4IC7B

Crystal structure of the erk5 kinase domain in complex with an mkk5 binding fragment
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
123
structure length
123
Chain Sequence
VLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGLKVNTRAGPSQSGRHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 7
publication title Structural mechanism for the specific assembly and activation of the extracellular signal regulated kinase 5 (ERK5) module.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 21
structure length 123
sequence length 123
chains with identical sequence E
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2012-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4ic7B00
3ML9A 4ZDVA 1UZXB 3DOWA 2BYEA 2JPHA 1LM8B 1IP9A 5D2MB 3DVNV 3V62A 4BKTA 3ZRFA 1HE8A 3EHVA 4LCDE 3BINA 3IG3A 4RM8A 2DZMA 4MDKE 3UINB 4FJVB 1GC6A 3DBSA 2O2VB 1ZKHA 3KH0A 3N30A 4FULA 3DBHI 4KDLB 3SU8X 1P98A 2WDTB 5D6JB 4A20A 2GBMA 3ZVVA 3CMMB 2A4ZA 2KWUB 4BOZB 4ANVA 5DPWA 4NNJB 1EUVB 5JZEB 1WX7A 2LASA 5DPSA 3M63B 2C5LC 1L7YA 3QQ8B 4IM3A 1E8ZA 2PE9A 4JIOU 3A9KA 4GDLB 5AZHA 2JF5A 3JYUA 2EMTA 1TGZB 1GJZA 5DCNA 3MTNB 4PS3A 4MEMA 4W9GA 2PPHA 4W9DA 4W9KA 3B1LX 4AUQC 1X1MA 4MGZE 3V6CB 3ZTDA 4FBJB 2LGXA 2N9EB 3SD5A 4FA6A 2ZZPB 3V6EB 3PVLA 4DHZB 3NY5A 4ASWC 1IYFA 2HTHA 3KUCB 2M17A 1OTRB 2MP2B 1D3ZA 2FCSA 1LXDA 3VH4B 5L95C 4G3XB 1U4AA 2MCNB 1C1YB 4KZ0A 4HLEA 3S2AA 2XK5A 3KYCD 3KYDD 5AZFA 2N9XA 4BKSA 4FADA 4MH0E 4A3PA 4I6PA 3QX1A 4ANWA 1ISNA 2LWPA 4IG7B 1WJ6A 1V5TA 4G11A 4IW0A 1YX5B 3QA8A 3NHEB 4II3B 1J8CA 2KKCA 3R3MA 1FXTB 2JWZA 2LXCA 2JUOA 4G50A 1LQBA 2JT4B 2KJ6A 2KX3A 3N3KB 4HVBA 1AARA 3LJ3A 4TKNA 5DPTA 1EF1A 4MJSA 1RLFA 3A9JA 3L13A 3TMPB 2L7RA 3PRZA 3MJWA 4RM9A 5LXIB 3TIXA 2NBVB 1GG3A 5BO4B 3PLVA 3TBLD 3DDCB 1UBIA 2J0JA 2DYMA 3A1QB 1WMHA 4K7SA 2ZNVC 4W9IA 3LDZE 3RZWC 2RSUA 2N1VA 2Z59B 4NQLB 2HJ8A 4TV3A 3ZNGC 4DBGA 5JHAA 2RR9A 4MGIE 4WJOA 5FR6A 2KFKA 2C7NB 3BY4B 1WYWB 3U30A 1V81A 3H7PA 2KTFA 1YD8U 2JRIB 2PE6B 3KUDB 3HM6X 1WJUA 3MHSD 2DAJA 1RRBA 2KX0A 3W1SC 5C23A 5J17A 2I1JA 2NPTA 5DPRA 2BYVE 2NR2A 2O6VA 3WAOA 1V5OA 1WXAA 2K39A 3WANA 3HK0A 2MBEA 4GDKA 3GZNI 4K81A 3SDLC 2FCMA 2DYOA 2C60A 5D7GA 2NVUI 3V61A 3OAWA 2BKRB 1WE6A 2BF8B 2LXAA 3L0WB 1XQQA 2L3ZA 3I3TB 3HIZA 3QC8B 4F1SA 2KTRA 4FN2A 2W9NA 4LDTD 4MGKE 3JSVA 4FLHA 3GOEA 2JRHA 4NAWA 3R7QA 2N7DA 1WZ3A 2IY0B 2L8JA 4KIKB 4NQKE 2A5UA 2IY1B 4OVVA 1VD2A 3KVFB 3TCAA 4EFOA 2B3AA 2KMAA 1V49A 3H1UA 2J7QB 2KC1A 2BWES 2KVRA 1XD3B 3DCGA 3PGEA 4GGQA 1IPGA 5CHWA 1E8XA 2AYOB 2AWTA 4DXAB 1S3SG 4EOYA 4IM0A 3W1SA 2HE7A 1WH3A 4EZJA 2KDEB 1QZEA 4P7IA 1M94A 4XZ4A 2O2VA 5GMVA 3ZDTA 2EMSA 2KD0A 3UQBA 1WR6E 4WWNA 2IO0B 1WGGA 2J0MA 2JVCA 4GOCA 1WM2A 2G4DB 2KLCA 4YL8A 2WYQA 5G55A 4EEWA 1RAXA 2Z0DB 3CSFA 3L10B 3UGBB 1RFAA 3JW0X 4WWPA 3VTWA 1SE9A 2DHZA 4IWOA 2KZRA 2MRPA 1WGYA 2EKEC 2KMCA 3QHTA 4HWIB 3QJZA 4XX5A 5KHOA 1PQSA 4GDLA 2YVCA 2LJ5A 3VTUA 3DBLI 3ZKJC 1YX6B 4NPNA 2GBRA 2C9WB 2VRRB 1A5RA 1KOTA 3OJ4B 2M4NA 3WALA 2NS5A 3VAWA 5LLIA 1UH6A 4JGHB 5HKHA 4M0WB 3X0WA 4E71A 1E7VA 2MP2A 2D10A 4J6IA 2ZCBA 3QCAA 2KC2A 3QARA 3VQIA 1UGMA 3ZLZA 5E6OA 2G3QB 4IWQA 3UIOB 3NS8A 3DVGY 1BT0A 2MQJA 2K8BA 2V3SA 1LFDA 2IO2B 2LVOA 2ZVNA 4KDIC 1V80A 4M8MA 4MSMB 3NOBA 1J19A 1G6JA 2MLBA 1Q5WB 4LJPB 3W1YA 3B08A 1WXSA 4A3OA 2KK8A 5CHVC 2N4FA 2KXJA 3T9LA 2KFJA 1WGDA 1F9JA 4HDQA 2LD9A 2K1FA 1EF5A 1P3QU 2KDFB 2LRUA 2LI5A 3U7DA 1WY8A 2C7HA 1K8RB 1UBQA 4IUMB 1T0YA 4I6LB 3Q3FA 3R66C 3PTFC 1P0RA 3N32A 1TTNA 4B95A 3ECIA 3H6NA 3NZUA 4URKA 5J18A 2LRWA 2ZEQA 2ZJDA 2GOWA 3KUZA 3UIPB 1TZ1A 4M8NA 4W9JA 1JRUA 4WWOA 4BKGA 4MSQB 1E5WA 2G4SA 4FHJA 3IFWB 2UYZB 2G45B 5JHBA 3D32A 4DWFA 2LVQA 2NBUA 3VUYA 4AOFA 2GMIC 2KDBA 2IYDB 3AU4A 4ZRIA 2V4LA 3A4RA 4K7WA 3ZRCA 3TJPA 2MA9B 1WGRA 4HDOA 4HXDA 2J0KA 2KWVB 2KOXA 1UELA 2FNJB 2LUEA 5G2NA 2DENB 3Q3JA 2MBQA 2QHOA 2DZIA 3ZW3A 2PEAA 3TL5A 3PRPB 1GNUA 1WR1A 4KVGB 4KV2A 3SHQA 1WXMA 1KJTA 3UF8A 3A4SC 3U8ZA 4EZLA 4W9CA 1GC7A 3WAMA 1WF9A 1V9JA 3AXCA 2PJHA 2L00B 4KIKA 1YJ1A 1EO6A 2CR5A 4GN1A 3WA0A 3VTVA 2FUHB 2KQSA 4HPMB 2RPQA 2BKFA 2LGYA 2O6VD 2AEHA 2KANA 3ZNID 4FHKA 3OJ3A 3VUXA 2AL3A 4IWPA 4LDTB 3RD2A 4F7ZA 2BWFA 2KWCA 3L08A 5CHFA 1CMXB 1OQYA 3QAQA 1R4MI 3K9PB 4KZCA 2CS4A 2I1KA 2ZPYA 3PSEB 2JZZA 3UQAA 2M1MA 1I42A 2IBIB 3PLUA 2BPSA 4W9FA 1SIFA 5LXHA 1C3TA 1YIWA 4F8CB 1J0GA 2KN5A 2JZ3B 2M0XA 3K9OB 3RUIB 4PYZA 3APFA 4KSKC 4PS7A 3IVFA 2KQ7A 2XEWA 2CKHB 1NI2A 5C1ZA 4BFRA 2ZVOA 4GIVA 5KHQA 4ZYNA 3PZDA 1Q0WB 4NY0A 2MSED 2CHZA 3L17A 2K8CA 4FJYA 2NBWB 3RCZA 3WIMA 4ANXA 4AWJA 4ZRJA 3AI5A 5CTRC 4W9EA 4BOSC 2HD5B 3O65B 1NBFC 1H4RA 3ZNZB 4ICUA 4AJWA 3PHXB 2ASQA 5EDSA 2ZCCA 2M8SA 2N1WA 3QK0A 1WI0A 2FCQA 4B9KA 2BGFA 2MWSB 4N9F4 2IO3B 2OOBB 4GU2A 4GXBA 3T8MA 3L16A 4ZRKA 3RT3B 3VUWA 2L0TA 3EFUA 3HHMA 3P2BA 1OEYA 1E8WA 1P1AA 4GB9A 2FCNA 2YLMA 4HPLB 4ICVA 4EUTA 3QWZB 4EZKA 4IM2A 5IAAC 4K1RB 3ZTCA 5JH5C 1I35A 3CSTA 2L76A 1WX8A 4HJKA 3VFKA 3DBRI 4NJ6A 4XC2A 1P9DU 2REXA 3WAPA 2RD0A 2N9PC 4G0NB 1V2YA 2ZPNA 4PYUA 4IC7B 3PREA 4GMVA 4HCNB 2LZ6A 3PT2B 2IZVB 3APDA 4MM3A 3A9KB 4WAAA 2CHWA 3RZFA 4CYEA 2GBKA 3ZUNA 3PRMB 3NZSA 4II2B 1WJ4A 4CO7A 2K25A 2LVPA 1E90A 2GBNA 2UWQA 4MELA 1UD7A 3VH3B 2L05A 3PS6A 4E3CA 1OEYJ 3A1QA 1WM3A 2WX0A 4BKSD 3ALBA 3DPDA 2JY6A 5AZGA 1WFYA 4TQ1A 1XT9B 2RGFA 3IHPC 2CU1A 3ONSA 4TQ0A 1R4NI 4BBNC 2AL6A 1ZW7A 3M95A 2C7MB 3AULA 2XK5B 4X57B 4DHJD 1TBEA 4RMAA 2MBBB 2KJRA 2WWZA 1H8CA 4K7UA 3VDZA 2R2OA 2IO1B 5J2RA 2BYFA 2N7EA 3X23A 1MG8A 1Q1OA 4OVUA 3VHTC 2K6QA 3A33B 4E74A 3ZDMC 4DHJB 5CX3A 2DZKA 4AP4C 4JQWC 4DDID 3M3JA 4KSLC 2MX2A 1WJNA 4B6WA 1YQBA 4MJSB 2FIFA 1WGHA 3H7SA 2Y5BB 2MW5A 3A9JB 4JLCA 2MBHA 4LJOB 4CHKA 2D3GA 1E7UA 4WJQA 1S1QB 4HCPB 1E8YA 3ML8A 1KLVA 1WMHB 4GSWA 2DX5B 3IBEA 4W9HA 2KFKB 3EC8A 2JXXA 2D11A 1V86A 2KO3A 2NCNA 3ZO5B 2KJHB 3H7PB 5E6PA 2Z0EB 4HK2A 1Y8RC 4PS8A 4I6NB 3PPAA 3ENEA 2KDIA 1WXVA 4JL9A 3RYTA 1L2NA 2KLGA 2LGDA 2GBJA 2NPTB 3PV1A 4DK5A 4EKUA 3VXWA 1GUAB 3PHWB 2OJRA 2D2QA 3R7RA 1SGHA 2O6VB 1WIAA 3M62B 4FJZA 1OGWA 5E6NA 4ANUA 2V1YA 5AEKB 3DVGX 1Z2MA 4BBNF 4GDKB 1WX9A 4WQOB 1WZ0A 3V60A 3RULA 3APCA 2WX1A 5IA7A 1V6EA 3KW5B 3C0RB 4NJ7A 3L54A 4MGYE 3ZNHB 5L83A 5D94A 1WRDB 2KNBA 4DHZE 4BVUC 4AJYB 1VCBA 2KHWB 2R2QA 3CF6E 3EECA 2KTRB 2L0FA 1Z5SB 2FAZA 3JSVB 4NAWB 4W9LA 3VVWB 3OLMD 2DZJA 4WJNA 4TUUA 3AU5A 2DAFA 2K6DB 3DQVA 1NDDA 2MBOA 2XBBC 2ZNVB 3JVZX 3H9DA 3HM3A 2CHXA 2D07B 1KM7A 1WE7A 2K8HA 2FIDA 3DVNU 4WJPA 2DYBA 5TR5A 3B0AA 3ZIMA 3QIJA 1ZGUB 4DDGD
chains in the Genus database with same CATH superfamily
