4IC5A

Crystal structure of deg5
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
237
structure length
210
Chain Sequence
EELEEEEERNVNLFQKTSPSVVYIEAIELEGTGSGFVWDKLGHIVTNYHVIAKLATDQFGLQRCKVSLVDAKGTRFSKEGKIVGLDPDNDLAVLKIETEGRELNPVVLGTSNDLRVGQSCFAIGNPYGYENTLTIGVVSGLGREIPSPNGKSISEAIQTDADINSGNAGGPLLDSYGHTIGVNTATFVNFAIPIDTVVRTVPYLIVYGTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease Do-like 5, chloroplastic
publication title The structures of Arabidopsis Deg5 and Deg8 reveal new insights into HtrA proteases
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 43
structure length 210
sequence length 237
chains with identical sequence B, C
ec nomenclature ec 3.4.21.-:
pdb deposition date 2012-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ic5A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ic5A01
5C2ZA 1Z6JH 4X0WU 1TPPA 1OS8A 3IWMA 4YLQH 3RM0H 4NWKA 3BG4C 4B74A 1KY9A 3E0PB 6GCHF 1P8VC 3NXPA 1LDTT 1SGPE 4TWYA 1DY9A 1GMCF 3ZYEA 1MTWA 2Y81A 1DWBH 1J14A 1HJAB 1D6RA 4GCHF 3P92A 1LVBA 1G3DA 1AN1E 1TE0A 3V7TA 1ANBA 3FAOA 1O30A 1DUEA 5EGMA 3F1SB 4B2CA 5C5NA 4MTBA 1JIRA 1N8OB 3GY3A 5L2ZH 1ELEE 4I8JA 3P8OA 3VB6A 3VGCC 2O8LA 1YKTA 4M7GA 3RXDA 3VPKA 3ZVGA 1CO7E 4AFQA 1EJMA 1VCQA 2R3UA 1C2MA 2J4IA 1T7CA 4RSPA 5CHAC 2A4GA 2P8OB 1ZJKA 4FUFA 1GHAF 5EODA 4NSYA 1RTLA 2ZGHA 5IYTA 1SQTA 3SUEA 3UWIA 3MWIU 1TPOA 3DD2H 1O2SA 3MU5A 4NA7A 4X2YA 4A1VA 2ANYA 2TGAA 1XKBC 4X2VA 1SR5C 3SI4H 1BTXA 2VVUA 4IBLH 1O2WA 1MTVA 2BD3A 1BBRH 2BD8A 1SGQE 1PPGE 4CRGA 3ITIA 1GBCA 2SNWA 1GBHA 1XVOA 4TPIZ 2H1UA 2A2QH 2BD7A 3ZVBA 2A5IA 2J38A 3TH2H 1EP6A 2YOLA 4JZFH 4K2YA 2M5TA 4WMDA 4D9QA 4BANB 5JYIA 1B0FA 5FCRA 4Z0KA 1PPFE 3GDVA 1C2FA 3TK5A 1EAUA 4XOJA 2ZFPH 2HRVA 5K7RA 1O2RA 3GCHC 1V2VT 5TCCA 2HLCA 3K65B 2V6NA 4BAKB 1F5KU 1O3JA 1C5UA 1W7XH 1GHBG 4Y0ZE 3SGAE 2WUCA 5ABWA 3ZZ4A 4ZAEA 3UR6A 2NWNA 5HMAA 4FUCA 2HNTE 2BX3A 3C27B 1VGCC 3RDZA 4FUIA 1Q2WA 3AAUA 1V2JT 1P2NA 2VIWA 3TJOA 1HJ9A 1V2MT 1KXEA 1QFKH 1CGHA 4B75A 2I6SA 3M36A 1A0LA 2B0FA 1QGFA 4Q2KA 4X1RU 1BZXE 2ZWLH 1AZ8A 3PYHA 5T6FA 2SGFE 2BB4A 4BTTB 2ZNKH 2GZ8A 3LGYA 1EZXC 3Q3KA 1GHZA 3UUZA 4B1TA 4WWYA 3F9EA 1EOJA 2IOTA 1P10A 3B23B 4A92A 4DURA 2BZAA 2XRCA 3L33A 4U2WA 1YCPM 3TNSA 1UTMA 1QBOA 4K1TA 4DG4A 2QA9E 5C1YA 1TOCB 3HPTB 2V0BA 3SU1A 9ESTA 3BTWE 4J1YA 3ATWA 1BJVA 1Z71A 1DPOA 2EC9H 1H8DH 1A5HA 1P03A 1AVXA 2TGTA 4NGAH 1O2ZA 2BY6X 3VXEH 2BDBA 2W5EA 3A8BA 1O35A 4JZEH 2FTLE 4Y8YA 2BXUH 1GDNA 1GHBF 1KSNA 4AOQA 1C2EA 2H6MA 1BMAA 3LGUA 2Y82A 1Z1IA 1XM1A 4B71A 1SOZA 1SC8U 1YPMH 3SUDA 4E7NA 2ZGBH 1THRH 1T8NA 2YNBA 4RN6A 3UWJH 4CR9A 5CHAB 1W3CA 3BSQA 4K1EA 4FU9A 1NFYA 5LPEA 1V2KT 2FODA 4CRDA 5F8TA 2WPLS 1DLKB 1NC6A 5EPNA 3RXUA 1VITF 1HCGA 5FAHA 2BYAX 3I77A 2RA0A 3R0FA 1YYY1 5SGAE 5F03A 2AGGX 1MAXA 4O03A 5JB9S 1BTUA 1P11E 5PTPA 2FX4A 3TITA 1P09A 1FLEE 3GDSA 4KGAA 1UVTH 3Q00A 2LNCA 2Y5FA 1P12E 5A8YA 1GVKB 2CGAA 4I8GA 4XSKU 2O8UA 2BX4A 4BAHB 1BTYA 1S84A 5ESTE 4AYYB 4UFDH 3TU7H 1C9TA 1P57B 3BEIB 3M7TA 2FOHA 3RXOA 1SGNE 2BDCA 2OC1A 3TK9A 2TIOA 2VIVA 1O2OA 2D1JA 4YESB 2BTCE 3JZ1B 1ZOMA 1DLEA 2WPKS 4JK6A 3C1KA 5A8XA 2QXGA 3VB7A 1NTPA 1D3TB 4K3JA 1AVGH 2BXTH 1SGFG 1C1OA 2VJ1A 1O38A 1KXFA 2A32A 3MH6A 3PO1B 3ZZ8A 1GI0A 1HXEH 5ETXA 4CREA 1BBRK 4DW2U 1GBAA 3Q76A 4ZXYH 1CT4E 1GG6C 1HXFH 1OXGA 3TIUA 1HLTH 3P8FA 3LDXH 1IQLA 3ZVEA 4NIYA 3RXCA 1A1RA 1GCDA 2BVSH 2HOBA 1EXFA 4DT7B 3U1JB 1O2LA 1HFDA 4LOYH 4AGKA 3ESTA 2ZHWH 2LPRA 2EI6A 1YPJH 3GCNA 3R3GB 4I7YH 1CT0E 3BTKE 1HBTH 3ATIA 4E06H 1YPKH 2Z94A 2ZDVH 3VEQB 4B2BA 2WPIS 4FXGH 3ZZAA 1W0YH 2J9NA 1EZUC 1BCUH 4DIHH 4BTIB 1ANCA 2GX4A 2BDGA 2CF9H 4X6OA 1ESTA 2NU3E 1UHBA 2ZHFH 1S82A 3QDZB 1TQ7B 3EA9A 1AFEH 2FM2A 4KKDA 3RLWH 2FOMB 3KIDU 1AE5A 2BOHB 1MKXH 4NIVA 5E2PA 4YT7H 2ZDLA 3ZYDA 1H4WA 1CGJE 2VINA 1MQ6A 1NPMA 4MQAA 4Y10E 1UK2A 4R8TB 1AB9B 4CH8B 1BRBE 1QA0A 1HAHH 3GOVB 1ZGVA 2GMTB 1GJ7B 1HAGE 3TPIZ 3RXPA 4DGJA 4JZIA 1MTNB 1NN6A 1GI9B 1O2HA 1Q31A 1QNJA 2XBYA 2A5KA 1GHYH 5GDSH 1CBWC 3PMJA 3MU0A 4NFEA 8KME2 4ABEA 2PWXA 3QZQA 1FQ3A 2XXLA 1HV7A 1EQ9A 4NA8A 1J17T 1CVWH 1HDTH 4VGCB 3Q3YA 1O32A 1ESBA 1MUEB 1UVSH 1ZLRA 2GD4B 2QYIA 1TAWA 3QO6A 1OP8A 1TPAE 5FCKA 4CRBA 3D62A 2BY8X 4D7FA 1QL8A 3RXJA 2UWLA 2VIPA 4BOHA 1IQNA 4XFQA 1QIXB 2ZPSA 1AHTH 2J92A 1G32B 1GVLA 1QL7A 1WCZA 2A1DB 4THNH 5GCHG 3MFJA 3BTTE 3CENA 4H6SB 5F6MA 2A5AA 1K1OA 2BQ6B 4KP0A 1L4ZA 3RC6A 2H5DA 3E3TA 4KTSA 2WPMS 1PPBH 3RLYH 4Y8XA 4ZKRU 1O2PA 1AD8H 2FZZA 1GBMA 2QXJA 5GXPA 1CU1A 3FP6E 1ZSJA 3BF6H 2ZI2H 2FYRA 2GV7A 1WU1A 1SFQB 3AW1A 3D65E 1SFIA 3QK1A 3PTNA 4H6TA 2ALPA 2GT8A 1D9IA 2C93B 3LT3A 1PJPA 4UD9H 4WXIA 1E36B 1GJDB 3PROA 5FX6A 3TK6A 1EX3A 1AI8H 1V2ST 1FZZA 2XC4A 4CBNA 2Q1JA 3RXTA 3SUGA 3FZZA 3A87A 1CA0B 1LHCH 4ISIH 1HJAC 1LVMA 2GCTB 3BTQE 1DSUA 2B5TB 2G5VA 1O5GH 3M37A 2W3IA 1BDAA 3PLPA 2HNTF 1FAXA 1N8OC 1O5AB 3D49H 1WTHD 1O39A 2PR3A 3UTUH 1ANDA 3GISB 3NCLA 1DT2A 3E1XB 3V13A 1MU6B 3A80A 1DWEH 1HUTH 2Y7ZA 3URDA 5GCHF 2AIPA 4UFEH 5B6OA 3SU3A 5H4IB 1OYTH 1RD3B 3GYMA 3ZZ7A 2P8OC 2FI3E 1F5LA 1S6HA 3MNBA 4X1SU 3M61U 1MTSA 2BD4A 5DG6A 3SNCA 3IG6B 1G2LA 1G2MA 3O8CA 1O2GH 