4IC7B

Crystal structure of the erk5 kinase domain in complex with an mkk5 binding fragment
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
123
structure length
123
Chain Sequence
b'VLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGLKVNTRAGPSQSGRHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 7
publication title Structural mechanism for the specific assembly and activation of the extracellular signal regulated kinase 5 (ERK5) module.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 21
structure length 123
sequence length 123
chains with identical sequence E
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2012-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4ic7B00
3TBLD 4FA6A 1LXDA 3CSTA 2KQSA 4KSLC 3DVGX 5D94A 4MELA 4PS8A 4DDGD 2N7DA 3ZW3A 3IFWB 3PRPB 1LFDA 2O6VD 2V3SA 4URKA 4GDLB 3WIMA 3PRMB 4IWQA 1RFAA 4MM3A 4MEMA 4G50A 2KTRB 4F7ZA 2FCNA 4BOSC 4HWIB 2MBHA 2N4FA 3DBSA 1WZ0A 4WAAA 5J18A 2KZRA 1Z2MA 1WX9A 3TMPB 2DZKA 3OLMD 4GB9A 2KHWB 2O6VA 3QIJA 4EEWA 5J17A 3U7DA 4JIOU 3SD5A 3ZDMC 3ML9A 1XD3B 1E90A 2KLGA 2Z59B 4BBNF 2BGFA 4K1RB 5CHFA 1WI0A 4MGZE 4HJKA 3DQVA 1OTRB 3QC8B 2GBKA 2L76A 3DDCB 1M94A 2RR9A 2L7RA 3L13A 2BPSA 5E6NA 3W1SC 3TIXA 4PS3A 3APCA 3DBHI 3R7QA 3APDA 5GMVA 3NZUA 1WR1A 4EOYA 1MG8A 4MH0E 3UINB 2KVRA 2K8HA 2NR2A 3O65B 1D3ZA 1GUAB 2A4ZA 2MCNB 3QA8A 1E8WA 1V5TA 1WX8A 4W9FA 2DENB 4CO7A 1EF5A 2ZCCA 2IY1B 2BYFA 1Q0WB 4J6IA 4FLHA 2JUOA 3PRZA 2IBIB 1R4MI 2J7QB 3M62B 4E71A 3SU8X 3KW5B 4MGIE 4NJ7A 3H7PB 3ONSA 3V60A 2LI5A 3HIZA 4M8MA 4WJPA 4DHZE 3N3KB 4BVUC 3K9OB 2M8SA 2GMIC 4WJNA 2BWES 4G11A 1Y8RC 2KC2A 5LXHA 1V2YA 2BYVE 2JWZA 2PPHA 3VUXA 3HM6X 3DVNV 4ZYNA 4KZ0A 3A1QA 1BT0A 3PS6A 4PS7A 4DHJD 4AJYB 4DK5A 3KVFB 4GGQA 3VTWA 3NS8A 1UELA 2AL6A 3QHTA 2XEWA 3VHTC 3RULA 3UGBB 4IWOA 3R66C 4I6LB 2W9NA 4K7UA 3PT2B 2D3GA 2KANA 2MBEA 2XK5A 2IO1B 1WM3A 5CX3A 2KWVB 2KTFA 1UH6A 2LWPA 4LDTB 4I6PA 4AOFA 4EUTA 1EUVB 2C60A 2WDTB 3M3JA 1EO6A 3QARA 4DHZB 2KWCA 4TQ0A 5DCNA 2N9XA 2L0FA 1WXVA 2MP2A 1WGRA 4TV3A 5LXIB 1T0YA 3HHMA 3KYDD 4GOCA 2CS4A 2FCSA 2KC1A 2DYBA 2CHXA 1RAXA 2MP2B 2V1YA 4OVVA 3TL5A 2BWFA 4II2B 3VAWA 3DOWA 4A3PA 2MRPA 2AWTA 1WH3A 3M63B 3JYUA 4X57B 2BYEA 2HJ8A 2K8CA 3CSFA 5E6PA 3RZFA 3RZWC 3NHEB 3PLVA 3V62A 2KWUB 3ZUNA 1WX7A 3AU5A 3WA0A 1ZGUB 4FULA 1H8CA 2G45B 2LZ6A 3JSVA 4BKTA 1WJUA 4KVGB 2NCNA 4GDKA 4WWNA 4PYZA 3L08A 3VFKA 5CTRC 2AL3A 2KNBA 5JZEB 2IY0B 2J0JA 1GC7A 1WFYA 3WAPA 3PTFC 3VUWA 2JXXA 2O2VA 4MGYE 3TJPA 1WM2A 2L8JA 4AP4C 3H6NA 4P7IA 4MSQB 4F8CB 2LVPA 5DPWA 2LUEA 3N32A 1HE8A 4KV2A 3ZRFA 4GDLA 4XZ4A 3RUIB 3VQIA 2LD9A 4JGHB 2KTRA 5CHWA 3R7RA 2WX0A 1WIAA 4RM8A 5DPRA 5AZGA 2ZPYA 1WXAA 2FCMA 1TGZB 1TBEA 2FAZA 2JPHA 3NZSA 3OJ3A 4W9DA 1OGWA 2AEHA 2M17A 3MTNB 2ZPNA 2G3QB 2IO0B 2ASQA 3C0RB 4ZDVA 2DYOA 3AULA 3KUDB 4HDQA 1WE6A 1X1MA 2YLMA 4N9F4 5DPTA 4K7WA 5D7GA 1V5OA 1WGYA 1GC6A 3A4SC 3RD2A 2K6DB 1SGHA 3ZTDA 2B3AA 1SIFA 3BINA 4BBNC 1K8RB 2WX1A 4IWPA 3DCGA 3ZNHB 1GNUA 4WJQA 1XQQA 4G3XB 3DVNU 3DBLI 1VD2A 3WAOA 3BY4B 3U8ZA 4MSMB 2LRWA 3V61A 2K25A 1LM8B 1P9DU 2KQ7A 5C1ZA 1S3SG 2EKEC 1V9JA 2D11A 1WJ4A 4W9LA 2UYZB 2K8BA 2DAJA 1ISNA 4IM3A 2HE7A 4ANXA 5D2MB 4ZRIA 3B1LX 4MJSB 5KHOA 1UD7A 1ZW7A 4RM9A 1P0RA 3H7PA 3DVGY 1V80A 3OJ4B 4K81A 1GG3A 3UQBA 4BKSD 4ANUA 3UQAA 3QQ8B 2KN5A 4DBGA 4HPMB 2LGXA 1GJZA 1YIWA 1I35A 3EFUA 3RCZA 2K6QA 2RGFA 3HM3A 4NQLB 4HK2A 2ZNVC 2NBVB 1E8XA 4W9KA 4A3OA 3IBEA 1UGMA 5LLIA 3ZIMA 4CHKA 2KFKA 3ENEA 4LDTD 2NS5A 3QK0A 4W9GA 5JHAA 2IO3B 4HCNB 1L7YA 1UBQA 2JY6A 2KFKB 4II3B 4NAWB 1WGHA 2PJHA 1ZKHA 1FXTB 2AYOB 4KDLB 4M0WB 4IUMB 4AJWA 4FN2A 2J0KA 3V6CB 3LJ3A 4YL8A 2GBRA 1WYWB 1KM7A 2G4SA 2ZJDA 1CMXB 2LXCA 3TCAA 1G6JA 2PE6B 2IYDB 2K1FA 4ICUA 2N9PC 2LASA 3QJZA 1Q5WB 4GIVA 2KDEB 3VDZA 1LQBA 2M4NA 4KDIC 5J2RA 3R3MA 2L05A 2PE9A 3AU4A 5E6OA 5IAAC 4B6WA 4JL9A 4NPNA 2HTHA 1OEYJ 2M1MA 4JQWC 2D10A 3ZRCA 3RYTA 4AWJA 1TZ1A 3PLUA 2KDFB 5EDSA 2C7NB 2EMTA 1S1QB 2MQJA 2JRHA 3WALA 3L17A 1UBIA 2DYMA 2VRRB 1WE7A 1V49A 2ZZPB 2ZVNA 1KLVA 1C1YB 1P1AA 1IPGA 1WMHB 1WXSA 2GBJA 4IG7B 2R2OA 2ZCBA 4XC2A 3PZDA 4EZLA 5JH5C 4FJYA 3UIOB 1A5RA 3A4RA 2NPTB 1RLFA 2MBQA 5CHVC 3ZNID 2J0MA 2WYQA 4DXAB 3L10B 1V86A 3S2AA 2LRUA 1V6EA 2QHOA 4IM0A 3A9KB 1I42A 5AZHA 4LJPB 2CR5A 2C5LC 2KJ6A 3IHPC 1IYFA 5KHQA 4ZRJA 3D32A 2BKFA 4WWOA 1SE9A 2BF8B 4WWPA 2FNJB 2JT4B 2A5UA 2MLBA 2MSED 3A9JA 2MBBB 5JHBA 2LVOA 3HK0A 3B0AA 3KUCB 1C3TA 3PHXB 3A9JB 2OJRA 3ZNGC 2RPQA 1E8ZA 3L54A 2FIFA 4IC7B 3ZTCA 4B9KA 1TTNA 3MJWA 3KUZA 3PHWB 3ZKJC 3PSEB 1WJNA 4IM2A 2DZIA 1U4AA 1YD8U 2KMCA 4ICVA 2R2QA 1EF1A 2JRIB 2LGDA 4IW0A 2KMAA 2NBUA 4GN1A 3H1UA 2DZJA 4E74A 2JVCA 2MW5A 2KDBA 4NJ6A 2KO3A 2NBWB 5DPSA 3VUYA 1YX5B 1YX6B 2MWSB 1NBFC 4DWFA 4FJVB 3APFA 1J8CA 5FR6A 3Q3JA 2LGYA 4G0NB 1J0GA 3P2BA 2JF5A 3PVLA 4FHKA 4JLCA 1WXMA 2NVUI 3W1SA 1WR6E 3ML8A 5HKHA 5G2NA 4KSKC 2KOXA 2N7EA 4RMAA 1P98A 4DDID 2LVQA 4TUUA 3VH4B 2ZVOA 1WF9A 3VXWA 3NY5A 3OAWA 1KOTA 3KYCD 3VVWB 2IZVB 1RRBA 2JZ3B 4FADA 4EKUA 5C23A 2IO2B 1J19A 2I1JA 4E3CA 4W9IA 2JZZA 2M0XA 2CKHB 2O6VB 2KFJA 2D2QA 3QAQA 2RSUA 3W1YA 3PPAA 2UWQA 3ZLZA 4ANVA 2KX0A 4MJSA 4TQ1A 2DX5B 4GU2A 2FUHB 4TKNA 3T8MA 4M8NA 1E5WA 1P3QU 2GOWA 4LJOB 4NQKE 1OEYA 2CU1A 4HCPB 2KDIA 3N30A 2K39A 3ECIA 3H9DA 4BKGA 4GSWA 2BKRB 2EMSA 1WZ3A 4ASWC 2ZNVB 2L3ZA 3PREA 2ZEQA 2Z0DB 4K7SA 4B95A 1YJ1A 4XX5A 2REXA 3UF8A 1L2NA 1E7UA 4NAWA 2N9EB 3QCAA 4HPLB 1H4RA 3VH3B 5TR5A 4BKSA 3SDLC 2XBBC 4HVBA 5G55A 3H7SA 3X23A 3JW0X 3X0WA 5AZFA 3ZNZB 3L0WB 2N1WA 2Z0EB 4EZJA 2KKCA 3CF6E 3IG3A 1WGGA 3ALBA 3I3TB 4FHJA 1WY8A 4KZCA 2FCQA 2KD0A 4GMVA 4WJOA 4PYUA 2LJ5A 3KH0A 4W9HA 2HD5B 2CHWA 4KIKA 3LDZE 3K9PB 1NI2A 3CMMB 4BFRA 3A33B 4MGKE 4KIKB 4ANWA 2DZMA 2KJHB 5AEKB 2CHZA 5L83A 4LCDE 4NNJB 4AUQC 1WGDA 3GOEA 4GXBA 2MA9B 2I1KA 3M95A 2C7MB 3A1QB 2L00B 2GBMA 1WMHA 3IVFA 1R4NI 3QWZB 3JVZX 4W9CA 2KXJA 2C7HA 4OVUA 3U30A 5IA7A 4I6NB 1AARA 2NPTA 3EC8A 2C9WB 2L0TA 4HDOA 1WRDB 2LXAA 5BO4B 2XK5B 3AXCA 4FJZA 1OQYA 2PEAA 3T9LA 4A20A 3AI5A 1JRUA 4HLEA 4CYEA 4W9EA 2DHZA 2G4DB 2RD0A 3A9KA 3DPDA 3V6EB 3VTVA 4DHJB 2OOBB 3RT3B 2DAFA 2KX3A 3EECA 4HXDA 4W9JA 4WQOB 5L95C 2KK8A 2KLCA 1PQSA 1YQBA 2FIDA 3SHQA 1KJTA 3WANA 1V81A 1UZXB 1XT9B 4NY0A 2MBOA 2Y5BB 1Z5SB 1VCBA 1WJ6A 3MHSD 4FBJB 2KJRA 4BOZB 3QX1A 2WWZA 1IP9A 3NOBA 5D6JB 3UIPB 3B08A 3DBRI 3L16A 2MX2A 1E8YA 2GBNA 2N1VA 2YVCA 3PV1A 1NDDA 3JSVB 3ZO5B 2D07B 4GDKB 3ZDTA 3ZVVA 4EZKA 1E7VA 1QZEA 3EHVA 3VTUA 4F1SA 1F9JA 3Q3FA 2O2VB 4MDKE 1Q1OA 3GZNI 3WAMA 4EFOA 3PGEA 4ZRKA 2V4LA