3DOWA 4ZRQA 2BYEA 4P6VF 2JPHA 5D2MB 1SE2A 1TIFA 3O13A 3V62A 2N0SB 4XYCA 3IG3A 4RM8A 2MEKA 1IBXB 2O2VB 3DBHI 4A20A 2GBMA 5HG2A 4C7ZA 2KWUB 4BOZB 4EE2A 3I9V1 4RGMA 1YQ3B 1JWMD 2WU5B 3HRDD 4JPSA 2BB5A 4K3BA 4W9DA 3GP7A 2W82A 1VLBA 1L5PA 3ZTDA 4FA6A 1AN8A 3NY5A 2MP2B 3VH4B 4KKIA 4G3XB 1U4AA 4BKSA 1SJHD 1UF0A 4A3PA 4I6PA 3QX1A 4ZHOA 1ISNA 1WJ6A 4IW0A 4HEA1 3RNAC 1J8CA 1C77A 2KKCA 1FXTB 3V3XA 1AARA 3BVGA 3A9JA 3RFZB 3TMPB 1FFVA 3PLVA 3DDCB 1UBIA 3A1QB 1WMHA 4ZYSA 1FNUA 3RZWC 2RSUA 1PDXA 2N1VA 3N9YC 4NQLB 4PT5A 5FK9C 1DOYA 2PTLA 1C4PA 3H7PA 2JRIB 3KUDB 1VR9A 2DAJA 3I57A 4RGNA 1ENFA 5C23A 3CIRB 2NPTA 5DPRA 2BYVE 2G9HD 2K39A 2Y3AA 1NEKB 3WANA 1D5MC 2MBEA 2DYOA 2C60A 5D7GA 3L0WB 1XQQA 1ACCA 4LDTD 2N7DA 3VR9B 1N5WA 4K3CA 1UWMA 2IY1B 1M4VA 1VD2A 3TCAA 2J7QB 1SEBD 2IGHA 4GGQA 1IPGA 3MP9A 5CHWA 2EKIA 3SFEB 1S3SG 4EOYA 3AEGB 4IM0A 2KQ4X 1HTQA 2KDEB 3ZDTA 2X38A 2KD0A 1T0SC 2LEKA 4WWNA 4YL8A 4EEWA 1KF6B 4WAFA 1RAXA 3UGBB 3L10B 4WWPA 2BTEA 1WGYA 4XDCA 4XX5A 2KMCA 4QAYA 5KHOA 3ABVB 4LLGM 3Q3OC 2WLBA 1HQRD 1KLUD 2BB6A 1B1ZA 2RPVA 3VTUA 2QC8A 3ZKJC 1L6UA 1QT9A 2M4NA 4JGHB 1E6EB 3SEBA 3X0WA 2W3RA 2D10A 3QCAA 2KC2A 3QARA 2JYEA 5E6OA 1L4ZB 3DHHC 3PZ8A 3W9CB 4JWSC 3NUHB 3RNFC 2ZVNA 4M8MA 4KDIC 4MSMB 2MLBA 3W1YA 4HROA 1V8CA 1WXSA 3NZ3A 4A3OA 2KK8A 2INDC 1FXAA 4YT0B 3AM9A 5CHVC 2KXJA 3T9LA 1WGDA 3W5UB 2K1FA 2KDFB 2LI5A 4C80A 4TMAB 1WY8A 1K8RB 1T0YA 4YWGG 4B95A 3MC8A 4URKA 3GE8C 3UIPB 4YTPB 2HDEA 1ZDVA 4WWOA 2FUG1 2KMMA 4OVZA 3H8HA 2V0GA 4DWFA 2JSVX 2NBUA 4M02A 2KDBA 3AU4A 4ZRIA 5AUKA 4K7WA 3RNCC 2J0KA 1CZPA 1MHHE 1UELA 1JALA 2MBQA 2QHOA 2LJIA 3SHQA 1KJTA 3A4SC 4EZLA 1GC7A 3WAMA 1WF9A 2L00B 5GXGB 4N59A 1ZDXA 2WXJA 4NAMA 1NVID 4XWWA 4IWPA 1PUTA 2BVCA 4F7ZA 1CMXB 1JRPA 2Y5PA 2V4IB 1KFYB 3UQAA 1N5XA 2QILA 1I42A 1EU4A 2BPSA 1SIFA 1C3TA 4F8CB 1FIQA 2JZ3B 4KSKC 4USAA 2LHEA 2XEWA 2BW2A 3MJ5A 4P16A 1MFWA 4BOSC 3O65B 3URYA 2M8SA 1FFUA 2IJ0A 2FCQA 2CJNA 3IT6B 5EE0A 2OOBB 1JWSD 3L16A 3RT3B 2V3NA 1OEYA 2E6XA 2D3CA 3FC4A 1I35A 1WX8A 4HRSA 3BVZA 3MFGA 3B2FA 1V2YA 2ZPNA 1MHXA 4IC7B 2INPE 4MM3A 4ZRPA 3A9KB 4CYEA 4CO7A 2LVPA 2LUMA 4E3CA 2FBWB 2K0PA 2L05A 1KLGD 2RGFA 3IHPC 2H89B 1HTOA 2B76B 2KJRA 2WWZA 2TSSA 5TSSA 2R2OA 2IO1B 5J2RA 3X23A 4OVUA 2QMTA 4XE0A 1IGCA 4AP4C 4DDID 3M3JA 2AQ1B 3MHZA 4AS1A 3RN9C 4MJSB 1WGHA 4LJOB 2EELA 4CHKA 1SJED 3DBLB 5T8IA 1S1QB 2WXFA 3ML8A 3AE9B 1T6BX 4W9HA 2JXXA 2KJHB 4HK2A 5H8YE 4PS8A 2MHJA 3U52E 3PPAA 1VZ8A 4GLSC 2KDIA 1V1PB 1SSNA 4DK5A 2O6VB 5E6NA 2V1YA 1C76A 4BBNF 1WX9A 3B9JA 3APCA 2WX1A 1V6EA 4NJ7A 3L54A 4MGYE 5L83A 4REZA 2QCZA 1VCBA 2KHWB 2R2QA 2L83A 2WXIA 1C79A 2KTRB 2L0FA 4W9LA 4DXGA 1JWBD 2XBBC 3H9DA 3ZIMA 3B0AA 2J53A 4DDGD 4M00A 3VRAB 1L6VA 3DVNV 2YEPF 2RDHA 2BS4B 3ZRFA 3AE5B 4LCDE 3NJTA 1C4AA 2WXPA 1N6ZA 3SU8X 3ZVVA 3P42A 2L32A 2BQQA 3C19A 1L7YA 3QQ8B 4IM3A 1E8ZA 2PE9A 1F2RI 4GDLB 2JF5A 3JYUA 1I4PA 1HZ6A 1TGZB 1GJZA 1AWDA 1TJEA 4LK0M 4MEMA 1TS5A 1QOGA 2Q5WD 3WCQA 4AUQC 1X1MA 3Q8FA 3V6CB 2M56B 3EGRA 4WH4A 4IDIA 2HTHA 3KUCB 3GE3C 3TEYA 3CWIA 3AE6B 2MCNB 3S2AA 2XK5A 3KYCD 3KYDD 2V3PA 4MH0E 2LWPA 4IG7B 4LTUA 3FKYA 3QA8A 3NHEB 4II3B 5FKAC 5FR3A 3KLSX 2KX3A 4HVBA 4TKNA 5DPTA 1FMAD 3PZ7A 3PRZA 3MJWA 3NVWA 3TIXA 2NBVB 2J0JA 4A55A 3N1ZC 2ZNVC 3LDZE 2Z59B 5JHAA 4DBGA 4MGIE 1YOVB 1OQQA 2C7NB 3U30A 2PE6B 1HXYD 1WJUA 3DBHB 1RRBA 3W1SC 3P1MA 4MH8A 4HKZE 1RFKA 4YSXB 2NR2A 3HK0A 4GDKA 4K81A 1JMLA 3IAM1 2KDMA 2LMCA 2LXAA 1GPXA 5EE1A 2L3ZA 3QC8B 4F1SA 3JSVA 4FLHA 2J4XA 1E10A 3Q3MC 1JQ4A 4NAWA 4NQKE 2D3AA 5HFYA 4KGTA 2KC1A 1YNTE 1RYJA 1XD3B 2KVRA 2BBCA 2AWTA 4DXAB 3W1SA 4EZJA 3VRBB 5GMVA 3KQ4A 1MI0A 3KWVA 2J0MA 5IKCM 1WM2A 1FNVA 1XCQL 1RFAA 3JW0X 1SE9A 2DHZA 2MRPA 3QJZA 1PQSA 2YVCA 2ON8A 4NPNA 2IDYA 1A5RA 2M0AA 1T0QC 1FNWA 1PYWD 4M0WB 1E7VA 1VJKA 1CJEA 1TY2A 4RH6A 3VQIA 3ZLZA 2HJ1A 1BT0A 2MQJA 2V3SA 2GLSA 1V80A 3NOBA 2L1AA 4LNOA 3Q3NC 2N4FA 4HDQA 3U7DA 1EF5A 2C7HA 4IUMB 2KN4A 2QSDA 1P0RA 1F52A 3ECIA 5EE3A 3NZUA 4HPPA 2ZEQA 2ZJDA 4ACFA 2GOWA 3KUZA 3R8BA 1TZ1A 1DYQA 2WGSA 1SIJA 2INNE 3IFWB 1TYGB 3VUYA 4AOFA 3Q2AC 2GMIC 1DOXA 3A4RA 3TJPA 2KWVB 1T3QA 2KOXA 5LNK1 2FNJB 2LUEA 5G2NA 2DENB 1TY0A 5BMGA 2DZIA 3ZW3A 1Q10A 1GNUA 1WXMA 2JQRB 3AXCA 2PJHA 4KIKA 1YJ1A 2CR5A 4L23A 2RPQA 2LGYA 2O6VD 2KANA 3ZNID 1I4QA 3Q8CA 1F0ZA 3Q69A 3QAQA 3FILB 2JZZA 2WXKA 2IBIB 2K5PA 2M0XA 3I5JC 3K9OB 4PYZA 4JE3B 2CKHB 1NI2A 4BAXA 3PZDA 1Q0WB 4NY0A 1TZOA 3TEZA 4JX1C 2NBWB 1EM7A 4AWJA 4ZRJA 1OQRA 2HD5B 2GB1A 1H4RA 1A70A 4ICUA 2PW9A 3ZJUA 3PHXB 2ASQA 5EDSA 1K53A 2N1WA 3QK0A 1EWCA 1I4HA 2MWSB 2IO3B 4GXBA 4ZRKA 2L0TA 3EFUA 3HHMA 3P2BA 1JWUD 1P1AA 3GZNB 4HPLB 2DWQA 3QWZB 4K1RB 3ZTCA 2L76A 1UUPA 1P9DU 3W2DA 1F2RC 1L4DB 2RD0A 1PGBA 1YQ4B 5D3DA 1R7SA 3PREA 1I4XA 3R2TA 4HCNB 2LZ6A 2KWDA 4WAAA 1VZ6A 3RZFA 2GBKA 4II2B 2K25A 3AH7A 1J7CA 1E90A 1I7HA 3PS6A 1D4BA 1GAQB 1HA5A 4R3DA 3ALBA 3N1YC 4XDDA 4TQ1A 3ONSA 3DHIC 3M95A 2GI9A 3BK1A 3P4PB 1TBEA 2ONQA 1L0YB 4K7UA 1Q1OA 3I63C 4E74A 4DHJB 5CX3A 1FPYA 2DZKA 3W5VB 4B6WA 4JLCA 3A9JB 1DOIA 1XLPA 2XNAC 3ZJVA 2PVGC 2X8XX 1WMHB 4HKQA 1QKZA 4GSWA 2MJDA 3AEAB 3EC8A 1FEHA 1V86A 3ZO5B 3H7PB 3C8YA 3PO0A 4YXDB 4OZAA 3EA6A 4RGTA 1L2NA 4LNIA 2KLGA 2GBJA 2NPTB 3PV1A 4EKUA 3VXWA 1GUAB 3PHWB 3ZYYX 2D2QA 3R7RA 3M62B 4FJZA 3DVGX 4WQOB 1E9MA 3RULA 4FXCA 1YJJA 5D94A 1MVKA 3AEBB 1Z5SB 5BYQA 2PMVA 2CJOA 2DZJA 4WJNA 4TUUA 4YTNB 1XXGA 2K22A 2D07B 2FIDA 3MC0B 1NI3A 5TR5A 4YTMB 3Q3JA 1XF5L 2I38A 1ET6A 1EWYC 3Q8AA 1XLNA 1LM8B 1SE4A 2YEPB 4BKTA 1HE8A 3EHVA 3BINA 2DLBA 1FCLA 1GB1A 2DZMA 4OHJA 3U7ZA 1GC6A 3DBSA 1FD6A 2SAKA 4FULA 2WXLA 4KDLB 3FAHA 1P98A 2WDTB 5D3IB 5D6JB 5DPWA 1EUVB 3N20C 5DPSA 1HEZE 3M63B 4JIOU 4PS3A 4W9GA 1YJIA 2PPHA 3B1LX 1XCTL 4MGZE 1YN5A 2ZW0A 4FBJB 2LGXA 2N9EB 2ZZPB 3V6EB 4ASWC 1R4MB 2M17A 3TEXA 1D3ZA 2OEDA 5L95C 2VH1A 2RDBC 4B0EA 4HLEA 4FADA 2N9XA 3DHGC 1MG4A 4G11A 1YX5B 3R3MA 1N63A 4C56C 2HTME 2JUOA 2LXCA 1LQBA 2JT4B 3EUB2 2CU3A 3LJ3A 1EF1A 1RLFA 1DGJA 2L7RA 5LXIB 1GG3A 5BO4B 2DYMA 4W9IA 2JXTA 4N58A 4WJOA 5FR6A 2KFKA 3BY4B 1ZXIA 1WYWB 1K51A 3HVZA 2KTFA 1VDVA 3HM6X 1MPEA 3MHSD 3NG0A 1ZXHA 4A6QA 3WAOA 1V5OA 5JXVA 3SDLC 2WP9B 1SE3A 2WNMA 3V61A 3OAWA 1F77A 1WE6A 2BF8B 1KH0A 1L0VB 3GOEA 2JRHA 3E9SA 5BYRA 4RGOS 1WGKA 3IXSA 1K52A 3ZXRA 1WZ3A 1RM6C 2ACZB 2A5UA 4OVVA 3AE4B 3TEWA 2OHFA 3T3OA 2KMAA 3GS2A 1ZP0B 3NVVA 3H1UA 1NYRA 3TUOA 1P7EA 1T0RC 3DCGA 5C2TB 4TSSA 1E8XA 1AYFA 2HE7A 1IBXA 2O2VA 2EMSA 1TS3A 3UQBA 1SF0A 2JVCA 4GOCA 5G55A 2AX5A 2Z0DB 3VTWA 4IWOA 2KZRA 1PGAA 5IO9A 4US9A 2EKEC 3AEEB 4HWIB 3AE8B 2LJ5A 3DBLI 1YX6B 2GBRA 2C9WB 2GRIA 1PFDA 3AE2B 1KOTA 3OJ4B 3VAWA 5LLIA 1ROEA 2QJLA 1UH6A 5HKHA 2LFIA 2MP2A 4J6IA 1UWXA 2V9HA 2WXQA 2G3QB 4IWQA 3UIOB 3NS8A 2QEJC 2K8BA 2IO2B 4ZHPA 4A90A 1J19A 2KFJA 1F9JA 2LD9A 1P3QU 2VZKB 4MM3B 4I6LB 3PTFC 2JYTA 1TTNA 1BXTA 2KT7A 2BS2B 4M8NA 1TKGA 2D3BA 4KKJA 4MSQB 2DBYA 2UYZB 2G45B 3D32A 2LVQA 3RI7C 2IYDB 4RF1A 3AB5A 2V4LA 5I4DA 2WXGA 1WGRA 1SBBB 3ZXVA 4S17A 4CQNA 4WWMA 2PEAA 2I2YA 3PRPB 1FCCC 3ZGZA 1C78A 4KVGB 4KV2A 3UF8A 4Q2JA 1LGRA 3BWUD 2Y5CA 4W9CA 1V9JA 5HHDG 4H2AA 3P4QB 1EO6A 1NENB 2FUHB 2KQSA 1KRHA 2WXHA 1CQVA 2AEHA 4IOIE 4P1BC 4FHKA 2Z8LA 3OJ3A 3VUXA 1LO5D 2BWFA 5CHFA 3AE3B 4KZCA 1WWTA 2ZPYA 4WQMA 2UU7A 3PLUA 1YIWA 3E56A 3HUIA 1I4RA 2AQ3B 3IVFA 5C1ZA 4IKGA 5KHQA 2VH2A 2KAJA 3L17A 4DXFA 5BMIA 2K8CA 4FJYA 4ANXA 5CTRC 4W9EA 3RPFC 1NBFC 3ZNZB 4AJWA 5IP4D 3ZQ4A 2ZCCA 1VZ7A 1WI0A 3Q8EA 4B9KA 1WXQA 4N9F4 4GU2A 3VUWA 4GB9A 4EZKA 4ICVA 4EUTA 5JH5C 4IM2A 5IAAC 3CSTA 3VFKA 3DBRI 4NJ6A 2R61A 3WAPA 2SEBD 3NVZA 4G0NB 1QQRA 4PYUA 2IZVB 1TT5B 1I4GA 2CHWA 3P4RB 3ZUNA 1IGDA 1N62A 1WJ4A 2WXNA 3VH3B 4MELA 1UD7A 1UGJA 1OEYJ 4MACA 1WRIA 3Q6BA 1SB3C 1FM0D 4A8XC 3DPDA 2JY6A 4L2YA 1XT9B 2CU1A 3B2GA 1R4NI 4BBNC 1ZPSA 2JWUA 1ZW7A 2C7MB 3AULA 1FO4A 2XK5B 4X57B 4RMAA 2NTSA 2MBBB 1N60A 3VDZA 1JCKB 3IAS1 2BYFA 4WIPA 3VHTC 3ZDMC 