4IC5A

Crystal structure of deg5
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
237
structure length
210
Chain Sequence
EELEEEEERNVNLFQKTSPSVVYIEAIELEGTGSGFVWDKLGHIVTNYHVIAKLATDQFGLQRCKVSLVDAKGTRFSKEGKIVGLDPDNDLAVLKIETEGRELNPVVLGTSNDLRVGQSCFAIGNPYGYENTLTIGVVSGLGREIPSPNGKSISEAIQTDADINSGNAGGPLLDSYGHTIGVNTATFVNFAIPIDTVVRTVPYLIVYGTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of Arabidopsis Deg5 and Deg8 reveal new insights into HtrA proteases
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords Protease Do-like 5, chloroplastic
total genus 43
structure length 210
sequence length 237
chains with identical sequence B, C
ec nomenclature ec 3.4.21.-:
pdb deposition date 2012-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ic5A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ic5A01
5EODA 2GMTC 1AGJA 2O8WA 1SGRE 4DG4A 2ODQA 4DURA 5LPFA 2UWLA 4WXIA 3E90B 1Y3XA 4ABFA 3GOVB 3VXFH 1P2QA 1GL1A 1PQ7A 2J38A 1GBJA 1MBMA 4BXSA 1K22H 1TNJA 4OS4A 3ODFA 1ELTA 1MKXK 2P3TB 3M3SA 1GVKB 3JZ2B 1LVYA 2F9OA 1S81A 1TPAE 1TRYA 2NU0E 4E05H 2FIRH 3ELAH 3SJKA 5CHAB 1UVPA 4X1PU 1ACBE 2VIQA 1O35A 5TJXA 1DE7H 1QNJA 2PSYA 2PSXA 1EJNA 2OC8A 2Q1JA 4RN6A 4Q7XA 2VGCC 2IN2A 4Y8XA 3GY4A 4WMFA 1CQQA 2W7SA 6CHAC 4GSOA 1P02A 2BDCA 1SGYE 2KAIB 5EPNA 5FPTA 4R0IA 2ZTXA 3RXPA 2VVCA 3RP2A 3ATKA 4FUCA 1TOCB 4K60A 4YZUA 2ZDVH 1V2MT 5DP8A 3GCOA 1HJ9A 5GCHG 1GHYH 4BAQB 1UVTH 2A4QA 4BAOB 1HAXB 6GCHG 1OP2A 4XDEA 3PMAB 1O0DH 1YPHC 2BHGA 1AZZA 3DFLA 3TJNA 4B74A 5FPYA 1ELVA 1V2JT 2BDYA 4MPVA 3QUMP 1MZAA 5L6NH 3KGPA 1EB2A 1TQ0B 4AN7A 1DVAH 2PUXB 1TIOA 2HPQH 1TB6H 4FUFA 4VGCC 4UDWH 5EQRA 3U1JB 2ZFPH 4CR5A 3A80A 2FS9A 1GHBG 1BTWA 1OWDA 2BDGA 3MWIU 4BAHB 2ZGHA 1Z8RA 4AX9H 1Y3UA 4B73A 2CGAA 3LC5A 4WXVA 2Y5GA 1GJ8B 1BHXF 1FAXA 1GJAB 4X6MA 1GMHF 1YC0A 5T6GA 4D7GA 3KNXA 1O2NA 1O2YA 2Z3DA 1A7SA 4I33A 4X1QU 1C5PA 2PR3A 4ABIA 5HM9A 1O2WA 2BX4A 4NG9H 3OTJE 5T6DA 3ATLA 3A7YA 4YTAA 4Q7YA 1O32A 1AE5A 3RDZA 2FOGA 5JBTA 2FM2A 5GWZA 1GHBF 1YKTA 4WF8A 5DP3A 2AERH 2C90B 2FP7B 3RM2H 2VNTA 1C5NH 4FUEA 1Z71A 2HNTE 3NPSA 1W7GH 3LH3A 3SUGA 1GI1A 4AG1A 1DANH 3BTKE 5F8XA 2GT7A 1FQ3A 3P8GA 1KLJH 1HXEH 4Z0KA 1BTXA 4JK6A 1IQKA 3ZZ4A 4ASHA 1P8VC 2PTCE 3EDXB 4IN2A 1YPKH 4O9VA 1HJAC 1ELCA 1K1MA 4I8JA 4NIXA 3SU2A 2GGVB 4X1NU 4NA8A 1KY9A 5JBAS 3GY5A 1JMOH 4OS7A 3EA7A 3LGIA 4BNRA 1MQ6A 1RTLA 2UUFB 1W8BH 1O3MA 1THRH 2XC5A 2OLGA 5LGOA 5FCRA 5JB8S 2QA9E 2GCHF 4X8VH 1O36A 3ZZ5A 1HAPH 5FX6A 5F8TA 8GCHG 1AFQC 1C2MA 4MPUA 2QGRA 2FZZA 1BTPA 2O8LA 2Y7XA 4AZ2B 5K7RA 3ZZ9A 3BTQE 2BZAA 1BRAA 2BY5X 5JBBS 2WPJS 3KL6A 3M61U 1O3DA 5J4SA 2HLCA 3AW1A 1HAYB 2EI8A 1D6WA 1NFWA 4AG2A 4WJG2 1O2OA 3IITA 1UJ1A 1TNGA 4ZXYH 2VVVA 2RA3A 2A1DB 2B8OH 2VH0A 2FO9A 3A7XA 1LVOA 2A5IA 1PPFE 2BVXH 4ISOA 1BMMH 1E34B 3UWIA 4WH6A 4CHAB 1GVZA 3KQBA 3PTBA 1EKBB 1K1NA 5B6OA 1SB1H 5EU8A 5C3NA 3QWCH 3C1KA 4IGDA 1H9IE 1UMAH 1JBUH 2Y7ZA 2WPIS 1IQNA 2B0FA 1QL7A 1SLVB 2LNCA 4O03A 3LC3A 1K28D 1TX6A 2FYQA 1S0RA 2FX6A 4Q2KA 3BN9A 4RKOB 2R2MB 3GCHB 4TWWA 1HAOH 3A8DA 2XW9A 1EASA 5GDSH 2W3KA 4H42U 3PO1C 1CVWH 2NWNA 2OUAA 4K8YA 1P57B 1Z8GA 2H1UA 4NFFA 1SLWB 3BEUA 2ZPRA 1DY8A 1PJPA 1YGCH 1C2JA 1O2ZA 1KTSB 1P06A 2IPHA 3A8BA 2BVRH 1C2KA 4HZHA 4GCHG 4FU9A 1DPOA 2BLQA 3BIVH 1NZQH 1O3IA 1ZRKA 1C1UH 2A2XH 1AB9C 1CO7E 5ETXA 1QL8A 1GBDA 1XUJA 3K2UA 1FZZA 4FVBA 3ZZBA 1NT1A 1FIZA 2PLXA 1O2QA 3PLBA 2XWBI 4K1SA 3V0XA 5BPEA 5A0AE 2V35A 1W0ZU 3GCTF 3QDZB 1O3AA 2R2WU 1NS3A 3F1SB 1W3CA 1RS0A 4Q80A 1AVXA 2ZECA 3DT0H 4SGAE 2ZWLH 1TMBH 4ABHA 1C1OA 1T7CA 2WPMS 4KELA 4YT7H 4IC6A 2Y81A 4ZKNU 4X2WA 2NU4E 1TGSZ 3SUEA 2CJIA 5JB9S 1F5RA 2YNBA 1QB6A 3UY9A 2XNIA 3N7OA 4ABDA 1YBWA 5GIBA 1LQDB 1O2UA 1GBKA 1GHVH 5LPEA 3QZQA 4E06H 4CH2B 2CF8H 4B2CA 2QIQA 1ZOMA 4MPWA 2SNVA 3NWUA 1Q31A 3QN7A 1P0SH 1Z1JA 1Q3XA 1EUFA 2ZHDA 4OGYA 5TCAA 3TJVA 3FP8E 1FPHH 1QQ4A 2ZPSA 1FPCH 2OBOA 2P93A 1MKXH 7KMEH 1NFYA 1S0QA 3VB7A 1QRZA 2XBXA 1XMNB 1QR3E 3SU4A 2XBWA 1RJXB 2ZU5A 2ZP0H 2TRMA 3A81A 1ZHMA 4WWYA 1HAVA 2F9NA 3RMMH 2EI7A 1LPGB 1WTHD 4K5ZA 3GDSA 4MNYA 1Z8IB 3DFJA 4B76A 1SC8U 4UEHH 1EAXA 1YF4A 3SI4H 2A31A 3MNXA 1EJAA 1GMCF 1GHXH 1GG6B 1JIMA 3AASA 3G01A 1MAXA 1TQ7B 1DITH 3ZZ6A 1L0ZA 3KN2A 4X2XA 1UTPA 1KXFA 1C2EA 2BD4A 1XM1A 3M7TA 1BBRK 1BHXB 1MCVA 1G9IE 2ZDNA 1UO6A 3PLKA 1GI5A 1QA7A 7GCHF 3O8RA 2FX4A 3E0NB 2PHBA 1P01A 4IS5A 1QJ6B 2PUQH 1NPMA 1C5RA 4AB8A 2BD7A 1C5UA 2QCYA 1SGCA 1ANCA 4ZHMU 3GY6A 1V2OT 1V2KT 2FLBH 1BRCE 1JRTA 2Y82A 5FBEA 4GVUA 5DP9A 2ZFSA 3RMNH 1YCPM 3F9HA 1GJ6A 1C4Y2 1UHBA 4RKJB 3ZZCA 1K1JA 1EOJA 1MTVA 3VXEH 4BXWA 1AN1E 5BRRE 1C5QA 1A0JA 1OS8A 3ZZDA 1SHYA 2AEIH 3A87A 1FLEE 4D9RA 3BG4C 3MNCA 3PWCA 4YO9A 2SGDE 1G3EA 1AHTH 1DUEA 1UTNA 3RXAA 3LJOA 2J92A 3STIA 3SJIA 1AWHB 1O2LA 5AHGH 1GI2A 2ZC9H 2YNAA 3FANA 4DVAU 1AKSA 4NIYA 1XXDA 1YPEH 5DP5A 1QRXA 2ZDAH 1O3KA 1V6DA 5J4QA 3LT3A 3URDA 3NCLA 3ZYDA 4X1RU 1GGDB 2ZG0H 3CENA 3RLYH 4LZ1H 2P8OC 3QLPH 4RSPA 2FYRA 3UREA 3S7HB 1CA0C 2BXUH 3PMHB 5SGAE 1NRPH 1ZTLA 2JETC 5DJ7A 1C5SA 2V3HH 4UFEH 3OY6U 1PPEE 5C1UA 1NU7B 1GL0E 1L1GA 1B5GH 3RXTA 3AAVA 4X6PA 7GCHG 1XUIA 3P17H 3RXFA 1PQ8A 