chains in the Genus database with same CATH superfamily
1LXDA 2KN4A 2Y5PA 4ARCA 4MELA 2K22A 1D5XC 3PRMB 3I57A 1QOGA 4MM3A 2RDGA 2WXMA 4F7ZA 2L83A 5EE3A 2WXOA 4RGMA 1SE4A 1WZ0A 4WAAA 1WX9A 2KHWB 4EEWA 2BGFA 4K1RB 1WI0A 4MGZE 3GE8C 4HJKA 3DQVA 3ZYYX 1OTRB 4RCOA 1FNVA 3AV8A 4A8XC 2GBKA 1XXGA 1L6VA 1PGXA 5GMVA 1GPXA 2KVRA 3TSSA 3FKYA 2NR2A 2JYTA 1YOVB 4XYCA 2OHFA 3QA8A 1WX8A 1EF5A 1IBXA 2ZCCA 2I2YA 2BYFA 4J6IA 1IBXB 4XDDA 2J7QB 4E71A 3SU8X 3KW5B 3ONSA 2QSDA 3HIZA 4DHZE 3Q3NC 3K9OB 1VDVA 2M8SA 3WCQA 4WJNA 1I4GA 2OEDA 2KC2A 2BYVE 4L2YA 4HJGE 3LB8C 2WU5B 4DK5A 3KVFB 1UELA 4I6LB 2W9NA 1VZ6A 4DXFA 4K7UA 1ZUD2 1IGDA 3I9V1 2XK5A 4OZCA 4BAXA 2G9HD 2KTFA 5HFYA 1JWMD 1V1PA 1E9MA 1T5XD 2WDTB 4TQ0A 4DHZB 3BVMA 2N9XA 1WXVA 3AEBB 1WGRA 1N5XA 4TV3A 5LXIB 3ZNGC 4OVVA 1RAXA 2V1YA 2BWFA 4II2B 4HKQA 2J42A 3VAWA 3DOWA 4A3PA 1I4QA 2MRPA 3JYUA 3OWEB 4BZAA 3ZUNA 3AU5A 3WA0A 4FULA 2LZ6A 1QOBA 4KVGB 4GDKA 1FO4A 4H2AA 5CTRC 2KNBA 2IY0B 3IAS1 2L8JA 5BYSA 1QQRA 4MSQB 2DBYA 2GI9A 3N32A 2JU6X 4GDLA 1CJEA 5LNK1 2WGSA 5CHWA 3R7RA 3L4PA 1WIAA 4RM8A 2BS3B 2X8XX 5AZGA 3EUB2 3NZSA 3OJ3A 4KKIA 2ZPNA 3B2GA 3C0RB 3J9CA 1N60A 3AULA 1N61A 4HDQA 5DPTA 3RNFC 3RD2A 1GC6A 2K6DB 2KAJA 1SGHA 5HHDG 1I4RA 3ABVB 5I4DA 3ZJVA 4IWPA 3DCGA 2WXQA 4WJQA 4G3XB 3DVNU 3BY4B 1S3SG 4LNFA 2HE7A 5D2MB 3B1LX 1UD7A 1PDXA 1P0RA 2ZW0A 3H7PA 3OJ4B 1GG3A 4BKSD 4ANUA 3MC8A 3UQAA 1TJEA 1WYGA 3RNCC 1GJZA 2RDBC 3EFUA 1QOAA 4NQLB 1KLGD 2ZNVC 1E8XA 3ZGZA 2PIAA 3DWMA 3ENEA 3DHHC 5JHAA 3ZJUA 2LUMA 5H8YE 1ZKHA 3V6CB 4YL8A 2GBRA 1KM7A 2NTTA 1AW7A 2MH7A 2QC8A 2N9PC 3QJZA 2KDEB 5J2RA 3R3MA 5E6OA 5IAAC 2WNMA 4JL9A 2HTHA 2PW9A 4JQWC 3R2IA 1FMAD 1DYQA 5EDSA 4ACFA 2JRHA 2DYMA 3Q8FA 1V49A 2MEKA 2ZZPB 1YN5A 1C1YB 1WXSA 3TEWA 2R2OA 5JH5C 3UIOB 4LNIA 3A4RA 2NPTB 1HZ5A 3ZNID 5CHVC 4JPSA 1OFFA 4DXAB 4A90A 1N6ZA 3NS1A 3S2AA 3A9KB 2KT7A 1UUPA 1QKZA 3IHPC 3TEXA 1KFYB 2JT4B 2L1AA 2MSED 5JHBA 4K3CA 3B0AA 1C3TA 1YQ4B 1V8CA 3FILB 5FR3A 2RPQA 3L54A 4IC7B 3ZTCA 4B9KA 3ZKJC 4IM2A 1GOZA 2AQ3B 1U4AA 2KMCA 4ICVA 3VR8B 2JRIB 2KMAA 4OVZA 4B0EA 3H1UA 2JVCA 4NJ6A 3ZQ4A 3MHZA 5DPSA 2MWSB 1PGAA 1NBFC 4FJVB 3APFA 1J8CA 3AEFB 3PVLA 4IKGA 1WXMA 1SJHD 1WR6E 5G2NA 3U2SC 2N7EA 1P98A 3VH4B 4D2KA 5AUKA 3OAWA 1KOTA 3VVWB 2ACZB 2Y3AA 1D5MC 4P1CC 5C23A 4PT5A 4E3CA 4W9IA 2JZZA 2KQ4X 2KFJA 2D2QA 4A6QA 5FKAC 2CU3A 4TQ1A 1FCLA 2QMTA 4XWWA 3CIRB 3P63A 3N1XC 1I4XA 4HCPB 3P1MA 2K5PA 2KWDA 4GSWA 2BKRB 1C4PA 1I7HA 2L3ZA 1TKYA 1ZXHA 4USAA 4XX5A 2REXA 3BWUD 2RPVA 4NAWA 4IOIE 2XBBC 2JZPA 3JW0X 4C80A 3RNGC 1K51A 3CF6E 3IG3A 4KZCA 2H89B 2VH1A 4GMVA 4KIKA 2X38A 1C4AA 1NI2A 1TT5B 2WXKA 3AE3B 3A33B 4MGKE 4KIKB 2DZMA 2CHZA 2INPE 1JALA 4NNJB 1F77A 3GOEA 4GXBA 3M95A 2BS4B 2XNAC 3ETRA 4OVUA 3U30A 1AARA 2L0TA 4HRSA 2QDFA 3I5JC 1SIJA 4HLEA 1KLUD 2AQ2B 3DPDA 3NG0A 2DAFA 2V0GA 5L95C 1VJKA 4LNKA 1YQBA 2FIDA 1I4HA 2ICIA 2BS2B 3U7ZA 2B76B 1L4DB 3BZDB 4UDUC 2WP9B 1SE3A 3HVZA 3L16A 2N1VA 3Q69A 3TUOA 2SEBD 2FE8A 3ZDTA 2PVGC 4N59A 1QZEA 1F9JA 2O2VB 3RNAC 3GZNI 4R3DA 4ZRKA 4RFBA 4J3OD 4KSLC 2N7JA 3ZXRA 4URKA 5BMHA 4RH6A 2KYWA 4MEMA 1C9FA 3VRBB 4N58A 1OQQA 3TEZA 2MBHA 1Z2MA 2QJLA 5J17A 2O6VA 3QIJA 3Q8CA 3U7DA 3ML9A 2Z59B 2KLGA 3W5UB 2I38A 4RNAA 3C19A 1XLQA 4NAMA 3DDCB 2L7RA 2BPSA 3TIXA 3DBHI 1MG8A 3UINB 2WDRB 2A4ZA 4C4VB 1JROA 2PVOD 1V5TA 4RF0A 2JUOA 3PRZA 1R4MI 4WURA 1JWBD 4M8MA 4BVUC 1MG4A 2PLPA 3U52E 5LXHA 4KGTA 2PPHA 3VUXA 1J7CA 3DVNV 1BT0A 1R7SA 4DHJD 4AJYB 3NS8A 3QHTA 3RULA 2W54A 2D3GA 2MBEA 4AS1A 2INNE 3O13A 1EUVB 3M3JA 1EO6A 4ZHPA 5DCNA 2MP2A 4GOCA 2FCSA 2DYBA 2MP2B 3NVZA 3AMZA 3IT6B 1QILA 1T0SC 3FAHA 1WH3A 2BYEA 2HJ8A 3BYYB 3CSFA 3PLVA 1H8CA 1ZGUB 1SE2A 3DWGC 4KGSA 3BVGA 2G45B 3BIID 2BT6A 5JZEB 2J0JA 1GC7A 1WFYA 3RMKC 1YN4A 3H6NA 1DOXA 1MHXA 1BMLC 3DBLB 1HE8A 4KV2A 3ZRFA 2WU2B 4XZ4A 1XCQL 2TSSA 2LD9A 2WX0A 2HDEA 4JX1C 1IUEA 2FCMA 2JPHA 2DLBA 3MTNB 1XCTL 4RGNA 2IO0B 2DYOA 1N63A 3KUDB 3UI3A 1WE6A 4N9F4 1LGRA 1CQVA 1WGYA 4DXGA 4LNNA 4XDCA 2B3AA 4MACA 1K8RB 2LMCA 4YTMB 2K3UA 5BMIA 1XQQA 3AEAB 3WAOA 4MSMB 4OZAA 1DOYA 1V9JA 5BYRA 3PZ8A 2DAJA 4IM3A 4ANXA 2LHEA 1ZW7A 4Q2JA 4RM9A 2MJDA 4K81A 3Q8EA 2LGXA 1YIWA 4YSXB 3HM3A 4ZRPA 2NBVB 4A3OA 2IPKD 3ZIMA 1FXAA 4LDTD 3QK0A 2DNFA 4M0WA 4HCNB 2JY6A 4II3B 3AE6B 4M0WB 3NUHB 4AJWA 2J0KA 3LJ3A 1SJED 2ZJDA 2BBCA 4WIPA 4HEA1 2K1FA 1V1OA 2OJWA 5EE0A 3VDZA 2M4NA 1D5ZC 1QF6A 2JX5A 3RYTA 4QAYA 3B9JA 1UBIA 1WE7A 5FK9C 1TS2A 4XC2A 4IG7B 1XEEA 2ZCBA 2K0PA 3PZDA 4EZLA 4KKJA 1RM6C 2J0MA 1L0XB 1VRAB 1YNTE 2IGGA 2QHOA 1V6EA 4IM0A 1ACCA 2WXHA 3AB5A 4YSZB 4IDIA 3E9SA 2BYTA 2CR5A 2C5LC 2KJ6A 4TSSA 3W5VB 1WGKA 4WWOA 2BF8B 4WWPA 2RDHA 3HK0A 1J7AA 4S0RA 2FIFA 4RF1A 2LGDA 2NBUA 5BMGA 4OHJA 3HUIA 1PGBA 2KDBA 2QIEB 2NBWB 1Q10A 3CWIA 3Q3JA 4LTUA 5GXGB 3ML8A 1SEBD 3W1SA 1L0YB 2D3CA 3Q2AC 1CK1A 1VZ8A 1RRBA 1NENB 2M19A 4EKUA 2IO2B 1J19A 3RNEC 2M0XA 2WDQB 3AEGB 5IN7A 2WS3B 1L0VB 4GU2A 2LFIA 4TKNA 3Q8AA 3T8MA 4ARIA 1FNUA 1C4CA 2KVZA 4BKGA 2ZNVB 2DWQA 4FXCA 4HROA 4K7SA 1UWXA 1YJ1A 3UF8A 1L2NA 1Y56A 3I63C 3P4PB 1TKGA 2WHIA 3RN9C 5G55A 3X23A 3ZNZB 2NTSA 2QEJC 3W9CB 3L0WB 1T0QC 2KKCA 3ALBA 3I3TB 1MVKA 2EKIA 1KF6B 1T3QA 1QOFA 1D6EC 2V4IB 4WJOA 1XO3A 3KH0A 2HD5B 3K9PB 3CMMB 4ANWA 4YXDB 2VZKD 5L83A 2D3AA 1JWUD 1M4VA 3LYYA 1WGDA 1YJIA 3A1QB 3ZXVA 2V9HA 1R4NI 4REZA 2KXJA 1SBBB 1C76A 4I6NB 5IA7A 2NPTA 3NVVA 1F1HA 1E7PB 4OW0A 2YEPF 1WRDB 2LXAA 1ZOYB 1OQYA 3AI5A 4CYEA 4W9EA 2RD0A 3A9KA 4DHJB 3VTVA 1OQRA 2OOBB 3RT3B 4WQOB 4RGTA 2BQQA 3SHQA 2WXRA 1QLBB 1XT9B 3FILA 1MPEA 2WWZA 1IP9A 1KH0A 3AE2B 3DBRI 1N5WA 2MX2A 1E8YA 3JSVB 3ZO5B 4WQMA 4EZKA 1VZ7A 4F1SA 3Q3FA 4ITKA 2ONQA 4MDKE 1JRPA 2J4XA 4EFOA 3PGEA 3TBLD 4FA6A 1ET6A 1N62A 2W55A 1NI3A 2SAKA 3DVGX 5D94A 4PS8A 3N20C 3IFWB 3PRPB 2AX5A 1RFAA 4S17A 4G50A 2KTRB 1L6UA 1UGJA 4ZOHC 4HWIB 1XLOA 2WLBA 3W2DA 3OG5A 2KZRA 2MJ3A 3TMPB 2DZKA 3OLMD 4GB9A 4O1NA 1XD3B 4BBNF 5CHFA 4XGAB 4C00A 3IT4B 3QC8B 2LGIA 2L76A 2RR9A 3L13A 3AE5B 3APCA 3APDA 3NZUA 1WR1A 4EOYA 4MH0E 5H92C 2K8HA 2BW2A 2WXLA 1GUAB 2BVCA 4WAFA 2MCNB 3NVWA 1HEZE 1NEKB 4W9FA 1ZXIA 2IJ0A 3M62B 3PZ7A 4MT5A 4MGIE 4NJ7A 1SB3C 3V60A 2LI5A 4WJPA 1ZE3D 2GMIC 3MC0B 5C3JB 4G11A 5IP4D 2WXGA 3HM6X 5TSSA 3PS6A 1EM7A 4PS7A 3VHTC 2WXPA 2XEWA 3R66C 2D3BA 2KANA 2IO1B 1WM3A 5CX3A 2KWVB 2W3RA 1EWYC 1UH6A 2LWPA 1ET9A 4LDTB 4I6PA 4EUTA 2C60A 3MJ5A 3QARA 2KWCA 3AE9B 4AQ7A 2KDMA 1GAQB 1FCCC 3HHMA 3KYDD 2CS4A 2KC1A 4P1BC 2CHXA 3TL5A 1TKEA 2AWTA 3AEEB 