1MTUA 1DXWA 3GCOA 4TY6A 1GL0E 1SHYA 2ZFSA 2ODQA 2PFEA 4Y71A 5DPAA 1C4U2 4MPXA 3F9GA 3GYLB 1ZRBA 3RXRA 1NRPH 2OINA 1UTJA 1W2KH 1ZHRA 1WV7H 1JOUB 1OWEA 3A8DA 4U01A 2XBVA 2FO9A 4UDWH 3TNTA 2YNAA 1ELBA 3H7TA 1TLDA 2I6QA 1ELDE 1C1WH 3RMOH 4JZ1A 1HAVA 1GI3A 5FBIA 1TALA 2F9BH 4B2AA 3MU1A 1S0RA 2AS9A 1QCPA 3DFLA 1K9OE 3BN9A 4TYDA 3EA7A 1A5GH 3GCTF 3ATKA 4X1QU 2XCNA 4MVNA 1BITA 2BLWA 4E05H 3VXFH 5HM9A 3EAJA 3TJUA 4O3UA 1EAXA 1O3BA 2ANWA 4A5TS 7GCHF 1EOLA 1QQUA 3BIUH 2XWBI 4ZUHA 3K9XB 1IAUA 2KAIA 3MOCA 1O2TA 3SJIA 1DSTA 1XVMA 3LJOA 1EATA 1DOJA 1W0ZU 3MH5A 1ZYOA 3MU8A 1S81A 2BD2A 2F9NA 3SGQE 2D8WA 1S6FA 2GGVB 2UUYA 3U1IB 3T28A 2RG3A 4LZ4B 2ZGCA 1O36A 3QGJA 1GHWH 1BMNH 4ZXXH 2TPIZ 1XUIA 2Z3DA 5JBCS 1LHEH 1BTPA 2CF8H 1AQ7A 1QQ4A 5AHGH 3BTGE 1L0ZA 1LHDH 3LH1A 3MMGA 5I25A 1O31A 1C2JA 1FNIA 1KXBA 2ZTZA 3T62A 1GBKA 1O3GA 1T8MA 2QN5T 4O3TA 3RU4E 4DCDA 1C1MA 4ESTE 2ZGJA 1KLTA 1O5DH 2FOFA 1EP5A 2FDAA 1A3BH 1O2KA 5L2YH 1OX1A 2Z7FE 2ZFFH 2C4FH 1C5WB 2C8ZB 4BAOB 2VVCA 1RIWB 1YM0A 4MNVA 1ZZZA 3RP2A 1TBQH 1VJAU 1Y8TA 3S9AA 2TRMA 3IITA 1GI6A 2P3FH 4CRCA 3B9FH 5GJ4B 1O5BB 1A0HB 1O2NA 3KN2A 1BTHH 1C5ZB 2FEQH 5I46H 3U69H 2ZZUH 2G52A 1JMOH 2AGEX 2ZU3A 1O2MA 3ZVFA 1JRTA 3KGPA 1W7GH 1S0QA 1WBGB 2JKHA 3T2NA 3OU0A 5DP4A 3TVJB 5A0AE 3SJ8A 1V2NT 2ZIQH 3KQBA 1OKXA 2ZU2A 1UK3A 3V3MA 3SI3H 4FUEA 1AKSA 1L1NA 1TX8A 1OOKB 2BQ7B 2XW9A 1SGFA 5DP8A 5K0HA 3SU4A 1FY3A 3MNXA 2QCYA 3VB5A 1ZMNA 1SGIB 4NSVA 3A89A 5J4QA 2GDDA 2A31A 2PKAA 5C1XA 1IQMA 2Q6GA 4K5ZA 1C4V2 4OS2A 2H5CA 4O9VA 2QXIA 1EB2A 1PQ5A 3HK3B 4NIXA 4WY3A 2QV1A 2ANKH 2ASUB 2Z9IA 1TYNA 1FY1A 1DFPA 1WTGH 2D2DA 3LGVA 1FY4A 2ZC9H 2BLOA 4YOGA 1TA6A 3A85A 1GBJA 1PPZA 1UO6A 3SNEA 3AASA 3PO1C 4Y0YE 1OYQA 1WQVH 2CXVA 2UUFB 7ESTE 3RXFA 1FXYA 3SZNA 1FIZA 3ZV8A 3ZVDA 4B73A 4YOJA 5JBAS 5TCAA 3SV6A 3SU2A 2ZQ1A 5F8ZA 2O8MA 9LPRA 1GDUA 2C90B 4BAMB 1W12U 1C1TA 3E0NB 1QR3E 2UUJB 3GY7A 1LVOA 1MBMA 2BMGB 2NU0E 1O3HA 5E0JA 2OLGA 2XC5A 4Y8ZA 2VWNA 1JRSA 3ZVCA 3NWUA 1C1QA 3M7UA 1QJ6B 5EQQA 1SGDE 5E0HA 3SW2B 1ZHPA 4SGBE 1PPEE 2FOGA 4KTCA 3MO9A 3U8RH 4OS6A 3A7ZA 5FPSA 1MMJN 3A8AA 1KTSB 2A0QB 3LONA 1ELFA 1FMGA 4KTUA 1O3MA 2AMDA 5FHTA 4ZROA 1H8IH 1O3NA 4NA9H 1ZPBA 1H1BA 1TRMA 1KLIH 3E16B 2ODYB 4MLFB 3KEEA 1QBNA 1DM4B 2EI7A 2QXHA 2BD9A 2Q6FA 1AB9C 4HI3A 4AYVB 1GBFA 4MNYA 2WINI 1EJAA 3KL6A 2GMTC 4WMEA 1Z8IB 1OP2A 2OBOA 2ZKSA 1NRSH 1TMTH 3NK8A 2CHAC 1Z6EA 1MTNC 2ZECA 2V35A 1EPTA 1WUNH 1DUAA 1ZSLA 4J2YB 4ISOA 4X8TH 1RXPA 3SHAH 2J94A 4AFZA 3E90B 2BZ6H 1LO6A 4MPVA 2WV4A 1PPCE 4MNXA 4VGCC 5HGGA 1BRUP 1NU9A 3STIA 1ELGA 3M5MA 1ZHMA 3PMBB 3BTEE 3DHKH 3RMMH 1UHBB 4Y76A 1IQEA 1CE5A 1SBWA 1TRNA 5EOKA 5C67A 1AWHB 1K1LA 1NRRH 3BV9B 1ZRKA 4FVBA 2XC0A 1ZMJA 2ZU1A 4AB9A 1YLCA 3UOPA 1LKBA 2ZDNA 4XBBA 2O8WA 1ZPCA 3T27A 1Z1JA 4A1XA 1V2LT 2BOKA 3MH4A 5LPRA 3F68H 2FI4E 1TONA 4NWLA 1UK4A 1BJUA 3RXLA 1GJ9B 3OY6U 1J9CH 1JXPA 1XUKA 2WYGA 3PMHB 1AE8H 2QF3A 5EQRA 3P8GA 2H9HA 1ARCA 1ELCA 4MPUA 1Y3VA 2SGPE 3A7XA 2ZCLP 1YPLH 1MH0A 1YBWA 1F0RA 4Y7BA 3ZZ3A 5CMXH 4UONA 1ID5H 1SMFE 1QRZA 2VGCB 3SJKA 1BMLA 3ZZDA 5LH8A 4JYVH 1NT1A 5G4BA 3STJA 1MAYA 1HAXB 2G4UA 5DP6A 1K1IA 1V2WT 3GY4A 5HYOA 4WH6A 2FOEA 4YT6H 1ACBE 1C5OH 1T8OA 1ETRH 3SV9A 1KIGH 1TX6A 1CA0C 4LZ1H 2ZU4A 3CS0A 3F9FA 1QL9A 1J15A 2GCTC 1O3KA 3A82A 2XBXA 2OC7A 1XUJA 2TBSA 4FUHA 4ABFA 4INKA 1E37B 3MNSA 1O3OA 1A61H 2A4OA 1CSOE 4KELA 3T29A 5JB8S 1FN6A 1JIMA 1UCYE 3T25A 3TLOA 3PLBA 1ZMLA 2BDIA 2ZA5A 1UMAH 2XWAA 1O0DH 1W13U 1GBTA 3B8JA 2NU1E 1ELAA 1ZTKA 1BTZA 2R3YA 2VH0A 3RMNH 3CP7A 5C3NA 5FPYA 1DS2E 3BTFE 3RC4A 4JYTA 2AFQB 2A2XH 4Q7YA 3MNCA 3RXSA 2QIQA 3RXHA 4ABBA 1GCTC 3P6ZB 2RDLA 1ZJDA 1W11U 3UNSA 3S9BA 1GJ5H 2Z3EA 4ZKOU 1BT7A 3PTBA 1SLWB 3MYWA 4I32A 1KLJH 1O33A 3A7WA 1YP9A 3EA8A 1QJ7B 1O3FA 3QLPH 3ATMA 1Y5AT 2CHAB 2XCFA 2Y5HA 3FP7E 1BIOA 1THSH 5BRRE 1E38B 3KNXA 4AG1A 3M5LA 1O2QA 4H42U 3BEUA 1KXAA 2HALA 1GBIA 3S69A 1BHXF 2R9PA 2EA3A 3ZZCA 1BMMH 1L1GA 1G30B 1SLUB 3A81A 2ZFTA 1W14U 2K1QA 2VIDA 2C8WB 5E0GA 4K69A 1TOMH 4OGXA 3O8RA 2O8TA 3VB4A 1C9PA 2FLBH 4XBDA 2D26C 1QURH 3RXBA 1ZPZA 1SL3A 1C5NH 2BLQA 1Q3XA 2PUXB 2F9UA 1T4VH 2ZPRA 1UJ1A 3FFGA 1TGBA 2P3UB 3LC5A 1SGYE 2QC2A 2ZDMA 3VB3A 1GPZA 3AVZA 3GY6A 6LPRA 1W8BH 4YTAA 2GT7A 3LU9B 2HWLB 1A46H 1PPHE 2W26A 2FXRA 4IGDA 4A6LA 4GLYA 5ESBA 2VIOA 2BDYA 1K22H 1V6DA 2ZF0H 1HAVB 1LQEA 2VWOA 2ALVA 4JCNA 1WSSH 1VITH 4ISHH 5DP7A 1MD7A 1CQQA 2WYJA 2Z6BD 3SJOA 3HATH 3SU5A 3MHWU 1Y5BT 2FOAA 1VR1H 4X8UH 3ZV9A 4JMYA 1O34A 4DVAU 8LPRA 1NS3A 1AVWA 2WUBA 1AO5A 1C2KA 3ZZ5A 1DICA 1GJ4H 1TNGA 2P16A 1T8LA 1MBQA 5FBEA 1H9HE 4GVUA 2PUQH 1L2EA 4AB8A 3D23A 1S85A 1SGCA 2BM2A 1X7AC 1Z8GA 3DFJA 4FUJA 5EXLA 3AAVA 2KAIB 2ZCKP 4MNWA 2DUCA 2ZTYA 1RIWC 1NROH 2AGIX 3BIVH 1A4WH 4X1PU 1SLXB 1QB6A 3L3TA 4AZ2B 2EEKA 1W10U 3ENSB 3SQHE 3P70B 4WMFA 1JWTA 2AMPA 4ABIA 1WQSA 2SGDE 3UNRA 2SGAA 2TGPZ 1Y3WA 1WYKA 2GKVE 1KXDA 1EJNA 4NG9H 1ZR0A 1FONA 2GCHG 3OTJE 3LPRA 1K28D 2BY9X 2SGQE 2H9TH 2PGQB 2WPJS 2OTVA 3AW0A 1GCTB 2JETB 1O37A 1F5RA 1KYNA 5EXNA 4ABGA 2G00A 1NFUA 1ANEA 1KXCA 1K1NA 3OX7U 1TGSZ 1Z7KA 1HRTH 5AF9H 1IQJA 4CRAA 3UPEA 4UFGH 1D3DB 1IQHA 1XUFA 3SN8A 