3T5FH 1FONA 1ZSKA 1GBCA 1CGHA 1V2PT 2ZFTA 3UNSA 3FZZA 3B23B 1J14A 2WV4A 1ANBA 2BTCE 4Y0YE 1C5YB 3GICB 5L2ZH 2A4RA 4D7FA 1O5GH 1RGQA 1IQMA 1UVUH 4Y10E 1TMTH 2ANMH 3VGCB 2ZHFH 3RXCA 1C5MD 3ENSB 4NFEA 2AIQA 2QF3A 2XBYA 1VCWA 1IQLA 2Z9IA 4CRDA 1SR5C 2Z6BD 4O3TA 8LPRA 1KIGH 2O8MA 1T8MA 5HM2A 1V2VT 3E0PB 3TJOA 2A0QB 1O2HA 2TGPZ 2PFEA 1TX8A 4NA7A 1VITF 1DLEA 1MTNC 2FMJA 1QBVH 2ILNA 2B5TB 4R8TB 4TWYA 2VWNA 1FY4A 1NRQH 4U2WA 1CBWB 4A1VA 1P9SA 1G32B 1UVSH 1LPKB 1K21H 1K1OA 1XUKA 4I32A 1O37A 2VIWA 3LGWA 3TITA 1O5FH 4H6SB 4B2BA 1ZTJA 1TYNA 2AMDA 1VCQA 2VIPA 1THSH 1KLTA 4VGCB 2R0KA 3GCNA 5F8ZA 4JYUH 4XE4A 1QBNA 5GJ4B 1QRWA 2WPHS 1AUTC 1CBWC 1FY1A 1EAUA 3MO3A 1AFEH 3BTGE 1LHDH 3VEQB 3UIRA 1MTNB 3BTME 3SQHE 2GZ8A 3EA9A 1WQVH 1O3CA 1WAYB 2ZFRH 4J2YB 4QT8C 4CBNA 3A89A 1P2JA 1J9CH 4I31A 2BDBA 1QHRB 4ZROA 1P11E 1DICA 1FNIA 2TGTA 1CHGA 2AS9A 2ZA5A 2OC1A 3LGVA 3LU9B 3Q3KA 5C1YA 3P8NA 1TX7A 4CREA 4HGCA 3SGAE 5K0HA 2Z9JA 3A8CA 4CHAC 4WMEA 5DP4A 3ZZ7A 2BY7X 2Z9KA 1QTFA 4B71A 2G51A 2J2UA 3TK9A 1FXYA 1V2ST 1AIXH 4F49A 3RU4E 1AUJA 1DXWA 2XCFA 1BTUA 1H1BA 3RMLH 4MQAA 1O2KA 3S7KB 3V3MA 1K9OE 1C1NA 2BY9X 3F68H 6ESTA 1NO9H 4OS2A 4XFQA 2PW8H 2WYJA 4X8UH 3E8LA 1VR1H 1T8NA 1AFQB 1FY3A 1BMNH 1UCYH 2UWPA 1LHFH 1GDQA 3ZZ8A 1TNIA 2BB4A 3MFJA 2H9TH 1CA0B 3P95A 4JZDH 1S6FA 2QXJA 2UUJB 2GDDA 3MI4A 3SOSA 1AE8H 1GHAG 2BY8X 1C9TA 2SNWA 5JYIA 2ZGBH 2Q6FA 2ZDLA 5C67A 5I46H 4ZUHA 1OWJA 2HALA 2VINA 1SFQB 4K2YA 1BB0B 1O5DH 3IWMA 1H8IH 1Z8JB 1J16A 3RM0H 1O5BB 3UFAA 3ZVDA 1AO5A 1QJ1B 3M37A 4ZHAA 1SQTA 1S82A 1G3DA 1XVOA 1BUIA 1EAWA 1J15A 3FP7E 2WINI 8GCHF 1ZGIA 2A2QH 2C8XB 2ALVA 2BXTH 2STAE 1ANDA 2BQWB 1KLIH 1IQJA 2I6SA 1Q2WA 1C2FA 1GI4A 1N6XA 4JZFH 3TK6A 1YYY1 2C3SA 4UE7H 1Y8TA 1PFXC 1DSTA 4A5TS 1C1RA 3S9BA 3TGIE 1RIWC 2G4TA 2XRCA 3UNQA 3SGQE 1TGBA 3F9GA 1ZTKA 4FUDA 1C2GA 4AORA 1TNHA 1U6QA 4U32A 3BF6H 1GI0A 1TRMA 2ZEBA 3OX7U 2OTVA 2ZF0H 5GPIB 4B75A 2C8YB 1EXFA 1V2WT 1ELBA 2P8OB 9ESTA 1RFNA 3M7QA 1TPSA 2BY6X 4YOGA 2H6MA 1ESAA 2RCEA 2A5AA 2VB0A 5A8YA 3H7TA 5DPAA 1P04A 3BTWE 4KKDA 1FJSA 1M9UA 1P09A 3PWBA 4MNVA 3P70B 1QA0A 2D2DA 2G00A 2BDAA 2BX3A 4DIHH 4B1TA 3BG4B 1C5OH 4AFZA 1MU8B 1DDJA 1UK3A 2FXRA 3KEEA 4ABEA 1G30B 3ATMA 4XBBA 1H9LB 1HXFH 5E0GA 4NWKA 3LPRA 3M5OA 1A61H 1QB1A 1C2IA 4OS1A 1IQFA 4BOHA 4X0WU 3T62A 1OP0A 1A5HA 4XOJA 2NU1E 2A7CA 2FLRH 4CRAA 2PKAB 4UFGH 4A1TA 4BAMB 5F03A 5F6MA 4WMDA 5DGJA 3CP7A 2W26A 3VB4A 2OP9A 4Y11E 2GTBA 1O34A 2F83A 3U8RH 1OOKB 1S85A 2VH6A 1MUEB 4U30A 4JZ1A 1W2KH 1ZSLA 1ETSH 2GVFA 3CS0A 1ORFA 1C1TA 1O38A 3VB6A 4ABAA 3LGTA 3ZVFA 1DWEH 3OY5U 2AH4X 3UR6A 1RD3B 5HYOA 2BD9A 1VITH 3GISB 1IQGA 3DUXH 3SJ9A 1O3FA 1Z6EA 1C5ZB 1BTZA 1JWTA 2F91A 4HTCH 5I25A 4Y79A 1UTJA 3AAUA 2Z9LA 3ZVCA 1THPB 1KXDA 4JYVH 3O8DA 2W3IA 1YPHE 3D62A 3SUFA 1FN8A 2SGAA 4DIIH 2Z3CA 4ISHH 3T29A 5LH8A 4O97A 1SGPE 3F9FA 4NCYA 1CA8B 3TNTA 3RXDA 1Y3VA 1OX1A 2FTMA 1TPPA 3SN8A 3MO9A 1MZDA 2A32A 4AYYB 3SJ8A 3MTYA 5L30H 1E35B 3BTHE 2K1QA 4DCDA 2OQUA 1BDAA 5PTPA 1Z1IA 4XSKU 1O3JA 2ZIQH 4MLFB 3TPIZ 3Q00A 1DXPA 1LPZB 2WV5A 1ZYOA 2OBQA 3UPEA 1G36A 2WUBA 2ZU3A 4K8BA 1C5TA 1L4DA 3NK8A 2P95A 2C4FH 3MYWA 1C1PA 1DWBH 2GT8A 3QTVH 1EZUC 2Q6DA 5ESTE 1DT2A 3EGKH 1CT0E 4HFPB 3RXLA 5FAHA 1Z7KA 2AYWA 4LZ4B 2QAAA 3LONA 3RUOA 1ETTH 1IQIA 3A83A 1GDUA 4NA9H 2JETB 4XBDA 2P16A 2TGDA 4DW2U 1F5KU 2WYGA 6LPRA 1FAKH 3LIWA 2Z3EA 3RC4A 5A8XA 1SL3A 2H5CA 3H7OA 2G55A 4MNWA 2ZTYA 2ALPA 1HAZB 2ZTZA 1AB9B 1GG6C 1TGNA 4X8SH 2BLOA 3VFEA 2G8TA 4CH8B 1SGFA 2BQ7B 2PGQB 1FY8E 1GJBB 1UCYE 4NIVA 3RXJA 1A3BH 1VJAU 1SSXA 2VIDA 1Y5AT 1NRRH 1KSNA 1O33A 2Y80A 5ESBA 4LK4A 2OD3B 1BJVA 3D65E 3FZDA 4MDSA 2HWLB 1NY22 1P2KA 3UOPA 4TYDA 3PB1E 1ELGA 2TPIZ 4AFUA 2GP9B 1YPLH 3GY8A 2KAIA 4GLYA 3A82A 2NU2E 1UVOA 5EOKA 1SGIB 3GCHC 1HIAB 4ZXXH 1OPHB 4YOIA 4KTUA 2J94A 4B2AA 1B7XB 1FMGA 1C5WB 2ZFFH 1V2RT 1W12U 3GYMA 1RRKA 5EQQA 3SHCH 3ZV9A 3RC6A 1BQYA 1OKXA 2W5EA 3V12A 1SLUB 1YPJH 1Y3YA 1N1LA 3GY7A 1AD8H 1TLDA 1P05A 1GMHG 3QX5H 3TK5A 1TMUH 1SPJA 2B9LA 1BBRE 4JZEH 1HJAB 1XUGA 3TVJB 3RXOA 3QGNB 3EYDA 4X6OA 3MNBA 3QZRA 4J1YA 4D76A 2ZNKH 4JZIA 1F5LA 1AU8A 1A2CH 2QXGA 2BQ6B 1C9PA 1GI7B 1HAIH 1GI8B 4Z6AH 1F0TA 1IOEA 1ESTA 3E1XB 2AGEX 2CHAC 1MKWK 4OS5A 3V7TA 4JYTA 4UFFH 3ZV8A 3AW0A 1SG8B 3U8TH 2QXHA 5DG6A 3SUDA 1MCTA 4BANB 2QYIA 5E8EH 1WUNH 2A7HA 2BLVA 1OXGA 1INCA 1DLKB 1DWCH 2WPKS 3Q3YA 4FU8A 4CRGA 3TU7H 1GMDF 5LPRA 1EJMA 1QFKH 5CMXH 4Y8YA 1QBOA 4WVPE 1O2IA 2P3UB 2AFQB 2P3FH 3KCGH 1ESBA 1EZXC 2Z94A 3S69A 1EP6A 1ARBA 3ESTA 3GCTG 1VJ9U 1GHZA 2ODPA 4I8GA 4H6TA 2BD5A 3SO3A 3SU0A 3BTTE 3ZVBA 4YM9A 1CGJE 4YT6H 1UK2A 2UUKB 4INKA 4DY7B 1SGEE 3A8AA 1EP5A 1QQUA 2P59A 3S9AA 4AYVB 1MBQA 1DFPA 1P2MA 3SNBA 2R9PA 2BOHB 1FI8A 3ZYEA 1UTQA 1C4U2 3HGNA 3R0FA 2M5TA 3NKKA 2VWLA 1TPOA 1TABE 3MU1A 2QN5T 1EZSC 2G5NA 3I77A 2ZCHP 5JPMH 1DY9A 1QB9A 1O5CB 4IMZA 1PQAA 5TCCA 2RA0A 3UTUH 9LPRA 3Q3XA 3HATH 2PTNA 1VGCB 4Q7ZA 3BG8A 3M35A 1W13U 2G5VA 8ESTE 1SGQE 3TIUA 4AGKA 1AZ8A 3E16B 2BLWA 3T27A 1KXEA 2V3OH 5EG4A 5A0BA 4SGBE 1YCPH 1K2I1 1LHGH 2DE9A 1TAWA 2XBVA 1BJUA 2D8WA 1O31A 3HPTB 2F9PA 1XUHA 2JKHA 5IDKA 4KGAA 1ELAA 1SQOA 2QF0A 