2K8CA 3RZFA 3RZWC 3NHEB 3NZ3A 3RFZB 2KWUB 1WX7A 4BKTA 3GP7A 4PYZA 3VFKA 2AL3A 1STEA 2CJNA 2K9XA 3PTFC 2JXXA 2O2VA 1WM2A 3HVDA 4AP4C 2RMMA 4P7IA 4KGRA 1D4BA 4P6VF 4F8CB 1L5PA 2LVPA 5DPWA 2LUEA 4A55A 5EE9A 3VQIA 2ZPYA 1WXAA 1TGZB 4W9DA 2M17A 2G3QB 1WRIA 1C79A 4ZRQA 5T8IA 2PKOA 2YLMA 4K7WA 1HTOA 3EGRA 3ZTDA 1PYWD 2MHJA 3BINA 4PK1A 3ZNHB 3U4EG 1FFVA 3DBLI 5G5GA 1VD2A 4C4VA 2LRWA 2KQ7A 1P9DU 5C1ZA 3R8BA 3VR9B 2D11A 1WJ4A 4W9LA 4YSYB 2K8BA 4YTPB 5KHOA 4MJSB 3TEYA 2MJEA 2KN5A 4DBGA 2QCZA 2ZW1A 3H8HA 1AYFA 3RCZA 2K6QA 4HK2A 5EE1A 1HA5A 2FUG1 1C77A 4CHKA 2KFKA 1P7EA 4W9GA 2IO3B 1T6BX 1MHHE 2KFKB 1MI0A 1WGHA 1XLNA 2PJHA 5BYQA 1FXTB 4M01A 3SEBA 4FN2A 1IGCA 2G4SA 2LXCA 3TCAA 1G6JA 2PE6B 2H88B 2IYDB 4ICUA 1Q5WB 2PE9A 4B6WA 2M1MA 3EFCA 2D10A 3ZRCA 2KDFB 1S1QB 2BB6A 3VRAB 3WALA 3L17A 2JSVX 2ZVNA 1KLVA 1WMHB 1P1AA 1IPGA 3Q6BA 3GZNB 4FJYA 1A5RA 3KQ4A 2MBQA 2WYQA 5D3DA 1V86A 2W82A 1I42A 4YWGG 1ZP0B 5AZHA 3AE8B 1TS4A 3PO0A 5KHQA 1FFUA 2BKFA 3N1YC 1SE9A 4C7ZA 2MBBB 2LVOA 2J52A 3KUCB 1TY2A 2OJRA 1E8ZA 2JYEA 4LLGM 3BK2A 3KUZA 3PSEB 1WJNA 2DZIA 1YD8U 2BTEA 2G1EA 4ZHOA 1FRRA 2DZJA 4E74A 2MW5A 1MJDA 1JWSD 3DBHB 3VUYA 1YX5B 1YX6B 1GB1A 4G0NB 3N9YC 2E6XA 4JLCA 3P4SB 2NVUI 4MM3B 3DHGC 4DDID 4TUUA 3VXWA 4XE0A 1WF9A 3NY5A 1R4MB 1PUTA 4WH4A 1XF5L 3QAQA 2RSUA 3W1YA 2UWQA 3ZLZA 4ANVA 2KX0A 5JXVA 1AN8A 4YTNB 1E5WA 2GOWA 2CU1A 3N30A 5IO9A 3ECIA 3SFEB 1F0ZA 1PFDA 2PMVA 2EMSA 4ASWC 1A70A 3PREA 2ZEQA 2Z0DB 4B95A 1E7UA 2N9EB 3VH3B 4HPLB 1H4RA 3SDLC 3H7SA 3X0WA 5AZFA 4FHJA 1WGGA 4WWMA 2FCQA 4W9HA 2CHWA 3LDZE 1JQ4A 3V05A 2WQYB 4BFRA 5AEKB 4XWTA 2WXIA 4AUQC 1K50A 2MA9B 2I1KA 3MP9A 1TYGB 2GBMA 1E0ZA 1HTQA 3JVZX 1TIFA 5BO4B 2XK5B 3T9LA 2PEAA 4A20A 2G4DB 1JWAD 1V1PB 1P7FA 3EECA 4W9JA 2KK8A 2KLCA 1PQSA 4YT0B 1KJTA 2KMMA 1V81A 4NY0A 5AUIA 1K53A 2MBOA 3N1ZC 1Z5SB 1VCBA 1RWSA 1WJ6A 2W3SA 3LXFA 1CZPA 3QX1A 4RGOS 1UNSA 3NOBA 3B08A 2YVCA 3NJTA 3PV1A 1LO5D 4GDKB 3T3NA 2ON8A 3ZVVA 1E7VA 3VTUA 1MFWA 4NZLB 1YMHE 2M56B 3WAMA 4JE3B 2Z8LA 3CSTA 1E6EB 2KQSA 4DDGD 2N7DA 3ZW3A 1DGJA 2E3TA 1LFDA 2O6VD 2V3SA 2WXJA 4GDLB 5D3IB 1JCKB 3WIMA 3RI7C 4IWQA 4US9A 2FCNA 4BOSC 2V3PA 2N4FA 4HKZE 1SXTA 3DBSA 2CJOA 5J18A 4TMAB 5C2TB 4JIOU 3SD5A 3FC4A 3ZDMC 4HPPA 2AQ1B 1E90A 2JWUA 3BYTB 3MFGA 3T3OA 1M94A 5E6NA 3W1SC 4PS3A 2FBWB 3R7QA 3AE1B 1FPYA 1J7BA 3AEDB 4NJCA 3O65B 1D3ZA 1C78A 4K3BA 1E8WA 4ZYSA 4A9AA 2DENB 4CO7A 2HJ1A 2IY1B 1Q0WB 4FLHA 1SF0A 2IBIB 3H7PB 5HG2A 3N3KB 3AH7A 4MH8A 2BWES 1B9RA 1Y8RC 1V2YA 2JWZA 4ZYNA 4KZ0A 3A1QA 4L23A 1ZDXA 4GGQA 3VTWA 2AL6A 4GLSC 1RFKA 3UGBB 4IWOA 3PT2B 2INDC 3DHIC 1K52A 3P42A 1GB4A 2D5GA 2PTLA 4AOFA 1WWTA 2KACA 2YEPB 3P4RB 2L0FA 2N0SB 3R2TA 2JXTA 1T0YA 3AM9A 1TZOA 3Q14C 3M63B 4X57B 5E6PA 3V62A 3URYA 3JSVA 1WJUA 2NCNA 4WWNA 3L08A 1E10A 3WAPA 3VUWA 4MGYE 3P4QB 3TJPA 3Q8BA 3HRDD 4M00A 4N6EB 1RYJA 2NMQA 3RUIB 1FIQA 4L1BA 4JGHB 2KTRA 3KWLA 5DPRA 1TBEA 2FAZA 1OGWA 2AEHA 2HTME 1BXTA 1UF0A 2ASQA 4ZDVA 1X1MA 2LEKA 5D7GA 1V5OA 3A4SC 1TS5A 2LHDA 1SIFA 4BBNC 1L4ZB 2WX1A 2EELA 1GNUA 1XLPA 3U8ZA 3MC9A 3V61A 2K25A 1LM8B 5HI1A 2EKEC 1T0RC 2UYZB 1ISNA 4KX6B 1EU3A 2UU7A 4JWUC 4ZRIA 4DQOC 3DVGY 1V80A 3UQBA 2Y5CA 1R4NB 1HQRD 3AECB 3QQ8B 4HPMB 3V3XA 4B0MA 4OZBA 1I35A 2RGFA 4W9KA 2M0AA 4LNOA 3IBEA 2N9KA 3B2FA 1UGMA 5LLIA 1FD6A 2NS5A 1L7YA 1UBQA 4NAWB 1BUIC 3NRZA 4KDLB 2AYOB 2WXFA 4IUMB 1VR9A 2L32A 1KTKA 1WYWB 2WXNA 1CMXB 4C7YA 2LASA 3IXSA 3AE7B 4GIVA 4EE2A 1LQBA 1KRHA 4KDIC 2L05A 3AU4A 2IGHA 4NPNA 2V3NA 1OEYJ 4AWJA 3DBRB 1TZ1A 3PLUA 2C7NB 2EMTA 2MQJA 2GRIA 2VRRB 1TY0A 1ENFA 1QT9A 1WSPA 1DOIA 2GBJA 1EWCA 1VLBA 3BVZA 3Q3MC 1RLFA 1TS3A 1NYRA 3AE4B 3L10B 2LRUA 2IGDA 4LJPB 1IYFA 4ZRJA 5E6JA 3D32A 1SSNA 3SR6A 2FNJB 2MLBA 2A5UA 3A9JA 1FNWA 1NYQA 3PHXB 3A9JB 1F2RI 4P16A 3ZJTA 5MPOA 2J53A 1TTNA 3MJWA 3PHWB 5G5HA 2R2QA 1EF1A 4IW0A 4GN1A 2GB1A 5IOIA 2KO3A 2IDYA 3EA6A 1YQ3B 1V97A 4DWFA 1ROEA 5FR6A 2LGYA 1J0GA 3C8YA 2WDVB 2JF5A 3P2BA 1EU4A 1UWMA 2N9LA 4FHKA 2QILA 5HKHA 3GE3C 4KSKC 2KOXA 4RMAA 2LVQA 2ZVOA 1JMLA 3SFDB 3KYCD 2IZVB 2L52A 2JZ3B 4FADA 2I1JA 2CKHB 2O6VB 2LGSA 3PPAA 4MJSA 3AN1A 1HZ6A 2DX5B 2FUHB 4M8NA 1P3QU 4LJOB 4NQKE 1OEYA 2KDIA 2K39A 3H9DA 4JWSC 1WZ3A 3Q3OC 1AWDA 4CQNA 2JQRB 3QCAA 4BKSA 4HVBA 5TR5A 4US8A 1FRDA 3RNBC 2N1WA 3KLSX 2Z0EB 1ZPSA 4EZJA 3KWVA 1WY8A 1ZDVA 5IKCM 2KD0A 4PYUA 2LJ5A 2KJHB 4LCDE 1NVID 2BB5A 1WXQA 2C7MB 4M02A 2L00B 1WMHA 3IVFA 3E56A 3IAM1 3NVYA 3QWZB 4W9CA 2C7HA 2VH2A 1I4PA 1HXYD 2INCC 3EC8A 2C9WB 4HDOA 3RPFC 3GB1A 3AXCA 4FJZA 2VZKB 1JRUA 3GS2A 2DHZA 3V6EB 2XN9C 1F2RC 2Q5WD 2KX3A 4HXDA 3BK1A 1FM0D 3WANA 1UZXB 2Y5BB 4LK0M 3MHSD 2LJIA 4FBJB 2KJRA 4BOZB 1FEHA 1JW9D 4C56C 5D6JB 3UIPB 1FXIA 1YJJA 1F52A 2GBNA 1NDDA 2D07B 1ESFA 3EHVA 2GLSA 1B1ZA 1Q1OA 2R61A 1YN3A 2V4LA
chains in the Genus database with same CATH topology
3TBLD 4FA6A 1LXDA 3CSTA 2KQSA 4KSLC 3DVGX 5D94A 4MELA 4PS8A 4DDGD 2N7DA 3ZW3A 3IFWB 3PRPB 1LFDA 2O6VD 2V3SA 4URKA 4GDLB 3WIMA 3PRMB 4IWQA 1RFAA 4MM3A 4MEMA 4G50A 2KTRB 4F7ZA 2FCNA 4BOSC 4HWIB 2MBHA 2N4FA 3DBSA 1WZ0A 4WAAA 5J18A 2KZRA 1Z2MA 1WX9A 3TMPB 2DZKA 3OLMD 4GB9A 2KHWB 2O6VA 3QIJA 4EEWA 5J17A 3U7DA 4JIOU 3SD5A 3ZDMC 3ML9A 1XD3B 1E90A 2KLGA 2Z59B 4BBNF 2BGFA 4K1RB 5CHFA 1WI0A 4MGZE 4HJKA 3DQVA 1OTRB 3QC8B 2GBKA 2L76A 3DDCB 1M94A 2RR9A 2L7RA 3L13A 2BPSA 5E6NA 3W1SC 3TIXA 4PS3A 3APCA 3DBHI 3R7QA 3APDA 5GMVA 3NZUA 1WR1A 4EOYA 1MG8A 4MH0E 3UINB 2KVRA 2K8HA 2NR2A 3O65B 1D3ZA 1GUAB 2A4ZA 2MCNB 3QA8A 1E8WA 1V5TA 1WX8A 4W9FA 2DENB 4CO7A 1EF5A 2ZCCA 2IY1B 2BYFA 1Q0WB 4J6IA 4FLHA 2JUOA 3PRZA 2IBIB 1R4MI 2J7QB 3M62B 4E71A 3SU8X 3KW5B 4MGIE 4NJ7A 3H7PB 3ONSA 3V60A 2LI5A 3HIZA 4M8MA 4WJPA 4DHZE 3N3KB 4BVUC 3K9OB 2M8SA 2GMIC 4WJNA 2BWES 4G11A 1Y8RC 2KC2A 5LXHA 1V2YA 2BYVE 2JWZA 2PPHA 3VUXA 3HM6X 3DVNV 4ZYNA 4KZ0A 3A1QA 1BT0A 3PS6A 4PS7A 4DHJD 4AJYB 4DK5A 3KVFB 4GGQA 3VTWA 3NS8A 1UELA 2AL6A 3QHTA 2XEWA 3VHTC 3RULA 3UGBB 4IWOA 3R66C 4I6LB 2W9NA 4K7UA 3PT2B 2D3GA 2KANA 2MBEA 2XK5A 2IO1B 1WM3A 5CX3A 2KWVB 2KTFA 1UH6A 2LWPA 4LDTB 4I6PA 4AOFA 4EUTA 1EUVB 2C60A 2WDTB 3M3JA 1EO6A 3QARA 4DHZB 2KWCA 4TQ0A 5DCNA 2N9XA 2L0FA 1WXVA 2MP2A 1WGRA 4TV3A 5LXIB 1T0YA 3HHMA 3KYDD 4GOCA 2CS4A 2FCSA 2KC1A 2DYBA 2CHXA 1RAXA 2MP2B 2V1YA 4OVVA 3TL5A 2BWFA 4II2B 3VAWA 3DOWA 4A3PA 2MRPA 2AWTA 1WH3A 3M63B 3JYUA 4X57B 2BYEA 2HJ8A 2K8CA 3CSFA 5E6PA 3RZFA 3RZWC 3NHEB 3PLVA 3V62A 2KWUB 3ZUNA 1WX7A 3AU5A 3WA0A 1ZGUB 4FULA 1H8CA 2G45B 2LZ6A 3JSVA 4BKTA 1WJUA 4KVGB 2NCNA 4GDKA 4WWNA 