1GI7B 2XTTB 4QT8C 2A4QA 1V2QT 2PTNA 1ELTA 1S5SA 1B7XB 2B9LA 2HVXA 1HIAA 3SV7A 2F9PA 1YPEH 3L6PA 2PW8H 2G51A 2HNTC 3LKWA 3SQEE 2WPHS 3KCGH 4CR5A 1A2CH 3FP8E 1P2QA 4GPGA 2O9QA 1BTWA 1WOFA 4PROA 5JPMH 1P2OA 4IC5A 2IJOB 1BQYA 1NZQH 5A0BA 5C1UA 1ETTH 1SGRE 2ODPA 1LKAA 1J16A 1MU8B 1VJ9U 3RXMA 1LMWB 4NZQA 4ZKNU 2BY5X 6GCHG 1AIXH 4Y7AA 1LHGH 1RS0A 4MG3A 4U30A 2QGRA 1GMCG 3PMAB 2PSYA 5CE1A 1THPB 1GBDA 2P3TB 3E91A 3WY8A 2OC0A 3W94A 4GCHG 2V3OH 2C8XB 3GICB 1KDQA 5FPTA 1TWXB 1AU8A 3LJJA 4NZLA 5T6DA 2GCHF 1AKSB 2BDHA 4ABDA 1O3AA 1L4DA 2A7JA 1PQ8A 1YPGH 2ZP0H 1UTPA 2OBQA 1P06A 3Q3XA 3URCA 5A2MH 1LHFH 1Y5UT 1DDJA 3V12A 2PGBB 2Y6TA 1GGDB 2RCEA 3QWCH 1FY5A 1V3XA 2PKAB 1LTOA 2FLRH 1F7ZA 1BHXB 2ESTE 2SNVA 1UVPA 1GJBB 4X6PA 1O3EA 2VVVA 1GDQA 3BTME 2ZFQH 3KHVA 2FOBA 4FUDA 5AVDA 1XMNB 3GY8A 1HB0B 5EPYA 2ULLA 1TGTA 4HTCH 4Q7ZA 2R0KA 3P17H 1T4UH 2GZ7A 1D6WA 1A3EH 3VFEA 3BTDE 1MKWK 1NM6A 4JZDH 1LVYA 4NIWA 3MO3A 1OPHB 4Q80A 2ZEBA 1G3EA 5A0CA 2VB0A 8ESTE 2ZDKA 4DJZB 3RXKA 3SUFA 3RC5A 4BXSA 5JBBS 1TX7A 8GCHG 5E8EH 1QB1A 3LIWA 4OS4A 3DT0H 1SPJA 4UEHH 1NY22 4WXVA 1FPHH 1O3PB 4BTUB 1A7SA 1N1LA 4U32A 3QTVH 4YZUA 4D76A 5T3HA 1NU7B 4UFFH 2AERH 1HAYB 2FOCA 1EZSC 3CS7A 1PYTC 5TJXA 2AEIH 3H5CB 1H9IE 1MQ5A 1SOTA 3JZ2B 1HAPH 1GBLA 1P9SA 3E8LA 3K6YA 3SJ9A 1RFNA 1EKBB 2FI5E 4E7RG 1GJ6A 1IHTH 2PSXA 5GWZA 1AFQB 1Y59T 3EDXB 3H7OA 4TWWA 1P01A 4YOIA 5L6NH 1DY8A 3PM3A 3LC3A 2OUAA 2VIQA 3M5OA 6CHAB 1E35B 1TMBH 4Q7XA 1QY6A 2FYQA 2OCVB 4CRFA 1DWCH 1FIWA 2GZ9A 1ZSKA 2IPHA 2XNIA 3A86A 1NFXA 1O2XA 4I8KA 1C5XB 2FTMA 2ZHDA 4Z6AH 1O5FH 3ZVAA 1EPTB 3BEFB 2C8YB 4DY7B 3W95A 3A8CA 1ORFA 2F83A 3ATLA 1F92A 1SHHB 5EW1H 2AH4X 2J34A 1V2OT 2A7CA 8GCHF 2VGCC 4ZHAA 1HYLA 1ZTJA 5EQSA 1K1MA 1EZQA 3FVFB 2Z9JA 4I8LA 3SV8A 3MTYA 1GHXH 2Y7XA 3TGIE 1PQAA 1C1SA 3FZDA 4NFFA 3PWBA 2F3CE 4GUXA 1ZGIA 2JH6D 2PHBA 3SBKA 4X1NU 1P2MA 1GJAB 2Z9GA 2GDEH 3MO6A 1BBRE 1Z8RA 1G36A 2BLVA 2STBE 2BDAA 4AN7A 4XDEA 5E2OA 2OQ5A 1TGCA 4Y11E 4IN2A 3NKKA 3UOUA 2PKSB 2VWMA 1C5QA 2B7DH 2HPPH 4CHAB 3HK6B 3LGWA 5F8XA 1GI8B 4FVDA 2CV3A 3DA9B 4OS5A 2J95A 3QN7A 1CA8B 1D4PB 1UTKA 5C20A 3A7VA 1YCPH 3GDUA 1TMUH 1VITG 1ARBA 4IW4E 4OS7A 1UTLM 1GWAA 1O3IA 2VH6A 2OQUA 1LQDB 1UTNA 3E6PH 4X6NA 3N7OA 1O3CA 1GMDG 5JDUB 1TIOA 3F9HA 2GVFA 3M35A 4INLA 1B5GH 3SU0A 4D8NA 2NU4E 1PQ7A 4AX9H 3BG4B 1AZZA 5JBTA 3KQEA 1JBUH 1GBEA 3I78A 4WJG2 3UQVA 1KTTB 5A09A 1C1VH 3A83A 1G3BA 1VCWA 1ABJH 4K8YA 4H4FA 5AFYH 4GSOA 1C2HA 1LCYA 1VCPA 3V0XA 4HFPB 3QUMP 4HZHA 3UREA 1C1UH 5AFZH 1U6QA 2F91A 3SNDA 3NPSA 3SHCH 1ELVA 1B0EA 1J8AA 2HPQH 1AY6H 1E0FD 3P95A 3MU4A 1OSSA 1ABIH 2QY0B 3VGCB 1PYTD 1XUGA 2P93A 2R2MB 1IOEA 1FJSA 2JH0D 4ZHLU 1YC0A 2IN2A 2THFB 1XXFA 2BQWB 1TRYA 3TH4H 1AUJA 3ZZ9A 1QBVH 2GP9B 2G5NA 1SLVB 1SQAA 3PLKA 1IQGA 2BVRH 1H9LB 5EW2H 7KMEH 4JK5A 1NESE 4O97A 3QX5H 2RA3A 3T5FH 1C2GA 3O8DA 2GTBA 5DK1A 5EU8A 2G4TA 2FPZA 1GMDF 1C5LH 3NZIA 2FESH 3MH7A 5A8ZA 3A7YA 1FDPA 1YPHC 3P8NA 1AMHA 1O5CB 1GI1A 1N6YA 4K60A 3OY5U 2G8TA 3MI4A 2A7HA 4X8VH 5J4SA 1VZQH 2FMJA 3LOXA 1HJ8A 5LGOA 1F0TA 3UQOA 4FU7A 4UE7H 2UUKB 1TQ0B 1UCYH 1XX9A 2FX6A 4GHTA 2W7UA 2Z9LA 3TH3H 1TBZH 1OWHA 4DIIH 1IQFA 5FXLA 4XE4A 1SB1H 3S9CA 1FV9A 3HKIB 4TY7A 2A45B 1DANH 3GCHB 3LH3A 1HAIH 4CH2B 4LXBH 1C5YB 1P2KA 1TABE 4A1TA 1BOQA 2QAAA 1C2IA 4FU8A 3QZRA 3UR9A 1MCVA 2ZO3H 4DOQA 3I29A 1QB9A 1AGJA 2OD3B 5DJ7A 7LPRA 1VGCB 2P94A 1GI4A 2TGDA 1HGTH 3ZZ6A 1V2UT 1INCA 1TNLA 1XXDA 3RU4T 1K1PA 1NRNH 2ZFRH 1C1NA 2ZHEH 1Y3YA 1O3DA 4AG2A 2H2ZA 3S0NA 2Z9KA 3Q77A 4FUBA 3RXAA 4GHQA 2Z3CA 3M7QA 3ODDA 1P9UA 1QJ1B 4LK4A 1CGIE 4X6MA 3EQ0H 2SGEE 3KF2A 4OS1A 1HAZB 2F9OA 1P2JA 5HXFA 1HNEE 1EASA 2UWPA 2CMYA 3PV4A 2JETC 4ZHMU 3NUMA 1ESAA 1MZDA 3EYDA 4MPWA 5HM2A 1QRWA 3ODFA 1SI5H 1SGTA 1OWKA 1K1JA 3ZZBA 3BTHE 4AORA 4IMZA 1YF4A 3LGIA 1G9IE 1GBBA 1OP0A 1V2TT 1D3QB 2Y80A 1Z8JB 3T26A 3O8BA 3HGNA 3FANA 1GMHG 3U9AH 1FI8A 3U8TH 3UNQA 3U8OH 4AFUA 1P2IA 3PWCA 1Y3XA 1P05A 1T32A 3M3VA 4ISNA 1ETSH 2R2WU 3BG8A 1FY8E 1A0JA 1RRKA 1C1PA 1OWIA 3HGPA 1UTQA 2P59A 4ABHA 1YCPK 4ZKSU 1DE7H 5T6GA 2ZPQA 1YLDA 5DO4H 1CT2E 1MCTA 2V3HH 1PFXC 1YGCH 3HKJB 1UVOA 2R0LA 1MZAA 5GPIB 1T31A 4X2XA 4IC6A 1OWJA 1C5VA 1IHSH 1WAYB 4INHA 2CJIA 1GI2A 2VNTA 1K21H 1TGNA 2XBWA 2BD5A 4K1SA 1MKWH 4ZH8A 1C5SA 1EAIA 2OP9A 2ZU5A 1O2JA 2QF0A 4I33A 1QA7A 4ABJA 1RTKA 2BHGA 3RXQA 4BXWA 1BA8B 1HIAB 3M3SA 1QTFA 3S7HB 1BRAA 3SGBE 1GGDC 1C5PA 1TBRH 2W7SA 1NO9H 1LPZB 2PV9B 2AMQA 3LGTA 2G81E 1P04A 4GAWA 4D7GA 1RJXB 1IQIA 2Y5GA 1GMHF 1TFXA 3SOSA 3G01A 3EE0B 1DVAH 5C5OA 2PTCE 2ZCHP 2ZHQH 1O2UA 2GV6A 3RXVA 3EGKH 3SNAA 1CHOG 1XKAC 3UIRA 5DP5A 4WH8A 2B8OH 3PB1E 1HAOH 1DWDH 5LPFA 3M3TA 3OSYA 2OC8A 5L30H 1TNIA 4OGYA 2ZDAH 3SORA 1KDQB 1A5IA 1N6XA 1BRCE 2FS9A 5DKMA 4IMQA 3RXEA 1YPHE 3RM2H 4SGAE 1GG6B 1GL1A 4AGJA 1SQOA 4BAQB 1TNHA 4R0IA 1Y3UA 4ABAA 1C1RA 2VU8E 4Y6DA 1G37A 4YLUA 3SO3A 4FUGA 3TJVA 1ZTLA 2PLXA 2F9VA 6ESTA 1C2DA 1MD8A 1E34B 1O2VA 1QRXA 1P3CA 3DUXH 3SV2H 1TA2A 5EXMA 1SSXA 3ELAH 2P95A 4CBOA 1RTFB 1G3CA 1UCYK 3S7KB 1TPSA 2VWLA 4AFSA 3GCTG 4BNRA 2J2UA 2JH5D 1NRQH 2XYAA 5BPEA 1V2RT 4RKJB 3TGKE 1OWDA 3UFAA 1C5RA 2DE9A 4TPYA 2ZQ2A 