3BTFE 1FDPA 2V0BA 3RXRA 2FI5E 2ZHEH 4BAKB 3PO1B 1CE5A 1EATA 5FX5A 3LH1A 1HJ8A 1OYTH 1P9UA 1O2PA 4ISLA 4E7RG 1KXBA 2PGBB 1HPGA 1A0LA 1G2LA 1MTUA 1E38B 1GVLA 1T4UH 3R3GB 3ZZAA 1WU1A 3TGJE 3MH5A 2ODYB 4GCHF 1C1MA 3GY2A 4LXBH 1NM6A 1HB0B 2J34A 2ZHQH 2FOFA 1MD7A 1D9IA 3VGCC 1OWIA 3QO6A 4D9QA 2JH6D 2FOMB 3VB5A 2Y6TA 1F0UA 1HYLA 3K6YA 5JBCS 2EEKA 3OSYA 3TLOA 2CMYA 1C1SA 2G52A 1TNLA 1ZHRA 1EPTC 1E37B 1EZQA 5EXNA 5T3HA 4O3UA 3SU3A 2QC2A 1C2DA 1CT2E 5E2PA 2FODA 4JMYA 1HAGE 4OS6A 4AOQA 4GHQA 3EAJA 1ABIH 3EA8A 1FY5A 1MMJN 1V2UT 2F9BH 5DKMA 1S5SA 2UUYA 3LGYA 4DJZB 2XTTB 1HV7A 1ZHPA 4AFSA 7LPRA 4BTIB 1TBRH 4ZKRU 2EI6A 1O3PB 2D26C 1LMWB 2PV9B 5H4IB 3HK3B 3PLPA 2ZGXH 1CT4E 3RXIA 1O3BA 3UUZA 3W95A 3BV9B 1PPGE 1JIRA 3OYPA 4CBOA 1DS2E 1KDQA 1D3QB 1YLCA 5DP7A 2FTLE 1IHSH 1HDTH 3IG6B 3TJUA 3W94A 2I6QA 2GV6A 4X2YA 5EXMA 3FP6E 1D6RA 3MU5A 2SGEE 2BVSH 1WSSH 5EPYA 3VPKA 1X7AC 1HLTH 5GXPA 4JK5A 2AGIX 3GYLB 2FI3E 1GI6A 3ZVGA 5AVDA 4CRCA 2BYAX 1O2GH 4X2VA 1GWAA 2FPZA 1C1VH 1TA2A 2ZO3H 3D49H 1LHCH 1WV7H 3K9XB 1BRBE 5EQSA 1SOTA 4YOJA 1DOJA 1ZLRA 1EX3A 1WBGB 3PMBB 1HUTH 2PKAA 3M36A 1AKSB 1GCTC 2ZHWH 1XX9A 1GI3A 5EW1H 1T8LA 4DOQA 1NC6A 1OYQA 3I29A 3KQDA 1FUJA 1JRSA 1BBRH 1G2MA 5FHTA 2ZGCA 4PROA 1LVBA 1Z6JH 1TBQH 2ZI2H 1AVWA 2ANWA 4Y6DA 1O2MA 1YPMH 1LO6A 2ZPQA 2GZ9A 3MU4A 5HXFA 3SZNA 2OC7A 1ETRH 3CS7A 4D8NA 4UONA 1SGTA 1ZR0A 2TIOA 1K1IA 3A86A 1QIXB 1BOQA 4WH8A 1LDTT 2AMQA 2FOEA 3LKWA 4GUXA 2H9HA 3A7TA 2O8TA 1XKBC 3UOUA 1A5GH 1MU6B 3HKJB 1XKAC 4WY3A 2RG3A 2XWAA 1QY6A 3RXKA 3T2NA 1QURH 1JXPA 4ZKSU 1C2HA 2J4IA 3U69H 3BTDE 2ZCKP 3MU0A 3PYHA 4FUJA 4ZMAH 1O2SA 3NXPA 5DK1A 3SV7A 2G4UA 3STJA 2A45B 3OU0A 2CXVA 3ODDA 4GAWA 1GJ7B 4CRFA 3RXGA 1MD8A 3DA9B 3MH7A 1C1WH 1H8DH 4ZHLU 1GDNA 3S9CA 3H5CB 3P6ZB 5G4BA 1N6YA 4ESTE 1P3EA 1BT7A 5FXLA 1GJDB 1IQEA 4HI3A 2LPRA 3SNDA 4MPXA 4KP0A 4FUBA 3TGKE 1K1PA 3SV6A 1DM4B 2J95A 2BM2A 2Z9GA 2PKSC 3Q77A 3O8CA 3SQEE 2OINA 1QL9A 4ISNA 1NN6A 1AQ7A 3KQEA 3U8OH 3URCA 2HNTC 1G3CA 2AIPA 3P92A 2G81E 1HCGA 4NWLA 1WTGH 3K65B 1XUFA 3E91A 3M5NA 5HMAA 1G37A 2H5DA 3FVFB 5L2YH 3WY8A 2OCVB 1GI9B 2VWMA 3HGPA 2ZCLP 4Y7AA 4Y8ZA 3MH4A 2BDIA 1AMHA 1WYKA 2C93B 2JH0D 2R0LA 4X6NA 1LKAA 4I8HA 1T8OA 1GGDC 2UWOA 2DE8A 4NZLA 3SU5A 2ZU2A 1OP8A 1UCYK 3L33A 1J17T 3KF2A 3GDVA 4IBLH 3RXBA 1SLXB 1J8AA 1Y5UT 1ZPBA 4KTCA 5FCKA 2XC0A 2F3CE 1F92A 2FOBA 4X8TH 4X1SU 2VJ1A 1VITG 3U9AH 5E2OA 4NZQA 1D4PB 4K1TA 1VCPA 1IHTH 3ZVEA 2HVXA 4I8KA 3AVZA 1W0YH 1UHBB 1MAYA 3JZ1B 1O30A 4GHTA 5C2ZA 1LVMA 2XC4A 1NROH 1GHWH 3NUMA 2ULLA 1ABJH 3QTOH 1Y3WA 5DP6A 1C5LH 1ZZZA 1KXAA 1W10U 2H9EH 1GBTA 1SHHB 2V6NA 5AFZH 3Q76A 1AWFH 2ZQ1A 1NTPA 4NSVA 2RDLA 2BZ6H 4FU7A 1TONA 3SNEA 3SV9A 2OC0A 3A7VA 1F0RA 1O3HA 1HAHH 1OWEA 4Y76A 2A4GA 1AI8H 1H4WA 1E0FD 2GCTB 3M3TA 1P10A 2VIOA 4AGJA 2QXIA 1O2TA 1CGIE 1VZQH 1VGCC 2BOKA 3PM3A 2OQ5A 4YLQH 2ZDMA 5C5OA 2ZGJA 1W14U 4GPGA 3PMJA 2C8ZB 4F4OC 2AGGX 1O3LA 1BITA 2ESTE 2IJOB 3SJOA 4MNXA 1C2LA 5E0HA 2EA3A 3U1IB 1CSOE 2FOHA 2SGPE 4MVNA 1A0HB 1XXFA 3VB3A 5CE1A 5C1XA 4K69A 3L6PA 1L1JA 1YM0A 1BRUP 3MO6A 1DWDH 1V2LT 3BTEE 5EW2H 4IC5A 2THFB 4U01A 1ELFA 2GKVE 2DUCA 4UD9H 1JOUB 1BIOA 1O39A 1PPBH 1FN6A 2J9NA 2HNTF 3HK6B 3U98H 1EAIA 1P12E 3KIDU 1WOFA 4MG3A 4ISIH 3B9FH 1P2OA 2H2ZA 1F7ZA 1S84A 4H4FA 3UQOA 2ZQ2A 2GCHG 2FEQH 2F9UA 4THNH 1TWXB 1GBFA 1GHAF 3MHWU 2ZDKA 1TGCA 1C1QA 1O3NA 3F6UH 1ID5H 1MH0A 1IAUA 1XVMA 2ANYA 3BIUH 1SGNE 5HGGA 1GMCG 4INHA 4FUIA 2FWWA 3A7WA 1PYTD 1OWHA 1H9HE 1ZMJA 1CHOF 2SGQE 1CU1A 3SBKA 1GBAA 5IYTA 1GBMA 1W7XH 1HIAA 5AF9H 1GBBA 1FIWA 4K1EA 1A46H 4LOYH 2CF9H 3P8FA 3ATIA 3RXMA 3RXEA 1O3EA 1PQ5A 1TGTA 1EPTB 1O2XA 3ZVAA 1V2NT 1YLDA 2GCTC 4ABJA 3NZIA 1DUAA 3RXQA 2QV1A 2B7DH 1B0FA 1HBTH 5EGMA 3TNSA 1PPHE 1QGFA 5ABWA 1FV9A 6GCHF 5A09A 1EOLA 3HKIB 3A85A 1ELDE 1RXPA 1WCZA 2C8WB 1ZGVA 1GMDG 4CR9A 3E6PH 1PPZA 2IOTA 1Y5BT 2R3UA 2GV7A 2ZZUH 3BEIB 5T6FA 3RU4D 2XCNA 3M7UA 2WUCA 1ZPCA 1NRNH 3SV8A 1KYNA 8KME2 1BA8B 4NIWA 1TA6A 4A1XA 5E0JA 3DHKH 1BTHH 1LTOA 4YESB 3FFGA 1D3PB 2WPLS 1SI5H 1TOMH 2Z7FE 4JCNA 2YOLA 4FUHA 3FAOA 4A6LA 3GY3A 1ZMNA 3RXVA 5DO4H 1LKBA 2TBSA 1HRTH 1P3CA 2GD4B 1P03A 1O2RA 2SFAA 4CRBA 1V3XA 1SGDE 1TRNA 3PV4A 4ABBA 1DX5M 2GX4A 1O5AB 1QJ7B 4ZH8A 3BSQA 1YPGH 3F9EA 3S0NA 1MTSA 4I7YH 1AY6H 1BZXE 1P2NA 3MNSA 2VU8E 3TH2H 1D3TB 3T26A 1C5XB 1ANEA 2FDAA 1NESE 1HAVB 1LQEA 3TH4H 2ZU4A 1SGFG 2Y5HA 1MTWA 3MU8A 1G3BA 4FXGH 1PYTC 2PKSB 1OWKA 1UTOA 4BTTB 1NU9A 1V2TT 2HOBA 1ZJDA 2FOAA 1GJ4H 3M5LA 1T32A 2O9QA 3C27B 4KTSA 1L1NA 4IMQA 1GCDA 4ABGA 1V2QT 4E7NA 2Q6GA 5GCHF 3SU1A 3RXUA 2XYAA 1E36B 2R3YA 1SBWA 2A7JA 2VWOA 2OXSA 1EB1H 4M7GA 1ARCA 1F0SA 2STBE 2FESH 2Y5FA 2W7UA 4INLA 3SNAA 1TALA 3L3TA 4TY7A 2XXLA 1L4ZA 1O5EH 4TY6A 2P94A 4FVDA 3PTNA 1ZPZA 2HPPH 1PPCE 2CHAB 7ESTE 3EQ0H 3QGJA 4IW4E 4ZKOU 1EPTA 1SMFE 1N8OC 4YLUA 1GPZA 3T25A 4I8LA 2BD3A 1ZRBA 1SQAA 3V13A 1C4V2 1D3DB 1YCPK 1MKWH 4NGAH 1RTKA 3E3TA 1IQHA 1S6HA 2TGAA 3O8BA 4TPIZ 2GDEH 3SNCA 2CV3A 1QCPA 1KXCA 3SHAH 4BTUB 2ZKSA 3MOCA 1GBLA 2NU3E 3T28A 3A84A 4UFDH 1ZJKA 3SV2H 4A92A 3UNRA 3LOXA 1TE0A 1AVGH 3UQVA 2FI4E 2A5KA 1GBEA 1GBHA 3SU6A 1LCYA 2ZFQH 4MTBA 3UWJH 