1TOCB 3QGJA 1FJSA 1UK4A 3ATKA 2P8OC 1BDAA 2ODYB 7GCHG 1WUNH 4DT7B 2HNTE 5A0CA 1OWKA 4HTCH 1ZSKA 4FU7A 1IQGA 1DOJA 4TY6A 3S7HB 1SGCA 1BOQA 1UVTH 3V12A 1BTXA 1GHWH 1TGSZ 3ENSB 1KXCA 2FEQH 1P9UA 5C67A 1XKBC 4GAWA 4SGAE 1EPTB 2W26A 3URDA 1F2SE 3MOCA 1OYTH 1TBRH 1QL7A 1TE0A 1ELAA 1TMTH 2Z6BD 4A6LA 3B8JA 1KLTA 2GGVB 1FV9A 2UUFB 3L3TA 3P95A 1C1VH 1QIXB 3CS0A 5EW1H 4THNH 2EI8A 2I6QA 4TWWA 5LPEA 1GBTA 5EPNA 4BXWA 1TA6A 3TLOA 5FCRA 3MNBA 1RGQA 2SGFE 4ABBA 1GBCA 1V2WT 2VGCC 4K1TA 2BOHB 1JOUB 1GI3A 2WV4A 1W2KH 3RXAA 1UJ1A 1MBMA 1UVUH 2IPHA 1EP6A 1KSNA 3RM0H 1GG6B 1W0ZU 4FUGA 3LC3A 2HRVA 4I31A 1O30A 1TNHA 2R3YA 1SGIB 1F5KU 1QL8A 4I8KA 4X0WU 1HGTH 2QF0A 4WH8A 2V3HH 1O2NA 4B2AA 1JRTA 1FPHH 3TIUA 1TGBA 3B9FH 4DIIH 1HJ9A 1ELBA 3WY8A 3TPIZ 1TBQH 1RS0A 2FP7B 2G51A 5FPSA 4J1YA 1NFWA 2XCFA 2J92A 2RA0A 3ZZAA 1O2LA 2PWXA 1O2XA 3SQEE 4FVBA 3EA9A 1EPTA 1C1MA 1DWCH 5CHAB 2IJOB 2SNWA 2PUXB 3U1IB 2J4IA 4FXGH 2VWLA 3IITA 1A4WH 1GBMA 2B8OH 2OLGA 5DJ7A 5L6NH 2HGTH 1PQ8A 5GCHG 1CU1A 1IQNA 2ANYA 3DT0H 2BLWA 2P3TB 1UTMA 3TNSA 3DD2H 1C4Y2 3KQDA 1XMNB 3RXVA 2ZFQH 1BTUA 2WPKS 1ZGVA 1GBKA 2ZU2A 4JZ1A 4OS4A 4U30A 1O5DH 2QF3A 3ZVAA 5EQSA 1GDQA 2BDGA 3P8NA 1Y3WA 4M7GA 1TNIA 3IWMA 4X8UH 1THRH 4CR5A 1FMGA 1C5ZB 4CH8B 2QXGA 3LU9B 1O2KA 2ODQA 3STJA 5I25A 4DGJA 1MKWH 4BXSA 2XC4A 3A7ZA 3U8RH 4F4OC 2G4TA 4XFQA 3P8GA 1BZXE 1TWXB 4BTIB 1O3EA 5ABWA 1FN8A 4I8JA 4YT7H 2Z3CA 1OOKB 3P6ZB 1SGDE 1DWEH 4XBCA 4X8TH 3SV6A 3SNBA 1MQ6A 3MU5A 1D6RA 1LTOA 2FM2A 1MBQA 4ABIA 3KEEA 4Y11E 2BD2A 1UO6A 3U98H 2GKVE 1OP8A 4ZXYH 4Y10E 4VGCC 2FI5E 1O2UA 1NRQH 1RTFB 3TGIE 5E0GA 1AFEH 3TJVA 1FN6A 3AAVA 4K8YA 1N1LA 3C1KA 1V2ST 1GG6C 1QBVH 4Q7ZA 1HXFH 3Q77A 4JZIA 1FY1A 4DG4A 1BMMH 1E34B 5L2ZH 4NG9H 3OX7U 1C5RA 1SGQE 2A2XH 2ZG0H 5IDKA 3E6PH 2QYIA 1MCTA 1LHFH 2BDBA 3A84A 3EDXB 4I8LA 2BVXH 1EJNA 1A7SA 5A0BA 3PWBA 3PLPA 1ZPCA 3M7UA 4CHAB 1HJAB 4AYYB 4KKDA 1E35B 1G3CA 1RIWB 5G4BA 1EATA 2EC9H 4GUXA 4DW2U 1O3BA 1JWTA 1NT1A 3M7TA 2A4QA 4K8BA 2FLRH 3ZZ9A 1FY4A 1ZLRA 4LOYH 4Y8ZA 1C9PA 2BY5X 3TH2H 2NU3E 2QC2A 4B76A 5HYOA 3A8AA 4ZHLU 4WMDA 3UPEA 1JMOH 3TK9A 3TJOA 2H9TH 1AD8H 3HGPA 3UNQA 1AFQC 3PLKA 4A7IB 2ZO3H 2HNTF 1Y3YA 1S6FA 1C5PA 3PYHA 3RU4E 1UTPA 1ELCA 2WINI 2BVRH 4AG1A 4UD9H 5J4SA 3Q3YA 1V2JT 2TGDA 4NA7A 1AIXH 1Z8GA 3R0FA 1AY6H 1PJPA 3U8OH 5FXLA 1DLEA 1YC0A 3V7TA 1O2TA 2ZU5A 4DIHH 1H4WA 2ZPRA 2B0FA 1ZZZA 1S0QA 4IN2A 2FOFA 1YPKH 1E38B 5E0JA 4O9VA 3TITA 3ZZDA 3LGVA