4PYZA 3L08A 3VFKA 5CTRC 2AL3A 2KNBA 5JZEB 2IY0B 2J0JA 1GC7A 1WFYA 3WAPA 3PTFC 3VUWA 2JXXA 2O2VA 4MGYE 3TJPA 1WM2A 2L8JA 4AP4C 3H6NA 4P7IA 4MSQB 4F8CB 2LVPA 5DPWA 2LUEA 3N32A 1HE8A 4KV2A 3ZRFA 4GDLA 4XZ4A 3RUIB 3VQIA 2LD9A 4JGHB 2KTRA 5CHWA 3R7RA 2WX0A 1WIAA 4RM8A 5DPRA 5AZGA 2ZPYA 1WXAA 2FCMA 1TGZB 1TBEA 2FAZA 2JPHA 3NZSA 3OJ3A 4W9DA 1OGWA 2AEHA 2M17A 3MTNB 2ZPNA 2G3QB 2IO0B 2ASQA 3C0RB 4ZDVA 2DYOA 3AULA 3KUDB 4HDQA 1WE6A 1X1MA 2YLMA 4N9F4 5DPTA 4K7WA 5D7GA 1V5OA 1WGYA 1GC6A 3A4SC 3RD2A 2K6DB 1SGHA 3ZTDA 2B3AA 1SIFA 3BINA 4BBNC 1K8RB 2WX1A 4IWPA 3DCGA 3ZNHB 1GNUA 4WJQA 1XQQA 4G3XB 3DVNU 3DBLI 1VD2A 3WAOA 3BY4B 3U8ZA 4MSMB 2LRWA 3V61A 2K25A 1LM8B 1P9DU 2KQ7A 5C1ZA 1S3SG 2EKEC 1V9JA 2D11A 1WJ4A 4W9LA 2UYZB 2K8BA 2DAJA 1ISNA 4IM3A 2HE7A 4ANXA 5D2MB 4ZRIA 3B1LX 4MJSB 5KHOA 1UD7A 1ZW7A 4RM9A 1P0RA 3H7PA 3DVGY 1V80A 3OJ4B 4K81A 1GG3A 3UQBA 4BKSD 4ANUA 3UQAA 3QQ8B 2KN5A 4DBGA 4HPMB 2LGXA 1GJZA 1YIWA 1I35A 3EFUA 3RCZA 2K6QA 2RGFA 3HM3A 4NQLB 4HK2A 2ZNVC 2NBVB 1E8XA 4W9KA 4A3OA 3IBEA 1UGMA 5LLIA 3ZIMA 4CHKA 2KFKA 3ENEA 4LDTD 2NS5A 3QK0A 4W9GA 5JHAA 2IO3B 4HCNB 1L7YA 1UBQA 2JY6A 2KFKB 4II3B 4NAWB 1WGHA 2PJHA 1ZKHA 1FXTB 2AYOB 4KDLB 4M0WB 4IUMB 4AJWA 4FN2A 2J0KA 3V6CB 3LJ3A 4YL8A 2GBRA 1WYWB 1KM7A 2G4SA 2ZJDA 1CMXB 2LXCA 3TCAA 1G6JA 2PE6B 2IYDB 2K1FA 4ICUA 2N9PC 2LASA 3QJZA 1Q5WB 4GIVA 2KDEB 3VDZA 1LQBA 2M4NA 4KDIC 5J2RA 3R3MA 2L05A 2PE9A 3AU4A 5E6OA 5IAAC 4B6WA 4JL9A 4NPNA 2HTHA 1OEYJ 2M1MA 4JQWC 2D10A 3ZRCA 3RYTA 4AWJA 1TZ1A 3PLUA 2KDFB 5EDSA 2C7NB 2EMTA 1S1QB 2MQJA 2JRHA 3WALA 3L17A 1UBIA 2DYMA 2VRRB 1WE7A 1V49A 2ZZPB 2ZVNA 1KLVA 1C1YB 1P1AA 1IPGA 1WMHB 1WXSA 2GBJA 4IG7B 2R2OA 2ZCBA 4XC2A 3PZDA 4EZLA 5JH5C 4FJYA 3UIOB 1A5RA 3A4RA 2NPTB 1RLFA 2MBQA 5CHVC 3ZNID 2J0MA 2WYQA 4DXAB 3L10B 1V86A 3S2AA 2LRUA 1V6EA 2QHOA 4IM0A 3A9KB 1I42A 5AZHA 4LJPB 2CR5A 2C5LC 2KJ6A 3IHPC 1IYFA 5KHQA 4ZRJA 3D32A 2BKFA 4WWOA 1SE9A 2BF8B 4WWPA 2FNJB 2JT4B 2A5UA 2MLBA 2MSED 3A9JA 2MBBB 5JHBA 2LVOA 3HK0A 3B0AA 3KUCB 1C3TA 3PHXB 3A9JB 2OJRA 3ZNGC 2RPQA 1E8ZA 3L54A 2FIFA 4IC7B 3ZTCA 4B9KA 1TTNA 3MJWA 3KUZA 3PHWB 3ZKJC 3PSEB 1WJNA 4IM2A 2DZIA 1U4AA 1YD8U 2KMCA 4ICVA 2R2QA 1EF1A 2JRIB 2LGDA 4IW0A 2KMAA 2NBUA 4GN1A 3H1UA 2DZJA 4E74A 2JVCA 2MW5A 2KDBA 4NJ6A 2KO3A 2NBWB 5DPSA 3VUYA 1YX5B 1YX6B 2MWSB 1NBFC 4DWFA 4FJVB 3APFA 1J8CA 5FR6A 3Q3JA 2LGYA 4G0NB 1J0GA 3P2BA 2JF5A 3PVLA 4FHKA 4JLCA 1WXMA 2NVUI 3W1SA 1WR6E 3ML8A 5HKHA 5G2NA 4KSKC 2KOXA 2N7EA 4RMAA 1P98A 4DDID 2LVQA 4TUUA 3VH4B 2ZVOA 1WF9A 3VXWA 3NY5A 3OAWA 1KOTA 3KYCD 3VVWB 2IZVB 1RRBA 2JZ3B 4FADA 4EKUA 5C23A 2IO2B 1J19A 2I1JA 4E3CA 4W9IA 2JZZA 2M0XA 2CKHB 2O6VB 2KFJA 2D2QA 3QAQA 2RSUA 3W1YA 3PPAA 2UWQA 3ZLZA 4ANVA 2KX0A 4MJSA 4TQ1A 2DX5B 4GU2A 2FUHB 4TKNA 3T8MA 4M8NA 1E5WA 1P3QU 2GOWA 4LJOB 4NQKE 1OEYA 2CU1A 4HCPB 2KDIA 3N30A 2K39A 3ECIA 3H9DA 4BKGA 4GSWA 2BKRB 2EMSA 1WZ3A 4ASWC 2ZNVB 2L3ZA 3PREA 2ZEQA 2Z0DB 4K7SA 4B95A 1YJ1A 4XX5A 2REXA 3UF8A 1L2NA 1E7UA 4NAWA 2N9EB 3QCAA 4HPLB 1H4RA 3VH3B 5TR5A 4BKSA 3SDLC 2XBBC 4HVBA 5G55A 3H7SA 3X23A 3JW0X 3X0WA 5AZFA 3ZNZB 3L0WB 2N1WA 2Z0EB 4EZJA 2KKCA 3CF6E 3IG3A 1WGGA 3ALBA 3I3TB 4FHJA 1WY8A 4KZCA 2FCQA 2KD0A 4GMVA 4WJOA 4PYUA 2LJ5A 3KH0A 4W9HA 2HD5B 2CHWA 4KIKA 3LDZE 3K9PB 1NI2A 3CMMB 4BFRA 3A33B 4MGKE 4KIKB 4ANWA 2DZMA 2KJHB 5AEKB 2CHZA 5L83A 4LCDE 4NNJB 4AUQC 1WGDA 3GOEA 4GXBA 2MA9B 2I1KA 3M95A 2C7MB 3A1QB 2L00B 2GBMA 1WMHA 3IVFA 1R4NI 3QWZB 3JVZX 4W9CA 2KXJA 2C7HA 4OVUA 3U30A 5IA7A 4I6NB 1AARA 2NPTA 3EC8A 2C9WB 2L0TA 4HDOA 1WRDB 2LXAA 5BO4B 2XK5B 3AXCA 4FJZA 1OQYA 2PEAA 3T9LA 4A20A 3AI5A 1JRUA 4HLEA 4CYEA 4W9EA 2DHZA 2G4DB 2RD0A 3A9KA 3DPDA 3V6EB 3VTVA 4DHJB 2OOBB 3RT3B 2DAFA 2KX3A 3EECA 4HXDA 4W9JA 4WQOB 5L95C 2KK8A 2KLCA 1PQSA 1YQBA 2FIDA 3SHQA 1KJTA 3WANA 1V81A 1UZXB 1XT9B 4NY0A 2MBOA 2Y5BB 1Z5SB 1VCBA 1WJ6A 3MHSD 4FBJB 2KJRA 4BOZB 3QX1A 2WWZA 1IP9A 3NOBA 5D6JB 3UIPB 3B08A 3DBRI 3L16A 2MX2A 1E8YA 2GBNA 2N1VA 2YVCA 3PV1A 1NDDA 3JSVB 3ZO5B 2D07B 4GDKB 3ZDTA 3ZVVA 4EZKA 1E7VA 1QZEA 3EHVA 3VTUA 4F1SA 1F9JA 3Q3FA 2O2VB 4MDKE 1Q1OA 3GZNI 3WAMA 4EFOA 3PGEA 4ZRKA 2V4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TBL D;  4FA6 A;  1LXD A;  3CST A;  2KQS A;  4KSL C;  3DVG X;  5D94 A;  4MEL A;  4PS8 A;  4DDG D;  2N7D A;  3ZW3 A;  3IFW B;  3PRP B;  1LFD A;  2O6V D;  2V3S A;  4URK A;  4GDL B;  3WIM A;  3PRM B;  4IWQ A;  1RFA A;  4MM3 A;  4MEM A;  4G50 A;  2KTR B;  4F7Z A;  2FCN A;  4BOS C;  4HWI B;  2MBH A;  2N4F A;  3DBS A;  1WZ0 A;  4WAA A;  5J18 A;  2KZR A;  1Z2M A;  1WX9 A;  3TMP B;  2DZK A;  3OLM D;  4GB9 A;  2KHW B;  2O6V A;  3QIJ A;  4EEW A;  5J17 A;  3U7D A;  4JIO U;  3SD5 A;  3ZDM C;  3ML9 A;  1XD3 B;  1E90 A;  2KLG A;  2Z59 B;  4BBN F;  2BGF A;  4K1R B;  5CHF A;  1WI0 A;  4MGZ E;  4HJK A;  3DQV A;  1OTR B;  3QC8 B;  2GBK A;  2L76 A;  3DDC B;  1M94 A;  2RR9 A;  2L7R A;  3L13 A;  2BPS A;  5E6N A;  3W1S C;  3TIX A;  4PS3 A;  3APC A;  3DBH I;  3R7Q A;  3APD A;  5GMV A;  3NZU A;  1WR1 A;  4EOY A;  1MG8 A;  4MH0 E;  3UIN B;  2KVR A;  2K8H A;  2NR2 A;  3O65 B;  1D3Z A;  1GUA B;  2A4Z A;  2MCN B;  3QA8 A;  1E8W A;  1V5T A;  1WX8 A;  4W9F A;  2DEN B;  4CO7 A;  1EF5 A;  2ZCC A;  2IY1 B;  2BYF A;  1Q0W B;  4J6I A;  4FLH A;  2JUO A;  3PRZ A;  2IBI B;  1R4M I;  2J7Q B;  3M62 B;  4E71 A;  3SU8 X;  3KW5 B;  4MGI E;  4NJ7 A;  3H7P B;  3ONS A;  3V60 A;  2LI5 A;  3HIZ A;  4M8M A;  4WJP A;  4DHZ E;  3N3K B;  4BVU C;  3K9O B;  2M8S A;  2GMI C;  4WJN A;  2BWE S;  4G11 A;  1Y8R C;  2KC2 A;  5LXH A;  1V2Y A;  2BYV E;  2JWZ A;  2PPH A;  3VUX A;  3HM6 X;  3DVN V;  4ZYN A;  4KZ0 A;  3A1Q A;  1BT0 A;  3PS6 A;  4PS7 A;  4DHJ D;  4AJY B;  4DK5 A;  3KVF B;  4GGQ A;  3VTW A;  3NS8 A;  1UEL A;  2AL6 A;  3QHT A;  2XEW A;  3VHT C;  3RUL A;  3UGB B;  4IWO A;  3R66 C;  4I6L B;  2W9N A;  4K7U A;  3PT2 B;  2D3G A;  2KAN A;  2MBE A;  2XK5 A;  2IO1 B;  1WM3 A;  5CX3 A;  2KWV B;  2KTF A;  1UH6 A;  2LWP A;  4LDT B;  4I6P A;  4AOF A;  4EUT A;  1EUV B;  2C60 A;  2WDT B;  3M3J A;  1EO6 A;  3QAR A;  4DHZ B;  2KWC A;  4TQ0 A;  5DCN A;  2N9X A;  2L0F A;  1WXV A;  2MP2 A;  1WGR A;  4TV3 A;  5LXI B;  1T0Y A;  3HHM A;  3KYD D;  4GOC A;  2CS4 A;  2FCS A;  2KC1 A;  2DYB A;  2CHX A;  1RAX A;  2MP2 B;  2V1Y A;  4OVV A;  3TL5 A;  2BWF A;  4II2 B;  3VAW A;  3DOW A;  4A3P A;  2MRP A;  2AWT A;  1WH3 A;  3M63 B;  3JYU A;  4X57 B;  2BYE A;  2HJ8 A;  2K8C A;  3CSF A;  5E6P A;  3RZF A;  3RZW C;  3NHE B;  