1EQ9A 1ELEE 3DD2H 1GJ9B 3M3VA 1BCUH 4Y0ZE 5FBIA 1T4VH 4K3JA 1KTTB 3MMGA 1NRSH 3K6ZA 2HRVA 1SFIA 2PWXA 1O2JA 1K1LA 3RXSA 5A2MH 4NSYA 1ZSJA 1T31A 1A3EH 3KHVA 2HGTH 3P8OA 3KQCA 1DSUA 1BMLA 4A7IB 3SI3H 1C5VA 1A5IA 1HFDA 2GZ7A 1KDQB 3ITIA 5AFYH 4ZAEA 1WQSA 3RU4T 1BMAA 1F2SE 1LHEH 3A7ZA 3ATWA 2BD8A 1HGTH 1L2EA 4DT7B 3RC5A 1TFXA 3LDXH 1B0EA 1MQ5A 2FOCA 6CHAB 3SGBE 5C5NA 2VGCB 3QK1A 2AMPA 1TNKA 5FPSA 1BTYA 2VVUA 2ANKH 3D23A 1HNEE 1GJCB 5CHAC 2QY0B 1SOZA 5A8ZA 3RLWH 1SVPA 1UTMA 4OGXA 2ASUB 3MH6A 1NFXA 3RXHA 2A4OA 1W11U 2ZU1A 1NFUA 4Y7BA 1N8OB 3LJJA 1S83A 1RIWB 2EC9H 5C20A 3BEFB 5EXLA 2CN0H 4DGJA 2SGFE 2BMGB 1O2VA 2O8UA 3M5MA 3I78A 5A0CA 3EE0B 1ZMLA 2BDHA 4Y71A 3RMOH 1A1RA 2GMTB 3SORA 1GBIA 2JH5D 1O3OA 1GCTB 1UTKA 4AB9A 1OSSA 5JDUB 2VIVA 1O3GA 1TBZH 2FS8A 1CHOG 3B8JA 3ZZ3A 4AFQA 1Y59T 4XBCA 3LGUA 1P2IA 4FUGA 3SW2B 1RTFB 1UTLM 3TH3H 3GDUA 1YP9A 2BD2A 4IN1A 2D1JA 1UK4A 2F9VA 3A88A 3PROA 4TPYA 1A4WH 3UR9A 1GJ5H
chains in the Genus database with same CATH superfamily
5EODA 2GMTC 1AGJA 2O8WA 1SGRE 4DG4A 2ODQA 4DURA 5LPFA 2UWLA 4WXIA 3E90B 1Y3XA 4ABFA 3GOVB 3VXFH 1P2QA 1GL1A 1PQ7A 1H8HD 2J38A 1GBJA 1MBMA 4BXSA 1K22H 1TNJA 4OS4A 3ODFA 1ELTA 1MKXK 2P3TB 3M3SA 3PV5A 1GVKB 3JZ2B 1LVYA 2F9OA 1S81A 1TPAE 1TRYA 2NU0E 4E05H 2FIRH 2QF5A 3ELAH 3SJKA 5CHAB 1UVPA 4X1PU 1ACBE 2VIQA 1O35A 5TJXA 1DE7H 1QNJA 2PSYA 2PSXA 3FO8D 1EJNA 2OC8A 2Q1JA 4RN6A 4Q7XA 2VGCC 2IN2A 4Y8XA 3GY4A 4WMFA 1CQQA 2W7SA 6CHAC 4GSOA 1P02A 2BDCA 1SGYE 2KAIB 5EPNA 5FPTA 3WWBA 4R0IA 2ZTXA 3RXPA 2VVCA 3RP2A 3ATKA 4FUCA 1TOCB 4K60A 4YZUA 2ZDVH 1V2MT 5DP8A 3GCOA 1HJ9A 5GCHG 1GHYH 4BAQB 1UVTH 2A4QA 4BAOB 1HAXB 6GCHG 1OP2A 2J5UA 4XDEA 2L6OA 3PMAB 1O0DH 1YPHC 2BHGA 1AZZA 3DFLA 3TJNA 4B74A 5FPYA 1ELVA 1V2JT 2BDYA 4MPVA 3QUMP 1MZAA 5L6NH 3KGPA 1EB2A 1TQ0B 4AN7A 1DVAH 2PUXB 1TIOA 2HPQH 1TB6H 4FUFA 4VGCC 4UDWH 5EQRA 3U1JB 2ZFPH 4CR5A 2WPDD 4XD7D 2KCOA 3A80A 2FS9A 1GHBG 1BTWA 1OWDA 2BDGA 3MWIU 4BAHB 2ZGHA 2AHME 1Z8RA 4AX9H 1Y3UA 4B73A 2CGAA 3LC5A 4WXVA 2Y5GA 1GJ8B 1BHXF 1FAXA 1GJAB 4X6MA 1GMHF 1YC0A 5T6GA 4D7GA 4ACBA 3KNXA 1O2NA 1BMFD 1O2YA 2Z3DA 1A7SA 3OTPA 4I33A 4X1QU 1C5PA 2PR3A 4ABIA 5HM9A 1O2WA 2BX4A 4NG9H 3OTJE 3F0PA 5T6DA 3ATLA 3A7YA 4YTAA 4Q7YA 3OEHD 1O32A 1AE5A 3RDZA 2FOGA 5JBTA 2FM2A 5GWZA 1GHBF 1YKTA 4WF8A 5DP3A 2AERH 2C90B 2FP7B 3RM2H 2VNTA 1C5NH 4FUEA 1Z71A 2HNTE 3NPSA 1W7GH 3LH3A 3SUGA 1GI1A 4AG1A 1DANH 3BTKE 5F8XA 2GT7A 1FQ3A 3P8GA 1KLJH 1HXEH 4Z0KA 1BTXA 4JK6A 1IQKA 3ZZ4A 4ASHA 1P8VC 2PTCE 3EDXB 4IN2A 1YPKH 4O9VA 1HJAC 1ELCA 1K1MA 4I8JA 4NIXA 3SU2A 2GGVB 4X1NU 4NA8A 1KY9A 5JBAS 3GY5A 1EFRD 1JMOH 4OS7A 3EA7A 3LGIA 4BNRA 1MQ6A 1RTLA 2UUFB 1W8BH 1O3MA 1THRH 2XC5A 2OLGA 5LGOA 5FCRA 5JB8S 2QA9E 2GCHF 4X8VH 1O36A 3ZZ5A 1HAPH 5FX6A 5F8TA 8GCHG 1AFQC 1C2MA 4MPUA 2QGRA 2EQNA 2FZZA 1BTPA 2O8LA 2Y7XA 4AZ2B 5K7RA 3ZZ9A 5EJLA 3BTQE 2BZAA 1BRAA 2BY5X 5JBBS 2WPJS 3KL6A 3M61U 1O3DA 5J4SA 2HLCA 3AW1A 1HAYB 2EI8A 1D6WA 1NFWA 4AG2A 4WJG2 1O2OA 3IITA 1UJ1A 1TNGA 4ZXYH 2VVVA 2RA3A 2A1DB 2B8OH 2VH0A 2FO9A 3A7XA 1LVOA 2A5IA 1PPFE 2BVXH 4ISOA 4ZCNA 1BMMH 1E34B 3UWIA 4WH6A 4CHAB 1GVZA 3KQBA 3PTBA 1EKBB 1K1NA 5B6OA 1SB1H 5EU8A 5C3NA 3QWCH 3C1KA 3N7EA 4IGDA 1H9IE 1UMAH 1JBUH 2Y7ZA 2WPIS 1IQNA 2B0FA 1QL7A 1SLVB 2LNCA 4O03A 3LC3A 1K28D 1TX6A 2FYQA 1S0RA 2FX6A 4Q2KA 3BN9A 4RKOB 2R2MB 2K0QA 4F55A 3GCHB 4TWWA 1HAOH 3A8DA 2XW9A 1EASA 5GDSH 1YWUA 2W3KA 3AK5A 4H42U 3PO1C 1CVWH 2NWNA 2OUAA 4K8YA 1P57B 1Z8GA 2H1UA 4NFFA 1SLWB 3BEUA 2ZPRA 1DY8A 1PJPA 1YGCH 1C2JA 1O2ZA 1KTSB 1P06A 2IPHA 3A8BA 2BVRH 1C2KA 4HZHA 4GCHG 1H8ED 4FU9A 1DPOA 2BLQA 3BIVH 1NZQH 1O3IA 1ZRKA 1C1UH 2A2XH 1AB9C 1CO7E 5ETXA 1QL8A 5T1VA 1GBDA 1XUJA 3K2UA 1FZZA 4FVBA 3ZZBA 1NT1A 1FIZA 2PLXA 1O2QA 3PLBA 2XWBI 4K1SA 3V0XA 5BPEA 5A0AE 2V35A 1W0ZU 3GCTF 3QDZB 1O3AA 2R2WU 1NS3A 3F1SB 1W3CA 1RS0A 4Q80A 1AVXA 4RT1A 2ZECA 3DT0H 4SGAE 2ZWLH 1TMBH 4ABHA 3DSGA 1C1OA 1T7CA 2WPMS 4KELA 4YT7H 4IC6A 2Y81A 4ZKNU 4X2WA 2NU4E 1TGSZ 3SUEA 2CJIA 5JB9S 5KEDA 1F5RA 2YNBA 1QB6A 3UY9A 2XNIA 2KCYA 3N7OA 2XNDD 4ABDA 1YBWA 4TT3D 5GIBA 2KCPA 1LQDB 1O2UA 1GBKA 1GHVH 5LPEA 3QZQA 4E06H 4CH2B 2CF8H 1W0KD 4B2CA 2QIQA 1ZOMA 4MPWA 2SNVA 3NWUA 1Q31A 3QN7A 1P0SH 1Z1JA 1Q3XA 1EUFA 2ZHDA 4OGYA 5TCAA 3TJVA 3FP8E 1FPHH 1QQ4A 2ZPSA 1FPCH 2OBOA 2P93A 1MKXH 7KMEH 1NFYA 1S0QA 3VB7A 1QRZA 2XBXA 1XMNB 1QR3E 3SU4A 2XBWA 1RJXB 2ZU5A 4FOUC 2ZP0H 2TRMA 3A81A 1ZHMA 4WWYA 1HAVA 2F9NA 3RMMH 2EI7A 1LPGB 1WTHD 4K5ZA 3GDSA 4MNYA 1Z8IB 3DFJA 4B76A 1SC8U 4UEHH 1EAXA 1YF4A 3DSOA 3SI4H 2A31A 3MNXA 1EJAA 1GMCF 1GHXH 1GG6B 1VKYA 1JIMA 3AASA 3G01A 1MAXA 1TQ7B 1DITH 3ZZ6A 1L0ZA 3KN2A 4X2XA 1UTPA 1KXFA 5C94A 1C2EA 4B6FA 2YMSB 2BD4A 1XM1A 3M7TA 1BBRK 1BHXB 3U28C 3W1EA 1MCVA 1G9IE 2ZDNA 1UO6A 4P02A 3PLKA 1GI5A 1QA7A 7GCHF 3O8RA 2FX4A 3E0NB 2PHBA 1P01A 4IS5A 1QJ6B 2PUQH 1NPMA 1C5RA 4AB8A 2BD7A 1C5UA 2QCYA 1SGCA 1ANCA 4ZHMU 3GY6A 1V2OT 1V2KT 2FLBH 1BRCE 1JRTA 2Y82A 5FBEA 4GVUA 5DP9A 2ZFSA 3RMNH 1YCPM 3F9HA 1GJ6A 1C4Y2 1UHBA 4RKJB 3ZZCA 1K1JA 1EOJA 1MTVA 3VXEH 4BXWA 1AN1E 5BRRE 1C5QA 1A0JA 1OS8A 3ZZDA 1SHYA 2AEIH 3A87A 1FLEE 4D9RA 1SKYE 3BG4C 3MNCA 3PWCA 4YO9A 