1T5XD 3BYYB 4JQWC 1TS4A 2JX5A 1WJNA 2MX2A 2WXRA 1YQBA 3H7SA 2MBHA 3DWGC 4ZOHC 1JROA 1E7UA 3AE1B 1KLVA 2NMQA 2WXMA 2DX5B 3IBEA 2D11A 4A9AA 2KO3A 1QLBB 5E6PA 2Z0EB 1Y8RC 4C7YA 1C9FA 2WXOA 2MJEA 4JL9A 4XWTA 3LXFA 1SGHA 1QOAA 4GDKB 3V60A 5IA7A 3KW5B 3OWEB 1WRDB 4BVUC 4AJYB 4M01A 3EECA 3CF6E 3JSVB 5MPOA 4NAWB 3LYYA 3VVWB 3OLMD 2DNFA 2K6DB 4N6EB 2ZNVB 1NYQA 2CHXA 1KM7A 1WE7A 3DVNU 3LB8C 2W54A 1ZE3D 4P7IA 3GB1A 3ML9A 4RCOA 4ZDVA 1UZXB 4LNNA 2WS3B 1IP9A 4KGSA 3EFCA 2KYWA 1ET9A 1V97A 3J9CA 1B9RA 1WYGA 2RDGA 2WDVB 2N7JA 4MDKE 3UINB 4FJVB 2QIEB 3KH0A 2JZPA 1ZKHA 3N30A 3VR8B 3CMMB 1QOBA 2A4ZA 4JWUC 4ANVA 4NNJB 5JZEB 5G5GA 2XN9C 1WX7A 2LASA 2NTTA 3BYTB 3NS1A 3BK2A 2C5LC 2WHIA 3A9KA 1SXTA 3AV8A 5AZHA 4HJGE 2EMTA 4KGRA 5IN7A 1OFFA 5DCNA 3MTNB 3AN1A 4W9KA 1STEA 3SD5A 2J42A 4DHZB 3PVLA 4L1BA 1IYFA 4P1CC 1OTRB 5EE9A 2FCSA 1LXDA 3V05A 1XLOA 1C1YB 4KZ0A 5AZFA 2VZKD 1FRRA 4ANWA 1V5TA 4RFBA 1E0ZA 1ZUD2 1Y56A 2JWZA 4G50A 2KJ6A 3N3KB 4US8A 2ICIA 4MJSA 2D5GA 3L13A 1YN4A 5IOIA 4RM9A 3TBLD 4K7SA 3ZNGC 4TV3A 2HJ8A 2RR9A 2KACA 1V81A 3P63A 1YD8U 2ZW1A 2LHDA 2KX0A 5J17A 1V1PA 2I1JA 3Q14C 2O6VA 1WXAA 1GOZA 4OZBA 3GZNI 2FCMA 2NVUI 2BKRB 3BVMA 3I3TB 3HIZA 2KTRA 4FN2A 2W9NA 4MGKE 2N9KA 3R7QA 1FRDA 3BZDB 2IY0B 2L8JA 4KIKB 3BIID 4NZLB 4RF0A 1PGXA 3KVFB 4EFOA 2B3AA 1V49A 1QILA 2FE8A 5BMHA 2BWES 3PGEA 2AYOB 4S0RA 1WH3A 3AMZA 4B0MA 1QZEA 1M94A 3NRZA 4XZ4A 1WR6E 4YSYB 4AQ7A 2IO0B 1WGGA 2G4DB 2KLCA 2WYQA 3CSFA 3UI3A 2G1EA 3P4SB 3QHTA 4GDLA 1VRAB 4NJCA 1WSPA 2VRRB 1RWSA 4MT5A 3WALA 1ESFA 2NS5A 3T3NA 4E71A 1KTKA 2ZCBA 1UGMA 4J3OD 1F1HA 1ZOYB 4RNAA 1BUIC 4C4VA 3DVGY 2BS3B 1LFDA 2LVOA 2BYTA 1G6JA 1Q5WB 3MC9A 4LJPB 4LNKA 3B08A 1J7BA 4KX6B 1N61A 2RMMA 2LRUA 3RNBC 3AEFB 1UBQA 3Q3FA 3R66C 3N32A 3H6NA 2J52A 2OJWA 5J18A 2LRWA 5G5HA 2IGGA 4W9JA 1JRUA 3AEDB 4BKGA 1E5WA 2G4SA 4FHJA 5JHBA 3ZRCA 1UNSA 2MA9B 1CK1A 4HDOA 4HXDA 1D6EC 2MJ3A 2N9LA 3TL5A 1QOFA 1WR1A 3U8ZA 4LNFA 1XLQA 4BZAA 3ZJTA 3WA0A 4GN1A 2K9XA 3VTVA 4HPMB 2BKFA 2MH7A 3AE7B 2AL3A 1C4CA 4LDTB 3RD2A 2KWCA 3L08A 1OQYA 2IGDA 1R4MI 3K9PB 2CS4A 2I1KA 3PSEB 4D2KA 2M1MA 3SR6A 1TS2A 3RMKC 4O1NA 4W9FA 5LXHA 1J0GA 2KN5A 1JWAD 1TKEA 2PKOA 1QF6A 3RUIB 1XEEA 3APFA 4PS7A 3ETRA 2JU6X 2KQ7A 2LGSA 4BFRA 1FXIA 2ZVOA 4GIVA 4ZYNA 4DQOC 2W55A 1MJDA 2MSED 2CHZA 4XGAB 3RCZA 3WIMA 2K3UA 3AI5A 3N1XC 4M0WA 4YSZB 3U4EG 1P7FA 3TSSA 4PK1A 3DWMA 2BGFA 3OG5A 2W3SA 3T8MA 2PIAA 1E8WA 2FCNA 2YLMA 3R2IA 5HI1A 2L52A 4ITKA 1HZ5A 4HJKA 3HVDA 4XC2A 5AUIA 2REXA 2N9PC 1BMLC 1JW9D 3SFDB 4GMVA 2M19A 2WU2B 3PT2B 3APDA 3IT4B 3PRMB 3NZSA 2WDQB 2KVZA 2GBNA 2UWQA 3A1QA 3NVYA 1WM3A 1E7PB 2WX0A 4BKSD 5AZGA 1WFYA 4TQ0A 5E6JA 4WURA 1XO3A 2AL6A 2AQ2B 5BYSA 4C4VB 2BT6A 1GB4A 4ARCA 4DHJD 4C00A 2E3TA 1H8CA 1J7AA 3U2SC 2N7EA 4OW0A 1MG8A 3KWLA 2K6QA 3A33B 1K50A 2QDFA 2PLPA 4KSLC 1YN3A 1V1OA 2FIFA 2Y5BB 2MW5A 2D3GA 2WQYB 2LGIA 4WJQA 4HCPB 1E8YA 4ARIA 2WDRB 1EU3A 2IPKD 2KFKB 1TKYA 2NCNA 1IUEA 5H92C 3RNGC 4OZCA 1AW7A 2INCC 3FILA 4I6NB 1D5ZC 1D5XC 5C3JB 3DBRB 3ENEA 1WXVA 3RYTA 4UDUC 2LGDA 2OJRA 1WIAA 1OGWA 4ANUA 5AEKB 1Z2MA 3RNEC 1WZ0A 1YMHE 3C0RB 3ZNHB 2KNBA 3Q8BA 4DHZE 3AECB 2H88B 2FAZA 3L4PA 1L0XB 3AU5A 2DAFA 3DQVA 1NDDA 1R4NB 2MBOA 3JVZX 3HM3A 2K8HA 4WJPA 2DYBA 3QIJA 1ZGUB 2PVOD
chains in the Genus database with same CATH topology
3ML9A 4ZDVA 1UZXB 3DOWA 2BYEA 2JPHA 1LM8B 1IP9A 5D2MB 3DVNV 3V62A 4BKTA 3ZRFA 1HE8A 3EHVA 4LCDE 3BINA 3IG3A 4RM8A 2DZMA 4MDKE 3UINB 4FJVB 1GC6A 3DBSA 2O2VB 1ZKHA 3KH0A 3N30A 4FULA 3DBHI 4KDLB 3SU8X 1P98A 2WDTB 5D6JB 4A20A 2GBMA 3ZVVA 3CMMB 2A4ZA 2KWUB 4BOZB 4ANVA 5DPWA 4NNJB 1EUVB 5JZEB 1WX7A 2LASA 5DPSA 3M63B 2C5LC 1L7YA 3QQ8B 4IM3A 1E8ZA 2PE9A 4JIOU 3A9KA 4GDLB 5AZHA 2JF5A 3JYUA 2EMTA 1TGZB 1GJZA 5DCNA 3MTNB 4PS3A 4MEMA 4W9GA 2PPHA 4W9DA 4W9KA 3B1LX 4AUQC 1X1MA 4MGZE 3V6CB 3ZTDA 4FBJB 2LGXA 2N9EB 3SD5A 4FA6A 2ZZPB 3V6EB 3PVLA 4DHZB 3NY5A 4ASWC 1IYFA 2HTHA 3KUCB 2M17A 1OTRB 2MP2B 1D3ZA 2FCSA 1LXDA 3VH4B 5L95C 4G3XB 1U4AA 2MCNB 1C1YB 4KZ0A 4HLEA 3S2AA 2XK5A 3KYCD 3KYDD 5AZFA 2N9XA 4BKSA 4FADA 4MH0E 4A3PA 4I6PA 3QX1A 4ANWA 1ISNA 2LWPA 4IG7B 1WJ6A 1V5TA 4G11A 4IW0A 1YX5B 3QA8A 3NHEB 4II3B 1J8CA 2KKCA 3R3MA 1FXTB 2JWZA 2LXCA 2JUOA 4G50A 1LQBA 2JT4B 2KJ6A 2KX3A 3N3KB 4HVBA 1AARA 3LJ3A 4TKNA 5DPTA 1EF1A 4MJSA 1RLFA 3A9JA 3L13A 3TMPB 2L7RA 3PRZA 3MJWA 4RM9A 5LXIB 3TIXA 2NBVB 1GG3A 5BO4B 3PLVA 3TBLD 3DDCB 1UBIA 2J0JA 2DYMA 3A1QB 1WMHA 4K7SA 2ZNVC 4W9IA 3LDZE 3RZWC 2RSUA 2N1VA 2Z59B 4NQLB 2HJ8A 4TV3A 3ZNGC 4DBGA 5JHAA 2RR9A 4MGIE 4WJOA 5FR6A 2KFKA 2C7NB 3BY4B 1WYWB 3U30A 1V81A 3H7PA 2KTFA 1YD8U 2JRIB 2PE6B 3KUDB 3HM6X 1WJUA 3MHSD 2DAJA 1RRBA 2KX0A 3W1SC 5C23A 5J17A 2I1JA 2NPTA 5DPRA 2BYVE 2NR2A 2O6VA 3WAOA 1V5OA 1WXAA 2K39A 3WANA 3HK0A 2MBEA 4GDKA 3GZNI 4K81A 3SDLC 2FCMA 2DYOA 2C60A 5D7GA 2NVUI 3V61A 3OAWA 2BKRB 1WE6A 2BF8B 2LXAA 3L0WB 1XQQA 2L3ZA 3I3TB 3HIZA 3QC8B 4F1SA 2KTRA 4FN2A 2W9NA 4LDTD 4MGKE 3JSVA 4FLHA 3GOEA 2JRHA 4NAWA 3R7QA 2N7DA 1WZ3A 2IY0B 2L8JA 4KIKB 4NQKE 2A5UA 2IY1B 4OVVA 1VD2A 3KVFB 3TCAA 4EFOA 2B3AA 2KMAA 1V49A 3H1UA 2J7QB 2KC1A 2BWES 2KVRA 1XD3B 3DCGA 3PGEA 4GGQA 1IPGA 5CHWA 1E8XA 2AYOB 2AWTA 4DXAB 1S3SG 4EOYA 4IM0A 3W1SA 2HE7A 1WH3A 4EZJA 2KDEB 1QZEA 4P7IA 1M94A 4XZ4A 2O2VA 5GMVA 3ZDTA 2EMSA 2KD0A 3UQBA 1WR6E 4WWNA 2IO0B 1WGGA 2J0MA 2JVCA 4GOCA 1WM2A 2G4DB 2KLCA 4YL8A 2WYQA 5G55A 4EEWA 1RAXA 2Z0DB 3CSFA 3L10B 3UGBB 1RFAA 3JW0X 4WWPA 3VTWA 1SE9A 2DHZA 4IWOA 2KZRA 2MRPA 1WGYA 2EKEC 2KMCA 3QHTA 4HWIB 3QJZA 4XX5A 5KHOA 1PQSA 4GDLA 2YVCA 2LJ5A 3VTUA 3DBLI 3ZKJC 1YX6B 4NPNA 2GBRA 2C9WB 2VRRB 1A5RA 1KOTA 3OJ4B 2M4NA 3WALA 2NS5A 3VAWA 5LLIA 1UH6A 4JGHB 5HKHA 4M0WB 3X0WA 4E71A 1E7VA 2MP2A 2D10A 4J6IA 2ZCBA 3QCAA 2KC2A 3QARA 3VQIA 1UGMA 3ZLZA 5E6OA 2G3QB 4IWQA 3UIOB 3NS8A 3DVGY 1BT0A 2MQJA 2K8BA 2V3SA 1LFDA 2IO2B 2LVOA 2ZVNA 4KDIC 1V80A 4M8MA 4MSMB 3NOBA 1J19A 1G6JA 2MLBA 1Q5WB 4LJPB 3W1YA 3B08A 1WXSA 4A3OA 2KK8A 5CHVC 2N4FA 2KXJA 3T9LA 2KFJA 1WGDA 1F9JA 4HDQA 2LD9A 2K1FA 1EF5A 1P3QU 2KDFB 2LRUA 2LI5A 3U7DA 1WY8A 2C7HA 1K8RB 1UBQA 4IUMB 1T0YA 4I6LB 3Q3FA 3R66C 3PTFC 1P0RA 3N32A 1TTNA 4B95A 3ECIA 3H6NA 3NZUA 4URKA 5J18A 2LRWA 2ZEQA 2ZJDA 2GOWA 3KUZA 3UIPB 1TZ1A 4M8NA 4W9JA 1JRUA 4WWOA 4BKGA 4MSQB 1E5WA 2G4SA 4FHJA 3IFWB 2UYZB 2G45B 5JHBA 3D32A 4DWFA 2LVQA 2NBUA 3VUYA 4AOFA 2GMIC 2KDBA 2IYDB 3AU4A 4ZRIA 2V4LA 3A4RA 4K7WA 3ZRCA 3TJPA 2MA9B 1WGRA 4HDOA 4HXDA 2J0KA 2KWVB 2KOXA 1UELA 2FNJB 2LUEA 5G2NA 2DENB 3Q3JA 2MBQA 2QHOA 2DZIA 3ZW3A 2PEAA 3TL5A 3PRPB 1GNUA 1WR1A 4KVGB 4KV2A 3SHQA 1WXMA 1KJTA 3UF8A 3A4SC 3U8ZA 4EZLA 4W9CA 1GC7A 3WAMA 1WF9A 1V9JA 3AXCA 2PJHA 2L00B 4KIKA 1YJ1A 1EO6A 2CR5A 4GN1A 3WA0A 3VTVA 2FUHB 2KQSA 4HPMB 2RPQA 2BKFA 2LGYA 2O6VD 2AEHA 2KANA 3ZNID 4FHKA 3OJ3A 3VUXA 2AL3A 4IWPA 4LDTB 3RD2A 4F7ZA 2BWFA 2KWCA 3L08A 5CHFA 1CMXB 1OQYA 3QAQA 1R4MI 3K9PB 4KZCA 2CS4A 2I1KA 2ZPYA 3PSEB 2JZZA 3UQAA 2M1MA 1I42A 2IBIB 3PLUA 2BPSA 4W9FA 1SIFA 5LXHA 1C3TA 1YIWA 4F8CB 1J0GA 2KN5A 2JZ3B 2M0XA 3K9OB 3RUIB 4PYZA 3APFA 4KSKC 4PS7A 3IVFA 2KQ7A 2XEWA 2CKHB 1NI2A 5C1ZA 4BFRA 2ZVOA 4GIVA 5KHQA 4ZYNA 3PZDA 1Q0WB 4NY0A 2MSED 2CHZA 3L17A 2K8CA 4FJYA 2NBWB 3RCZA 3WIMA 4ANXA 4AWJA 4ZRJA 3AI5A 5CTRC 4W9EA 4BOSC 2HD5B 3O65B 1NBFC 1H4RA 