3PLV A;  3V62 A;  2KWU B;  3ZUN A;  1WX7 A;  3AU5 A;  3WA0 A;  1ZGU B;  4FUL A;  1H8C A;  2G45 B;  2LZ6 A;  3JSV A;  4BKT A;  1WJU A;  4KVG B;  2NCN A;  4GDK A;  4WWN A;  4PYZ A;  3L08 A;  3VFK A;  5CTR C;  2AL3 A;  2KNB A;  5JZE B;  2IY0 B;  2J0J A;  1GC7 A;  1WFY A;  3WAP A;  3PTF C;  3VUW A;  2JXX A;  2O2V A;  4MGY E;  3TJP A;  1WM2 A;  2L8J A;  4AP4 C;  3H6N A;  4P7I A;  4MSQ B;  4F8C B;  2LVP A;  5DPW A;  2LUE A;  3N32 A;  1HE8 A;  4KV2 A;  3ZRF A;  4GDL A;  4XZ4 A;  3RUI B;  3VQI A;  2LD9 A;  4JGH B;  2KTR A;  5CHW A;  3R7R A;  2WX0 A;  1WIA A;  4RM8 A;  5DPR A;  5AZG A;  2ZPY A;  1WXA A;  2FCM A;  1TGZ B;  1TBE A;  2FAZ A;  2JPH A;  3NZS A;  3OJ3 A;  4W9D A;  1OGW A;  2AEH A;  2M17 A;  3MTN B;  2ZPN A;  2G3Q B;  2IO0 B;  2ASQ A;  3C0R B;  4ZDV A;  2DYO A;  3AUL A;  3KUD B;  4HDQ A;  1WE6 A;  1X1M A;  2YLM A;  4N9F 4;  5DPT A;  4K7W A;  5D7G A;  1V5O A;  1WGY A;  1GC6 A;  3A4S C;  3RD2 A;  2K6D B;  1SGH A;  3ZTD A;  2B3A A;  1SIF A;  3BIN A;  4BBN C;  1K8R B;  2WX1 A;  4IWP A;  3DCG A;  3ZNH B;  1GNU A;  4WJQ A;  1XQQ A;  4G3X B;  3DVN U;  3DBL I;  1VD2 A;  3WAO A;  3BY4 B;  3U8Z A;  4MSM B;  2LRW A;  3V61 A;  2K25 A;  1LM8 B;  1P9D U;  2KQ7 A;  5C1Z A;  1S3S G;  2EKE C;  1V9J A;  2D11 A;  1WJ4 A;  4W9L A;  2UYZ B;  2K8B A;  2DAJ A;  1ISN A;  4IM3 A;  2HE7 A;  4ANX A;  5D2M B;  4ZRI A;  3B1L X;  4MJS B;  5KHO A;  1UD7 A;  1ZW7 A;  4RM9 A;  1P0R A;  3H7P A;  3DVG Y;  1V80 A;  3OJ4 B;  4K81 A;  1GG3 A;  3UQB A;  4BKS D;  4ANU A;  3UQA A;  3QQ8 B;  2KN5 A;  4DBG A;  4HPM B;  2LGX A;  1GJZ A;  1YIW A;  1I35 A;  3EFU A;  3RCZ A;  2K6Q A;  2RGF A;  3HM3 A;  4NQL B;  4HK2 A;  2ZNV C;  2NBV B;  1E8X A;  4W9K A;  4A3O A;  3IBE A;  1UGM A;  5LLI A;  3ZIM A;  4CHK A;  2KFK A;  3ENE A;  4LDT D;  2NS5 A;  3QK0 A;  4W9G A;  5JHA A;  2IO3 B;  4HCN B;  1L7Y A;  1UBQ A;  2JY6 A;  2KFK B;  4II3 B;  4NAW B;  1WGH A;  2PJH A;  1ZKH A;  1FXT B;  2AYO B;  4KDL B;  4M0W B;  4IUM B;  4AJW A;  4FN2 A;  2J0K A;  3V6C B;  3LJ3 A;  4YL8 A;  2GBR A;  1WYW B;  1KM7 A;  2G4S A;  2ZJD A;  1CMX B;  2LXC A;  3TCA A;  1G6J A;  2PE6 B;  2IYD B;  2K1F A;  4ICU A;  2N9P C;  2LAS A;  3QJZ A;  1Q5W B;  4GIV A;  2KDE B;  3VDZ A;  1LQB A;  2M4N A;  4KDI C;  5J2R A;  3R3M A;  2L05 A;  2PE9 A;  3AU4 A;  5E6O A;  5IAA C;  4B6W A;  4JL9 A;  4NPN A;  2HTH A;  1OEY J;  2M1M A;  4JQW C;  2D10 A;  3ZRC A;  3RYT A;  4AWJ A;  1TZ1 A;  3PLU A;  2KDF B;  5EDS A;  2C7N B;  2EMT A;  1S1Q B;  2MQJ A;  2JRH A;  3WAL A;  3L17 A;  1UBI A;  2DYM A;  2VRR B;  1WE7 A;  1V49 A;  2ZZP B;  2ZVN A;  1KLV A;  1C1Y B;  1P1A A;  1IPG A;  1WMH B;  1WXS A;  2GBJ A;  4IG7 B;  2R2O A;  2ZCB A;  4XC2 A;  3PZD A;  4EZL A;  5JH5 C;  4FJY A;  3UIO B;  1A5R A;  3A4R A;  2NPT B;  1RLF A;  2MBQ A;  5CHV C;  3ZNI D;  2J0M A;  2WYQ A;  4DXA B;  3L10 B;  1V86 A;  3S2A A;  2LRU A;  1V6E A;  2QHO A;  4IM0 A;  3A9K B;  1I42 A;  5AZH A;  4LJP B;  2CR5 A;  2C5L C;  2KJ6 A;  3IHP C;  1IYF A;  5KHQ A;  4ZRJ A;  3D32 A;  2BKF A;  4WWO A;  1SE9 A;  2BF8 B;  4WWP A;  2FNJ B;  2JT4 B;  2A5U A;  2MLB A;  2MSE D;  3A9J A;  2MBB B;  5JHB A;  2LVO A;  3HK0 A;  3B0A A;  3KUC B;  1C3T A;  3PHX B;  3A9J B;  2OJR A;  3ZNG C;  2RPQ A;  1E8Z A;  3L54 A;  2FIF A;  4IC7 B;  3ZTC A;  4B9K A;  1TTN A;  3MJW A;  3KUZ A;  3PHW B;  3ZKJ C;  3PSE B;  1WJN A;  4IM2 A;  2DZI A;  1U4A A;  1YD8 U;  2KMC A;  4ICV A;  2R2Q A;  1EF1 A;  2JRI B;  2LGD A;  4IW0 A;  2KMA A;  2NBU A;  4GN1 A;  3H1U A;  2DZJ A;  4E74 A;  2JVC A;  2MW5 A;  2KDB A;  4NJ6 A;  2KO3 A;  2NBW B;  5DPS A;  3VUY A;  1YX5 B;  1YX6 B;  2MWS B;  1NBF C;  4DWF A;  4FJV B;  3APF A;  1J8C A;  5FR6 A;  3Q3J A;  2LGY A;  4G0N B;  1J0G A;  3P2B A;  2JF5 A;  3PVL A;  4FHK A;  4JLC A;  1WXM A;  2NVU I;  3W1S A;  1WR6 E;  3ML8 A;  5HKH A;  5G2N A;  4KSK C;  2KOX A;  2N7E A;  4RMA A;  1P98 A;  4DDI D;  2LVQ A;  4TUU A;  3VH4 B;  2ZVO A;  1WF9 A;  3VXW A;  3NY5 A;  3OAW A;  1KOT A;  3KYC D;  3VVW B;  2IZV B;  1RRB A;  2JZ3 B;  4FAD A;  4EKU A;  5C23 A;  2IO2 B;  1J19 A;  2I1J A;  4E3C A;  4W9I A;  2JZZ A;  2M0X A;  2CKH B;  2O6V B;  2KFJ A;  2D2Q A;  3QAQ A;  2RSU A;  3W1Y A;  3PPA A;  2UWQ A;  3ZLZ A;  4ANV A;  2KX0 A;  4MJS A;  4TQ1 A;  2DX5 B;  4GU2 A;  2FUH B;  4TKN A;  3T8M A;  4M8N A;  1E5W A;  1P3Q U;  2GOW A;  4LJO B;  4NQK E;  1OEY A;  2CU1 A;  4HCP B;  2KDI A;  3N30 A;  2K39 A;  3ECI A;  3H9D A;  4BKG A;  4GSW A;  2BKR B;  2EMS A;  1WZ3 A;  4ASW C;  2ZNV B;  2L3Z A;  3PRE A;  2ZEQ A;  2Z0D B;  4K7S A;  4B95 A;  1YJ1 A;  4XX5 A;  2REX A;  3UF8 A;  1L2N A;  1E7U A;  4NAW A;  2N9E B;  3QCA A;  4HPL B;  1H4R A;  3VH3 B;  5TR5 A;  4BKS A;  3SDL C;  2XBB C;  4HVB A;  5G55 A;  3H7S A;  3X23 A;  3JW0 X;  3X0W A;  5AZF A;  3ZNZ B;  3L0W B;  2N1W A;  2Z0E B;  4EZJ A;  2KKC A;  3CF6 E;  3IG3 A;  1WGG A;  3ALB A;  3I3T B;  4FHJ A;  1WY8 A;  4KZC A;  2FCQ A;  2KD0 A;  4GMV A;  4WJO A;  4PYU A;  2LJ5 A;  3KH0 A;  4W9H A;  2HD5 B;  2CHW A;  4KIK A;  3LDZ E;  3K9P B;  1NI2 A;  3CMM B;  4BFR A;  3A33 B;  4MGK E;  4KIK B;  4ANW A;  2DZM A;  2KJH B;  5AEK B;  2CHZ A;  5L83 A;  4LCD E;  4NNJ B;  4AUQ C;  1WGD A;  3GOE A;  4GXB A;  2MA9 B;  2I1K A;  3M95 A;  2C7M B;  3A1Q B;  2L00 B;  2GBM A;  1WMH A;  3IVF A;  1R4N I;  3QWZ B;  3JVZ X;  4W9C A;  2KXJ A;  2C7H A;  4OVU A;  3U30 A;  5IA7 A;  4I6N B;  1AAR A;  2NPT A;  3EC8 A;  2C9W B;  2L0T A;  4HDO A;  1WRD B;  2LXA A;  5BO4 B;  2XK5 B;  3AXC A;  4FJZ A;  1OQY A;  2PEA A;  3T9L A;  4A20 A;  3AI5 A;  1JRU A;  4HLE A;  4CYE A;  4W9E A;  2DHZ A;  2G4D B;  2RD0 A;  3A9K A;  3DPD A;  3V6E B;  3VTV A;  4DHJ B;  2OOB B;  3RT3 B;  2DAF A;  2KX3 A;  3EEC A;  4HXD A;  4W9J A;  4WQO B;  5L95 C;  2KK8 A;  2KLC A;  1PQS A;  1YQB A;  2FID A;  3SHQ A;  1KJT A;  3WAN A;  1V81 A;  1UZX B;  1XT9 B;  4NY0 A;  2MBO A;  2Y5B B;  1Z5S B;  1VCB A;  1WJ6 A;  3MHS D;  4FBJ B;  2KJR A;  4BOZ B;  3QX1 A;  2WWZ A;  1IP9 A;  3NOB A;  5D6J B;  3UIP B;  3B08 A;  3DBR I;  3L16 A;  2MX2 A;  1E8Y A;  2GBN A;  2N1V A;  2YVC A;  3PV1 A;  1NDD A;  3JSV B;  3ZO5 B;  2D07 B;  4GDK B;  3ZDT A;  3ZVV A;  4EZK A;  1E7V A;  1QZE A;  3EHV A;  3VTU A;  4F1S A;  1F9J A;  3Q3F A;  2O2V B;  4MDK E;  1Q1O A;  3GZN I;  3WAM A;  4EFO A;  3PGE A;  4ZRK A;  2V4L A; 
#chains in the Genus database with same CATH topology