2SGDE 1G3EA 1AHTH 1DUEA 1UTNA 3RXAA 3LJOA 2J92A 3STIA 3SJIA 1AWHB 1O2LA 5AHGH 1GI2A 2ZC9H 2YNAA 3FANA 4DVAU 1AKSA 3OFND 4NIYA 1XXDA 1YPEH 5DP5A 1QRXA 2ZDAH 1O3KA 1V6DA 5J4QA 3LT3A 3URDA 3NCLA 2EY4C 3ZYDA 4X1RU 1GGDB 2ZG0H 3CENA 3RLYH 4LZ1H 2P8OC 3QLPH 4RSPA 2FYRA 3UREA 3S7HB 1CA0C 2BXUH 3PMHB 5SGAE 1NRPH 1ZTLA 2RFKC 2JETC 5DJ7A 1C5SA 2V3HH 4UFEH 3OY6U 1PPEE 5C1UA 1NU7B 1GL0E 1L1GA 1B5GH 3RXTA 3AAVA 4X6PA 7GCHG 1XUIA 3KQ5A 3P17H 3RXFA 1PQ8A 3T5FH 1FONA 1ZSKA 1GBCA 1CGHA 1V2PT 2ZFTA 3UNSA 3FZZA 3B23B 1J14A 2WV4A 1ANBA 2BTCE 4Y0YE 1C5YB 3GICB 5L2ZH 2A4RA 4D7FA 4RT0A 1O5GH 1RGQA 1IQMA 1UVUH 4Y10E 1TMTH 2ANMH 3VGCB 2ZHFH 3RXCA 1C5MD 3ENSB 4NFEA 2AIQA 2QF3A 2XBYA 1VCWA 1IQLA 2Z9IA 4CRDA 1SR5C 2Z6BD 4O3TA 2HLDD 8LPRA 1KIGH 2O8MA 1T8MA 5HM2A 1V2VT 4Z1MD 3E0PB 3PRBA 3TJOA 2A0QB 1O2HA 2TGPZ 2HVYB 2L74A 2PFEA 1TX8A 4NA7A 1VITF 1DLEA 1MTNC 2FMJA 1QBVH 2ILNA 2B5TB 4R8TB 4TWYA 2VWNA 1FY4A 1NRQH 4U2WA 1CBWB 4A1VA 1P9SA 1G32B 1UVSH 3CNRA 1LPKB 1K21H 1K1OA 1XUKA 4I32A 1O37A 2VIWA 3LGWA 3TITA 1O5FH 4H6SB 4B2BA 2QE7D 1ZTJA 1TYNA 2AMDA 1VCQA 2VIPA 1THSH 1KLTA 4VGCB 2R0KA 3GCNA 5F8ZA 4JYUH 4XE4A 1QBNA 5GJ4B 1QRWA 2WPHS 1AUTC 1CBWC 1FY1A 1EAUA 3MO3A 1AFEH 3BTGE 1LHDH 3VEQB 3UIRA 1MTNB 3F3BA 3BTME 3SQHE 2GZ8A 2VBCA 3EA9A 1WQVH 1O3CA 1WAYB 2ZFRH 4J2YB 4QT8C 4CBNA 3A89A 1P2JA 1J9CH 4I31A 2BDBA 1QHRB 4ZROA 1P11E 1DICA 1FNIA 2TGTA 1CHGA 2AS9A 2ZA5A 2OC1A 3LGVA 3LU9B 3Q3KA 5C1YA 3P8NA 1TX7A 4CREA 3F2HA 4HGCA 3SGAE 3SZEA 2JIZD 5K0HA 2Z9JA 1OHHD 3A8CA 4CHAC 4WMEA 5DP4A 3ZZ7A 2BY7X 2Z9KA 1QTFA 3UB0A 4B71A 2G51A 2J2UA 3TK9A 1FXYA 1V2ST 1AIXH 4F49A 3N99A 1AUJA 3RU4E 3WWFA 2WHXA 1DXWA 2XCFA 1BTUA 1H1BA 3RMLH 4MQAA 1O2KA 3S7KB 3V3MA 1K9OE 1C1NA 2BY9X 3F68H 6ESTA 1NO9H 4OS2A 4XFQA 2PW8H 4F48B 2WYJA 2KX4A 4X8UH 3E8LA 1VR1H 1T8NA 1AFQB 1FY3A 1BMNH 1UCYH 2UWPA 1LHFH 1GDQA 3ZZ8A 1TNIA 2BB4A 3MFJA 2H9TH 1CA0B 3P95A 4JZDH 1S6FA 2QXJA 2UUJB 2GDDA 3MI4A 3SOSA 1AE8H 1GHAG 2BY8X 1C9TA 2SNWA 5JYIA 2ZGBH 2Q6FA 2ZDLA 5C67A 5I46H 4ZUHA 1OWJA 2HALA 2VINA 1SFQB 4K2YA 1BB0B 1O5DH 3IWMA 1H8IH 3FN8A 1Z8JB 1J16A 2OK5A 3RM0H 1O5BB 3UFAA 3ZVDA 1AO5A 1QJ1B 3M37A 2KCAA 4ZHAA 1SQTA 1S82A 1G3DA 1XVOA 1BUIA 1EAWA 1J15A 3FP7E 2WINI 8GCHF 1ZGIA 2A2QH 2C8XB 2ALVA 2BXTH 2STAE 1ANDA 2BQWB 1KLIH 1IQJA 2I6SA 1Q2WA 2QF4A 1C2FA 1GI4A 1N6XA 4JZFH 3TK6A 1YYY1 2C3SA 4UE7H 1Y8TA 1PFXC 5CDFE 1DSTA 4A5TS 1C1RA 3S9BA 3TGIE 1RIWC 2G4TA 2XRCA 3UNQA 3SGQE 1TGBA 3F9GA 1ZTKA 4FUDA 1C2GA 4AORA 4Q63A 4HG6A 1TNHA 1U6QA 4U32A 3BF6H 5B6LA 1GI0A 1TRMA 2ZEBA 3OX7U 2OTVA 2ZF0H 5GPIB 4B75A 5C0TA 2C8YB 1EXFA 1V2WT 1ELBA 2P8OB 9ESTA 1RFNA 3M7QA 1TPSA 2BY6X 4YOGA 2H6MA 1ESAA 2RCEA 2A5AA 2VB0A 5A8YA 3H7TA 5DPAA 1P04A 3BTWE 2PP6A 4KKDA 1FJSA 1M9UA 1P09A 5CHBA 3PWBA 4MNVA 3KYFA 3P70B 1QA0A 2D2DA 2G00A 2BDAA 2BX3A 5DSFA 4DIHH 4B1TA 3BG4B 3F0OA 1C5OH 4AFZA 1MU8B 1DDJA 1UK3A 2FXRA 3KEEA 4ABEA 1G30B 3ATMA 4XBBA 1H9LB 1HXFH 5E0GA 4ASUD 4NWKA 3LPRA 3M5OA 2WV9A 5EJZA 1A61H 1QB1A 1C2IA 4OS1A 1IQFA 4BOHA 4X0WU 3T62A 1OP0A 1A5HA 4XOJA 2NU1E 2A7CA 2FLRH 4CRAA 5KECA 2PKAB 4UFGH 4A1TA 4BAMB 5F03A 5F6MA 4WMDA 5DGJA 3CP7A 2W26A 1UW7A 3VB4A 2OP9A 4Y11E 2GTBA 1O34A 2F83A 3U8RH 1OOKB 1S85A 2VH6A 1MUEB 4U30A 4JZ1A 1W2KH 1ZSLA 1ETSH 2GVFA 3CS0A 1ORFA 1C1TA 1O38A 3VB6A 4ABAA 3LGTA 3ZVFA 1DWEH 3OY5U 2AH4X 3UR6A 1RD3B 5HYOA 2BD9A 1VITH 3GISB 1IQGA 3DUXH 3SJ9A 1O3FA 1Z6EA 1C5ZB 1BTZA 1JWTA 2F91A 4HTCH 5I25A 4Y79A 1UTJA 3AAUA 2Z9LA 3ZVCA 1THPB 1KXDA 4JYVH 3O8DA 2W3IA 1YPHE 3D62A 3SUFA 1FN8A 2SGAA 4DIIH 2Z3CA 4ISHH 3T29A 5LH8A 4O97A 1SGPE 3F9FA 4NCYA 1CA8B 3TNTA 2W6ID 3RXDA 1Y3VA 1OX1A 2FTMA 1TPPA 3SN8A 3MO9A 1MZDA 2A32A 4AYYB 3SJ8A 3MTYA 5L30H 1E35B 3BTHE 1YY3A 2K1QA 3DCLA 4DCDA 2OQUA 1BDAA 5PTPA 1Z1IA 4XSKU 1O3JA 2ZIQH 4MLFB 3TPIZ 3Q00A 1DXPA 1LPZB 2WV5A 1ZYOA 2OBQA 3UPEA 1G36A 2WUBA 2ZU3A 4K8BA 1C5TA 1L4DA 3NK8A 2P95A 2C4FH 3MYWA 1C1PA 1DWBH 4B6EA 2GT8A 3QTVH 1EZUC 2Q6DA 2LELA 5ESTE 1DT2A 3EGKH 1CT0E 4HFPB 3RXLA 5FAHA 1Z7KA 2AYWA 4LZ4B 2QAAA 3LONA 3RUOA 5EIYA 1ETTH 1IQIA 3A83A 1GDUA 3N7DA 4NA9H 2JETB 4XBDA 2P16A 2TGDA 4DW2U 1F5KU 2WYGA 6LPRA 1FAKH 3LIWA 2Z3EA 3RC4A 5A8XA 1SL3A 2KR7A 2H5CA 3H7OA 2G55A 4MNWA 2ZTYA 2ALPA 1HAZB 2ZTZA 1AB9B 1GG6C 1TGNA 4X8SH 2BLOA 3VFEA 2G8TA 4CH8B 1SGFA 2BQ7B 2PGQB 1FY8E 1GJBB 1UCYE 4NIVA 3RXJA 1A3BH 1VJAU 1SSXA 2VIDA 1Y5AT 1NRRH 1KSNA 1O33A 2Y80A 5ESBA 4LK4A 2OD3B 1BJVA 3D65E 3FZDA 4MDSA 2HWLB 1NY22 1P2KA 3UOPA 4TYDA 3PB1E 1ELGA 2TPIZ 3NRLA 4AFUA 2GP9B 1YPLH 2IPQX 3GY8A 2KAIA 4GLYA 3A82A 2NU2E 1UVOA 5EOKA 1SGIB 3GCHC 1HIAB 2JDID 4ZXXH 2M2AA 5EJ1A 1OPHB 4YOIA 4KTUA 2J94A 4B2AA 1B7XB 1FMGA 1C5WB 2ZFFH 1V2RT 1W12U 3GYMA 1RRKA 5EQQA 3SHCH 3ZV9A 3RC6A 1BQYA 5HKKD 1OKXA 2W5EA 3V12A 1SLUB 1YPJH 1Y3YA 1N1LA 3GY7A 1AD8H 1TLDA 1P05A 1GMHG 3QX5H 3TK5A 1TMUH 1SPJA 2B9LA 1BBRE 4JZEH 1HJAB 1XUGA 3TVJB 4RI0A 3QGNB 3RXOA 3EYDA 4X6OA 3MNBA 3QZRA 4J1YA 4D76A 2ZNKH 4JZIA 1F5LA 1AU8A 1KMHB 1A2CH 2QXGA 2BQ6B 1C9PA 1GI7B 1HAIH 1GI8B 4Z6AH 1F0TA 1IOEA 1ESTA 4Q4LA 3E1XB 2AGEX 2CHAC 1MKWK 4OS5A 3V7TA 4JYTA 4UFFH 3ZV8A 3AW0A 1SG8B 3U8TH 2QXHA 5DG6A 2J98A 3SUDA 1MCTA 4BANB 2QYIA 