3ZNZB 4ICUA 4AJWA 3PHXB 2ASQA 5EDSA 2ZCCA 2M8SA 2N1WA 3QK0A 1WI0A 2FCQA 4B9KA 2BGFA 2MWSB 4N9F4 2IO3B 2OOBB 4GU2A 4GXBA 3T8MA 3L16A 4ZRKA 3RT3B 3VUWA 2L0TA 3EFUA 3HHMA 3P2BA 1OEYA 1E8WA 1P1AA 4GB9A 2FCNA 2YLMA 4HPLB 4ICVA 4EUTA 3QWZB 4EZKA 4IM2A 5IAAC 4K1RB 3ZTCA 5JH5C 1I35A 3CSTA 2L76A 1WX8A 4HJKA 3VFKA 3DBRI 4NJ6A 4XC2A 1P9DU 2REXA 3WAPA 2RD0A 2N9PC 4G0NB 1V2YA 2ZPNA 4PYUA 4IC7B 3PREA 4GMVA 4HCNB 2LZ6A 3PT2B 2IZVB 3APDA 4MM3A 3A9KB 4WAAA 2CHWA 3RZFA 4CYEA 2GBKA 3ZUNA 3PRMB 3NZSA 4II2B 1WJ4A 4CO7A 2K25A 2LVPA 1E90A 2GBNA 2UWQA 4MELA 1UD7A 3VH3B 2L05A 3PS6A 4E3CA 1OEYJ 3A1QA 1WM3A 2WX0A 4BKSD 3ALBA 3DPDA 2JY6A 5AZGA 1WFYA 4TQ1A 1XT9B 2RGFA 3IHPC 2CU1A 3ONSA 4TQ0A 1R4NI 4BBNC 2AL6A 1ZW7A 3M95A 2C7MB 3AULA 2XK5B 4X57B 4DHJD 1TBEA 4RMAA 2MBBB 2KJRA 2WWZA 1H8CA 4K7UA 3VDZA 2R2OA 2IO1B 5J2RA 2BYFA 2N7EA 3X23A 1MG8A 1Q1OA 4OVUA 3VHTC 2K6QA 3A33B 4E74A 3ZDMC 4DHJB 5CX3A 2DZKA 4AP4C 4JQWC 4DDID 3M3JA 4KSLC 2MX2A 1WJNA 4B6WA 1YQBA 4MJSB 2FIFA 1WGHA 3H7SA 2Y5BB 2MW5A 3A9JB 4JLCA 2MBHA 4LJOB 4CHKA 2D3GA 1E7UA 4WJQA 1S1QB 4HCPB 1E8YA 3ML8A 1KLVA 1WMHB 4GSWA 2DX5B 3IBEA 4W9HA 2KFKB 3EC8A 2JXXA 2D11A 1V86A 2KO3A 2NCNA 3ZO5B 2KJHB 3H7PB 5E6PA 2Z0EB 4HK2A 1Y8RC 4PS8A 4I6NB 3PPAA 3ENEA 2KDIA 1WXVA 4JL9A 3RYTA 1L2NA 2KLGA 2LGDA 2GBJA 2NPTB 3PV1A 4DK5A 4EKUA 3VXWA 1GUAB 3PHWB 2OJRA 2D2QA 3R7RA 1SGHA 2O6VB 1WIAA 3M62B 4FJZA 1OGWA 5E6NA 4ANUA 2V1YA 5AEKB 3DVGX 1Z2MA 4BBNF 4GDKB 1WX9A 4WQOB 1WZ0A 3V60A 3RULA 3APCA 2WX1A 5IA7A 1V6EA 3KW5B 3C0RB 4NJ7A 3L54A 4MGYE 3ZNHB 5L83A 5D94A 1WRDB 2KNBA 4DHZE 4BVUC 4AJYB 1VCBA 2KHWB 2R2QA 3CF6E 3EECA 2KTRB 2L0FA 1Z5SB 2FAZA 3JSVB 4NAWB 4W9LA 3VVWB 3OLMD 2DZJA 4WJNA 4TUUA 3AU5A 2DAFA 2K6DB 3DQVA 1NDDA 2MBOA 2XBBC 2ZNVB 3JVZX 3H9DA 3HM3A 2CHXA 2D07B 1KM7A 1WE7A 2K8HA 2FIDA 3DVNU 4WJPA 2DYBA 5TR5A 3B0AA 3ZIMA 3QIJA 1ZGUB 4DDGD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ML9 A;  4ZDV A;  1UZX B;  3DOW A;  2BYE A;  2JPH A;  1LM8 B;  1IP9 A;  5D2M B;  3DVN V;  3V62 A;  4BKT A;  3ZRF A;  1HE8 A;  3EHV A;  4LCD E;  3BIN A;  3IG3 A;  4RM8 A;  2DZM A;  4MDK E;  3UIN B;  4FJV B;  1GC6 A;  3DBS A;  2O2V B;  1ZKH A;  3KH0 A;  3N30 A;  4FUL A;  3DBH I;  4KDL B;  3SU8 X;  1P98 A;  2WDT B;  5D6J B;  4A20 A;  2GBM A;  3ZVV A;  3CMM B;  2A4Z A;  2KWU B;  4BOZ B;  4ANV A;  5DPW A;  4NNJ B;  1EUV B;  5JZE B;  1WX7 A;  2LAS A;  5DPS A;  3M63 B;  2C5L C;  1L7Y A;  3QQ8 B;  4IM3 A;  1E8Z A;  2PE9 A;  4JIO U;  3A9K A;  4GDL B;  5AZH A;  2JF5 A;  3JYU A;  2EMT A;  1TGZ B;  1GJZ A;  5DCN A;  3MTN B;  4PS3 A;  4MEM A;  4W9G A;  2PPH A;  4W9D A;  4W9K A;  3B1L X;  4AUQ C;  1X1M A;  4MGZ E;  3V6C B;  3ZTD A;  4FBJ B;  2LGX A;  2N9E B;  3SD5 A;  4FA6 A;  2ZZP B;  3V6E B;  3PVL A;  4DHZ B;  3NY5 A;  4ASW C;  1IYF A;  2HTH A;  3KUC B;  2M17 A;  1OTR B;  2MP2 B;  1D3Z A;  2FCS A;  1LXD A;  3VH4 B;  5L95 C;  4G3X B;  1U4A A;  2MCN B;  1C1Y B;  4KZ0 A;  4HLE A;  3S2A A;  2XK5 A;  3KYC D;  3KYD D;  5AZF A;  2N9X A;  4BKS A;  4FAD A;  4MH0 E;  4A3P A;  4I6P A;  3QX1 A;  4ANW A;  1ISN A;  2LWP A;  4IG7 B;  1WJ6 A;  1V5T A;  4G11 A;  4IW0 A;  1YX5 B;  3QA8 A;  3NHE B;  4II3 B;  1J8C A;  2KKC A;  3R3M A;  1FXT B;  2JWZ A;  2LXC A;  2JUO A;  4G50 A;  1LQB A;  2JT4 B;  2KJ6 A;  2KX3 A;  3N3K B;  4HVB A;  1AAR A;  3LJ3 A;  4TKN A;  5DPT A;  1EF1 A;  4MJS A;  1RLF A;  3A9J A;  3L13 A;  3TMP B;  2L7R A;  3PRZ A;  3MJW A;  4RM9 A;  5LXI B;  3TIX A;  2NBV B;  1GG3 A;  5BO4 B;  3PLV A;  3TBL D;  3DDC B;  1UBI A;  2J0J A;  2DYM A;  3A1Q B;  1WMH A;  4K7S A;  2ZNV C;  4W9I A;  3LDZ E;  3RZW C;  2RSU A;  2N1V A;  2Z59 B;  4NQL B;  2HJ8 A;  4TV3 A;  3ZNG C;  4DBG A;  5JHA A;  2RR9 A;  4MGI E;  4WJO A;  5FR6 A;  2KFK A;  2C7N B;  3BY4 B;  1WYW B;  3U30 A;  1V81 A;  3H7P A;  2KTF A;  1YD8 U;  2JRI B;  2PE6 B;  3KUD B;  3HM6 X;  1WJU A;  3MHS D;  2DAJ A;  1RRB A;  2KX0 A;  3W1S C;  5C23 A;  5J17 A;  2I1J A;  2NPT A;  5DPR A;  2BYV E;  2NR2 A;  2O6V A;  3WAO A;  1V5O A;  1WXA A;  2K39 A;  3WAN A;  3HK0 A;  2MBE A;  4GDK A;  3GZN I;  4K81 A;  3SDL C;  2FCM A;  2DYO A;  2C60 A;  5D7G A;  2NVU I;  3V61 A;  3OAW A;  2BKR B;  1WE6 A;  2BF8 B;  2LXA A;  3L0W B;  1XQQ A;  2L3Z A;  3I3T B;  3HIZ A;  3QC8 B;  4F1S A;  2KTR A;  4FN2 A;  2W9N A;  4LDT D;  4MGK E;  3JSV A;  4FLH A;  3GOE A;  2JRH A;  4NAW A;  3R7Q A;  2N7D A;  1WZ3 A;  2IY0 B;  2L8J A;  4KIK B;  4NQK E;  2A5U A;  2IY1 B;  4OVV A;  1VD2 A;  3KVF B;  3TCA A;  4EFO A;  2B3A A;  2KMA A;  1V49 A;  3H1U A;  2J7Q B;  2KC1 A;  2BWE S;  2KVR A;  1XD3 B;  3DCG A;  3PGE A;  4GGQ A;  1IPG A;  5CHW A;  1E8X A;  2AYO B;  2AWT A;  4DXA B;  1S3S G;  4EOY A;  4IM0 A;  3W1S A;  2HE7 A;  1WH3 A;  4EZJ A;  2KDE B;  1QZE A;  4P7I A;  1M94 A;  4XZ4 A;  2O2V A;  5GMV A;  3ZDT A;  2EMS A;  2KD0 A;  3UQB A;  1WR6 E;  4WWN A;  2IO0 B;  1WGG A;  2J0M A;  2JVC A;  4GOC A;  1WM2 A;  2G4D B;  2KLC A;  4YL8 A;  2WYQ A;  5G55 A;  4EEW A;  1RAX A;  2Z0D B;  3CSF A;  3L10 B;  3UGB B;  1RFA A;  3JW0 X;  4WWP A;  3VTW A;  1SE9 A;  2DHZ A;  4IWO A;  2KZR A;  2MRP A;  1WGY A;  2EKE C;  2KMC A;  3QHT A;  4HWI B;  3QJZ A;  4XX5 A;  5KHO A;  1PQS A;  4GDL A;  2YVC A;  2LJ5 A;  3VTU A;  3DBL I;  3ZKJ C;  1YX6 B;  4NPN A;  2GBR A;  2C9W B;  2VRR B;  1A5R A;  1KOT A;  3OJ4 B;  2M4N A;  3WAL A;  2NS5 A;  3VAW A;  5LLI A;  1UH6 A;  4JGH B;  5HKH A;  4M0W B;  3X0W A;  4E71 A;  1E7V A;  2MP2 A;  2D10 A;  4J6I A;  2ZCB A;  3QCA A;  2KC2 A;  3QAR A;  3VQI A;  1UGM A;  3ZLZ A;  5E6O A;  2G3Q B;  4IWQ A;  3UIO B;  3NS8 A;  3DVG Y;  1BT0 A;  2MQJ A;  2K8B A;  2V3S A;  1LFD A;  2IO2 B;  2LVO A;  2ZVN A;  4KDI C;  1V80 A;  4M8M A;  4MSM B;  3NOB A;  1J19 A;  1G6J A;  2MLB A;  1Q5W B;  4LJP B;  3W1Y A;  3B08 A;  1WXS A;  4A3O A;  2KK8 A;  5CHV C;  2N4F A;  2KXJ A;  3T9L A;  2KFJ A;  1WGD A;  1F9J A;  4HDQ A;  2LD9 A;  2K1F A;  1EF5 A;  1P3Q U;  2KDF B;  2LRU A;  2LI5 A;  3U7D A;  1WY8 A;  2C7H A;  1K8R B;  1UBQ A;  4IUM B;  1T0Y A;  4I6L B;  3Q3F A;  3R66 C;  3PTF C;  1P0R A;  3N32 A;  1TTN A;  4B95 A;  3ECI A;  3H6N A;  3NZU A;  4URK A;  5J18 A;  2LRW A;  2ZEQ A;  2ZJD A;  2GOW A;  3KUZ A;  3UIP B;  1TZ1 A;  4M8N A;  4W9J A;  1JRU A;  4WWO A;  4BKG A;  4MSQ B;  1E5W A;  2G4S A;  4FHJ A;  3IFW B;  2UYZ B;  2G45 B;  5JHB A;  3D32 A;  4DWF A;  2LVQ A;  2NBU A;  3VUY A;  4AOF A;  2GMI C;  2KDB A;  2IYD B;  3AU4 A;  4ZRI A;  2V4L A;  3A4R A;  4K7W A;  3ZRC A;  3TJP A;  2MA9 B;  1WGR A;  4HDO A;  4HXD A;  2J0K A;  2KWV B;  2KOX A;  1UEL A;  2FNJ B;  2LUE A;  5G2N A;  2DEN B;  3Q3J A;  2MBQ A;  2QHO A;  2DZI A;  3ZW3 A;  2PEA A;  3TL5 A;  3PRP B;  1GNU A;  1WR1 A;  4KVG B;  4KV2 A;  3SHQ A;  1WXM A;  1KJT A;  3UF8 A;  3A4S C;  3U8Z A;  4EZL A;  4W9C A;  1GC7 A;  3WAM A;  1WF9 A;  1V9J A;  3AXC A;  2PJH A;  2L00 B;  4KIK A;  1YJ1 A;  1EO6 A;  2CR5 A;  4GN1 A;  3WA0 A;  3VTV A;  2FUH B;  2KQS A;  4HPM B;  2RPQ A;  2BKF A;  2LGY A;  2O6V D;  2AEH A;  2KAN A;  3ZNI D;  4FHK A;  3OJ3 A;  3VUX A;  2AL3 A;  4IWP A;  4LDT B;  3RD2 A;  4F7Z A;  2BWF A;  2KWC A;  3L08 A;  5CHF A;  1CMX B;  1OQY A;  3QAQ A;  1R4M I;  3K9P B;  4KZC A;  2CS4 A;  2I1K