 1LXD A;  2KN4 A;  2Y5P A;  4ARC A;  4MEL A;  2K22 A;  1D5X C;  3PRM B;  3I57 A;  1QOG A;  4MM3 A;  2RDG A;  2WXM A;  4F7Z A;  2L83 A;  5EE3 A;  2WXO A;  4RGM A;  1SE4 A;  1WZ0 A;  4WAA A;  1WX9 A;  2KHW B;  4EEW A;  2BGF A;  4K1R B;  1WI0 A;  4MGZ E;  3GE8 C;  4HJK A;  3DQV A;  3ZYY X;  1OTR B;  4RCO A;  1FNV A;  3AV8 A;  4A8X C;  2GBK A;  1XXG A;  1L6V A;  1PGX A;  5GMV A;  1GPX A;  2KVR A;  3TSS A;  3FKY A;  2NR2 A;  2JYT A;  1YOV B;  4XYC A;  2OHF A;  3QA8 A;  1WX8 A;  1EF5 A;  1IBX A;  2ZCC A;  2I2Y A;  2BYF A;  4J6I A;  1IBX B;  4XDD A;  2J7Q B;  4E71 A;  3SU8 X;  3KW5 B;  3ONS A;  2QSD A;  3HIZ A;  4DHZ E;  3Q3N C;  3K9O B;  1VDV A;  2M8S A;  3WCQ A;  4WJN A;  1I4G A;  2OED A;  2KC2 A;  2BYV E;  4L2Y A;  4HJG E;  3LB8 C;  2WU5 B;  4DK5 A;  3KVF B;  1UEL A;  4I6L B;  2W9N A;  1VZ6 A;  4DXF A;  4K7U A;  1ZUD 2;  1IGD A;  3I9V 1;  2XK5 A;  4OZC A;  4BAX A;  2G9H D;  2KTF A;  5HFY A;  1JWM D;  1V1P A;  1E9M A;  1T5X D;  2WDT B;  4TQ0 A;  4DHZ B;  3BVM A;  2N9X A;  1WXV A;  3AEB B;  1WGR A;  1N5X A;  4TV3 A;  5LXI B;  3ZNG C;  4OVV A;  1RAX A;  2V1Y A;  2BWF A;  4II2 B;  4HKQ A;  2J42 A;  3VAW A;  3DOW A;  4A3P A;  1I4Q A;  2MRP A;  3JYU A;  3OWE B;  4BZA A;  3ZUN A;  3AU5 A;  3WA0 A;  4FUL A;  2LZ6 A;  1QOB A;  4KVG B;  4GDK A;  1FO4 A;  4H2A A;  5CTR C;  2KNB A;  2IY0 B;  3IAS 1;  2L8J A;  5BYS A;  1QQR A;  4MSQ B;  2DBY A;  2GI9 A;  3N32 A;  2JU6 X;  4GDL A;  1CJE A;  5LNK 1;  2WGS A;  5CHW A;  3R7R A;  3L4P A;  1WIA A;  4RM8 A;  2BS3 B;  2X8X X;  5AZG A;  3EUB 2;  3NZS A;  3OJ3 A;  4KKI A;  2ZPN A;  3B2G A;  3C0R B;  3J9C A;  1N60 A;  3AUL A;  1N61 A;  4HDQ A;  5DPT A;  3RNF C;  3RD2 A;  1GC6 A;  2K6D B;  2KAJ A;  1SGH A;  5HHD G;  1I4R A;  3ABV B;  5I4D A;  3ZJV A;  4IWP A;  3DCG A;  2WXQ A;  4WJQ A;  4G3X B;  3DVN U;  3BY4 B;  1S3S G;  4LNF A;  2HE7 A;  5D2M B;  3B1L X;  1UD7 A;  1PDX A;  1P0R A;  2ZW0 A;  3H7P A;  3OJ4 B;  1GG3 A;  4BKS D;  4ANU A;  3MC8 A;  3UQA A;  1TJE A;  1WYG A;  3RNC C;  1GJZ A;  2RDB C;  3EFU A;  1QOA A;  4NQL B;  1KLG D;  2ZNV C;  1E8X A;  3ZGZ A;  2PIA A;  3DWM A;  3ENE A;  3DHH C;  5JHA A;  3ZJU A;  2LUM A;  5H8Y E;  1ZKH A;  3V6C B;  4YL8 A;  2GBR A;  1KM7 A;  2NTT A;  1AW7 A;  2MH7 A;  2QC8 A;  2N9P C;  3QJZ A;  2KDE B;  5J2R A;  3R3M A;  5E6O A;  5IAA C;  2WNM A;  4JL9 A;  2HTH A;  2PW9 A;  4JQW C;  3R2I A;  1FMA D;  1DYQ A;  5EDS A;  4ACF A;  2JRH A;  2DYM A;  3Q8F A;  1V49 A;  2MEK A;  2ZZP B;  1YN5 A;  1C1Y B;  1WXS A;  3TEW A;  2R2O A;  5JH5 C;  3UIO B;  4LNI A;  3A4R A;  2NPT B;  1HZ5 A;  3ZNI D;  5CHV C;  4JPS A;  1OFF A;  4DXA B;  4A90 A;  1N6Z A;  3NS1 A;  3S2A A;  3A9K B;  2KT7 A;  1UUP A;  1QKZ A;  3IHP C;  3TEX A;  1KFY B;  2JT4 B;  2L1A A;  2MSE D;  5JHB A;  4K3C A;  3B0A A;  1C3T A;  1YQ4 B;  1V8C A;  3FIL B;  5FR3 A;  2RPQ A;  3L54 A;  4IC7 B;  3ZTC A;  4B9K A;  3ZKJ C;  4IM2 A;  1GOZ A;  2AQ3 B;  1U4A A;  2KMC A;  4ICV A;  3VR8 B;  2JRI B;  2KMA A;  4OVZ A;  4B0E A;  3H1U A;  2JVC A;  4NJ6 A;  3ZQ4 A;  3MHZ A;  5DPS A;  2MWS B;  1PGA A;  1NBF C;  4FJV B;  3APF A;  1J8C A;  3AEF B;  3PVL A;  4IKG A;  1WXM A;  1SJH D;  1WR6 E;  5G2N A;  3U2S C;  2N7E A;  1P98 A;  3VH4 B;  4D2K A;  5AUK A;  3OAW A;  1KOT A;  3VVW B;  2ACZ B;  2Y3A A;  1D5M C;  4P1C C;  5C23 A;  4PT5 A;  4E3C A;  4W9I A;  2JZZ A;  2KQ4 X;  2KFJ A;  2D2Q A;  4A6Q A;  5FKA C;  2CU3 A;  4TQ1 A;  1FCL A;  2QMT A;  4XWW A;  3CIR B;  3P63 A;  3N1X C;  1I4X A;  4HCP B;  3P1M A;  2K5P A;  2KWD A;  4GSW A;  2BKR B;  1C4P A;  1I7H A;  2L3Z A;  1TKY A;  1ZXH A;  4USA A;  4XX5 A;  2REX A;  3BWU D;  2RPV A;  4NAW A;  4IOI E;  2XBB C;  2JZP A;  3JW0 X;  4C80 A;  3RNG C;  1K51 A;  3CF6 E;  3IG3 A;  4KZC A;  2H89 B;  2VH1 A;  4GMV A;  4KIK A;  2X38 A;  1C4A A;  1NI2 A;  1TT5 B;  2WXK A;  3AE3 B;  3A33 B;  4MGK E;  4KIK B;  2DZM A;  2CHZ A;  2INP E;  1JAL A;  4NNJ B;  1F77 A;  3GOE A;  4GXB A;  3M95 A;  2BS4 B;  2XNA C;  3ETR A;  4OVU A;  3U30 A;  1AAR A;  2L0T A;  4HRS A;  2QDF A;  3I5J C;  1SIJ A;  4HLE A;  1KLU D;  2AQ2 B;  3DPD A;  3NG0 A;  2DAF A;  2V0G A;  5L95 C;  1VJK A;  4LNK A;  1YQB A;  2FID A;  1I4H A;  2ICI A;  2BS2 B;  3U7Z A;  2B76 B;  1L4D B;  3BZD B;  4UDU C;  2WP9 B;  1SE3 A;  3HVZ A;  3L16 A;  2N1V A;  3Q69 A;  3TUO A;  2SEB D;  2FE8 A;  3ZDT A;  2PVG C;  4N59 A;  1QZE A;  1F9J A;  2O2V B;  3RNA C;  3GZN I;  4R3D A;  4ZRK A;  4RFB A;  4J3O D;  4KSL C;  2N7J A;  3ZXR A;  4URK A;  5BMH A;  4RH6 A;  2KYW A;  4MEM A;  1C9F A;  3VRB B;  4N58 A;  1OQQ A;  3TEZ A;  2MBH A;  1Z2M A;  2QJL A;  5J17 A;  2O6V A;  3QIJ A;  3Q8C A;  3U7D A;  3ML9 A;  2Z59 B;  2KLG A;  3W5U B;  2I38 A;  4RNA A;  3C19 A;  1XLQ A;  4NAM A;  3DDC B;  2L7R A;  2BPS A;  3TIX A;  3DBH I;  1MG8 A;  3UIN B;  2WDR B;  2A4Z A;  4C4V B;  1JRO A;  2PVO D;  1V5T A;  4RF0 A;  2JUO A;  3PRZ A;  1R4M I;  4WUR A;  1JWB D;  4M8M A;  4BVU C;  1MG4 A;  2PLP A;  3U52 E;  5LXH A;  4KGT A;  2PPH A;  3VUX A;  1J7C A;  3DVN V;  1BT0 A;  1R7S A;  4DHJ D;  4AJY B;  3NS8 A;  3QHT A;  3RUL A;  2W54 A;  2D3G A;  2MBE A;  4AS1 A;  2INN E;  3O13 A;  1EUV B;  3M3J A;  1EO6 A;  4ZHP A;  5DCN A;  2MP2 A;  4GOC A;  2FCS A;  2DYB A;  2MP2 B;  3NVZ A;  3AMZ A;  3IT6 B;  1QIL A;  1T0S C;  3FAH A;  1WH3 A;  2BYE A;  2HJ8 A;  3BYY B;  3CSF A;  3PLV A;  1H8C A;  1ZGU B;  1SE2 A;  3DWG C;  4KGS A;  3BVG A;  2G45 B;  3BII D;  2BT6 A;  5JZE B;  2J0J A;  1GC7 A;  1WFY A;  3RMK C;  1YN4 A;  3H6N A;  1DOX A;  1MHX A;  1BML C;  3DBL B;  1HE8 A;  4KV2 A;  3ZRF A;  2WU2 B;  4XZ4 A;  1XCQ L;  2TSS A;  2LD9 A;  2WX0 A;  2HDE A;  4JX1 C;  1IUE A;  2FCM A;  2JPH A;  2DLB A;  3MTN B;  1XCT L;  4RGN A;  2IO0 B;  2DYO A;  1N63 A;  3KUD B;  3UI3 A;  1WE6 A;  4N9F 4;  1LGR A;  1CQV A;  1WGY A;  4DXG A;  4LNN A;  4XDC A;  2B3A A;  4MAC A;  1K8R B;  2LMC A;  4YTM B;  2K3U A;  5BMI A;  1XQQ A;  3AEA B;  3WAO A;  4MSM B;  4OZA A;  1DOY A;  1V9J A;  5BYR A;  3PZ8 A;  2DAJ A;  4IM3 A;  4ANX A;  2LHE A;  1ZW7 A;  4Q2J A;  4RM9 A;  2MJD A;  4K81 A;  3Q8E A;  2LGX A;  1YIW A;  4YSX B;  3HM3 A;  4ZRP A;  2NBV B;  4A3O A;  2IPK D;  3ZIM A;  1FXA A;  4LDT D;  3QK0 A;  2DNF A;  4M0W A;  4HCN B;  2JY6 A;  4II3 B;  3AE6 B;  4M0W B;  3NUH B;  4AJW A;  2J0K A;  3LJ3 A;  1SJE D;  2ZJD A;  2BBC A;  4WIP A;  4HEA 1;  2K1F A;  1V1O A;  2OJW A;  5EE0 A;  3VDZ A;  2M4N A;  1D5Z C;  1QF6 A;  2JX5 A;  3RYT A;  4QAY A;  3B9J A;  1UBI A;  1WE7 A;  5FK9 C;  1TS2 