5E8EH 5GNDA 1WUNH 2A7HA 2BLVA 1OXGA 1INCA 1DLKB 1DWCH 2WPKS 3Q3YA 4FU8A 4CRGA 3TU7H 1GMDF 5LPRA 1EJMA 1QFKH 2F43B 4Y8YA 1QBOA 4WVPE 5CMXH 1O2IA 2P3UB 2AFQB 2P3FH 3KCGH 1ESBA 1EZXC 2Z94A 3S69A 1EP6A 1ARBA 3ESTA 3GCTG 1VJ9U 1GHZA 2ODPA 4I8GA 4H6TA 2BD5A 3SO3A 3SU0A 3BTTE 3ZVBA 4YM9A 5HIYA 1CGJE 4YT6H 1UK2A 2UUKB 4INKA 4DY7B 1SGEE 3A8AA 1EP5A 1QQUA 2P59A 3S9AA 4AYVB 1MBQA 1DFPA 1P2MA 3SNBA 2R9PA 4I86A 2BOHB 1FI8A 3ZYEA 1UTQA 1C4U2 3HGNA 3R0FA 2M5TA 3NKKA 1K0HA 2VWLA 1TPOA 1TABE 3MU1A 2QN5T 1EZSC 2G5NA 3I77A 2ZCHP 5JPMH 1DY9A 1QB9A 1O5CB 4IMZA 1PQAA 5TCCA 2RA0A 3UTUH 2JJ2D 9LPRA 3Q3XA 3HATH 5KGOA 2PTNA 1VGCB 4Q7ZA 3BG8A 3M35A 1W13U 2G5VA 4P00A 8ESTE 1SGQE 3TIUA 4AGKA 1AZ8A 3E16B 2BLWA 3T27A 1KXEA 3FKSD 2V3OH 5EG4A 5A0BA 4SGBE 1YCPH 1K2I1 1LHGH 2DE9A 1TAWA 2XBVA 1BJUA 2D8WA 1O31A 3HPTB 2F9PA 1XUHA 2JKHA 5IDKA 4KGAA 1ELAA 1SQOA 2QF0A 3BTFE 1FDPA 2V0BA 3RXRA 2FI5E 1NBMD 2ZHEH 4BAKB 3PO1B 1CE5A 1EATA 5FX5A 3DSPA 3LH1A 1HJ8A 1OYTH 1P9UA 1O2PA 4ISLA 4E7RG 1KXBA 2PGBB 1HPGA 1A0LA 1G2LA 1MTUA 1E38B 1GVLA 1T4UH 3R3GB 3ZZAA 1WU1A 3TGJE 3MH5A 2ODYB 4GCHF 1C1MA 3GY2A 3ZIAD 4LXBH 1NM6A 1HB0B 2J34A 2ZHQH 2FOFA 1MD7A 1D9IA 3VGCC 1OWIA 3QO6A 4D9QA 2JH6D 2FOMB 3VB5A 2Y6TA 1F0UA 1HYLA 1E1RD 3K6YA 5JBCS 2EEKA 3OSYA 3TLOA 2CMYA 1C1SA 2G52A 1TNLA 1ZHRA 1EPTC 1E37B 1EZQA 5EXNA 5T3HA 4O3UA 3SU3A 2QC2A 1C2DA 1CT2E 5E2PA 2FODA 4JMYA 1HAGE 2JJ1D 4OS6A 4AOQA 4GHQA 3EAJA 1ABIH 3EA8A 1FY5A 1MMJN 1V2UT 2F9BH 5DKMA 1S5SA 2UUYA 3LGYA 4DJZB 2XTTB 1HV7A 1ZHPA 4AFSA 7LPRA 4BTIB 1TBRH 4ZKRU 2EI6A 1O3PB 2D26C 1LMWB 2PV9B 5H4IB 3HK3B 3PLPA 2ZGXH 1CT4E 3RXIA 1O3BA 1QZ8A 3UUZA 3W95A 3BV9B 1PPGE 1JIRA 3OYPA 4CBOA 1DS2E 1KDQA 1D3QB 1YLCA 5DP7A 2FTLE 1IHSH 1HDTH 3IG6B 3TJUA 3W94A 2I6QA 2GV6A 4X2YA 5EXMA 3FP6E 1D6RA 3MU5A 2SGEE 2BVSH 1WSSH 5EPYA 3VPKA 1X7AC 1HLTH 5GXPA 4JK5A 2AGIX 3GYLB 2FI3E 1GI6A 3ZVGA 5AVDA 4CRCA 2BYAX 1O2GH 4X2VA 1GWAA 2FPZA 1C1VH 1TA2A 2ZO3H 3D49H 1LHCH 1WV7H 3K9XB 1BRBE 5EQSA 1SOTA 4YOJA 1DOJA 1ZLRA 1EX3A 1WBGB 3PMBB 1HUTH 2PKAA 3M36A 1AKSB 1GCTC 2ZHWH 1XX9A 1GI3A 5EW1H 1T8LA 4DOQA 3VG8A 1NC6A 1OYQA 5C0UA 3I29A 4ACAA 3KQDA 1FUJA 1JRSA 1BBRH 1G2MA 5FHTA 2ZGCA 4PROA 1LVBA 1Z6JH 1TBQH 2ZI2H 3F2GA 1AVWA 2ANWA 3OAAD 1O2MA 4Y6DA 1YPMH 1LO6A 2ZPQA 2GZ9A 2KFWA 3MU4A 5HXFA 3SZNA 2OC7A 3KYGA 1ETRH 3CS7A 4D8NA 4UONA 1SGTA 1S6LA 1ZR0A 2TIOA 1K1IA 3A86A 1QIXB 1BOQA 4WH8A 1LDTT 2AMQA 2FOEA 3LKWA 4GUXA 2H9HA 3A7TA 2O8TA 1XKBC 3UOUA 1A5GH 1MU6B 3HKJB 2F4LA 1XKAC 4WY3A 2RG3A 2XWAA 1QY6A 3RXKA 3T2NA 1QURH 1JXPA 4ZKSU 1C2HA 2J4IA 3U69H 2KZ4A 3BTDE 2ZCKP 3MU0A 3PYHA 4FUJA 4ZMAH 1O2SA 3NXPA 5DK1A 3SV7A 2G4UA 3STJA 2A45B 3OU0A 2CXVA 3ODDA 4GAWA 1GJ7B 4CRFA 3RXGA 1MD8A 2YMSD 3DA9B 3MH7A 1C1WH 1H8DH 4ZHLU 1GDNA 3S9CA 3H5CB 3P6ZB 5G4BA 1N6YA 4ESTE 1P3EA 1BT7A 5FXLA 1GJDB 1E1QD 1IQEA 4HI3A 2LPRA 3SNDA 4MPXA 4KP0A 4FUBA 3TGKE 1K1PA 3SV6A 1DM4B 2J95A 2BM2A 2Z9GA 2PKSC 3Q77A 3O8CA 3SQEE 2OINA 1QL9A 4ISNA 1NN6A 1AQ7A 3KQEA 3U8OH 3URCA 2HNTC 1G3CA 2AIPA 3P92A 2G81E 1HCGA 4NWLA 1WTGH 3K65B 1XUFA 3E91A 3M5NA 5HMAA 1G37A 2H5DA 3FVFB 5L2YH 3WY8A 2OCVB 1GI9B 2VWMA 3HGPA 2ZCLP 4Y7AA 4Y8ZA 3MH4A 2BDIA 1AMHA 1WYKA 2C93B 2JH0D 2R0LA 4OM9A 4X6NA 1LKAA 4I8HA 1T8OA 1GGDC 2UWOA 2DE8A 4NZLA 3SU5A 2ZU2A 1OP8A 1UCYK 3L33A 1NBME 1J17T 3KF2A 3GDVA 4IBLH 3GS9A 3RXBA 1SLXB 1J8AA 1Y5UT 1ZPBA 4KTCA 5FCKA 2F3CE 2FOBA 1F92A 2XC0A 4X8TH 4X1SU 2VJ1A 1VITG 1WXRA 3U9AH 5E2OA 4NZQA 1D4PB 4K1TA 1VCPA 1IHTH 3ZVEA 2HVXA 4I8KA 3AVZA 1W0YH 1UHBB 1MAYA 3JZ1B 4DT4A 1O30A 5DN6D 4GHTA 5C2ZA 1LVMA 2XC4A 1NROH 1GHWH 3NUMA 2ULLA 1ABJH 3EE7A 3QTOH 1Y3WA 5DP6A 1C5LH 1ZZZA 1KXAA 1W10U 2H9EH 1GBTA 1SHHB 2V6NA 5AFZH 3Q76A 1AWFH 2ZQ1A 1NTPA 4NSVA 2RDLA 2BZ6H 4FU7A 3PV2A 1TONA 3SNEA 3SV9A 2OC0A 3A7VA 1F0RA 1O3HA 1HAHH 1OWEA 2YMSC 4Y76A 2A4GA 5IK2D 1AI8H 1H4WA 1E0FD 2GCTB 3M3TA 1P10A 2VIOA 1MABB 4AGJA 2QXIA 1O2TA 1CGIE 1VZQH 1VGCC 2BOKA 3PM3A 2OQ5A 4YLQH 2ZDMA 5C5OA 2ZGJA 1W14U 4GPGA 2IJD1 3PMJA 2C8ZB 4F4OC 2AGGX 1O3LA 1BITA 2ESTE 2IJOB 2V3MA 3SJOA 4MNXA 1C2LA 5E0HA 2EA3A 3U1IB 1CSOE 2FOHA 2SGPE 4MVNA 3SYJA 1A0HB 1XXFA 3VB3A 5CE1A 5C1XA 4K69A 3L6PA 1L1JA 1YM0A 1BRUP 3MO6A 1DWDH 4YXWD 1V2LT 3BTEE 5EW2H 4IC5A 2THFB 4U01A 1ELFA 2GKVE 2DUCA 4UD9H 1JOUB 1BIOA 1O39A 1PPBH 1FN6A 2J9NA 4AC9A 2HNTF 3HK6B 3OEED 1EAIA 3U98H 1P12E 3KIDU 1WOFA 4MG3A 4ISIH 3B9FH 1P2OA 2H2ZA 1F7ZA 1S84A 4H4FA 3UQOA 2ZQ2A 2GCHG 2FEQH 2F9UA 2J98B 4THNH 1TWXB 1GBFA 1COWD 1GHAF 2KM0A 3MHWU 2ZDKA 1TGCA 5FL7D 1C1QA 1O3NA 3F6UH 1ID5H 1MH0A 1IAUA 1XVMA 3PRDA 2ANYA 3BIUH 1SGNE 2WSSD 1GMCG 5HGGA 4INHA 4FUIA 1W0JD 2FWWA 3A7WA 1PYTD 1OWHA 1H9HE 1ZMJA 1CHOF 2SGQE 3UAIC 1CU1A 3SBKA 1GBAA 5IYTA 1GBMA 1W7XH 1HIAA 5AF9H 1GBBA 1FIWA 4K1EA 1A46H 4LOYH 2CF9H 3P8FA 3ATIA 3RXMA 3RXEA 1O3EA 1PQ5A 1TGTA 1EPTB 1O2XA 3ZVAA 1V2NT 1YLDA 2GCTC 4ABJA 3NZIA 1DUAA 3RXQA 2QV1A 2B7DH 1B0FA 1HBTH 5EGMA 3TNSA 1PPHE 1QGFA 5ABWA 1FV9A 6GCHF 5A09A 1EOLA 3HKIB 3A85A 1ELDE 1RXPA 1WCZA 2C8WB 1ZGVA 1GMDG 4CR9A 3E6PH 3F2FA 1PPZA 2IOTA 4FETA 5C17A 1Y5BT 2R3UA 2GV7A 2ZZUH 3BEIB 5T6FA 3RU4D 2XCNA 3M7UA 2WUCA 2WZQA 1ZPCA 1NRNH 3SV8A 1KYNA 8KME2 