A;  2ZPY A;  3PSE B;  2JZZ A;  3UQA A;  2M1M A;  1I42 A;  2IBI B;  3PLU A;  2BPS A;  4W9F A;  1SIF A;  5LXH A;  1C3T A;  1YIW A;  4F8C B;  1J0G A;  2KN5 A;  2JZ3 B;  2M0X A;  3K9O B;  3RUI B;  4PYZ A;  3APF A;  4KSK C;  4PS7 A;  3IVF A;  2KQ7 A;  2XEW A;  2CKH B;  1NI2 A;  5C1Z A;  4BFR A;  2ZVO A;  4GIV A;  5KHQ A;  4ZYN A;  3PZD A;  1Q0W B;  4NY0 A;  2MSE D;  2CHZ A;  3L17 A;  2K8C A;  4FJY A;  2NBW B;  3RCZ A;  3WIM A;  4ANX A;  4AWJ A;  4ZRJ A;  3AI5 A;  5CTR C;  4W9E A;  4BOS C;  2HD5 B;  3O65 B;  1NBF C;  1H4R A;  3ZNZ B;  4ICU A;  4AJW A;  3PHX B;  2ASQ A;  5EDS A;  2ZCC A;  2M8S A;  2N1W A;  3QK0 A;  1WI0 A;  2FCQ A;  4B9K A;  2BGF A;  2MWS B;  4N9F 4;  2IO3 B;  2OOB B;  4GU2 A;  4GXB A;  3T8M A;  3L16 A;  4ZRK A;  3RT3 B;  3VUW A;  2L0T A;  3EFU A;  3HHM A;  3P2B A;  1OEY A;  1E8W A;  1P1A A;  4GB9 A;  2FCN A;  2YLM A;  4HPL B;  4ICV A;  4EUT A;  3QWZ B;  4EZK A;  4IM2 A;  5IAA C;  4K1R B;  3ZTC A;  5JH5 C;  1I35 A;  3CST A;  2L76 A;  1WX8 A;  4HJK A;  3VFK A;  3DBR I;  4NJ6 A;  4XC2 A;  1P9D U;  2REX A;  3WAP A;  2RD0 A;  2N9P C;  4G0N B;  1V2Y A;  2ZPN A;  4PYU A;  4IC7 B;  3PRE A;  4GMV A;  4HCN B;  2LZ6 A;  3PT2 B;  2IZV B;  3APD A;  4MM3 A;  3A9K B;  4WAA A;  2CHW A;  3RZF A;  4CYE A;  2GBK A;  3ZUN A;  3PRM B;  3NZS A;  4II2 B;  1WJ4 A;  4CO7 A;  2K25 A;  2LVP A;  1E90 A;  2GBN A;  2UWQ A;  4MEL A;  1UD7 A;  3VH3 B;  2L05 A;  3PS6 A;  4E3C A;  1OEY J;  3A1Q A;  1WM3 A;  2WX0 A;  4BKS D;  3ALB A;  3DPD A;  2JY6 A;  5AZG A;  1WFY A;  4TQ1 A;  1XT9 B;  2RGF A;  3IHP C;  2CU1 A;  3ONS A;  4TQ0 A;  1R4N I;  4BBN C;  2AL6 A;  1ZW7 A;  3M95 A;  2C7M B;  3AUL A;  2XK5 B;  4X57 B;  4DHJ D;  1TBE A;  4RMA A;  2MBB B;  2KJR A;  2WWZ A;  1H8C A;  4K7U A;  3VDZ A;  2R2O A;  2IO1 B;  5J2R A;  2BYF A;  2N7E A;  3X23 A;  1MG8 A;  1Q1O A;  4OVU A;  3VHT C;  2K6Q A;  3A33 B;  4E74 A;  3ZDM C;  4DHJ B;  5CX3 A;  2DZK A;  4AP4 C;  4JQW C;  4DDI D;  3M3J A;  4KSL C;  2MX2 A;  1WJN A;  4B6W A;  1YQB A;  4MJS B;  2FIF A;  1WGH A;  3H7S A;  2Y5B B;  2MW5 A;  3A9J B;  4JLC A;  2MBH A;  4LJO B;  4CHK A;  2D3G A;  1E7U A;  4WJQ A;  1S1Q B;  4HCP B;  1E8Y A;  3ML8 A;  1KLV A;  1WMH B;  4GSW A;  2DX5 B;  3IBE A;  4W9H A;  2KFK B;  3EC8 A;  2JXX A;  2D11 A;  1V86 A;  2KO3 A;  2NCN A;  3ZO5 B;  2KJH B;  3H7P B;  5E6P A;  2Z0E B;  4HK2 A;  1Y8R C;  4PS8 A;  4I6N B;  3PPA A;  3ENE A;  2KDI A;  1WXV A;  4JL9 A;  3RYT A;  1L2N A;  2KLG A;  2LGD A;  2GBJ A;  2NPT B;  3PV1 A;  4DK5 A;  4EKU A;  3VXW A;  1GUA B;  3PHW B;  2OJR A;  2D2Q A;  3R7R A;  1SGH A;  2O6V B;  1WIA A;  3M62 B;  4FJZ A;  1OGW A;  5E6N A;  4ANU A;  2V1Y A;  5AEK B;  3DVG X;  1Z2M A;  4BBN F;  4GDK B;  1WX9 A;  4WQO B;  1WZ0 A;  3V60 A;  3RUL A;  3APC A;  2WX1 A;  5IA7 A;  1V6E A;  3KW5 B;  3C0R B;  4NJ7 A;  3L54 A;  4MGY E;  3ZNH B;  5L83 A;  5D94 A;  1WRD B;  2KNB A;  4DHZ E;  4BVU C;  4AJY B;  1VCB A;  2KHW B;  2R2Q A;  3CF6 E;  3EEC A;  2KTR B;  2L0F A;  1Z5S B;  2FAZ A;  3JSV B;  4NAW B;  4W9L A;  3VVW B;  3OLM D;  2DZJ A;  4WJN A;  4TUU A;  3AU5 A;  2DAF A;  2K6D B;  3DQV A;  1NDD A;  2MBO A;  2XBB C;  2ZNV B;  3JVZ X;  3H9D A;  3HM3 A;  2CHX A;  2D07 B;  1KM7 A;  1WE7 A;  2K8H A;  2FID A;  3DVN U;  4WJP A;  2DYB A;  5TR5 A;  3B0A A;  3ZIM A;  3QIJ A;  1ZGU B;  4DDG D; 
#chains in the Genus database with same CATH topology
 3DOW A;  4ZRQ A;  2BYE A;  4P6V F;  2JPH A;  5D2M B;  1SE2 A;  1TIF A;  3O13 A;  3V62 A;  2N0S B;  4XYC A;  3IG3 A;  4RM8 A;  2MEK A;  1IBX B;  2O2V B;  3DBH I;  4A20 A;  2GBM A;  5HG2 A;  4C7Z A;  2KWU B;  4BOZ B;  4EE2 A;  3I9V 1;  4RGM A;  1YQ3 B;  1JWM D;  2WU5 B;  3HRD D;  4JPS A;  2BB5 A;  4K3B A;  4W9D A;  3GP7 A;  2W82 A;  1VLB A;  1L5P A;  3ZTD A;  4FA6 A;  1AN8 A;  3NY5 A;  2MP2 B;  3VH4 B;  4KKI A;  4G3X B;  1U4A A;  4BKS A;  1SJH D;  1UF0 A;  4A3P A;  4I6P A;  3QX1 A;  4ZHO A;  1ISN A;  1WJ6 A;  4IW0 A;  4HEA 1;  3RNA C;  1J8C A;  1C77 A;  2KKC A;  1FXT B;  3V3X A;  1AAR A;  3BVG A;  3A9J A;  3RFZ B;  3TMP B;  1FFV A;  3PLV A;  3DDC B;  1UBI A;  3A1Q B;  1WMH A;  4ZYS A;  1FNU A;  3RZW C;  2RSU A;  1PDX A;  2N1V A;  3N9Y C;  4NQL B;  4PT5 A;  5FK9 C;  1DOY A;  2PTL A;  1C4P A;  3H7P A;  2JRI B;  3KUD B;  1VR9 A;  2DAJ A;  3I57 A;  4RGN A;  1ENF A;  5C23 A;  3CIR B;  2NPT A;  5DPR A;  2BYV E;  2G9H D;  2K39 A;  2Y3A A;  1NEK B;  3WAN A;  1D5M C;  2MBE A;  2DYO A;  2C60 A;  5D7G A;  3L0W B;  1XQQ A;  1ACC A;  4LDT D;  2N7D A;  3VR9 B;  1N5W A;  4K3C A;  1UWM A;  2IY1 B;  1M4V A;  1VD2 A;  3TCA A;  2J7Q B;  1SEB D;  2IGH A;  4GGQ A;  1IPG A;  3MP9 A;  5CHW A;  2EKI A;  3SFE B;  1S3S G;  4EOY A;  3AEG B;  4IM0 A;  2KQ4 X;  1HTQ A;  2KDE B;  3ZDT A;  2X38 A;  2KD0 A;  1T0S C;  2LEK A;  4WWN A;  4YL8 A;  4EEW A;  1KF6 B;  4WAF A;  1RAX A;  3UGB B;  3L10 B;  4WWP A;  2BTE A;  1WGY A;  4XDC A;  4XX5 A;  2KMC A;  4QAY A;  5KHO A;  3ABV B;  4LLG M;  3Q3O C;  2WLB A;  1HQR D;  1KLU D;  2BB6 A;  1B1Z A;  2RPV A;  3VTU A;  2QC8 A;  3ZKJ C;  1L6U A;  1QT9 A;  2M4N A;  4JGH B;  1E6E B;  3SEB A;  3X0W A;  2W3R A;  2D10 A;  3QCA A;  2KC2 A;  3QAR A;  2JYE A;  5E6O A;  1L4Z B;  3DHH C;  3PZ8 A;  3W9C B;  4JWS C;  3NUH B;  3RNF C;  2ZVN A;  4M8M A;  4KDI C;  4MSM B;  2MLB A;  3W1Y A;  4HRO A;  1V8C A;  1WXS A;  3NZ3 A;  4A3O A;  2KK8 A;  2IND C;  1FXA A;  4YT0 B;  3AM9 A;  5CHV C;  2KXJ A;  3T9L A;  1WGD A;  3W5U B;  2K1F A;  2KDF B;  2LI5 A;  4C80 A;  4TMA B;  1WY8 A;  1K8R B;  1T0Y A;  4YWG G;  4B95 A;  3MC8 A;  4URK A;  3GE8 C;  3UIP B;  4YTP B;  2HDE A;  1ZDV A;  4WWO A;  2FUG 1;  2KMM A;  4OVZ A;  3H8H A;  2V0G A;  4DWF A;  2JSV X;  2NBU A;  4M02 A;  2KDB A;  3AU4 A;  4ZRI A;  5AUK A;  4K7W A;  3RNC C;  2J0K A;  1CZP A;  1MHH E;  1UEL A;  1JAL A;  2MBQ A;  2QHO A;  2LJI A;  3SHQ A;  1KJT A;  3A4S C;  4EZL A;  1GC7 A;  3WAM A;  1WF9 A;  2L00 B;  5GXG B;  4N59 A;  1ZDX A;  2WXJ A;  4NAM A;  1NVI D;  4XWW A;  4IWP A;  1PUT A;  2BVC A;  4F7Z A;  1CMX B;  1JRP A;  2Y5P A;  2V4I B;  1KFY B;  3UQA A;  1N5X A;  2QIL A;  1I42 A;  1EU4 A;  2BPS A;  1SIF A;  1C3T A;  4F8C B;  1FIQ A;  2JZ3 B;  4KSK C;  4USA A;  2LHE A;  2XEW A;  2BW2 A;  3MJ5 A;  4P16 A;  1MFW A;  4BOS C;  3O65 B;  3URY A;  2M8S A;  1FFU A;  2IJ0 A;  2FCQ A;  2CJN A;  3IT6 B;  5EE0 A;  2OOB B;  1JWS D;  3L16 A;  3RT3 B;  2V3N A;  1OEY A;  2E6X A;  2D3C A;  3FC4 A;  1I35 A;  1WX8 A;  4HRS A;  3BVZ A;  3MFG A;  3B2F A;  1V2Y A;  2ZPN A;  1MHX A;  4IC7 B;  2INP E;  4MM3 A;  4ZRP A;  3A9K B;  4CYE A;  4CO7 A;  2LVP A;  2LUM A;  4E3C A;  2FBW B;  2K0P A;  2L05 A;  1KLG D;  2RGF A;  3IHP C;  2H89 B;  1HTO A;  2B76 B;  2KJR A;  2WWZ A;  2TSS A;  5TSS A;  2R2O A;  2IO1 B;  5J2R A;  3X23 A;  4OVU A;  2QMT A;  4XE0 A;  1IGC A;  4AP4 C;  4DDI D;  3M3J A;  2AQ1 B;  3MHZ A;  4AS1 A;  3RN9 C;  4MJS B;  1WGH A;  4LJO B;  2EEL A;  4CHK A;  1SJE D;  3DBL B;  5T8I A;  1S1Q B;  2WXF A;  3ML8 A;  3AE9 B;  1T6B X;  4W9H A;  2JXX A;  2KJH B;  4HK2 A;  5H8Y E;  4PS8 A;  2MHJ A;  3U52 E;  3PPA A;  1VZ8 A;  4GLS C;  2KDI A;  1V1P B;  1SSN A;  4DK5 A;  2O6V B;  5E6N A;  2V1Y A;  1C76 A;  4BBN F;  1WX9 