A;  4XC2 A;  4IG7 B;  1XEE A;  2ZCB A;  2K0P A;  3PZD A;  4EZL A;  4KKJ A;  1RM6 C;  2J0M A;  1L0X B;  1VRA B;  1YNT E;  2IGG A;  2QHO A;  1V6E A;  4IM0 A;  1ACC A;  2WXH A;  3AB5 A;  4YSZ B;  4IDI A;  3E9S A;  2BYT A;  2CR5 A;  2C5L C;  2KJ6 A;  4TSS A;  3W5V B;  1WGK A;  4WWO A;  2BF8 B;  4WWP A;  2RDH A;  3HK0 A;  1J7A A;  4S0R A;  2FIF A;  4RF1 A;  2LGD A;  2NBU A;  5BMG A;  4OHJ A;  3HUI A;  1PGB A;  2KDB A;  2QIE B;  2NBW B;  1Q10 A;  3CWI A;  3Q3J A;  4LTU A;  5GXG B;  3ML8 A;  1SEB D;  3W1S A;  1L0Y B;  2D3C A;  3Q2A C;  1CK1 A;  1VZ8 A;  1RRB A;  1NEN B;  2M19 A;  4EKU A;  2IO2 B;  1J19 A;  3RNE C;  2M0X A;  2WDQ B;  3AEG B;  5IN7 A;  2WS3 B;  1L0V B;  4GU2 A;  2LFI A;  4TKN A;  3Q8A A;  3T8M A;  4ARI A;  1FNU A;  1C4C A;  2KVZ A;  4BKG A;  2ZNV B;  2DWQ A;  4FXC A;  4HRO A;  4K7S A;  1UWX A;  1YJ1 A;  3UF8 A;  1L2N A;  1Y56 A;  3I63 C;  3P4P B;  1TKG A;  2WHI A;  3RN9 C;  5G55 A;  3X23 A;  3ZNZ B;  2NTS A;  2QEJ C;  3W9C B;  3L0W B;  1T0Q C;  2KKC A;  3ALB A;  3I3T B;  1MVK A;  2EKI A;  1KF6 B;  1T3Q A;  1QOF A;  1D6E C;  2V4I B;  4WJO A;  1XO3 A;  3KH0 A;  2HD5 B;  3K9P B;  3CMM B;  4ANW A;  4YXD B;  2VZK D;  5L83 A;  2D3A A;  1JWU D;  1M4V A;  3LYY A;  1WGD A;  1YJI A;  3A1Q B;  3ZXV A;  2V9H A;  1R4N I;  4REZ A;  2KXJ A;  1SBB B;  1C76 A;  4I6N B;  5IA7 A;  2NPT A;  3NVV A;  1F1H A;  1E7P B;  4OW0 A;  2YEP F;  1WRD B;  2LXA A;  1ZOY B;  1OQY A;  3AI5 A;  4CYE A;  4W9E A;  2RD0 A;  3A9K A;  4DHJ B;  3VTV A;  1OQR A;  2OOB B;  3RT3 B;  4WQO B;  4RGT A;  2BQQ A;  3SHQ A;  2WXR A;  1QLB B;  1XT9 B;  3FIL A;  1MPE A;  2WWZ A;  1IP9 A;  1KH0 A;  3AE2 B;  3DBR I;  1N5W A;  2MX2 A;  1E8Y A;  3JSV B;  3ZO5 B;  4WQM A;  4EZK A;  1VZ7 A;  4F1S A;  3Q3F A;  4ITK A;  2ONQ A;  4MDK E;  1JRP A;  2J4X A;  4EFO A;  3PGE A;  3TBL D;  4FA6 A;  1ET6 A;  1N62 A;  2W55 A;  1NI3 A;  2SAK A;  3DVG X;  5D94 A;  4PS8 A;  3N20 C;  3IFW B;  3PRP B;  2AX5 A;  1RFA A;  4S17 A;  4G50 A;  2KTR B;  1L6U A;  1UGJ A;  4ZOH C;  4HWI B;  1XLO A;  2WLB A;  3W2D A;  3OG5 A;  2KZR A;  2MJ3 A;  3TMP B;  2DZK A;  3OLM D;  4GB9 A;  4O1N A;  1XD3 B;  4BBN F;  5CHF A;  4XGA B;  4C00 A;  3IT4 B;  3QC8 B;  2LGI A;  2L76 A;  2RR9 A;  3L13 A;  3AE5 B;  3APC A;  3APD A;  3NZU A;  1WR1 A;  4EOY A;  4MH0 E;  5H92 C;  2K8H A;  2BW2 A;  2WXL A;  1GUA B;  2BVC A;  4WAF A;  2MCN B;  3NVW A;  1HEZ E;  1NEK B;  4W9F A;  1ZXI A;  2IJ0 A;  3M62 B;  3PZ7 A;  4MT5 A;  4MGI E;  4NJ7 A;  1SB3 C;  3V60 A;  2LI5 A;  4WJP A;  1ZE3 D;  2GMI C;  3MC0 B;  5C3J B;  4G11 A;  5IP4 D;  2WXG A;  3HM6 X;  5TSS A;  3PS6 A;  1EM7 A;  4PS7 A;  3VHT C;  2WXP A;  2XEW A;  3R66 C;  2D3B A;  2KAN A;  2IO1 B;  1WM3 A;  5CX3 A;  2KWV B;  2W3R A;  1EWY C;  1UH6 A;  2LWP A;  1ET9 A;  4LDT B;  4I6P A;  4EUT A;  2C60 A;  3MJ5 A;  3QAR A;  2KWC A;  3AE9 B;  4AQ7 A;  2KDM A;  1GAQ B;  1FCC C;  3HHM A;  3KYD D;  2CS4 A;  2KC1 A;  4P1B C;  2CHX A;  3TL5 A;  1TKE A;  2AWT A;  3AEE B;  2K8C A;  3RZF A;  3RZW C;  3NHE B;  3NZ3 A;  3RFZ B;  2KWU B;  1WX7 A;  4BKT A;  3GP7 A;  4PYZ A;  3VFK A;  2AL3 A;  1STE A;  2CJN A;  2K9X A;  3PTF C;  2JXX A;  2O2V A;  1WM2 A;  3HVD A;  4AP4 C;  2RMM A;  4P7I A;  4KGR A;  1D4B A;  4P6V F;  4F8C B;  1L5P A;  2LVP A;  5DPW A;  2LUE A;  4A55 A;  5EE9 A;  3VQI A;  2ZPY A;  1WXA A;  1TGZ B;  4W9D A;  2M17 A;  2G3Q B;  1WRI A;  1C79 A;  4ZRQ A;  5T8I A;  2PKO A;  2YLM A;  4K7W A;  1HTO A;  3EGR A;  3ZTD A;  1PYW D;  2MHJ A;  3BIN A;  4PK1 A;  3ZNH B;  3U4E G;  1FFV A;  3DBL I;  5G5G A;  1VD2 A;  4C4V A;  2LRW A;  2KQ7 A;  1P9D U;  5C1Z A;  3R8B A;  3VR9 B;  2D11 A;  1WJ4 A;  4W9L A;  4YSY B;  2K8B A;  4YTP B;  5KHO A;  4MJS B;  3TEY A;  2MJE A;  2KN5 A;  4DBG A;  2QCZ A;  2ZW1 A;  3H8H A;  1AYF A;  3RCZ A;  2K6Q A;  4HK2 A;  5EE1 A;  1HA5 A;  2FUG 1;  1C77 A;  4CHK A;  2KFK A;  1P7E A;  4W9G A;  2IO3 B;  1T6B X;  1MHH E;  2KFK B;  1MI0 A;  1WGH A;  1XLN A;  2PJH A;  5BYQ A;  1FXT B;  4M01 A;  3SEB A;  4FN2 A;  1IGC A;  2G4S A;  2LXC A;  3TCA A;  1G6J A;  2PE6 B;  2H88 B;  2IYD B;  4ICU A;  1Q5W B;  2PE9 A;  4B6W A;  2M1M A;  3EFC A;  2D10 A;  3ZRC A;  2KDF B;  1S1Q B;  2BB6 A;  3VRA B;  3WAL A;  3L17 A;  2JSV X;  2ZVN A;  1KLV A;  1WMH B;  1P1A A;  1IPG A;  3Q6B A;  3GZN B;  4FJY A;  1A5R A;  3KQ4 A;  2MBQ A;  2WYQ A;  5D3D A;  1V86 A;  2W82 A;  1I42 A;  4YWG G;  1ZP0 B;  5AZH A;  3AE8 B;  1TS4 A;  3PO0 A;  5KHQ A;  1FFU A;  2BKF A;  3N1Y C;  1SE9 A;  4C7Z A;  2MBB B;  2LVO A;  2J52 A;  3KUC B;  1TY2 A;  2OJR A;  1E8Z A;  2JYE A;  4LLG M;  3BK2 A;  3KUZ A;  3PSE B;  1WJN A;  2DZI A;  1YD8 U;  2BTE A;  2G1E A;  4ZHO A;  1FRR A;  2DZJ A;  4E74 A;  2MW5 A;  1MJD A;  1JWS D;  3DBH B;  3VUY A;  1YX5 B;  1YX6 B;  1GB1 A;  4G0N B;  3N9Y C;  2E6X A;  4JLC A;  3P4S B;  2NVU I;  4MM3 B;  3DHG C;  4DDI D;  4TUU A;  3VXW A;  4XE0 A;  1WF9 A;  3NY5 A;  1R4M B;  1PUT A;  4WH4 A;  1XF5 L;  3QAQ A;  2RSU A;  3W1Y A;  2UWQ A;  3ZLZ A;  4ANV A;  2KX0 A;  5JXV A;  1AN8 A;  4YTN B;  1E5W A;  2GOW A;  2CU1 A;  3N30 A;  5IO9 A;  3ECI A;  3SFE B;  1F0Z A;  1PFD A;  2PMV A;  2EMS A;  4ASW C;  1A70 A;  3PRE A;  2ZEQ A;  2Z0D B;  4B95 A;  1E7U A;  2N9E B;  3VH3 B;  4HPL B;  1H4R A;  3SDL C;  3H7S A;  3X0W A;  5AZF A;  4FHJ A;  1WGG A;  4WWM A;  2FCQ A;  4W9H A;  2CHW A;  3LDZ E;  1JQ4 A;  3V05 A;  2WQY B;  4BFR A;  5AEK B;  4XWT A;  2WXI A;  4AUQ C;  1K50 A;  2MA9 B;  2I1K A;  3MP9 A;  1TYG B;  2GBM A;  1E0Z A;  1HTQ A;  3JVZ X;  1TIF A;  5BO4 B;  2XK5 B;  3T9L A;  2PEA A;  4A20 A;  2G4D B;  1JWA D;  1V1P B;  1P7F A;  3EEC A;  4W9J A;  2KK8 A;  2KLC A;  1PQS A;  4YT0 B;  1KJT A;  2KMM A;  1V81 A;  4NY0 A;  5AUI A;  1K53 A;  2MBO A;  3N1Z C;  1Z5S B;  1VCB A;  1RWS A;  1WJ6 A;  2W3S A;  3LXF A;  1CZP A;  3QX1 A;  4RGO S;  1UNS A;  3NOB A;  3B08 A;  2YVC A;  3NJT A;  3PV1 A;  1LO5 D;  4GDK B;  3T3N A;  2ON8 A;  3ZVV A;  1E7V A;  3VTU A;  1MFW A;  4NZL B;  1YMH E;  2M56 B;  3WAM A;  4JE3 B;  2Z8L A;  3CST A;  1E6E B;  2KQS A;  4DDG D;  2N7D A;  3ZW3 A;  1DGJ A;  2E3T A;  1LFD A;  2O6V D;  2V3S A;  2WXJ A;  4GDL B;  5D3I B;  1JCK B;  3WIM A;  3RI7 C;  4IWQ A;  4US9 A;  2FCN A;  4BOS C;  2V3P A;  2N4F A;  4HKZ E;  1SXT A;  3DBS A;  2CJO A;  5J18 A;  4TMA B;  5C2T B;  4JIO U;  3SD5 A;  3FC4 A;  3ZDM C;  4HPP A;  2AQ1 B;  1E90 A;  2JWU A;  3BYT B;  3MFG A;  3T3O A;  1M94 A;  5E6N A;  3W1S C;  