2G55A 3K6ZA 1AUTC 1HPGA 3K2UA 1UTOA 1FUJA 2AIQA 2ILNA 3KQCA 2H9EH 1O2YA 1DX5M 1F2SE 1QHRB 2FP7B 4B76A 2OXSA 7GCHG 1AFQC 1CHGA 1BB0B 1D3PB 2DE8A 3M5NA 4XBCA 1XUHA 1P02A 6CHAC 3UY9A 2AYWA 2ZGXH 1SVPA 4RKOB 1O2IA 1TNJA 2STAE 1NFWA 2A4RA 1CHOF 2FWWA 4F4OC 1FAKH 1LPKB 1SGEE 1FPCH 2SFAA 4WVPE 5FX5A 3RXIA 4A7IB 2NU2E 3A84A 1EB1H 2ANMH 3F6UH 1EPTC 4I31A 1RGQA 1UVUH 4K8BA 2WV5A 4X2WA 4D9RA 1GJ8B 1C4Y2 3A88A 3OYPA 1V2PT 2BY7X 2Q6DA 4YO9A 1CBWB 5EG4A 1EUFA 1M9UA 4X8SH 1GHVH 1LPGB 1TNKA 5DGJA 4ASHA 1EAWA 4ISLA 1C2LA 1K2I1 1AWFH 2FIRH 2ZG0H 3GY5A 4JYUH 4IN1A 4YM9A 1BUIA 5GIBA 1GI5A 2EI8A 1P3EA 4I8HA 3RXGA 3U98H 1TB6H 1MKXK 4ZMAH 2CN0H 1C5TA 3QTOH 3QGNB 3GY2A 1C5MD 3SU6A 2UWOA 4HGCA 5DP9A 2W3KA 2FS8A 1P0SH 2PKSC 3A7TA 3RUOA 3TJNA 1DITH 1O5EH 3RU4D 2C3SA 4CHAC 2ZTXA 5IDKA 1GJCB 1O3LA 1FN8A 1GHAG 4MDSA 4IS5A 1IQKA 3KQDA 2HGTH 3SNBA 4Y79A 1SG8B 1GVZA 3TGJE 2BVXH 3RMLH 1L1JA 1F0SA 4NCYA 5DP3A 1DXPA 1F0UA 4WF8A 1S83A 4F49A
chains in the Genus database with same CATH superfamily
5C2ZA 1Z6JH 4X0WU 1TPPA 1OS8A 3IWMA 4YLQH 4RT0A 3RM0H 4NWKA 3BG4C 4B74A 1KY9A 3E0PB 6GCHF 1P8VC 2KX4A 3NXPA 1LDTT 1SGPE 4TWYA 1DY9A 1GMCF 3ZYEA 2AHME 1MTWA 2Y81A 1DWBH 1J14A 1HJAB 1D6RA 4GCHF 3P92A 1LVBA 1G3DA 1AN1E 1TE0A 3V7TA 1ANBA 3FAOA 1O30A 1DUEA 5EGMA 3F1SB 4B2CA 5C5NA 4MTBA 1JIRA 1N8OB 1E1RD 3GY3A 5L2ZH 1ELEE 4I8JA 1COWD 3P8OA 3VB6A 3VGCC 2O8LA 1YKTA 4M7GA 3RXDA 3VPKA 3ZVGA 1CO7E 4AFQA 1EJMA 1VCQA 2R3UA 1C2MA 2J4IA 1T7CA 4RSPA 5CHAC 3SZEA 2A4GA 2P8OB 1ZJKA 4FUFA 1GHAF 5EODA 4M9FA 4NSYA 1RTLA 2ZGHA 5IYTA 1SQTA 3SUEA 3UWIA 5HIZA 3MWIU 1TPOA 3DD2H 1O2SA 3MU5A 4NA7A 4X2YA 4A1VA 2ANYA 2TGAA 1XKBC 5F53A 4X2VA 1SR5C 3SI4H 1BTXA 2VVUA 4IBLH 1O2WA 1MTVA 2BD3A 1BBRH 2BD8A 1SGQE 1PPGE 4CRGA 3ITIA 1GBCA 2SNWA 1GBHA 1XVOA 4TPIZ 2H1UA 2A2QH 2BD7A 3ZVBA 2A5IA 2J38A 3TH2H 1EP6A 2YOLA 4JZFH 1SKYE 3PRDA 2M5TA 4K2YA 4WMDA 4D9QA 4BANB 5JYIA 1B0FA 5FCRA 4Z0KA 5C94A 1PPFE 3GDVA 1C2FA 3TK5A 1EAUA 4XOJA 2ZFPH 2HRVA 4FETA 5K7RA 1O2RA 3GCHC 1V2VT 5TCCA 2HLCA 3K65B 2V6NA 4BAKB 1F5KU 1O3JA 1C5UA 1W7XH 1GHBG 4Y0ZE 3SGAE 2WUCA 5ABWA 1NBMD 3ZZ4A 4ZAEA 3UR6A 2NWNA 5HMAA 4FUCA 2HNTE 2BX3A 3C27B 1VGCC 3RDZA 4FUIA 1Q2WA 3AAUA 1V2JT 1P2NA 2VIWA 3TJOA 1HJ9A 1V2MT 1KXEA 1QFKH 1CGHA 5B6LA 4B75A 2I6SA 3M36A 2KM0A 1A0LA 2B0FA 5C17A 1QGFA 4Q2KA 4X1RU 1BZXE 2ZWLH 4DT4A 1AZ8A 3PYHA 5T6FA 2SGFE 2BB4A 4BTTB 2ZNKH 2GZ8A 3LGYA 1EZXC 3Q3KA 1GHZA 3UUZA 4B1TA 4WWYA 3F9EA 1EOJA 2IOTA 1P10A 3B23B 4A92A 4DURA 2BZAA 2XRCA 3L33A 4U2WA 1YCPM 3TNSA 1UTMA 1QBOA 4K1TA 4DG4A 2QA9E 5C1YA 1TOCB 1NBME 3HPTB 2V0BA 3SU1A 9ESTA 3BTWE 4J1YA 3ATWA 1BJVA 1Z71A 2J98A 1DPOA 2EC9H 1H8DH 1A5HA 1P03A 1AVXA 2TGTA 4NGAH 1O2ZA 2BY6X 3VXEH 2BDBA 2W6JD 2W5EA 3A8BA 1O35A 4JZEH 2FTLE 4Y8YA 2BXUH 1GDNA 1GHBF 1KSNA 4AOQA 1C2EA 2H6MA 1BMAA 3LGUA 2Y82A 1Z1IA 1XM1A 4B71A 1SOZA 1SC8U 1YPMH 3SUDA 4E7NA 2ZGBH 2F43B 2KCOA 1THRH 1T8NA 2YNBA 4RN6A 3UWJH 4CR9A 5CHAB 1W3CA 3BSQA 4K1EA 4FU9A 1NFYA 5LPEA 3AK5A 1V2KT 2FODA 4CRDA 5F8TA 2WPLS 1DLKB 1NC6A 5EPNA 3RXUA 1VITF 1HCGA 5FAHA 2BYAX 3I77A 2RA0A 3R0FA 1YYY1 3N7DA 5SGAE 5F03A 2AGGX 1MAXA 4O03A 5JB9S 1BTUA 1P11E 5PTPA 2FX4A 3TITA 1P09A 1FLEE 3GDSA 4KGAA 1UVTH 3Q00A 2LNCA 2Y5FA 1P12E 5A8YA 1GVKB 2CGAA 4I8GA 4XSKU 2O8UA 2BX4A 4BAHB 1BTYA 1S84A 5ESTE 4AYYB 4UFDH 3TU7H 1C9TA 1P57B 3BEIB 3M7TA 2FOHA 3RXOA 1SGNE 2BDCA 2OC1A 3TK9A 2TIOA 2VIVA 1O2OA 2D1JA 4YESB 2BTCE 3JZ1B 1ZOMA 1DLEA 2WPKS 4JK6A 3C1KA 5A8XA 3F2HA 2QXGA 3VB7A 1NTPA 1D3TB 4K3JA 1AVGH 2BXTH 1SGFG 1C1OA 1VKYA 2VJ1A 1O38A 1KXFA 2A32A 3MH6A 3PO1B 3ZZ8A 1GI0A 1HXEH 5ETXA 4CREA 1BBRK 4DW2U 1GBAA 3Q76A 4ZXYH 1CT4E 1GG6C 1HXFH 1OXGA 3TIUA 1HLTH 3P8FA 3LDXH 1IQLA 3ZVEA 4NIYA 3RXCA 1A1RA 1GCDA 2BVSH 2HOBA 1EXFA 4DT7B 3U1JB 1O2LA 1HFDA 4LOYH 4AGKA 3ESTA 2ZHWH 2LPRA 2EI6A 1YPJH 3GCNA 3R3GB 4I7YH 1CT0E 3BTKE 1HBTH 3ATIA 4E06H 3KYGA 1YPKH 2Z94A 2ZDVH 3VEQB 4B2BA 2WPIS 4FXGH 3ZZAA 2KZ4A 1W0YH 2J9NA 1EZUC 1BCUH 4DIHH 4BTIB 1ANCA 2GX4A 2BDGA 2CF9H 4X6OA 1ESTA 2NU3E 1UHBA 2ZHFH 1S82A 3FOAA 3QDZB 1TQ7B 3EA9A 1AFEH 2FM2A 4KKDA 3RLWH 2FOMB 3KIDU 1AE5A 2BOHB 1MKXH 4NIVA 5E2PA 4YT7H 2ZDLA 3ZYDA 1H4WA 1CGJE 2VBCA 2VINA 1MQ6A 1NPMA 4MQAA 4Y10E 1UK2A 4R8TB 1AB9B 4CH8B 1BRBE 1QA0A 1HAHH 3GOVB 1ZGVA 2GMTB 1GJ7B 1HAGE 3TPIZ 3RXPA 4DGJA 4JZIA 5DN6D 1MTNB 1NN6A 1GI9B 1O2HA 1Q31A 2IPQX 1QNJA 2XBYA 2A5KA 1GHYH 5GDSH 1CBWC 3PMJA 3MU0A 4NFEA 8KME2 4ABEA 2PWXA 3QZQA 3H09A 3UAIC 1FQ3A 2XXLA 1HV7A 1EQ9A 4NA8A 1J17T 1CVWH 1HDTH 4VGCB 3Q3YA 1O32A 1ESBA 1MUEB 1UVSH 1ZLRA 2GD4B 2QYIA 1TAWA 3QO6A 1OP8A 1FX0B 1TPAE 5FCKA 4CRBA 3D62A 2BY8X 4D7FA 1QL8A 3RXJA 2UWLA 2VIPA 2EQNA 4BOHA 1IQNA 4XFQA 1QIXB 2ZPSA 1AHTH 2J92A 1G32B 1GVLA 1QL7A 1WCZA 2A1DB 4THNH 4XD7D 5GCHG 3MFJA 3BTTE 3CENA 4H6SB 5F6MA 2A5AA 1K1OA 2BQ6B 4KP0A 1L4ZA 3RC6A 2H5DA 3E3TA 4KTSA 2WPMS 1PPBH 3RLYH 4Y8XA 2IJD1 4ZKRU 1O2PA 1AD8H 2FZZA 1GBMA 2QXJA 5GXPA 1CU1A 3FP6E 1ZSJA 3BF6H 2ZI2H 2FYRA 1SQRA 2GV7A 1WU1A 1SFQB 3AW1A 3D65E 1SFIA 3QK1A 3CNRA 3PTNA 4H6TA 2ALPA 2GT8A 1D9IA 2C93B 3LT3A 1PJPA 4UD9H 4WXIA 1E36B 1GJDB 3PROA 5FX6A 3TK6A 1EX3A 3KQ5A 1AI8H 1V2ST 1FZZA 2XC4A 4CBNA 