1BA8B 4NIWA 1TA6A 4A1XA 5E0JA 3DHKH 4XRNA 1BTHH 1LTOA 4YESB 3FFGA 1D3PB 2WPLS 1SI5H 1TOMH 2Z7FE 4JCNA 2YOLA 4FUHA 3FAOA 4A6LA 3GY3A 1ZMNA 3WW7A 3RXVA 5DO4H 1LKBA 2TBSA 1HRTH 1P3CA 2GJGA 3FOAA 2GD4B 1P03A 1O2RA 2SFAA 4CRBA 1V3XA 2CK3D 1SGDE 1TRNA 3PV4A 4ABBA 1DX5M 2GX4A 1O5AB 1QJ7B 4ZH8A 3BSQA 1YPGH 2V7QD 3F9EA 3S0NA 1MTSA 4I7YH 1AY6H 1BZXE 1P2NA 3MNSA 2VU8E 3TH2H 1D3TB 3T26A 1C5XB 1ANEA 2FDAA 1NESE 1HAVB 1LQEA 3TH4H 2ZU4A 1SGFG 2Y5HA 1FX0B 1MTWA 3MU8A 1G3BA 4FXGH 1PYTC 2PKSB 1OWKA 1UTOA 4BTTB 1NU9A 1V2TT 3MQKC 2HOBA 1ZJDA 2FOAA 1GJ4H 3M5LA 1T32A 2O9QA 3C27B 4KTSA 1L1NA 4IMQA 1GCDA 4ABGA 1V2QT 4E7NA 2Q6GA 5GCHF 3SU1A 3RXUA 2XYAA 1E36B 2R3YA 1SBWA 2A7JA 2VWOA 2OXSA 1YLNA 2XOKD 1EB1H 4M7GA 1ARCA 1F0SA 2STBE 2FESH 2Y5FA 2W7UA 4INLA 3SNAA 1TALA 3L3TA 4TY7A 2XXLA 1L4ZA 1O5EH 4TY6A 2P94A 4FVDA 3PTNA 1ZPZA 2HPPH 1PPCE 2CHAB 7ESTE 3EQ0H 3QGJA 4IW4E 3OE7D 4ZKOU 1EPTA 1SMFE 1N8OC 4YLUA 1GPZA 3T25A 4I8LA 2BD3A 1ZRBA 1SQAA 3V13A 1C4V2 1D3DB 1YCPK 2K8IA 1MKWH 4TSFD 4NGAH 1RTKA 3E3TA 1IQHA 1S6HA 2TGAA 3O8BA 4TPIZ 2GDEH 3SNCA 2CV3A 1QCPA 1KXCA 1WDIA 3SHAH 4BTUB 2ZKSA 3MOCA 1GBLA 2NU3E 3T28A 3A84A 4UFDH 1ZJKA 3SV2H 4A92A 3UNRA 3LOXA 1TE0A 1AVGH 3UQVA 2FI4E 2A5KA 1GBEA 1GBHA 3SU6A 1LCYA 2ZFQH 4MTBA 3UWJH 1EQ9A 1ELEE 3DD2H 1GJ9B 5F53A 3M3VA 1BCUH 4Y0ZE 5FBIA 1T4VH 4K3JA 1KTTB 3MMGA 1NRSH 3K6ZA 2LP6A 2HRVA 1SFIA 2PWXA 1O2JA 1K1LA 3RXSA 5A2MH 4NSYA 1ZSJA 1T31A 1A3EH 3KHVA 2HGTH 3P8OA 3KQCA 1DSUA 1BMLA 4A7IB 3SI3H 1C5VA 1A5IA 1HFDA 2GZ7A 1KDQB 3ITIA 5AFYH 4ZAEA 1WQSA 3RU4T 1BMAA 1F2SE 1LHEH 3A7ZA 3ATWA 1SQRA 2BD8A 1HGTH 1L2EA 4DT7B 3RC5A 1TFXA 3LDXH 1B0EA 1MQ5A 2FOCA 6CHAB 3SGBE 5C5NA 2VGCB 3QK1A 2AMPA 1TNKA 5FPSA 1BTYA 2VVUA 2ANKH 3D23A 1HNEE 1GJCB 5CHAC 2QY0B 1SOZA 5A8ZA 3RLWH 1SVPA 1UTMA 4OGXA 2ASUB 3MH6A 1NFXA 3RXHA 2A4OA 1W11U 2ZU1A 1NFUA 4Y7BA 1N8OB 3LJJA 1S83A 1RIWB 2EC9H 5C20A 3BEFB 5EXLA 2CN0H 4DGJA 2SGFE 2BMGB 1O2VA 2O8UA 3M5MA 3I78A 5A0CA 3EE0B 1ZMLA 2BDHA 4Y71A 3RMOH 1A1RA 2GMTB 3SORA 1GBIA 2JH5D 1O3OA 1GCTB 1UTKA 4AB9A 1OSSA 5JDUB 2VIVA 1O3GA 1TBZH 2FS8A 1CHOG 3B8JA 2RDEA 3ZZ3A 4AFQA 1Y59T 4XBCA 3LGUA 1P2IA 4FUGA 4M9FA 3SW2B 1RTFB 2W6JD 1UTLM 3TH3H 1E79D 3GDUA 1YP9A 2BD2A 4IN1A 3H09A 2D1JA 1UK4A 2F9VA 5HIZA 3A88A 3PROA 2J97A 4TPYA 1A4WH 3UR9A 1GJ5H
chains in the Genus database with same CATH topology
5EODA 2GMTC 1AGJA 2O8WA 1SGRE 4DG4A 2ODQA 4DURA 5LPFA 2UWLA 4WXIA 3E90B 1Y3XA 4ABFA 3GOVB 3VXFH 1P2QA 1GL1A 1PQ7A 2J38A 1GBJA 1MBMA 4BXSA 1K22H 1TNJA 4OS4A 3ODFA 1ELTA 1MKXK 2P3TB 3M3SA 1GVKB 3JZ2B 1LVYA 2F9OA 1S81A 1TPAE 1TRYA 2NU0E 4E05H 2FIRH 3ELAH 3SJKA 5CHAB 1UVPA 4X1PU 1ACBE 2VIQA 1O35A 5TJXA 1DE7H 1QNJA 2PSYA 2PSXA 1EJNA 2OC8A 2Q1JA 4RN6A 4Q7XA 2VGCC 2IN2A 4Y8XA 3GY4A 4WMFA 1CQQA 2W7SA 6CHAC 4GSOA 1P02A 2BDCA 1SGYE 2KAIB 5EPNA 5FPTA 4R0IA 2ZTXA 3RXPA 2VVCA 3RP2A 3ATKA 4FUCA 1TOCB 4K60A 4YZUA 2ZDVH 1V2MT 5DP8A 3GCOA 1HJ9A 5GCHG 1GHYH 4BAQB 1UVTH 2A4QA 4BAOB 1HAXB 6GCHG 1OP2A 4XDEA 3PMAB 1O0DH 1YPHC 2BHGA 1AZZA 3DFLA 3TJNA 4B74A 5FPYA 1ELVA 1V2JT 2BDYA 4MPVA 3QUMP 1MZAA 5L6NH 3KGPA 1EB2A 1TQ0B 4AN7A 1DVAH 2PUXB 1TIOA 2HPQH 1TB6H 4FUFA 4VGCC 4UDWH 5EQRA 3U1JB 2ZFPH 4CR5A 3A80A 2FS9A 1GHBG 1BTWA 1OWDA 2BDGA 3MWIU 4BAHB 2ZGHA 1Z8RA 4AX9H 1Y3UA 4B73A 2CGAA 3LC5A 4WXVA 2Y5GA 1GJ8B 1BHXF 1FAXA 1GJAB 4X6MA 1GMHF 1YC0A 5T6GA 4D7GA 3KNXA 1O2NA 1O2YA 2Z3DA 1A7SA 4I33A 4X1QU 1C5PA 2PR3A 4ABIA 5HM9A 1O2WA 2BX4A 4NG9H 3OTJE 5T6DA 3ATLA 3A7YA 4YTAA 4Q7YA 1O32A 1AE5A 3RDZA 2FOGA 5JBTA 2FM2A 5GWZA 1GHBF 1YKTA 4WF8A 5DP3A 2AERH 2C90B 2FP7B 3RM2H 2VNTA 1C5NH 4FUEA 1Z71A 2HNTE 3NPSA 1W7GH 3LH3A 3SUGA 1GI1A 4AG1A 1DANH 3BTKE 5F8XA 2GT7A 1FQ3A 3P8GA 1KLJH 1HXEH 4Z0KA 1BTXA 4JK6A 1IQKA 3ZZ4A 4ASHA 1P8VC 2PTCE 3EDXB 4IN2A 1YPKH 4O9VA 1HJAC 1ELCA 1K1MA 4I8JA 4NIXA 3SU2A 2GGVB 4X1NU 4NA8A 1KY9A 5JBAS 3GY5A 1JMOH 4OS7A 3EA7A 3LGIA 4BNRA 1MQ6A 1RTLA 2UUFB 1W8BH 1O3MA 1THRH 2XC5A 2OLGA 5LGOA 5FCRA 5JB8S 2QA9E 2GCHF 4X8VH 1O36A 3ZZ5A 1HAPH 5FX6A 5F8TA 8GCHG 1AFQC 1C2MA 4MPUA 2QGRA 2FZZA 1BTPA 2O8LA 2Y7XA 4AZ2B 5K7RA 3ZZ9A 3BTQE 2BZAA 1BRAA 2BY5X 5JBBS 2WPJS 3KL6A 3M61U 1O3DA 5J4SA 2HLCA 3AW1A 1HAYB 2EI8A 1D6WA 1NFWA 4AG2A 4WJG2 1O2OA 3IITA 1UJ1A 1TNGA 4ZXYH 2VVVA 2RA3A 2A1DB 2B8OH 2VH0A 2FO9A 3A7XA 1LVOA 2A5IA 1PPFE 2BVXH 4ISOA 1BMMH 1E34B 3UWIA 4WH6A 4CHAB 1GVZA 3KQBA 3PTBA 1EKBB 1K1NA 5B6OA 1SB1H 5EU8A 5C3NA 3QWCH 3C1KA 4IGDA 1H9IE 1UMAH 1JBUH 2Y7ZA 2WPIS 1IQNA 2B0FA 1QL7A 1SLVB 2LNCA 4O03A 3LC3A 1K28D 1TX6A 2FYQA 1S0RA 2FX6A 4Q2KA 3BN9A 4RKOB 2R2MB 3GCHB 4TWWA 1HAOH 3A8DA 2XW9A 1EASA 5GDSH 2W3KA 4H42U 3PO1C 1CVWH 2NWNA 2OUAA 4K8YA 1P57B 1Z8GA 2H1UA 4NFFA 1SLWB 3BEUA 2ZPRA 1DY8A 1PJPA 1YGCH 1C2JA 1O2ZA 1KTSB 1P06A 2IPHA 3A8BA 2BVRH 1C2KA 4HZHA 4GCHG 4FU9A 1DPOA 2BLQA 3BIVH 1NZQH 1O3IA 1ZRKA 1C1UH 2A2XH 1AB9C 1CO7E 5ETXA 1QL8A 1GBDA 1XUJA 3K2UA 1FZZA 4FVBA 3ZZBA 1NT1A 1FIZA 2PLXA 1O2QA 3PLBA 2XWBI 4K1SA 3V0XA 5BPEA 5A0AE 2V35A 1W0ZU 3GCTF 3QDZB 1O3AA 2R2WU 1NS3A 3F1SB 1W3CA 1RS0A 4Q80A 1AVXA 2ZECA 3DT0H 4SGAE 2ZWLH 1TMBH 4ABHA 1C1OA 1T7CA 2WPMS 4KELA 4YT7H 4IC6A 2Y81A 4ZKNU 4X2WA 2NU4E 1TGSZ 3SUEA 