A;  3B9J A;  3APC A;  2WX1 A;  1V6E A;  4NJ7 A;  3L54 A;  4MGY E;  5L83 A;  4REZ A;  2QCZ A;  1VCB A;  2KHW B;  2R2Q A;  2L83 A;  2WXI A;  1C79 A;  2KTR B;  2L0F A;  4W9L A;  4DXG A;  1JWB D;  2XBB C;  3H9D A;  3ZIM A;  3B0A A;  2J53 A;  4DDG D;  4M00 A;  3VRA B;  1L6V A;  3DVN V;  2YEP F;  2RDH A;  2BS4 B;  3ZRF A;  3AE5 B;  4LCD E;  3NJT A;  1C4A A;  2WXP A;  1N6Z A;  3SU8 X;  3ZVV A;  3P42 A;  2L32 A;  2BQQ A;  3C19 A;  1L7Y A;  3QQ8 B;  4IM3 A;  1E8Z A;  2PE9 A;  1F2R I;  4GDL B;  2JF5 A;  3JYU A;  1I4P A;  1HZ6 A;  1TGZ B;  1GJZ A;  1AWD A;  1TJE A;  4LK0 M;  4MEM A;  1TS5 A;  1QOG A;  2Q5W D;  3WCQ A;  4AUQ C;  1X1M A;  3Q8F A;  3V6C B;  2M56 B;  3EGR A;  4WH4 A;  4IDI A;  2HTH A;  3KUC B;  3GE3 C;  3TEY A;  3CWI A;  3AE6 B;  2MCN B;  3S2A A;  2XK5 A;  3KYC D;  3KYD D;  2V3P A;  4MH0 E;  2LWP A;  4IG7 B;  4LTU A;  3FKY A;  3QA8 A;  3NHE B;  4II3 B;  5FKA C;  5FR3 A;  3KLS X;  2KX3 A;  4HVB A;  4TKN A;  5DPT A;  1FMA D;  3PZ7 A;  3PRZ A;  3MJW A;  3NVW A;  3TIX A;  2NBV B;  2J0J A;  4A55 A;  3N1Z C;  2ZNV C;  3LDZ E;  2Z59 B;  5JHA A;  4DBG A;  4MGI E;  1YOV B;  1OQQ A;  2C7N B;  3U30 A;  2PE6 B;  1HXY D;  1WJU A;  3DBH B;  1RRB A;  3W1S C;  3P1M A;  4MH8 A;  4HKZ E;  1RFK A;  4YSX B;  2NR2 A;  3HK0 A;  4GDK A;  4K81 A;  1JML A;  3IAM 1;  2KDM A;  2LMC A;  2LXA A;  1GPX A;  5EE1 A;  2L3Z A;  3QC8 B;  4F1S A;  3JSV A;  4FLH A;  2J4X A;  1E10 A;  3Q3M C;  1JQ4 A;  4NAW A;  4NQK E;  2D3A A;  5HFY A;  4KGT A;  2KC1 A;  1YNT E;  1RYJ A;  1XD3 B;  2KVR A;  2BBC A;  2AWT A;  4DXA B;  3W1S A;  4EZJ A;  3VRB B;  5GMV A;  3KQ4 A;  1MI0 A;  3KWV A;  2J0M A;  5IKC M;  1WM2 A;  1FNV A;  1XCQ L;  1RFA A;  3JW0 X;  1SE9 A;  2DHZ A;  2MRP A;  3QJZ A;  1PQS A;  2YVC A;  2ON8 A;  4NPN A;  2IDY A;  1A5R A;  2M0A A;  1T0Q C;  1FNW A;  1PYW D;  4M0W B;  1E7V A;  1VJK A;  1CJE A;  1TY2 A;  4RH6 A;  3VQI A;  3ZLZ A;  2HJ1 A;  1BT0 A;  2MQJ A;  2V3S A;  2GLS A;  1V80 A;  3NOB A;  2L1A A;  4LNO A;  3Q3N C;  2N4F A;  4HDQ A;  3U7D A;  1EF5 A;  2C7H A;  4IUM B;  2KN4 A;  2QSD A;  1P0R A;  1F52 A;  3ECI A;  5EE3 A;  3NZU A;  4HPP A;  2ZEQ A;  2ZJD A;  4ACF A;  2GOW A;  3KUZ A;  3R8B A;  1TZ1 A;  1DYQ A;  2WGS A;  1SIJ A;  2INN E;  3IFW B;  1TYG B;  3VUY A;  4AOF A;  3Q2A C;  2GMI C;  1DOX A;  3A4R A;  3TJP A;  2KWV B;  1T3Q A;  2KOX A;  5LNK 1;  2FNJ B;  2LUE A;  5G2N A;  2DEN B;  1TY0 A;  5BMG A;  2DZI A;  3ZW3 A;  1Q10 A;  1GNU A;  1WXM A;  2JQR B;  3AXC A;  2PJH A;  4KIK A;  1YJ1 A;  2CR5 A;  4L23 A;  2RPQ A;  2LGY A;  2O6V D;  2KAN A;  3ZNI D;  1I4Q A;  3Q8C A;  1F0Z A;  3Q69 A;  3QAQ A;  3FIL B;  2JZZ A;  2WXK A;  2IBI B;  2K5P A;  2M0X A;  3I5J C;  3K9O B;  4PYZ A;  4JE3 B;  2CKH B;  1NI2 A;  4BAX A;  3PZD A;  1Q0W B;  4NY0 A;  1TZO A;  3TEZ A;  4JX1 C;  2NBW B;  1EM7 A;  4AWJ A;  4ZRJ A;  1OQR A;  2HD5 B;  2GB1 A;  1H4R A;  1A70 A;  4ICU A;  2PW9 A;  3ZJU A;  3PHX B;  2ASQ A;  5EDS A;  1K53 A;  2N1W A;  3QK0 A;  1EWC A;  1I4H A;  2MWS B;  2IO3 B;  4GXB A;  4ZRK A;  2L0T A;  3EFU A;  3HHM A;  3P2B A;  1JWU D;  1P1A A;  3GZN B;  4HPL B;  2DWQ A;  3QWZ B;  4K1R B;  3ZTC A;  2L76 A;  1UUP A;  1P9D U;  3W2D A;  1F2R C;  1L4D B;  2RD0 A;  1PGB A;  1YQ4 B;  5D3D A;  1R7S A;  3PRE A;  1I4X A;  3R2T A;  4HCN B;  2LZ6 A;  2KWD A;  4WAA A;  1VZ6 A;  3RZF A;  2GBK A;  4II2 B;  2K25 A;  3AH7 A;  1J7C A;  1E90 A;  1I7H A;  3PS6 A;  1D4B A;  1GAQ B;  1HA5 A;  4R3D A;  3ALB A;  3N1Y C;  4XDD A;  4TQ1 A;  3ONS A;  3DHI C;  3M95 A;  2GI9 A;  3BK1 A;  3P4P B;  1TBE A;  2ONQ A;  1L0Y B;  4K7U A;  1Q1O A;  3I63 C;  4E74 A;  4DHJ B;  5CX3 A;  1FPY A;  2DZK A;  3W5V B;  4B6W A;  4JLC A;  3A9J B;  1DOI A;  1XLP A;  2XNA C;  3ZJV A;  2PVG C;  2X8X X;  1WMH B;  4HKQ A;  1QKZ A;  4GSW A;  2MJD A;  3AEA B;  3EC8 A;  1FEH A;  1V86 A;  3ZO5 B;  3H7P B;  3C8Y A;  3PO0 A;  4YXD B;  4OZA A;  3EA6 A;  4RGT A;  1L2N A;  4LNI A;  2KLG A;  2GBJ A;  2NPT B;  3PV1 A;  4EKU A;  3VXW A;  1GUA B;  3PHW B;  3ZYY X;  2D2Q A;  3R7R A;  3M62 B;  4FJZ A;  3DVG X;  4WQO B;  1E9M A;  3RUL A;  4FXC A;  1YJJ A;  5D94 A;  1MVK A;  3AEB B;  1Z5S B;  5BYQ A;  2PMV A;  2CJO A;  2DZJ A;  4WJN A;  4TUU A;  4YTN B;  1XXG A;  2K22 A;  2D07 B;  2FID A;  3MC0 B;  1NI3 A;  5TR5 A;  4YTM B;  3Q3J A;  1XF5 L;  2I38 A;  1ET6 A;  1EWY C;  3Q8A A;  1XLN A;  1LM8 B;  1SE4 A;  2YEP B;  4BKT A;  1HE8 A;  3EHV A;  3BIN A;  2DLB A;  1FCL A;  1GB1 A;  2DZM A;  4OHJ A;  3U7Z A;  1GC6 A;  3DBS A;  1FD6 A;  2SAK A;  4FUL A;  2WXL A;  4KDL B;  3FAH A;  1P98 A;  2WDT B;  5D3I B;  5D6J B;  5DPW A;  1EUV B;  3N20 C;  5DPS A;  1HEZ E;  3M63 B;  4JIO U;  4PS3 A;  4W9G A;  1YJI A;  2PPH A;  3B1L X;  1XCT L;  4MGZ E;  1YN5 A;  2ZW0 A;  4FBJ B;  2LGX A;  2N9E B;  2ZZP B;  3V6E B;  4ASW C;  1R4M B;  2M17 A;  3TEX A;  1D3Z A;  2OED A;  5L95 C;  2VH1 A;  2RDB C;  4B0E A;  4HLE A;  4FAD A;  2N9X A;  3DHG C;  1MG4 A;  4G11 A;  1YX5 B;  3R3M A;  1N63 A;  4C56 C;  2HTM E;  2JUO A;  2LXC A;  1LQB A;  2JT4 B;  3EUB 2;  2CU3 A;  3LJ3 A;  1EF1 A;  1RLF A;  1DGJ A;  2L7R A;  5LXI B;  1GG3 A;  5BO4 B;  2DYM A;  4W9I A;  2JXT A;  4N58 A;  4WJO A;  5FR6 A;  2KFK A;  3BY4 B;  1ZXI A;  1WYW B;  1K51 A;  3HVZ A;  2KTF A;  1VDV A;  3HM6 X;  1MPE A;  3MHS D;  3NG0 A;  1ZXH A;  4A6Q A;  3WAO A;  1V5O A;  5JXV A;  3SDL C;  2WP9 B;  1SE3 A;  2WNM A;  3V61 A;  3OAW A;  1F77 A;  1WE6 A;  2BF8 B;  1KH0 A;  1L0V B;  3GOE A;  2JRH A;  3E9S A;  5BYR A;  4RGO S;  1WGK A;  3IXS A;  1K52 A;  3ZXR A;  1WZ3 A;  1RM6 C;  2ACZ B;  2A5U A;  4OVV A;  3AE4 B;  3TEW A;  2OHF A;  3T3O A;  2KMA A;  3GS2 A;  1ZP0 B;  3NVV A;  3H1U A;  1NYR A;  3TUO A;  1P7E A;  1T0R C;  3DCG A;  5C2T B;  4TSS A;  1E8X A;  1AYF A;  2HE7 A;  1IBX A;  2O2V A;  2EMS A;  1TS3 A;  3UQB A;  1SF0 A;  2JVC A;  4GOC A;  5G55 A;  2AX5 A;  2Z0D B;  3VTW A;  4IWO A;  2KZR A;  1PGA A;  5IO9 A;  4US9 A;  2EKE C;  3AEE B;  4HWI B;  3AE8 B;  2LJ5 A;  3DBL I;  1YX6 B;  2GBR A;  2C9W B;  2GRI A;  1PFD A;  3AE2 B;  1KOT A;  3OJ4 B;  3VAW A;  5LLI A;  1ROE A;  2QJL A;  1UH6 A;  5HKH A;  2LFI A;  2MP2 A;  4J6I A;  1UWX A;  2V9H A;  2WXQ A;  2G3Q B;  4IWQ A;  3UIO B;  3NS8 A;  2QEJ C;  2K8B A;  2IO2 B;  4ZHP A;  4A90 A;  1J19 A;  2KFJ A;  1F9J A;  2LD9 A;  1P3Q U;  2VZK B;  4MM3 B;  4I6L B;  3PTF C;  2JYT A;  1TTN A;  1BXT A;  2KT7 A;  2BS2 B;  4M8N A;  1TKG A;  2D3B A;  4KKJ A;  4MSQ B;  2DBY A;  2UYZ B;  2G45 B;  3D32 A;  2LVQ A;  3RI7 C;  2IYD B;  4RF1 A;  3AB5 A;  2V4L A;  5I4D A;  2WXG A;  1WGR A;  1SBB B;  3ZXV A;  4S17 A;  4CQN A;  4WWM A;  2PEA A;  2I2Y A;  3PRP B;  1FCC C;  3ZGZ A;  1C78 A;  4KVG B;  4KV2 A;  3UF8 A;  4Q2J A;  1LGR A;  3BWU D;  2Y5C A;  4W9C A;  1V9J A;  5HHD G;  4H2A A;  3P4Q B;  1EO6 A;  1NEN B;  2FUH B;  2KQS A;  1KRH A;  2WXH A;  1CQV A;  2AEH A;  4IOI E;  4P1B C;  4FHK A;  2Z8L A;  3OJ3 A;  3VUX A;  1LO5 D;  2BWF A;  5CHF A;  3AE3 B;  4KZC A;  1WWT A;  2ZPY A;  4WQM A;  2UU7 A;  3PLU A;  1YIW A;  3E56 A;  3HUI A;  1I4R A;  2AQ3 B;  3IVF A;  5C1Z A;  4IKG A;  5KHQ A;  2VH2 A;  2KAJ A;  3L17 A;  4DXF A;  5BMI A;  2K8C A;  4FJY A;  4ANX A;  5CTR C;  4W9E