4AC9A 2Q1JA 3RXTA 3SUGA 3FZZA 3A87A 1CA0B 1LHCH 4ISIH 4FOUC 1HJAC 1LVMA 2GCTB 3BTQE 1DSUA 2B5TB 2G5VA 1O5GH 3M37A 2W3IA 1BDAA 3PLPA 2HNTF 1FAXA 1N8OC 1O5AB 3D49H 1WTHD 1O39A 2PR3A 3UTUH 1ANDA 3GISB 3NCLA 1DT2A 3E1XB 3V13A 1MU6B 3A80A 1DWEH 1HUTH 2Y7ZA 3URDA 5GCHF 2AIPA 4UFEH 5B6OA 3SU3A 5H4IB 1OYTH 1RD3B 3GYMA 3ZZ7A 2P8OC 2FI3E 1F5LA 1S6HA 3MNBA 4X1SU 3M61U 1MTSA 2BD4A 5DG6A 3SNCA 3IG6B 1G2LA 1G2MA 3O8CA 1O2GH 1MTUA 1DXWA 3GCOA 4TY6A 1GL0E 1SHYA 2ZFSA 2ODQA 2PFEA 4Y71A 5DPAA 1C4U2 1H8HD 4MPXA 3F9GA 3GYLB 1ZRBA 3RXRA 1NRPH 2OINA 1UTJA 1W2KH 1ZHRA 1WV7H 1JOUB 5C0UA 1OWEA 3A8DA 4U01A 2XBVA 2FO9A 4UDWH 5KGOA 3TNTA 2YNAA 1ELBA 3H7TA 1TLDA 2I6QA 1ELDE 1C1WH 4ZCNA 3RMOH 4JZ1A 1HAVA 1GI3A 5FBIA 1TALA 2F9BH 4B2AA 3MU1A 1S0RA 2AS9A 1QCPA 3DFLA 1K9OE 3BN9A 1W0KD 2QF5A 4TYDA 3EA7A 1A5GH 3GCTF 3ATKA 4X1QU 2XCNA 4MVNA 1BITA 2BLWA 4E05H 3VXFH 5IK2D 2HLDD 5HM9A 1WDIA 3EAJA 3TJUA 4O3UA 1EAXA 4F48B 5CDFE 1O3BA 2ANWA 2WV9A 4A5TS 7GCHF 1EOLA 1QQUA 3BIUH 2XWBI 4ZUHA 3K9XB 1IAUA 2KAIA 3MOCA 1O2TA 3SJIA 1DSTA 1XVMA 3LJOA 1EATA 1DOJA 1W0ZU 3MH5A 1ZYOA 3MU8A 1S81A 2BD2A 2F9NA 3SGQE 2D8WA 1S6FA 2GGVB 2UUYA 3U1IB 3T28A 2RG3A 4LZ4B 2ZGCA 1O36A 3QGJA 4YXWD 1GHWH 1BMNH 4ZXXH 2TPIZ 3WWFA 1XUIA 2Z3DA 5JBCS 1LHEH 1BTPA 2CF8H 1AQ7A 1QQ4A 5AHGH 3BTGE 1L0ZA 1LHDH 3LH1A 3MMGA 5I25A 1O31A 1C2JA 1FNIA 1KXBA 2ZTZA 3T62A 1GBKA 1O3GA 1T8MA 2QN5T 4O3TA 3RU4E 4DCDA 1C1MA 4ESTE 2ZGJA 1KLTA 1O5DH 2FOFA 1EP5A 2FDAA 1A3BH 1O2KA 5L2YH 1OX1A 2Z7FE 2ZFFH 2C4FH 1C5WB 2C8ZB 4BAOB 2VVCA 3SYJA 1RIWB 1YM0A 4MNVA 1ZZZA 3RP2A 1TBQH 1VJAU 1Y8TA 3S9AA 2TRMA 3IITA 1GI6A 2P3FH 4CRCA 3B9FH 5GJ4B 1O5BB 1A0HB 1O2NA 3KN2A 2WPDD 1BTHH 1C5ZB 2FEQH 5I46H 3U69H 2ZZUH 2G52A 3FN8A 1JMOH 3PV2A 2AGEX 2ZU3A 1O2MA 3ZVFA 1JRTA 3KGPA 1W7GH 1S0QA 1WBGB 2JKHA 3T2NA 3OU0A 2KFWA 5DP4A 3TVJB 5A0AE 3SJ8A 2J98B 1V2NT 2ZIQH 3KQBA 1OKXA 2ZU2A 1UK3A 3V3MA 3WW7A 3SI3H 4FUEA 1AKSA 1L1NA 1TX8A 1OOKB 2BQ7B 2XW9A 1SGFA 5DP8A 5K0HA 3SU4A 1FY3A 3MNXA 2QCYA 3KYFA 3VB5A 1ZMNA 1QZ8A 1SGIB 4NSVA 3A89A 5J4QA 2GDDA 2A31A 2PKAA 5C1XA 1IQMA 2Q6GA 4XRNA 4K5ZA 1C4V2 4OS2A 2H5CA 4O9VA 2QXIA 1EB2A 1PQ5A 3HK3B 4NIXA 4WY3A 5EIYA 2QV1A 2ANKH 2ASUB 2Z9IA 1TYNA 1FY1A 1DFPA 1WTGH 3NRLA 2D2DA 3LGVA 1FY4A 2ZC9H 2BLOA 4YOGA 1TA6A 3A85A 1GBJA 1PPZA 1UO6A 4B6FA 3SNEA 3AASA 3PO1C 4Y0YE 1OYQA 1WQVH 2CXVA 2UUFB 7ESTE 3RXFA 1FXYA 3SZNA 1FIZA 3ZV8A 3ZVDA 4B73A 4YOJA 5JBAS 2WZQA 5TCAA 3SV6A 2M2AA 3SU2A 2ZQ1A 5F8ZA 2O8MA 9LPRA 1GDUA 2C90B 4BAMB 1W12U 1C1TA 3E0NB 1QR3E 2UUJB 3GY7A 1LVOA 1MBMA 2BMGB 2NU0E 1O3HA 5E0JA 2OLGA 2XC5A 4Y8ZA 2VWNA 1JRSA 3ZVCA 3NWUA 1C1QA 3M7UA 1QJ6B 5EQQA 1SGDE 5E0HA 3SW2B 1ZHPA 4SGBE 1PPEE 2FOGA 4KTCA 3MO9A 3U8RH 4OS6A 3A7ZA 5FPSA 1MMJN 3A8AA 1KTSB 2A0QB 3LONA 1ELFA 1FMGA 4KTUA 1O3MA 2AMDA 5FHTA 4ZROA 1H8IH 1O3NA 4NA9H 1ZPBA 3OTPA 5FL7D 1H1BA 1TRMA 1KLIH 3E16B 2ODYB 4MLFB 3KEEA 1QBNA 1DM4B 3MQKC 2EI7A 2QXHA 2BD9A 2Q6FA 1AB9C 4HI3A 4AYVB 1GBFA 4MNYA 2WINI 1EJAA 3KL6A 2GMTC 4WMEA 1K0HA 1Z8IB 1OP2A 2OBOA 2ZKSA 1NRSH 1TMTH 4Q63A 3NK8A 2CHAC 1Z6EA 1MTNC 2ZECA 2V35A 1EPTA 1WUNH 1DUAA 1ZSLA 4J2YB 4ISOA 4X8TH 1RXPA 3SHAH 2J94A 4AFZA 3PRBA 3E90B 2BZ6H 1LO6A 4MPVA 2WV4A 1PPCE 4MNXA 4VGCC 5HGGA 1BRUP 1NU9A 3STIA 1ELGA 3M5MA 1ZHMA 2CK3D 3PMBB 3BTEE 3DHKH 3RMMH 1UHBB 4Y76A 1IQEA 1CE5A 1SBWA 1TRNA 5EOKA 5C67A 1AWHB 1K1LA 1NRRH 3BV9B 1ZRKA 4FVBA 2XC0A 1ZMJA 2ZU1A 2QE7D 4AB9A 1YLCA 3UOPA 1LKBA 2ZDNA 4XBBA 2O8WA 1ZPCA 3T27A 2V7QD 1Z1JA 4A1XA 1V2LT 2BOKA 3MH4A 5LPRA 3F68H 2FI4E 1TONA 4NWLA 1UK4A 1BJUA 3RXLA 1GJ9B 3OY6U 1WXRA 1J9CH 1JXPA 1XUKA 2WYGA 3PMHB 1AE8H 2QF3A 5EQRA 3P8GA 2H9HA 1ARCA 1ELCA 4MPUA 2XOKD 1Y3VA 2SGPE 3A7XA 2YMSB 2ZCLP 1YPLH 4I86A 1MH0A 1YBWA 1F0RA 4Y7BA 3ZZ3A 5CMXH 4UONA 1ID5H 1SMFE 1QRZA 2VGCB 3SJKA 1BMLA 3ZZDA 5LH8A 4JYVH 1NT1A 5G4BA 3STJA 1MAYA 3DSPA 1HAXB 2G4UA 5DP6A 1K1IA 1V2WT 3GY4A 5HYOA 4WH6A 2FOEA 4YT6H 1ACBE 1C5OH 1T8OA 1ETRH 3SV9A 1KIGH 1TX6A 1CA0C 4LZ1H 3FO8D 2ZU4A 3CS0A 3F9FA 1QL9A 1J15A 2GCTC 1O3KA 3A82A 2XBXA 2OC7A 1XUJA 2TBSA 4FUHA 4ABFA 4INKA 1E37B 2LP6A 3MNSA 1O3OA 1A61H 2A4OA 1CSOE 3F2GA 4KELA 3T29A 5JB8S 1FN6A 1JIMA 1UCYE 3T25A 3TLOA 3PLBA 1ZMLA 2BDIA 2ZA5A 1UMAH 2XWAA 1O0DH 1W13U 1GBTA 3B8JA 2NU1E 1ELAA 5KEDA 1ZTKA 1BTZA 2R3YA 2VH0A 3RMNH 3CP7A 5C3NA 5FPYA 1DS2E 3BTFE 3RC4A 2KCAA 4JYTA 2AFQB 2A2XH 4Q7YA 2EY4C 3MNCA 3RXSA 2QIQA 3RXHA 4ABBA 1GCTC 3P6ZB 2RDLA 1ZJDA 1W11U 3UNSA 3S9BA 1GJ5H 2Z3EA 4ZKOU 1BT7A 3PTBA 1SLWB 3MYWA 4I32A 1KLJH 1O33A 2RDEA 3A7WA 1YP9A 3EA8A 1QJ7B 1O3FA 3QLPH 3ATMA 1Y5AT 2CHAB 2XCFA 2Y5HA 3FP7E 1BIOA 1THSH 5BRRE 1E38B 3KNXA 4AG1A 3M5LA 1O2QA 4H42U 3BEUA 1KXAA 2HALA 1GBIA 3S69A 1BHXF 2R9PA 2EA3A 3ZZCA 1BMMH 1L1GA 1G30B 1SLUB 3A81A 2ZFTA 3PV5A 1W14U 2K1QA 2VIDA 2C8WB 5E0GA 4K69A 1TOMH 4OGXA 3O8RA 2O8TA 3VB4A 1C9PA 2FLBH 4XBDA 2L74A 2D26C 1H8ED 1QURH 3RXBA 1ZPZA 1SL3A 1C5NH 2BLQA 1Q3XA 2PUXB 2F9UA 1T4VH 2ZPRA 1UJ1A 3FFGA 1TGBA 2P3UB 3LC5A 1SGYE 2QC2A 2ZDMA 2KCPA 3VB3A 1GPZA 3AVZA 3GY6A 6LPRA 1W8BH 4YTAA 2GT7A 3LU9B 2HWLB 1A46H 1PPHE 2W26A 2FXRA 4IGDA 4A6LA 4GLYA 5ESBA 2VIOA 2BDYA 1K22H 3OEHD 1V6DA 2ZF0H 1HAVB 1LQEA 2VWOA 