2CJIA 5JB9S 1F5RA 2YNBA 1QB6A 3UY9A 2XNIA 3N7OA 4ABDA 1YBWA 5GIBA 1LQDB 1O2UA 1GBKA 1GHVH 5LPEA 3QZQA 4E06H 4CH2B 2CF8H 4B2CA 2QIQA 1ZOMA 4MPWA 2SNVA 3NWUA 1Q31A 3QN7A 1P0SH 1Z1JA 1Q3XA 1EUFA 2ZHDA 4OGYA 5TCAA 3TJVA 3FP8E 1FPHH 1QQ4A 2ZPSA 1FPCH 2OBOA 2P93A 1MKXH 7KMEH 1NFYA 1S0QA 3VB7A 1QRZA 2XBXA 1XMNB 1QR3E 3SU4A 2XBWA 1RJXB 2ZU5A 2ZP0H 2TRMA 3A81A 1ZHMA 4WWYA 1HAVA 2F9NA 3RMMH 2EI7A 1LPGB 1WTHD 4K5ZA 3GDSA 4MNYA 1Z8IB 3DFJA 4B76A 1SC8U 4UEHH 1EAXA 1YF4A 3SI4H 2A31A 3MNXA 1EJAA 1GMCF 1GHXH 1GG6B 1JIMA 3AASA 3G01A 1MAXA 1TQ7B 1DITH 3ZZ6A 1L0ZA 3KN2A 4X2XA 1UTPA 1KXFA 1C2EA 2BD4A 1XM1A 3M7TA 1BBRK 1BHXB 1MCVA 1G9IE 2ZDNA 1UO6A 3PLKA 1GI5A 1QA7A 7GCHF 3O8RA 2FX4A 3E0NB 2PHBA 1P01A 4IS5A 1QJ6B 2PUQH 1NPMA 1C5RA 4AB8A 2BD7A 1C5UA 2QCYA 1SGCA 1ANCA 4ZHMU 3GY6A 1V2OT 1V2KT 2FLBH 1BRCE 1JRTA 2Y82A 5FBEA 4GVUA 5DP9A 2ZFSA 3RMNH 1YCPM 3F9HA 1GJ6A 1C4Y2 1UHBA 4RKJB 3ZZCA 1K1JA 1EOJA 1MTVA 3VXEH 4BXWA 1AN1E 5BRRE 1C5QA 1A0JA 1OS8A 3ZZDA 1SHYA 2AEIH 3A87A 1FLEE 4D9RA 3BG4C 3MNCA 3PWCA 4YO9A 2SGDE 1G3EA 1AHTH 1DUEA 1UTNA 3RXAA 3LJOA 2J92A 3STIA 3SJIA 1AWHB 1O2LA 5AHGH 1GI2A 2ZC9H 2YNAA 3FANA 4DVAU 1AKSA 4NIYA 1XXDA 1YPEH 5DP5A 1QRXA 2ZDAH 1O3KA 1V6DA 5J4QA 3LT3A 3URDA 3NCLA 3ZYDA 4X1RU 1GGDB 2ZG0H 3CENA 3RLYH 4LZ1H 2P8OC 3QLPH 4RSPA 2FYRA 3UREA 3S7HB 1CA0C 2BXUH 3PMHB 5SGAE 1NRPH 1ZTLA 2JETC 5DJ7A 1C5SA 2V3HH 4UFEH 3OY6U 1PPEE 5C1UA 1NU7B 1GL0E 1L1GA 1B5GH 3RXTA 3AAVA 4X6PA 7GCHG 1XUIA 3P17H 3RXFA 1PQ8A 3T5FH 1FONA 1ZSKA 1GBCA 1CGHA 1V2PT 2ZFTA 3UNSA 3FZZA 3B23B 1J14A 2WV4A 1ANBA 2BTCE 4Y0YE 1C5YB 3GICB 5L2ZH 2A4RA 4D7FA 1O5GH 1RGQA 1IQMA 1UVUH 4Y10E 1TMTH 2ANMH 3VGCB 2ZHFH 3RXCA 1C5MD 3ENSB 4NFEA 2AIQA 2QF3A 2XBYA 1VCWA 1IQLA 2Z9IA 4CRDA 1SR5C 2Z6BD 4O3TA 8LPRA 1KIGH 2O8MA 1T8MA 5HM2A 1V2VT 3E0PB 3TJOA 2A0QB 1O2HA 2TGPZ 2PFEA 1TX8A 4NA7A 1VITF 1DLEA 1MTNC 2FMJA 1QBVH 2ILNA 2B5TB 4R8TB 4TWYA 2VWNA 1FY4A 1NRQH 4U2WA 1CBWB 4A1VA 1P9SA 1G32B 1UVSH 1LPKB 1K21H 1K1OA 1XUKA 4I32A 1O37A 2VIWA 3LGWA 3TITA 1O5FH 4H6SB 4B2BA 1ZTJA 1TYNA 2AMDA 1VCQA 2VIPA 1THSH 1KLTA 4VGCB 2R0KA 3GCNA 5F8ZA 4JYUH 4XE4A 1QBNA 5GJ4B 1QRWA 2WPHS 1AUTC 1CBWC 1FY1A 1EAUA 3MO3A 1AFEH 3BTGE 1LHDH 3VEQB 3UIRA 1MTNB 3BTME 3SQHE 2GZ8A 3EA9A 1WQVH 1O3CA 1WAYB 2ZFRH 4J2YB 4QT8C 4CBNA 3A89A 1P2JA 1J9CH 4I31A 2BDBA 1QHRB 4ZROA 1P11E 1DICA 1FNIA 2TGTA 1CHGA 2AS9A 2ZA5A 2OC1A 3LGVA 3LU9B 3Q3KA 5C1YA 3P8NA 1TX7A 4CREA 4HGCA 3SGAE 5K0HA 2Z9JA 3A8CA 4CHAC 4WMEA 5DP4A 3ZZ7A 2BY7X 2Z9KA 1QTFA 4B71A 2G51A 2J2UA 3TK9A 1FXYA 1V2ST 1AIXH 4F49A 3RU4E 1AUJA 1DXWA 2XCFA 1BTUA 1H1BA 3RMLH 4MQAA 1O2KA 3S7KB 3V3MA 1K9OE 1C1NA 2BY9X 3F68H 6ESTA 1NO9H 4OS2A 4XFQA 2PW8H 2WYJA 4X8UH 3E8LA 1VR1H 1T8NA 1AFQB 1FY3A 1BMNH 1UCYH 2UWPA 1LHFH 1GDQA 3ZZ8A 1TNIA 2BB4A 3MFJA 2H9TH 1CA0B 3P95A 4JZDH 1S6FA 2QXJA 2UUJB 2GDDA 3MI4A 3SOSA 1AE8H 1GHAG 2BY8X 1C9TA 2SNWA 5JYIA 2ZGBH 2Q6FA 2ZDLA 5C67A 5I46H 4ZUHA 1OWJA 2HALA 2VINA 1SFQB 4K2YA 1BB0B 1O5DH 3IWMA 1H8IH 1Z8JB 1J16A 3RM0H 1O5BB 3UFAA 3ZVDA 1AO5A 1QJ1B 3M37A 4ZHAA 1SQTA 1S82A 1G3DA 1XVOA 1BUIA 1EAWA 1J15A 3FP7E 2WINI 8GCHF 1ZGIA 2A2QH 2C8XB 2ALVA 2BXTH 2STAE 1ANDA 2BQWB 1KLIH 1IQJA 2I6SA 1Q2WA 1C2FA 1GI4A 1N6XA 4JZFH 3TK6A 1YYY1 2C3SA 4UE7H 1Y8TA 1PFXC 1DSTA 4A5TS 1C1RA 3S9BA 3TGIE 1RIWC 2G4TA 2XRCA 3UNQA 3SGQE 1TGBA 3F9GA 1ZTKA 4FUDA 1C2GA 4AORA 1TNHA 1U6QA 4U32A 3BF6H 1GI0A 1TRMA 2ZEBA 3OX7U 2OTVA 2ZF0H 5GPIB 4B75A 2C8YB 1EXFA 1V2WT 1ELBA 2P8OB 9ESTA 1RFNA 3M7QA 1TPSA 2BY6X 4YOGA 2H6MA 1ESAA 2RCEA 2A5AA 2VB0A 5A8YA 3H7TA 5DPAA 1P04A 3BTWE 4KKDA 1FJSA 1M9UA 1P09A 3PWBA 4MNVA 3P70B 1QA0A 2D2DA 2G00A 2BDAA 2BX3A 4DIHH 4B1TA 3BG4B 1C5OH 4AFZA 1MU8B 1DDJA 1UK3A 2FXRA 3KEEA 4ABEA 1G30B 3ATMA 4XBBA 1H9LB 1HXFH 5E0GA 4NWKA 3LPRA 3M5OA 1A61H 1QB1A 1C2IA 4OS1A 1IQFA 4BOHA 4X0WU 3T62A 1OP0A 1A5HA 4XOJA 2NU1E 2A7CA 2FLRH 4CRAA 2PKAB 4UFGH 4A1TA 4BAMB 5F03A 5F6MA 4WMDA 5DGJA 3CP7A 2W26A 3VB4A 2OP9A 4Y11E 2GTBA 1O34A 2F83A 3U8RH 1OOKB 1S85A 2VH6A 1MUEB 4U30A 4JZ1A 1W2KH 1ZSLA 1ETSH 2GVFA 3CS0A 1ORFA 1C1TA 1O38A 3VB6A 4ABAA 3LGTA 3ZVFA 1DWEH 3OY5U 2AH4X 3UR6A 1RD3B 5HYOA 2BD9A 1VITH 3GISB 1IQGA 3DUXH 3SJ9A 1O3FA 1Z6EA 1C5ZB 1BTZA 1JWTA 2F91A 4HTCH 5I25A 4Y79A 1UTJA 3AAUA 2Z9LA 3ZVCA 1THPB 1KXDA 4JYVH 3O8DA 2W3IA 1YPHE 3D62A 3SUFA 1FN8A 2SGAA 4DIIH 2Z3CA 4ISHH 3T29A 5LH8A 4O97A 1SGPE 3F9FA 4NCYA 1CA8B 3TNTA 3RXDA 1Y3VA 1OX1A 2FTMA 1TPPA 3SN8A 3MO9A 1MZDA 2A32A 4AYYB 3SJ8A 3MTYA 5L30H 1E35B 3BTHE 2K1QA 4DCDA 2OQUA 1BDAA 5PTPA 1Z1IA 4XSKU 1O3JA 2ZIQH 4MLFB 3TPIZ 3Q00A 1DXPA 1LPZB 2WV5A 1ZYOA 2OBQA 3UPEA 1G36A 2WUBA 2ZU3A 4K8BA 1C5TA 1L4DA 3NK8A 2P95A 2C4FH 3MYWA 1C1PA 1DWBH 2GT8A 3QTVH 1EZUC 2Q6DA 5ESTE 1DT2A 3EGKH 1CT0E 4HFPB 3RXLA 5FAHA 1Z7KA 2AYWA 4LZ4B 2QAAA 3LONA 3RUOA 1ETTH 1IQIA 3A83A 1GDUA 4NA9H 2JETB 4XBDA 2P16A 2TGDA 4DW2U 1F5KU 2WYGA 6LPRA 1FAKH 3LIWA 2Z3EA 3RC4A 5A8XA 1SL3A 2H5CA 3H7OA 2G55A 4MNWA 2ZTYA 2ALPA 1HAZB 2ZTZA 1AB9B 1GG6C 1TGNA 4X8SH 2BLOA 3VFEA 2G8TA 4CH8B 1SGFA 2BQ7B 2PGQB 1FY8E 1GJBB 1UCYE 4NIVA 3RXJA 1A3BH 1VJAU 1SSXA 2VIDA 1Y5AT 1NRRH 1KSNA 1O33A 2Y80A 5ESBA 4LK4A 2OD3B 1BJVA 3D65E