A;  3RPF C;  1NBF C;  3ZNZ B;  4AJW A;  5IP4 D;  3ZQ4 A;  2ZCC A;  1VZ7 A;  1WI0 A;  3Q8E A;  4B9K A;  1WXQ A;  4N9F 4;  4GU2 A;  3VUW A;  4GB9 A;  4EZK A;  4ICV A;  4EUT A;  5JH5 C;  4IM2 A;  5IAA C;  3CST A;  3VFK A;  3DBR I;  4NJ6 A;  2R61 A;  3WAP A;  2SEB D;  3NVZ A;  4G0N B;  1QQR A;  4PYU A;  2IZV B;  1TT5 B;  1I4G A;  2CHW A;  3P4R B;  3ZUN A;  1IGD A;  1N62 A;  1WJ4 A;  2WXN A;  3VH3 B;  4MEL A;  1UD7 A;  1UGJ A;  1OEY J;  4MAC A;  1WRI A;  3Q6B A;  1SB3 C;  1FM0 D;  4A8X C;  3DPD A;  2JY6 A;  4L2Y A;  1XT9 B;  2CU1 A;  3B2G A;  1R4N I;  4BBN C;  1ZPS A;  2JWU A;  1ZW7 A;  2C7M B;  3AUL A;  1FO4 A;  2XK5 B;  4X57 B;  4RMA A;  2NTS A;  2MBB B;  1N60 A;  3VDZ A;  1JCK B;  3IAS 1;  2BYF A;  4WIP A;  3VHT C;  3ZDM C;  1T5X D;  3BYY B;  4JQW C;  1TS4 A;  2JX5 A;  1WJN A;  2MX2 A;  2WXR A;  1YQB A;  3H7S A;  2MBH A;  3DWG C;  4ZOH C;  1JRO A;  1E7U A;  3AE1 B;  1KLV A;  2NMQ A;  2WXM A;  2DX5 B;  3IBE A;  2D11 A;  4A9A A;  2KO3 A;  1QLB B;  5E6P A;  2Z0E B;  1Y8R C;  4C7Y A;  1C9F A;  2WXO A;  2MJE A;  4JL9 A;  4XWT A;  3LXF A;  1SGH A;  1QOA A;  4GDK B;  3V60 A;  5IA7 A;  3KW5 B;  3OWE B;  1WRD B;  4BVU C;  4AJY B;  4M01 A;  3EEC A;  3CF6 E;  3JSV B;  5MPO A;  4NAW B;  3LYY A;  3VVW B;  3OLM D;  2DNF A;  2K6D B;  4N6E B;  2ZNV B;  1NYQ A;  2CHX A;  1KM7 A;  1WE7 A;  3DVN U;  3LB8 C;  2W54 A;  1ZE3 D;  4P7I A;  3GB1 A;  3ML9 A;  4RCO A;  4ZDV A;  1UZX B;  4LNN A;  2WS3 B;  1IP9 A;  4KGS A;  3EFC A;  2KYW A;  1ET9 A;  1V97 A;  3J9C A;  1B9R A;  1WYG A;  2RDG A;  2WDV B;  2N7J A;  4MDK E;  3UIN B;  4FJV B;  2QIE B;  3KH0 A;  2JZP A;  1ZKH A;  3N30 A;  3VR8 B;  3CMM B;  1QOB A;  2A4Z A;  4JWU C;  4ANV A;  4NNJ B;  5JZE B;  5G5G A;  2XN9 C;  1WX7 A;  2LAS A;  2NTT A;  3BYT B;  3NS1 A;  3BK2 A;  2C5L C;  2WHI A;  3A9K A;  1SXT A;  3AV8 A;  5AZH A;  4HJG E;  2EMT A;  4KGR A;  5IN7 A;  1OFF A;  5DCN A;  3MTN B;  3AN1 A;  4W9K A;  1STE A;  3SD5 A;  2J42 A;  4DHZ B;  3PVL A;  4L1B A;  1IYF A;  4P1C C;  1OTR B;  5EE9 A;  2FCS A;  1LXD A;  3V05 A;  1XLO A;  1C1Y B;  4KZ0 A;  5AZF A;  2VZK D;  1FRR A;  4ANW A;  1V5T A;  4RFB A;  1E0Z A;  1ZUD 2;  1Y56 A;  2JWZ A;  4G50 A;  2KJ6 A;  3N3K B;  4US8 A;  2ICI A;  4MJS A;  2D5G A;  3L13 A;  1YN4 A;  5IOI A;  4RM9 A;  3TBL D;  4K7S A;  3ZNG C;  4TV3 A;  2HJ8 A;  2RR9 A;  2KAC A;  1V81 A;  3P63 A;  1YD8 U;  2ZW1 A;  2LHD A;  2KX0 A;  5J17 A;  1V1P A;  2I1J A;  3Q14 C;  2O6V A;  1WXA A;  1GOZ A;  4OZB A;  3GZN I;  2FCM A;  2NVU I;  2BKR B;  3BVM A;  3I3T B;  3HIZ A;  2KTR A;  4FN2 A;  2W9N A;  4MGK E;  2N9K A;  3R7Q A;  1FRD A;  3BZD B;  2IY0 B;  2L8J A;  4KIK B;  3BII D;  4NZL B;  4RF0 A;  1PGX A;  3KVF B;  4EFO A;  2B3A A;  1V49 A;  1QIL A;  2FE8 A;  5BMH A;  2BWE S;  3PGE A;  2AYO B;  4S0R A;  1WH3 A;  3AMZ A;  4B0M A;  1QZE A;  1M94 A;  3NRZ A;  4XZ4 A;  1WR6 E;  4YSY B;  4AQ7 A;  2IO0 B;  1WGG A;  2G4D B;  2KLC A;  2WYQ A;  3CSF A;  3UI3 A;  2G1E A;  3P4S B;  3QHT A;  4GDL A;  1VRA B;  4NJC A;  1WSP A;  2VRR B;  1RWS A;  4MT5 A;  3WAL A;  1ESF A;  2NS5 A;  3T3N A;  4E71 A;  1KTK A;  2ZCB A;  1UGM A;  4J3O D;  1F1H A;  1ZOY B;  4RNA A;  1BUI C;  4C4V A;  3DVG Y;  2BS3 B;  1LFD A;  2LVO A;  2BYT A;  1G6J A;  1Q5W B;  3MC9 A;  4LJP B;  4LNK A;  3B08 A;  1J7B A;  4KX6 B;  1N61 A;  2RMM A;  2LRU A;  3RNB C;  3AEF B;  1UBQ A;  3Q3F A;  3R66 C;  3N32 A;  3H6N A;  2J52 A;  2OJW A;  5J18 A;  2LRW A;  5G5H A;  2IGG A;  4W9J A;  1JRU A;  3AED B;  4BKG A;  1E5W A;  2G4S A;  4FHJ A;  5JHB A;  3ZRC A;  1UNS A;  2MA9 B;  1CK1 A;  4HDO A;  4HXD A;  1D6E C;  2MJ3 A;  2N9L A;  3TL5 A;  1QOF A;  1WR1 A;  3U8Z A;  4LNF A;  1XLQ A;  4BZA A;  3ZJT A;  3WA0 A;  4GN1 A;  2K9X A;  3VTV A;  4HPM B;  2BKF A;  2MH7 A;  3AE7 B;  2AL3 A;  1C4C A;  4LDT B;  3RD2 A;  2KWC A;  3L08 A;  1OQY A;  2IGD A;  1R4M I;  3K9P B;  2CS4 A;  2I1K A;  3PSE B;  4D2K A;  2M1M A;  3SR6 A;  1TS2 A;  3RMK C;  4O1N A;  4W9F A;  5LXH A;  1J0G A;  2KN5 A;  1JWA D;  1TKE A;  2PKO A;  1QF6 A;  3RUI B;  1XEE A;  3APF A;  4PS7 A;  3ETR A;  2JU6 X;  2KQ7 A;  2LGS A;  4BFR A;  1FXI A;  2ZVO A;  4GIV A;  4ZYN A;  4DQO C;  2W55 A;  1MJD A;  2MSE D;  2CHZ A;  4XGA B;  3RCZ A;  3WIM A;  2K3U A;  3AI5 A;  3N1X C;  4M0W A;  4YSZ B;  3U4E G;  1P7F A;  3TSS A;  4PK1 A;  3DWM A;  2BGF A;  3OG5 A;  2W3S A;  3T8M A;  2PIA A;  1E8W A;  2FCN A;  2YLM A;  3R2I A;  5HI1 A;  2L52 A;  4ITK A;  1HZ5 A;  4HJK A;  3HVD A;  4XC2 A;  5AUI A;  2REX A;  2N9P C;  1BML C;  1JW9 D;  3SFD B;  4GMV A;  2M19 A;  2WU2 B;  3PT2 B;  3APD A;  3IT4 B;  3PRM B;  3NZS A;  2WDQ B;  2KVZ A;  2GBN A;  2UWQ A;  3A1Q A;  3NVY A;  1WM3 A;  1E7P B;  2WX0 A;  4BKS D;  5AZG A;  1WFY A;  4TQ0 A;  5E6J A;  4WUR A;  1XO3 A;  2AL6 A;  2AQ2 B;  5BYS A;  4C4V B;  2BT6 A;  1GB4 A;  4ARC A;  4DHJ D;  4C00 A;  2E3T A;  1H8C A;  1J7A A;  3U2S C;  2N7E A;  4OW0 A;  1MG8 A;  3KWL A;  2K6Q A;  3A33 B;  1K50 A;  2QDF A;  2PLP A;  4KSL C;  1YN3 A;  1V1O A;  2FIF A;  2Y5B B;  2MW5 A;  2D3G A;  2WQY B;  2LGI A;  4WJQ A;  4HCP B;  1E8Y A;  4ARI A;  2WDR B;  1EU3 A;  2IPK D;  2KFK B;  1TKY A;  2NCN A;  1IUE A;  5H92 C;  3RNG C;  4OZC A;  1AW7 A;  2INC C;  3FIL A;  4I6N B;  1D5Z C;  1D5X C;  5C3J B;  3DBR B;  3ENE A;  1WXV A;  3RYT A;  4UDU C;  2LGD A;  2OJR A;  1WIA A;  1OGW A;  4ANU A;  5AEK B;  1Z2M A;  3RNE C;  1WZ0 A;  1YMH E;  3C0R B;  3ZNH B;  2KNB A;  3Q8B A;  4DHZ E;  3AEC B;  2H88 B;  2FAZ A;  3L4P A;  1L0X B;  3AU5 A;  2DAF A;  3DQV A;  1NDD A;  1R4N B;  2MBO A;  3JVZ X;  3HM3 A;  2K8H A;  4WJP A;  2DYB A;  3QIJ A;  1ZGU B;  2PVO D; 
#chains in the Genus database with same CATH homology
 3ML9 A;  4ZDV A;  1UZX B;  3DOW A;  2BYE A;  2JPH A;  1LM8 B;  1IP9 A;  5D2M B;  3DVN V;  3V62 A;  4BKT A;  3ZRF A;  1HE8 A;  3EHV A;  4LCD E;  3BIN A;  3IG3 A;  4RM8 A;  2DZM A;  4MDK E;  3UIN B;  4FJV B;  1GC6 A;  3DBS A;  2O2V B;  1ZKH A;  3KH0 A;  3N30 A;  4FUL A;  3DBH I;  4KDL B;  3SU8 X;  1P98 A;  2WDT B;  5D6J B;  4A20 A;  2GBM A;  3ZVV A;  3CMM B;  2A4Z A;  2KWU B;  4BOZ B;  4ANV A;  5DPW A;  4NNJ B;  1EUV B;  5JZE B;  1WX7 A;  2LAS A;  5DPS A;  3M63 B;  2C5L C;  1L7Y A;  3QQ8 B;  4IM3 A;  1E8Z A;  2PE9 A;  4JIO U;  3A9K A;  4GDL B;  5AZH A;  2JF5 A;  3JYU A;  2EMT A;  1TGZ B;  1GJZ A;  5DCN A;  3MTN B;  4PS3 A;  4MEM A;  4W9G A;  2PPH A;  4W9D A;  4W9K A;  3B1L X;  4AUQ C;  1X1M A;  4MGZ E;  3V6C B;  3ZTD A;  4FBJ B;  2LGX A;  2N9E B;  3SD5 A;  4FA6 A;  2ZZP B;  3V6E B;  3PVL A;  4DHZ B;  3NY5 A;  4ASW C;  1IYF A;  2HTH A;  3KUC B;  2M17 A;  1OTR B;  2MP2 B;  1D3Z A;  2FCS A;  1LXD A;  3VH4 B;  5L95 C;  4G3X B;  1U4A A;  2MCN B;  1C1Y B;  4KZ0 A;  4HLE A;  3S2A A;  2XK5 A;  3KYC D;  3KYD D;  5AZF A;  2N9X A;  4BKS A;  4FAD A;  4MH0 E;  4A3P A;  4I6P A;  3QX1 A;  4ANW A;  1ISN A;  2LWP A;  4IG7 B;  1WJ6 A;  1V5T A;  4G11 A;  4IW0 A;  1YX5 B;  3QA8 A;  3NHE B;  4II3 B;  1J8C A;  2KKC A;  3R3M A;  1FXT B;  2JWZ A;  2LXC A;  2JUO A;  4G50 A;  1LQB A;  2JT4 B;  2KJ6 A;  2KX3 A;  3N3K B;  4HVB A;  1AAR A;  3LJ3 A;  4TKN A;  5DPT A;  1EF1 A;  4MJS A;  1RLF A;  3A9J A;  3L13 A;  3TMP B;  