2ALVA 4JCNA 1WSSH 1VITH 4ISHH 5EJLA 5DP7A 1MD7A 1CQQA 2WYJA 2Z6BD 3SJOA 3HATH 3SU5A 3MHWU 1Y5BT 2FOAA 1VR1H 4X8UH 3ZV9A 4JMYA 1O34A 4DVAU 8LPRA 1NS3A 1AVWA 2WUBA 1AO5A 1C2KA 3F0PA 3ZZ5A 1DICA 1GJ4H 1TNGA 2P16A 1T8LA 1MBQA 5FBEA 1H9HE 4GVUA 2PUQH 1L2EA 4AB8A 3D23A 1S85A 1SGCA 2BM2A 1X7AC 1Z8GA 3DFJA 4FUJA 5EXLA 4RT1A 3AAVA 2KAIB 2ZCKP 4MNWA 2DUCA 2ZTYA 1RIWC 2AGIX 1NROH 3BIVH 1A4WH 4X1PU 1SLXB 1QB6A 3L3TA 4AZ2B 2EEKA 1W10U 3ENSB 3SQHE 3P70B 4WMFA 1JWTA 2AMPA 4ABIA 5C0TA 1WQSA 2SGDE 3UNRA 2SGAA 2TGPZ 1Y3WA 1WYKA 2GKVE 1KXDA 5HIYA 3DSGA 1EJNA 4NG9H 1ZR0A 1FONA 2GCHG 3OTJE 3LPRA 1K28D 2BY9X 2SGQE 2H9TH 2PGQB 2WPJS 2OTVA 3AW0A 1GCTB 2JETB 1O37A 1F5RA 1KYNA 5EXNA 4ABGA 2G00A 1NFUA 1ANEA 1KXCA 1K1NA 3OX7U 1TGSZ 1Z7KA 1HRTH 5AF9H 1IQJA 4CRAA 3UPEA 4UFGH 1D3DB 1IQHA 1XUFA 3SN8A 1GI7B 2XTTB 4QT8C 2A4QA 1V2QT 2PTNA 4RI0A 1ELTA 1S5SA 3WWBA 1B7XB 2B9LA 2HVXA 1HIAA 3SV7A 2F9PA 1YPEH 3L6PA 2PW8H 2G51A 5KECA 2HNTC 2W6ID 3LKWA 3SQEE 2WPHS 3KCGH 4CR5A 1A2CH 3FP8E 1P2QA 5T1VA 4GPGA 2O9QA 1BTWA 1WOFA 4PROA 5JPMH 1P2OA 4IC5A 2IJOB 1BQYA 1NZQH 5A0BA 5C1UA 1ETTH 1SGRE 2ODPA 1LKAA 1J16A 1MU8B 1VJ9U 3RXMA 2HVYB 1LMWB 2JDID 3F0OA 4NZQA 3OEED 4ZKNU 2BY5X 6GCHG 1AIXH 4Y7AA 1LHGH 1RS0A 4MG3A 4U30A 2QGRA 1GMCG 3PMAB 2PSYA 5CE1A 1THPB 1GBDA 2P3TB 3E91A 3WY8A 2OC0A 3W94A 4GCHG 2V3OH 2C8XB 3GICB 1KDQA 5FPTA 1TWXB 1AU8A 3LJJA 4NZLA 4B6EA 5T6DA 4ACAA 2GCHF 1AKSB 2BDHA 4ABDA 1O3AA 1L4DA 2A7JA 1PQ8A 1YPGH 2ZP0H 1UTPA 2OBQA 1P06A 3Q3XA 3URCA 5A2MH 1LHFH 3OAAD 1Y5UT 1DDJA 2F4LA 3V12A 2PGBB 2Y6TA 1GGDB 2RCEA 3QWCH 1FY5A 3W1EA 1V3XA 2PKAB 1LTOA 2FLRH 1F7ZA 1BHXB 2ESTE 2SNVA 1UVPA 1GJBB 4X6PA 1O3EA 2VVVA 2JJ2D 1GDQA 3BTME 2ZFQH 3KHVA 2FOBA 4FUDA 5AVDA 1XMNB 3GY8A 2WSSD 1HB0B 5EPYA 2ULLA 1TGTA 4HTCH 4Q7ZA 2R0KA 3P17H 1T4UH 2GZ7A 1D6WA 1A3EH 3VFEA 3BTDE 1MKWK 1NM6A 4JZDH 1LVYA 4NIWA 4ASUD 3MO3A 1OPHB 3N99A 4Q80A 2ZEBA 1G3EA 5A0CA 2VB0A 8ESTE 2V3MA 2ZDKA 4DJZB 4OM9A 3RXKA 3SUFA 3RC5A 4BXSA 5JBBS 1TX7A 8GCHG 5E8EH 1QB1A 3LIWA 4OS4A 3DT0H 1SPJA 4UEHH 1NY22 4WXVA 1FPHH 1O3PB 4BTUB 1A7SA 1N1LA 4U32A 3QTVH 4YZUA 4D76A 5T3HA 1NU7B 3N7EA 4UFFH 2AERH 1HAYB 2FOCA 1EZSC 3CS7A 1PYTC 5TJXA 2AEIH 3H5CB 1H9IE 1MQ5A 1SOTA 3JZ2B 1HAPH 1GBLA 1P9SA 3E8LA 3K6YA 3SJ9A 1RFNA 1EKBB 2FI5E 4E7RG 1GJ6A 1E1QD 1IHTH 2PSXA 5GWZA 1AFQB 1Y59T 3EDXB 3H7OA 4TWWA 1P01A 4YOIA 5L6NH 1DY8A 3PM3A 3LC3A 2OUAA 2VIQA 3M5OA 1YLNA 1E35B 4Q4LA 6CHAB 1TMBH 2PP6A 4Q7XA 1QY6A 2FYQA 2OCVB 4CRFA 1DWCH 1FIWA 2GZ9A 1ZSKA 2IPHA 2XNIA 3A86A 1NFXA 1O2XA 3DSOA 4I8KA 1C5XB 2FTMA 1YY3A 2ZHDA 4Z6AH 1O5FH 3ZVAA 1EPTB 3BEFB 2C8YB 4DY7B 3W95A 2YMSC 3A8CA 1ORFA 2F83A 3ATLA 1F92A 1SHHB 5EW1H 2AH4X 2OK5A 2J34A 1V2OT 2A7CA 8GCHF 2VGCC 4ZHAA 1HYLA 1ZTJA 5EQSA 1K1MA 1EZQA 3FVFB 2Z9JA 4I8LA 3SV8A 3MTYA 1GHXH 2Y7XA 3TGIE 1PQAA 1C1SA 3FZDA 4NFFA 3PWBA 2F3CE 5EJZA 4GUXA 1ZGIA 2JH6D 2KCYA 2PHBA 3SBKA 4X1NU 1P2MA 1GJAB 2Z9GA 2GDEH 3MO6A 1BBRE 1Z8RA 1G36A 2BLVA 2STBE 2BDAA 4AN7A 4XDEA 5E2OA 2OQ5A 2WHXA 1TGCA 4Y11E 4IN2A 2JIZD 3NKKA 3UOUA 2PKSB 2VWMA 1C5QA 2B7DH 2HPPH 4CHAB 2J97A 3FKSD 3HK6B 3LGWA 5F8XA 1GI8B 4FVDA 2CV3A 3VG8A 3DA9B 4OS5A 2J95A 3QN7A 1CA8B 1D4PB 1UTKA 5C20A 3A7VA 1YCPH 3GDUA 1TMUH 1VITG 1ARBA 3DCLA 4IW4E 4OS7A 1UTLM 1OHHD 1GWAA 1O3IA 2VH6A 2OQUA 1LQDB 1UTNA 3E6PH 4X6NA 3N7OA 1O3CA 1GMDG 5JDUB 1TIOA 3F9HA 2GVFA 3M35A 4INLA 4Z1MD 1W0JD 1B5GH 3SU0A 4D8NA 2NU4E 1PQ7A 4AX9H 3BG4B 1AZZA 5JBTA 3KQEA 1JBUH 1GBEA 3I78A 4WJG2 1EFRD 3UQVA 1MABB 1KTTB 5A09A 1C1VH 3A83A 1G3BA 1VCWA 1ABJH 4K8YA 4H4FA 5AFYH 4F55A 4GSOA 1C2HA 1LCYA 1VCPA 3V0XA 4HFPB 3QUMP 4HZHA 3UREA 1C1UH 5AFZH 1U6QA 2F91A 3SNDA 3NPSA 3SHCH 1ELVA 1B0EA 1J8AA 5GNDA 2HPQH 1AY6H 1E0FD 3P95A 5EJ1A 3MU4A 1OSSA 3F2FA 1ABIH 2QY0B 3VGCB 1PYTD 1YWUA 1XUGA 2P93A 2R2MB 1IOEA 1FJSA 2JH0D 4ZHLU 1YC0A 2IN2A 2THFB 1XXFA 2BQWB 1TRYA 3TH4H 3UB0A 1AUJA 3ZZ9A 1QBVH 2GP9B 2G5NA 1SLVB 1SQAA 3PLKA 1IQGA 2BVRH 1H9LB 5EW2H 7KMEH 4JK5A 1NESE 4O97A 3QX5H 2RA3A 3T5FH 1C2GA 3O8DA 2GJGA 2GTBA 5DK1A 5EU8A 2G4TA 2FPZA 1GMDF 1C5LH 3NZIA 2FESH 3MH7A 5A8ZA 3A7YA 1FDPA 1YPHC 3P8NA 1AMHA 1O5CB 1GI1A 1N6YA 4K60A 3OY5U 2G8TA 3MI4A 2A7HA 4X8VH 2YMSD 5J4SA 1VZQH 2FMJA 3LOXA 1HJ8A 5LGOA 1F0TA 3UQOA 4FU7A 4UE7H 2KR7A 2UUKB 1TQ0B 1UCYH 1XX9A 2FX6A 4GHTA 2W7UA 2Z9LA 3TH3H 1TBZH 1OWHA 4DIIH 1IQFA 5FXLA 4XE4A 1SB1H 3S9CA 4TSFD 1FV9A 3HKIB 4TY7A 2A45B 1DANH 3GCHB 3LH3A 1HAIH 4CH2B 4LXBH 1C5YB 1P2KA 1TABE 4A1TA 1BOQA 2QAAA 1C2IA 4FU8A 3QZRA 3UR9A 1MCVA 2ZO3H 4DOQA 3I29A 2LELA 1QB9A 1AGJA 2OD3B 5DJ7A 7LPRA 1VGCB 2K0QA 2P94A 1GI4A 2TGDA 1HGTH 3ZZ6A 1V2UT 1INCA 1TNLA 1XXDA 3RU4T 1K1PA 1NRNH 2ZFRH 1C1NA 2ZHEH 1Y3YA 1O3DA 4AG2A 2H2ZA 3S0NA 2Z9KA 3Q77A 4FUBA 3RXAA 4GHQA 2Z3CA 3M7QA 3ODDA 1P9UA 1QJ1B 4LK4A 1CGIE 4X6MA 3EQ0H 2SGEE 3KF2A 4OS1A 1HAZB 2F9OA 1P2JA 5HXFA 1HNEE 1EASA 2UWPA 2CMYA 3F3BA 2JETC 3PV4A 4ZHMU 3NUMA 1ESAA 1MZDA 3EYDA 4MPWA 5HM2A 1QRWA 3ODFA 1SI5H 1SGTA 1OWKA 1K1JA 3ZZBA 5HKKD 3BTHE 4AORA 4IMZA 1YF4A 3LGIA 1G9IE 1GBBA 1OP0A 1V2TT 1D3QB 2Y80A 1Z8JB 3T26A 3OE7D 3O8BA 3HGNA 3FANA 1GMHG 3U9AH 1FI8A 3U8TH 3UNQA 3U8OH 4AFUA 1P2IA 3PWCA 1Y3XA 1P05A 1T32A 