2L7R A;  3PRZ A;  3MJW A;  4RM9 A;  5LXI B;  3TIX A;  2NBV B;  1GG3 A;  5BO4 B;  3PLV A;  3TBL D;  3DDC B;  1UBI A;  2J0J A;  2DYM A;  3A1Q B;  1WMH A;  4K7S A;  2ZNV C;  4W9I A;  3LDZ E;  3RZW C;  2RSU A;  2N1V A;  2Z59 B;  4NQL B;  2HJ8 A;  4TV3 A;  3ZNG C;  4DBG A;  5JHA A;  2RR9 A;  4MGI E;  4WJO A;  5FR6 A;  2KFK A;  2C7N B;  3BY4 B;  1WYW B;  3U30 A;  1V81 A;  3H7P A;  2KTF A;  1YD8 U;  2JRI B;  2PE6 B;  3KUD B;  3HM6 X;  1WJU A;  3MHS D;  2DAJ A;  1RRB A;  2KX0 A;  3W1S C;  5C23 A;  5J17 A;  2I1J A;  2NPT A;  5DPR A;  2BYV E;  2NR2 A;  2O6V A;  3WAO A;  1V5O A;  1WXA A;  2K39 A;  3WAN A;  3HK0 A;  2MBE A;  4GDK A;  3GZN I;  4K81 A;  3SDL C;  2FCM A;  2DYO A;  2C60 A;  5D7G A;  2NVU I;  3V61 A;  3OAW A;  2BKR B;  1WE6 A;  2BF8 B;  2LXA A;  3L0W B;  1XQQ A;  2L3Z A;  3I3T B;  3HIZ A;  3QC8 B;  4F1S A;  2KTR A;  4FN2 A;  2W9N A;  4LDT D;  4MGK E;  3JSV A;  4FLH A;  3GOE A;  2JRH A;  4NAW A;  3R7Q A;  2N7D A;  1WZ3 A;  2IY0 B;  2L8J A;  4KIK B;  4NQK E;  2A5U A;  2IY1 B;  4OVV A;  1VD2 A;  3KVF B;  3TCA A;  4EFO A;  2B3A A;  2KMA A;  1V49 A;  3H1U A;  2J7Q B;  2KC1 A;  2BWE S;  2KVR A;  1XD3 B;  3DCG A;  3PGE A;  4GGQ A;  1IPG A;  5CHW A;  1E8X A;  2AYO B;  2AWT A;  4DXA B;  1S3S G;  4EOY A;  4IM0 A;  3W1S A;  2HE7 A;  1WH3 A;  4EZJ A;  2KDE B;  1QZE A;  4P7I A;  1M94 A;  4XZ4 A;  2O2V A;  5GMV A;  3ZDT A;  2EMS A;  2KD0 A;  3UQB A;  1WR6 E;  4WWN A;  2IO0 B;  1WGG A;  2J0M A;  2JVC A;  4GOC A;  1WM2 A;  2G4D B;  2KLC A;  4YL8 A;  2WYQ A;  5G55 A;  4EEW A;  1RAX A;  2Z0D B;  3CSF A;  3L10 B;  3UGB B;  1RFA A;  3JW0 X;  4WWP A;  3VTW A;  1SE9 A;  2DHZ A;  4IWO A;  2KZR A;  2MRP A;  1WGY A;  2EKE C;  2KMC A;  3QHT A;  4HWI B;  3QJZ A;  4XX5 A;  5KHO A;  1PQS A;  4GDL A;  2YVC A;  2LJ5 A;  3VTU A;  3DBL I;  3ZKJ C;  1YX6 B;  4NPN A;  2GBR A;  2C9W B;  2VRR B;  1A5R A;  1KOT A;  3OJ4 B;  2M4N A;  3WAL A;  2NS5 A;  3VAW A;  5LLI A;  1UH6 A;  4JGH B;  5HKH A;  4M0W B;  3X0W A;  4E71 A;  1E7V A;  2MP2 A;  2D10 A;  4J6I A;  2ZCB A;  3QCA A;  2KC2 A;  3QAR A;  3VQI A;  1UGM A;  3ZLZ A;  5E6O A;  2G3Q B;  4IWQ A;  3UIO B;  3NS8 A;  3DVG Y;  1BT0 A;  2MQJ A;  2K8B A;  2V3S A;  1LFD A;  2IO2 B;  2LVO A;  2ZVN A;  4KDI C;  1V80 A;  4M8M A;  4MSM B;  3NOB A;  1J19 A;  1G6J A;  2MLB A;  1Q5W B;  4LJP B;  3W1Y A;  3B08 A;  1WXS A;  4A3O A;  2KK8 A;  5CHV C;  2N4F A;  2KXJ A;  3T9L A;  2KFJ A;  1WGD A;  1F9J A;  4HDQ A;  2LD9 A;  2K1F A;  1EF5 A;  1P3Q U;  2KDF B;  2LRU A;  2LI5 A;  3U7D A;  1WY8 A;  2C7H A;  1K8R B;  1UBQ A;  4IUM B;  1T0Y A;  4I6L B;  3Q3F A;  3R66 C;  3PTF C;  1P0R A;  3N32 A;  1TTN A;  4B95 A;  3ECI A;  3H6N A;  3NZU A;  4URK A;  5J18 A;  2LRW A;  2ZEQ A;  2ZJD A;  2GOW A;  3KUZ A;  3UIP B;  1TZ1 A;  4M8N A;  4W9J A;  1JRU A;  4WWO A;  4BKG A;  4MSQ B;  1E5W A;  2G4S A;  4FHJ A;  3IFW B;  2UYZ B;  2G45 B;  5JHB A;  3D32 A;  4DWF A;  2LVQ A;  2NBU A;  3VUY A;  4AOF A;  2GMI C;  2KDB A;  2IYD B;  3AU4 A;  4ZRI A;  2V4L A;  3A4R A;  4K7W A;  3ZRC A;  3TJP A;  2MA9 B;  1WGR A;  4HDO A;  4HXD A;  2J0K A;  2KWV B;  2KOX A;  1UEL A;  2FNJ B;  2LUE A;  5G2N A;  2DEN B;  3Q3J A;  2MBQ A;  2QHO A;  2DZI A;  3ZW3 A;  2PEA A;  3TL5 A;  3PRP B;  1GNU A;  1WR1 A;  4KVG B;  4KV2 A;  3SHQ A;  1WXM A;  1KJT A;  3UF8 A;  3A4S C;  3U8Z A;  4EZL A;  4W9C A;  1GC7 A;  3WAM A;  1WF9 A;  1V9J A;  3AXC A;  2PJH A;  2L00 B;  4KIK A;  1YJ1 A;  1EO6 A;  2CR5 A;  4GN1 A;  3WA0 A;  3VTV A;  2FUH B;  2KQS A;  4HPM B;  2RPQ A;  2BKF A;  2LGY A;  2O6V D;  2AEH A;  2KAN A;  3ZNI D;  4FHK A;  3OJ3 A;  3VUX A;  2AL3 A;  4IWP A;  4LDT B;  3RD2 A;  4F7Z A;  2BWF A;  2KWC A;  3L08 A;  5CHF A;  1CMX B;  1OQY A;  3QAQ A;  1R4M I;  3K9P B;  4KZC A;  2CS4 A;  2I1K A;  2ZPY A;  3PSE B;  2JZZ A;  3UQA A;  2M1M A;  1I42 A;  2IBI B;  3PLU A;  2BPS A;  4W9F A;  1SIF A;  5LXH A;  1C3T A;  1YIW A;  4F8C B;  1J0G A;  2KN5 A;  2JZ3 B;  2M0X A;  3K9O B;  3RUI B;  4PYZ A;  3APF A;  4KSK C;  4PS7 A;  3IVF A;  2KQ7 A;  2XEW A;  2CKH B;  1NI2 A;  5C1Z A;  4BFR A;  2ZVO A;  4GIV A;  5KHQ A;  4ZYN A;  3PZD A;  1Q0W B;  4NY0 A;  2MSE D;  2CHZ A;  3L17 A;  2K8C A;  4FJY A;  2NBW B;  3RCZ A;  3WIM A;  4ANX A;  4AWJ A;  4ZRJ A;  3AI5 A;  5CTR C;  4W9E A;  4BOS C;  2HD5 B;  3O65 B;  1NBF C;  1H4R A;  3ZNZ B;  4ICU A;  4AJW A;  3PHX B;  2ASQ A;  5EDS A;  2ZCC A;  2M8S A;  2N1W A;  3QK0 A;  1WI0 A;  2FCQ A;  4B9K A;  2BGF A;  2MWS B;  4N9F 4;  2IO3 B;  2OOB B;  4GU2 A;  4GXB A;  3T8M A;  3L16 A;  4ZRK A;  3RT3 B;  3VUW A;  2L0T A;  3EFU A;  3HHM A;  3P2B A;  1OEY A;  1E8W A;  1P1A A;  4GB9 A;  2FCN A;  2YLM A;  4HPL B;  4ICV A;  4EUT A;  3QWZ B;  4EZK A;  4IM2 A;  5IAA C;  4K1R B;  3ZTC A;  5JH5 C;  1I35 A;  3CST A;  2L76 A;  1WX8 A;  4HJK A;  3VFK A;  3DBR I;  4NJ6 A;  4XC2 A;  1P9D U;  2REX A;  3WAP A;  2RD0 A;  2N9P C;  4G0N B;  1V2Y A;  2ZPN A;  4PYU A;  4IC7 B;  3PRE A;  4GMV A;  4HCN B;  2LZ6 A;  3PT2 B;  2IZV B;  3APD A;  4MM3 A;  3A9K B;  4WAA A;  2CHW A;  3RZF A;  4CYE A;  2GBK A;  3ZUN A;  3PRM B;  3NZS A;  4II2 B;  1WJ4 A;  4CO7 A;  2K25 A;  2LVP A;  1E90 A;  2GBN A;  2UWQ A;  4MEL A;  1UD7 A;  3VH3 B;  2L05 A;  3PS6 A;  4E3C A;  1OEY J;  3A1Q A;  1WM3 A;  2WX0 A;  4BKS D;  3ALB A;  3DPD A;  2JY6 A;  5AZG A;  1WFY A;  4TQ1 A;  1XT9 B;  2RGF A;  3IHP C;  2CU1 A;  3ONS A;  4TQ0 A;  1R4N I;  4BBN C;  2AL6 A;  1ZW7 A;  3M95 A;  2C7M B;  3AUL A;  2XK5 B;  4X57 B;  4DHJ D;  1TBE A;  4RMA A;  2MBB B;  2KJR A;  2WWZ A;  1H8C A;  4K7U A;  3VDZ A;  2R2O A;  2IO1 B;  5J2R A;  2BYF A;  2N7E A;  3X23 A;  1MG8 A;  1Q1O A;  4OVU A;  3VHT C;  2K6Q A;  3A33 B;  4E74 A;  3ZDM C;  4DHJ B;  5CX3 A;  2DZK A;  4AP4 C;  4JQW C;  4DDI D;  3M3J A;  4KSL C;  2MX2 A;  1WJN A;  4B6W A;  1YQB A;  4MJS B;  2FIF A;  1WGH A;  3H7S A;  2Y5B B;  2MW5 A;  3A9J B;  4JLC A;  2MBH A;  4LJO B;  4CHK A;  2D3G A;  1E7U A;  4WJQ A;  1S1Q B;  4HCP B;  1E8Y A;  3ML8 A;  1KLV A;  1WMH B;  4GSW A;  2DX5 B;  3IBE A;  4W9H A;  2KFK B;  3EC8 A;  2JXX A;  2D11 A;  1V86 A;  2KO3 A;  2NCN A;  3ZO5 B;  2KJH B;  3H7P B;  5E6P A;  2Z0E B;  4HK2 A;  1Y8R C;  4PS8 A;  4I6N B;  3PPA A;  3ENE A;  2KDI A;  1WXV A;  4JL9 A;  3RYT A;  1L2N A;  2KLG A;  2LGD A;  2GBJ A;  2NPT B;  3PV1 A;  4DK5 A;  4EKU A;  3VXW A;  1GUA B;  3PHW B;  2OJR A;  2D2Q A;  3R7R A;  1SGH A;  2O6V B;  1WIA A;  3M62 B;  4FJZ A;  1OGW A;  5E6N A;  4ANU A;  2V1Y A;  5AEK B;  3DVG X;  1Z2M A;  4BBN F;  4GDK B;  1WX9 A;  4WQO B;  1WZ0 A;  3V60 A;  3RUL A;  3APC A;  2WX1 A;  5IA7 A;  1V6E A;  3KW5 B;  3C0R B;  4NJ7 A;  3L54 A;  4MGY E;  3ZNH B;  5L83 A;  5D94 A;  1WRD B;  2KNB A;  4DHZ E;  4BVU C;  4AJY B;  1VCB A;  2KHW B;  2R2Q A;  3CF6 E;  3EEC A;  2KTR B;  2L0F A;  1Z5S B;  2FAZ A;  3JSV B;  4NAW B;  4W9L A;  3VVW B;  3OLM D;  2DZJ A;  4WJN A;  4TUU A;  3AU5 A;  2DAF A;  2K6D B;  3DQV A;  1NDD A;  2MBO A;  2XBB C;  2ZNV B;  3JVZ X;  3H9D A;  3HM3 A;  2CHX A;  2D07 B;  1KM7 A;  1WE7 A;  2K8H A;  2FID A;  3DVN U;  4WJP A;  2DYB A;  5TR5 A;  3B0A A;  3ZIM A;  3QIJ A;  1ZGU B;  4DDG D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...