3M3VA 4ISNA 4ACBA 1ETSH 2R2WU 3BG8A 1FY8E 1A0JA 1RRKA 1C1PA 1OWIA 3HGPA 1UTQA 2P59A 4ABHA 1YCPK 4ZKSU 1DE7H 5T6GA 2ZPQA 1YLDA 5DO4H 1CT2E 1MCTA 3ZIAD 2V3HH 1PFXC 1YGCH 3HKJB 1UVOA 2R0LA 1MZAA 5GPIB 1T31A 4X2XA 4IC6A 1OWJA 1C5VA 1IHSH 1WAYB 2XNDD 4INHA 3U28C 5DSFA 2CJIA 1GI2A 2VNTA 1K21H 1UW7A 1TGNA 2XBWA 2BD5A 4K1SA 1MKWH 4ZH8A 1C5SA 1EAIA 2OP9A 2ZU5A 1O2JA 2QF0A 4I33A 5CHBA 1QA7A 4ABJA 1RTKA 2BHGA 3RXQA 4BXWA 1BA8B 1HIAB 3M3SA 1QTFA 1E79D 3S7HB 1BRAA 3SGBE 1GGDC 1C5PA 1TBRH 2W7SA 1NO9H 1LPZB 2PV9B 2AMQA 3LGTA 2G81E 1P04A 4GAWA 4D7GA 1RJXB 1IQIA 2Y5GA 1GMHF 1TFXA 3SOSA 3G01A 3EE0B 1DVAH 5C5OA 1BMFD 2PTCE 2ZCHP 2ZHQH 2QF4A 1O2UA 2GV6A 3RXVA 2K8IA 3EGKH 3SNAA 1CHOG 1XKAC 3UIRA 5DP5A 4WH8A 2B8OH 3PB1E 1HAOH 1DWDH 5LPFA 3M3TA 3OSYA 2OC8A 5L30H 1TNIA 4OGYA 2ZDAH 3SORA 2JJ1D 1KDQB 1A5IA 1N6XA 1BRCE 3EE7A 2FS9A 5DKMA 4IMQA 3RXEA 1YPHE 3RM2H 4SGAE 1GG6B 1GL1A 4AGJA 1SQOA 4BAQB 1TNHA 4R0IA 1Y3UA 4ABAA 1C1RA 2VU8E 4Y6DA 1G37A 4YLUA 3SO3A 4FUGA 3TJVA 1ZTLA 2PLXA 2F9VA 6ESTA 1C2DA 1MD8A 1E34B 1O2VA 1QRXA 1P3CA 3DUXH 3SV2H 1TA2A 5EXMA 1SSXA 3ELAH 2P95A 4CBOA 1RTFB 1G3CA 1UCYK 3S7KB 1TPSA 2VWLA 4AFSA 3GCTG 4BNRA 2J2UA 2JH5D 1NRQH 2XYAA 5BPEA 1V2RT 4RKJB 3GS9A 3TGKE 1OWDA 3UFAA 1C5RA 2DE9A 4TPYA 2ZQ2A 2G55A 3K6ZA 1KMHB 1AUTC 1HPGA 3K2UA 1UTOA 1FUJA 2AIQA 2ILNA 3KQCA 2H9EH 1O2YA 1DX5M 1F2SE 1QHRB 2FP7B 4B76A 1S6LA 2OXSA 1AFQC 7GCHG 1CHGA 4P02A 1BB0B 1D3PB 2DE8A 3M5NA 4XBCA 1XUHA 1P02A 6CHAC 3UY9A 2AYWA 2ZGXH 3OFND 1SVPA 4RKOB 1O2IA 1TNJA 2STAE 1NFWA 2A4RA 1CHOF 2FWWA 2J5UA 4P00A 4F4OC 1FAKH 1LPKB 1SGEE 1FPCH 2SFAA 4WVPE 5FX5A 3RXIA 4A7IB 2NU2E 3A84A 1EB1H 2ANMH 3F6UH 1EPTC 4I31A 1RGQA 1UVUH 4K8BA 2WV5A 4X2WA 4D9RA 1GJ8B 1C4Y2 3A88A 3OYPA 1V2PT 2BY7X 2Q6DA 4YO9A 1CBWB 5EG4A 2RFKC 1EUFA 1M9UA 4X8SH 1GHVH 1LPGB 1TNKA 5DGJA 4ASHA 1EAWA 4ISLA 1C2LA 1K2I1 1AWFH 4TT3D 2FIRH 2ZG0H 3GY5A 4JYUH 4IN1A 4YM9A 1BUIA 5GIBA 1GI5A 2EI8A 1P3EA 4I8HA 3RXGA 3U98H 1TB6H 1MKXK 4ZMAH 2CN0H 1C5TA 3QTOH 3QGNB 3GY2A 1C5MD 2L6OA 3SU6A 2UWOA 4HGCA 5DP9A 2W3KA 4HG6A 2FS8A 1P0SH 2PKSC 3A7TA 3RUOA 3TJNA 1DITH 1O5EH 3RU4D 2C3SA 4CHAC 2ZTXA 5IDKA 1GJCB 1O3LA 1FN8A 1GHAG 4MDSA 4IS5A 1IQKA 3KQDA 2HGTH 3SNBA 4Y79A 1SG8B 1GVZA 3TGJE 2BVXH 3RMLH 1L1JA 1F0SA 4NCYA 5DP3A 1DXPA 1F0UA 4WF8A 1S83A 4F49A
chains in the Genus database with same CATH topology
5C2ZA 1Z6JH 4X0WU 1TPPA 1OS8A 3IWMA 4YLQH 3RM0H 4NWKA 3BG4C 4B74A 1KY9A 3E0PB 6GCHF 1P8VC 3NXPA 1LDTT 1SGPE 4TWYA 1DY9A 1GMCF 3ZYEA 1MTWA 2Y81A 1DWBH 1J14A 1HJAB 1D6RA 4GCHF 3P92A 1LVBA 1G3DA 1AN1E 1TE0A 3V7TA 1ANBA 3FAOA 1O30A 1DUEA 5EGMA 3F1SB 4B2CA 5C5NA 4MTBA 1JIRA 1N8OB 3GY3A 5L2ZH 1ELEE 4I8JA 3P8OA 3VB6A 3VGCC 2O8LA 1YKTA 4M7GA 3RXDA 3VPKA 3ZVGA 1CO7E 4AFQA 1EJMA 1VCQA 2R3UA 1C2MA 2J4IA 1T7CA 4RSPA 5CHAC 2A4GA 2P8OB 1ZJKA 4FUFA 1GHAF 5EODA 4NSYA 1RTLA 2ZGHA 5IYTA 1SQTA 3SUEA 3UWIA 3MWIU 1TPOA 3DD2H 1O2SA 3MU5A 4NA7A 4X2YA 4A1VA 2ANYA 2TGAA 1XKBC 4X2VA 1SR5C 3SI4H 1BTXA 2VVUA 4IBLH 1O2WA 1MTVA 2BD3A 1BBRH 2BD8A 1SGQE 1PPGE 4CRGA 3ITIA 1GBCA 2SNWA 1GBHA 1XVOA 4TPIZ 2H1UA 2A2QH 2BD7A 3ZVBA 2A5IA 2J38A 3TH2H 1EP6A 2YOLA 4JZFH 4K2YA 2M5TA 4WMDA 4D9QA 4BANB 5JYIA 1B0FA 5FCRA 4Z0KA 1PPFE 3GDVA 1C2FA 3TK5A 1EAUA 4XOJA 2ZFPH 2HRVA 5K7RA 1O2RA 3GCHC 1V2VT 5TCCA 2HLCA 3K65B 2V6NA 4BAKB 1F5KU 1O3JA 1C5UA 1W7XH 1GHBG 4Y0ZE 3SGAE 2WUCA 5ABWA 3ZZ4A 4ZAEA 3UR6A 2NWNA 5HMAA 4FUCA 2HNTE 2BX3A 3C27B 1VGCC 3RDZA 4FUIA 1Q2WA 3AAUA 1V2JT 1P2NA 2VIWA 3TJOA 1HJ9A 1V2MT 1KXEA 1QFKH 1CGHA 4B75A 2I6SA 3M36A 1A0LA 2B0FA 1QGFA 4Q2KA 4X1RU 1BZXE 2ZWLH 1AZ8A 3PYHA 5T6FA 2SGFE 2BB4A 4BTTB 2ZNKH 2GZ8A 3LGYA 1EZXC 3Q3KA 1GHZA 3UUZA 4B1TA 4WWYA 3F9EA 1EOJA 2IOTA 1P10A 3B23B 4A92A 4DURA 2BZAA 2XRCA 3L33A 4U2WA 1YCPM 3TNSA 1UTMA 1QBOA 4K1TA 4DG4A 2QA9E 5C1YA 1TOCB 3HPTB 2V0BA 3SU1A 9ESTA 3BTWE 4J1YA 3ATWA 1BJVA 1Z71A 1DPOA 2EC9H 1H8DH 1A5HA 1P03A 1AVXA 2TGTA 4NGAH 1O2ZA 2BY6X 3VXEH 2BDBA 2W5EA 3A8BA 1O35A 4JZEH 2FTLE 4Y8YA 2BXUH 1GDNA 1GHBF 1KSNA 4AOQA 1C2EA 2H6MA 1BMAA 3LGUA 2Y82A 1Z1IA 1XM1A 4B71A 1SOZA 1SC8U 1YPMH 3SUDA 4E7NA 2ZGBH 1THRH 1T8NA 2YNBA 4RN6A 3UWJH 4CR9A 5CHAB 1W3CA 3BSQA 4K1EA 4FU9A 1NFYA 5LPEA 1V2KT 2FODA 4CRDA 5F8TA 2WPLS 1DLKB 1NC6A 5EPNA 3RXUA 1VITF 1HCGA 5FAHA 2BYAX 3I77A 2RA0A 3R0FA 1YYY1 5SGAE 5F03A 2AGGX 1MAXA 4O03A 5JB9S 1BTUA 1P11E 5PTPA 2FX4A 3TITA 1P09A 1FLEE 3GDSA 4KGAA 1UVTH 3Q00A 2LNCA 2Y5FA 1P12E 5A8YA 1GVKB 2CGAA 4I8GA 4XSKU 2O8UA 2BX4A 4BAHB 1BTYA 1S84A 5ESTE 4AYYB 4UFDH 3TU7H 1C9TA 1P57B 3BEIB 3M7TA 2FOHA 3RXOA 1SGNE 2BDCA 2OC1A 3TK9A 2TIOA 2VIVA 1O2OA 2D1JA 4YESB 2BTCE 3JZ1B 1ZOMA 1DLEA 2WPKS 4JK6A 3C1KA 5A8XA 2QXGA 3VB7A 1NTPA 1D3TB 4K3JA 1AVGH 2BXTH 1SGFG 1C1OA 2VJ1A 1O38A 1KXFA 2A32A 3MH6A 3PO1B 3ZZ8A 1GI0A 1HXEH 5ETXA 4CREA 1BBRK 4DW2U 1GBAA 3Q76A 4ZXYH 1CT4E 1GG6C 1HXFH 1OXGA 3TIUA 1HLTH 3P8FA 3LDXH 1IQLA 3ZVEA 4NIYA 3RXCA 1A1RA 1GCDA 2BVSH 2HOBA 1EXFA 4DT7B 3U1JB 1O2LA 1HFDA 4LOYH 4AGKA 3ESTA 2ZHWH 2LPRA 2EI6A 1YPJH 3GCNA 3R3GB 4I7YH 1CT0E 3BTKE 1HBTH 3ATIA 4E06H 1YPKH 2Z94A 2ZDVH 3VEQB 4B2BA 2WPIS 4FXGH 3ZZAA 1W0YH 2J9NA 1EZUC 1BCUH 4DIHH 4BTIB 1ANCA 2GX4A 2BDGA 2CF9H 4X6OA 1ESTA 2NU3E 1UHBA 2ZHFH 1S82A 3QDZB 1TQ7B 3EA9A 1AFEH 2FM2A 4KKDA 3RLWH 2FOMB 3KIDU 1AE5A 2BOHB 1MKXH 4NIVA 5E2PA 4YT7H 2ZDLA 3ZYDA 1H4WA 1CGJE 2VINA 1MQ6A 1NPMA 4MQAA 4Y10E 1UK2A 4R8TB 1AB9B 4CH8B 1BRBE 1QA0A 1HAHH 3GOVB 1ZGVA 2GMTB 1GJ7B 1HAGE 3TPIZ 3RXPA 4DGJA 4JZIA 1MTNB 1NN6A 1GI9B 1O2HA 1Q31A 1QNJA 2XBYA 2A5KA 1GHYH 5GDSH 1CBWC 3PMJA 3MU0A 4NFEA 8KME2 4ABEA 2PWXA 3QZQA 1FQ3A 2XXLA 1HV7A 1EQ9A 4NA8A 1J17T 1CVWH 1HDTH 4VGCB 3Q3YA 1O32A 1ESBA 1MUEB 1UVSH 1ZLRA 2GD4B 2QYIA 1TAWA 3QO6A 1OP8A 1TPAE 5FCKA 4CRBA 3D62A 2BY8X 4D7FA 1QL8A 3RXJA 2UWLA 2VIPA 4BOHA 1IQNA 4XFQA 1QIXB 2ZPSA 1AHTH 2J92A 1G32B 1GVLA 1QL7A 1WCZA 2A1DB 4THNH 5GCHG 3MFJA 3BTTE 3CENA 4H6SB 5F6MA 2A5AA 1K1OA 2BQ6B 4KP0A 1L4ZA 3RC6A 2H5DA 3E3TA 4KTSA 2WPMS 1PPBH 3RLYH 4Y8XA 4ZKRU 1O2PA 1AD8H 2FZZA 1GBMA 2QXJA 5GXPA 1CU1A 3FP6E 1ZSJA 3BF6H 2ZI2H 2FYRA 2GV7A 1WU1A 1SFQB 3AW1A 3D65E 1SFIA 3QK1A 3PTNA 4H6TA 2ALPA 2GT8A 1D9IA 2C93B 3LT3A 1PJPA 4UD9H 4WXIA 1E36B 1GJDB 3PROA 5FX6A 3TK6A 1EX3A 1AI8H 1V2ST 1FZZA 2XC4A 4CBNA 2Q1JA 3RXTA 3SUGA 3FZZA 3A87A 1CA0B 1LHCH 4ISIH 1HJAC 1LVMA 2GCTB 3BTQE 1DSUA 2B5TB 2G5VA 1O5GH 3M37A 2W3IA 1BDAA 3PLPA 2HNTF 1FAXA 1N8OC 1O5AB 3D49H 1WTHD 1O39A 2PR3A 3UTUH 1ANDA 3GISB 3NCLA 1DT2A 3E1XB 3V13A 1MU6B 3A80A 1DWEH 1HUTH 2Y7ZA 3URDA 5GCHF 2AIPA 4UFEH 5B6OA 3SU3A 5H4IB 1OYTH 1RD3B 3GYMA 3ZZ7A 2P8OC 2FI3E 1F5LA 1S6HA 3MNBA 4X1SU 3M61U 1MTSA 2BD4A 5DG6A 3SNCA 3IG6B 1G2LA 1G2MA 3O8CA 1O2GH 1MTUA 1DXWA 3GCOA 4TY6A 1GL0E 1SHYA 2ZFSA 2ODQA 2PFEA 4Y71A 5DPAA 1C4U2 4MPXA 3F9GA 3GYLB 1ZRBA 3RXRA 1NRPH 2OINA 1UTJA 1W2KH 1ZHRA 1WV7H 1JOUB 1OWEA 3A8DA 4U01A 2XBVA 2FO9A 4UDWH 3TNTA 2YNAA 1ELBA 3H7TA 1TLDA 2I6QA 1ELDE 1C1WH 3RMOH 4JZ1A 1HAVA 1GI3A 5FBIA 1TALA 2F9BH 4B2AA 3MU1A 1S0RA 2AS9A 1QCPA 3DFLA 1K9OE 3BN9A 4TYDA 3EA7A 1A5GH 3GCTF 3ATKA 4X1QU 2XCNA 4MVNA 1BITA 2BLWA 4E05H 3VXFH 5HM9A 3EAJA 3TJUA 4O3UA 1EAXA 1O3BA 2ANWA 4A5TS 7GCHF 1EOLA 1QQUA 3BIUH 2XWBI 4ZUHA 3K9XB 1IAUA 2KAIA 3MOCA 1O2TA 3SJIA 1DSTA 1XVMA 3LJOA 1EATA 1DOJA 1W0ZU 3MH5A 1ZYOA 3MU8A 1S81A 2BD2A 2F9NA 3SGQE 2D8WA 1S6FA 2GGVB 2UUYA 3U1IB 3T28A 2RG3A 4LZ4B 2ZGCA 1O36A 3QGJA 1GHWH 1BMNH 4ZXXH 2TPIZ 1XUIA 2Z3DA 5JBCS 1LHEH 1BTPA 2CF8H 1AQ7A 1QQ4A 5AHGH 3BTGE 1L0ZA 1LHDH 3LH1A 3MMGA 5I25A 1O31A 1C2JA 1FNIA 1KXBA 2ZTZA 3T62A 1GBKA 1O3GA 1T8MA 2QN5T 4O3TA 3RU4E 4DCDA 1C1MA 4ESTE 2ZGJA 1KLTA 1O5DH 2FOFA 1EP5A 2FDAA 1A3BH 1O2KA 5L2YH 1OX1A 2Z7FE 2ZFFH 2C4FH 1C5WB 2C8ZB 4BAOB 2VVCA 1RIWB 1YM0A 4MNVA 1ZZZA 3RP2A 1TBQH 1VJAU 1Y8TA 3S9AA 2TRMA 3IITA 1GI6A 2P3FH 4CRCA 3B9FH 5GJ4B 1O5BB 1A0HB 1O2NA 3KN2A 1BTHH 1C5ZB 2FEQH 5I46H 3U69H 2ZZUH 2G52A 1JMOH 2AGEX 2ZU3A 1O2MA 3ZVFA 1JRTA 3KGPA 1W7GH 1S0QA 1WBGB 2JKHA 3T2NA 3OU0A 5DP4A 3TVJB 5A0AE 3SJ8A 1V2NT 2ZIQH 3KQBA 1OKXA 2ZU2A 1UK3A 3V3MA 3SI3H 4FUEA 1AKSA 1L1NA 1TX8A 1OOKB 2BQ7B 2XW9A 1SGFA 5DP8A 5K0HA 3SU4A 1FY3A 3MNXA 2QCYA 3VB5A 1ZMNA 1SGIB 4NSVA 3A89A 5J4QA 2GDDA 2A31A 2PKAA 5C1XA 1IQMA 2Q6GA 4K5ZA 1C4V2 4OS2A 2H5CA 4O9VA 2QXIA 1EB2A 1PQ5A 3HK3B 4NIXA 4WY3A 2QV1A 2ANKH 2ASUB 2Z9IA 1TYNA 1FY1A 1DFPA 1WTGH 2D2DA 3LGVA 1FY4A 2ZC9H 2BLOA 4YOGA 1TA6A 3A85A 1GBJA 1PPZA 1UO6A 3SNEA 3AASA 3PO1C 4Y0YE 1OYQA 1WQVH 2CXVA 2UUFB 7ESTE 3RXFA 1FXYA 3SZNA 1FIZA 3ZV8A 3ZVDA 4B73A 4YOJA 5JBAS 5TCAA 3SV6A 3SU2A 2ZQ1A 5F8ZA 2O8MA 9LPRA 1GDUA 2C90B 4BAMB 1W12U 1C1TA 3E0NB 1QR3E 2UUJB 3GY7A 1LVOA 1MBMA 2BMGB 2NU0E 1O3HA 5E0JA 2OLGA 2XC5A 4Y8ZA 2VWNA 1JRSA 3ZVCA 3NWUA 1C1QA 3M7UA 1QJ6B 5EQQA 1SGDE 5E0HA 3SW2B 1ZHPA 4SGBE 1PPEE 2FOGA 4KTCA 3MO9A 3U8RH 4OS6A 3A7ZA 5FPSA 1MMJN 3A8AA 1KTSB 2A0QB 3LONA 1ELFA 1FMGA 4KTUA 1O3MA 2AMDA 5FHTA 4ZROA 1H8IH 1O3NA 4NA9H 1ZPBA 1H1BA 1TRMA 1KLIH 3E16B 2ODYB 4MLFB 3KEEA 1QBNA 1DM4B 2EI7A 2QXHA 2BD9A 2Q6FA 1AB9C 4HI3A 4AYVB 1GBFA 4MNYA 2WINI 1EJAA 3KL6A 2GMTC 4WMEA 1Z8IB 1OP2A 2OBOA 2ZKSA 1NRSH 1TMTH 3NK8A 2CHAC 1Z6EA 1MTNC 2ZECA 2V35A 1EPTA 1WUNH 1DUAA 1ZSLA 4J2YB 4ISOA 4X8TH 1RXPA 3SHAH 2J94A 4AFZA 3E90B 2BZ6H 1LO6A 4MPVA 2WV4A 1PPCE 4MNXA 4VGCC 5HGGA 1BRUP 1NU9A 3STIA 1ELGA 3M5MA 1ZHMA 3PMBB 3BTEE 3DHKH 3RMMH 1UHBB 4Y76A 1IQEA 1CE5A 1SBWA 1TRNA 5EOKA 5C67A 1AWHB 1K1LA 1NRRH 3BV9B 1ZRKA 4FVBA 2XC0A 1ZMJA 2ZU1A 4AB9A 1YLCA 3UOPA 1LKBA 2ZDNA 4XBBA 2O8WA 1ZPCA 3T27A 1Z1JA 4A1XA 1V2LT 2BOKA 3MH4A 5LPRA 3F68H 2FI4E 1TONA 4NWLA 1UK4A 1BJUA 3RXLA 1GJ9B 3OY6U 1J9CH 1JXPA 1XUKA 2WYGA 3PMHB 1AE8H 2QF3A 5EQRA 3P8GA 2H9HA 1ARCA 1ELCA 4MPUA 1Y3VA 2SGPE 3A7XA 2ZCLP 1YPLH 1MH0A 1YBWA 1F0RA 4Y7BA 3ZZ3A 5CMXH 4UONA 1ID5H 1SMFE 1QRZA 2VGCB 3SJKA 1BMLA 3ZZDA 5LH8A 4JYVH 1NT1A 5G4BA 3STJA 1MAYA 1HAXB 2G4UA 5DP6A 1K1IA 1V2WT 3GY4A 5HYOA 4WH6A 2FOEA 4YT6H 1ACBE 1C5OH 1T8OA 1ETRH 3SV9A 1KIGH 1TX6A 1CA0C 4LZ1H 2ZU4A 3CS0A 3F9FA 1QL9A 1J15A 2GCTC 1O3KA 3A82A 2XBXA 2OC7A 1XUJA 2TBSA 4FUHA 4ABFA 4INKA 1E37B 3MNSA 1O3OA 1A61H 2A4OA 1CSOE 4KELA 3T29A 5JB8S 1FN6A 1JIMA 1UCYE 3T25A 3TLOA 3PLBA 1ZMLA 2BDIA 2ZA5A 1UMAH 2XWAA 1O0DH 1W13U 1GBTA 3B8JA 2NU1E 1ELAA 1ZTKA 1BTZA 2R3YA 2VH0A 3RMNH 3CP7A 5C3NA 5FPYA 1DS2E 3BTFE 3RC4A 4JYTA 2AFQB 2A2XH 4Q7YA 3MNCA 3RXSA 2QIQA 3RXHA 4ABBA 1GCTC 3P6ZB