4PS3 A;  2FBW B;  3R7Q A;  3AE1 B;  1FPY A;  1J7B A;  3AED B;  4NJC A;  3O65 B;  1D3Z A;  1C78 A;  4K3B A;  1E8W A;  4ZYS A;  4A9A A;  2DEN B;  4CO7 A;  2HJ1 A;  2IY1 B;  1Q0W B;  4FLH A;  1SF0 A;  2IBI B;  3H7P B;  5HG2 A;  3N3K B;  3AH7 A;  4MH8 A;  2BWE S;  1B9R A;  1Y8R C;  1V2Y A;  2JWZ A;  4ZYN A;  4KZ0 A;  3A1Q A;  4L23 A;  1ZDX A;  4GGQ A;  3VTW A;  2AL6 A;  4GLS C;  1RFK A;  3UGB B;  4IWO A;  3PT2 B;  2IND C;  3DHI C;  1K52 A;  3P42 A;  1GB4 A;  2D5G A;  2PTL A;  4AOF A;  1WWT A;  2KAC A;  2YEP B;  3P4R B;  2L0F A;  2N0S B;  3R2T A;  2JXT A;  1T0Y A;  3AM9 A;  1TZO A;  3Q14 C;  3M63 B;  4X57 B;  5E6P A;  3V62 A;  3URY A;  3JSV A;  1WJU A;  2NCN A;  4WWN A;  3L08 A;  1E10 A;  3WAP A;  3VUW A;  4MGY E;  3P4Q B;  3TJP A;  3Q8B A;  3HRD D;  4M00 A;  4N6E B;  1RYJ A;  2NMQ A;  3RUI B;  1FIQ A;  4L1B A;  4JGH B;  2KTR A;  3KWL A;  5DPR A;  1TBE A;  2FAZ A;  1OGW A;  2AEH A;  2HTM E;  1BXT A;  1UF0 A;  2ASQ A;  4ZDV A;  1X1M A;  2LEK A;  5D7G A;  1V5O A;  3A4S C;  1TS5 A;  2LHD A;  1SIF A;  4BBN C;  1L4Z B;  2WX1 A;  2EEL A;  1GNU A;  1XLP A;  3U8Z A;  3MC9 A;  3V61 A;  2K25 A;  1LM8 B;  5HI1 A;  2EKE C;  1T0R C;  2UYZ B;  1ISN A;  4KX6 B;  1EU3 A;  2UU7 A;  4JWU C;  4ZRI A;  4DQO C;  3DVG Y;  1V80 A;  3UQB A;  2Y5C A;  1R4N B;  1HQR D;  3AEC B;  3QQ8 B;  4HPM B;  3V3X A;  4B0M A;  4OZB A;  1I35 A;  2RGF A;  4W9K A;  2M0A A;  4LNO A;  3IBE A;  2N9K A;  3B2F A;  1UGM A;  5LLI A;  1FD6 A;  2NS5 A;  1L7Y A;  1UBQ A;  4NAW B;  1BUI C;  3NRZ A;  4KDL B;  2AYO B;  2WXF A;  4IUM B;  1VR9 A;  2L32 A;  1KTK A;  1WYW B;  2WXN A;  1CMX B;  4C7Y A;  2LAS A;  3IXS A;  3AE7 B;  4GIV A;  4EE2 A;  1LQB A;  1KRH A;  4KDI C;  2L05 A;  3AU4 A;  2IGH A;  4NPN A;  2V3N A;  1OEY J;  4AWJ A;  3DBR B;  1TZ1 A;  3PLU A;  2C7N B;  2EMT A;  2MQJ A;  2GRI A;  2VRR B;  1TY0 A;  1ENF A;  1QT9 A;  1WSP A;  1DOI A;  2GBJ A;  1EWC A;  1VLB A;  3BVZ A;  3Q3M C;  1RLF A;  1TS3 A;  1NYR A;  3AE4 B;  3L10 B;  2LRU A;  2IGD A;  4LJP B;  1IYF A;  4ZRJ A;  5E6J A;  3D32 A;  1SSN A;  3SR6 A;  2FNJ B;  2MLB A;  2A5U A;  3A9J A;  1FNW A;  1NYQ A;  3PHX B;  3A9J B;  1F2R I;  4P16 A;  3ZJT A;  5MPO A;  2J53 A;  1TTN A;  3MJW A;  3PHW B;  5G5H A;  2R2Q A;  1EF1 A;  4IW0 A;  4GN1 A;  2GB1 A;  5IOI A;  2KO3 A;  2IDY A;  3EA6 A;  1YQ3 B;  1V97 A;  4DWF A;  1ROE A;  5FR6 A;  2LGY A;  1J0G A;  3C8Y A;  2WDV B;  2JF5 A;  3P2B A;  1EU4 A;  1UWM A;  2N9L A;  4FHK A;  2QIL A;  5HKH A;  3GE3 C;  4KSK C;  2KOX A;  4RMA A;  2LVQ A;  2ZVO A;  1JML A;  3SFD B;  3KYC D;  2IZV B;  2L52 A;  2JZ3 B;  4FAD A;  2I1J A;  2CKH B;  2O6V B;  2LGS A;  3PPA A;  4MJS A;  3AN1 A;  1HZ6 A;  2DX5 B;  2FUH B;  4M8N A;  1P3Q U;  4LJO B;  4NQK E;  1OEY A;  2KDI A;  2K39 A;  3H9D A;  4JWS C;  1WZ3 A;  3Q3O C;  1AWD A;  4CQN A;  2JQR B;  3QCA A;  4BKS A;  4HVB A;  5TR5 A;  4US8 A;  1FRD A;  3RNB C;  2N1W A;  3KLS X;  2Z0E B;  1ZPS A;  4EZJ A;  3KWV A;  1WY8 A;  1ZDV A;  5IKC M;  2KD0 A;  4PYU A;  2LJ5 A;  2KJH B;  4LCD E;  1NVI D;  2BB5 A;  1WXQ A;  2C7M B;  4M02 A;  2L00 B;  1WMH A;  3IVF A;  3E56 A;  3IAM 1;  3NVY A;  3QWZ B;  4W9C A;  2C7H A;  2VH2 A;  1I4P A;  1HXY D;  2INC C;  3EC8 A;  2C9W B;  4HDO A;  3RPF C;  3GB1 A;  3AXC A;  4FJZ A;  2VZK B;  1JRU A;  3GS2 A;  2DHZ A;  3V6E B;  2XN9 C;  1F2R C;  2Q5W D;  2KX3 A;  4HXD A;  3BK1 A;  1FM0 D;  3WAN A;  1UZX B;  2Y5B B;  4LK0 M;  3MHS D;  2LJI A;  4FBJ B;  2KJR A;  4BOZ B;  1FEH A;  1JW9 D;  4C56 C;  5D6J B;  3UIP B;  1FXI A;  1YJJ A;  1F52 A;  2GBN A;  1NDD A;  2D07 B;  1ESF A;  3EHV A;  2GLS A;  1B1Z A;  1Q1O A;  2R61 A;  1YN3 A;  2V4L A; 
#chains in the Genus database with same CATH homology
 3TBL D;  4FA6 A;  1LXD A;  3CST A;  2KQS A;  4KSL C;  3DVG X;  5D94 A;  4MEL A;  4PS8 A;  4DDG D;  2N7D A;  3ZW3 A;  3IFW B;  3PRP B;  1LFD A;  2O6V D;  2V3S A;  4URK A;  4GDL B;  3WIM A;  3PRM B;  4IWQ A;  1RFA A;  4MM3 A;  4MEM A;  4G50 A;  2KTR B;  4F7Z A;  2FCN A;  4BOS C;  4HWI B;  2MBH A;  2N4F A;  3DBS A;  1WZ0 A;  4WAA A;  5J18 A;  2KZR A;  1Z2M A;  1WX9 A;  3TMP B;  2DZK A;  3OLM D;  4GB9 A;  2KHW B;  2O6V A;  3QIJ A;  4EEW A;  5J17 A;  3U7D A;  4JIO U;  3SD5 A;  3ZDM C;  3ML9 A;  1XD3 B;  1E90 A;  2KLG A;  2Z59 B;  4BBN F;  2BGF A;  4K1R B;  5CHF A;  1WI0 A;  4MGZ E;  4HJK A;  3DQV A;  1OTR B;  3QC8 B;  2GBK A;  2L76 A;  3DDC B;  1M94 A;  2RR9 A;  2L7R A;  3L13 A;  2BPS A;  5E6N A;  3W1S C;  3TIX A;  4PS3 A;  3APC A;  3DBH I;  3R7Q A;  3APD A;  5GMV A;  3NZU A;  1WR1 A;  4EOY A;  1MG8 A;  4MH0 E;  3UIN B;  2KVR A;  2K8H A;  2NR2 A;  3O65 B;  1D3Z A;  1GUA B;  2A4Z A;  2MCN B;  3QA8 A;  1E8W A;  1V5T A;  1WX8 A;  4W9F A;  2DEN B;  4CO7 A;  1EF5 A;  2ZCC A;  2IY1 B;  2BYF A;  1Q0W B;  4J6I A;  4FLH A;  2JUO A;  3PRZ A;  2IBI B;  1R4M I;  2J7Q B;  3M62 B;  4E71 A;  3SU8 X;  3KW5 B;  4MGI E;  4NJ7 A;  3H7P B;  3ONS A;  3V60 A;  2LI5 A;  3HIZ A;  4M8M A;  4WJP A;  4DHZ E;  3N3K B;  4BVU C;  3K9O B;  2M8S A;  2GMI C;  4WJN A;  2BWE S;  4G11 A;  1Y8R C;  2KC2 A;  5LXH A;  1V2Y A;  2BYV E;  2JWZ A;  2PPH A;  3VUX A;  3HM6 X;  3DVN V;  4ZYN A;  4KZ0 A;  3A1Q A;  1BT0 A;  3PS6 A;  4PS7 A;  4DHJ D;  4AJY B;  4DK5 A;  3KVF B;  4GGQ A;  3VTW A;  3NS8 A;  1UEL A;  2AL6 A;  3QHT A;  2XEW A;  3VHT C;  3RUL A;  3UGB B;  4IWO A;  3R66 C;  4I6L B;  2W9N A;  4K7U A;  3PT2 B;  2D3G A;  2KAN A;  2MBE A;  2XK5 A;  2IO1 B;  1WM3 A;  5CX3 A;  2KWV B;  2KTF A;  1UH6 A;  2LWP A;  4LDT B;  4I6P A;  4AOF A;  4EUT A;  1EUV B;  2C60 A;  2WDT B;  3M3J A;  1EO6 A;  3QAR A;  4DHZ B;  2KWC A;  4TQ0 A;  5DCN A;  2N9X A;  2L0F A;  1WXV A;  2MP2 A;  1WGR A;  4TV3 A;  5LXI B;  1T0Y A;  3HHM A;  3KYD D;  4GOC A;  2CS4 A;  2FCS A;  2KC1 A;  2DYB A;  2CHX A;  1RAX A;  2MP2 B;  2V1Y A;  4OVV A;  3TL5 A;  2BWF A;  4II2 B;  3VAW A;  3DOW A;  4A3P A;  2MRP A;  2AWT A;  1WH3 A;  3M63 B;  3JYU A;  4X57 B;  2BYE A;  2HJ8 A;  2K8C A;  3CSF A;  5E6P A;  3RZF A;  3RZW C;  3NHE B;  3PLV A;  3V62 A;  2KWU B;  3ZUN A;  1WX7 A;  3AU5 A;  3WA0 A;  1ZGU B;  4FUL A;  1H8C A;  2G45 B;  2LZ6 A;  3JSV A;  4BKT A;  1WJU A;  4KVG B;  2NCN A;  4GDK A;  4WWN A;  4PYZ A;  3L08 A;  3VFK A;  5CTR C;  2AL3 A;  2KNB A;  5JZE B;  2IY0 B;  2J0J A;  1GC7 A;  1WFY A;  3WAP A;  3PTF C;  3VUW A;  2JXX A;  2O2V A;  4MGY E;  3TJP A;  1WM2 A;  2L8J A;  4AP4 C;  3H6N A;  4P7I A;  4MSQ B;  4F8C B;  2LVP A;  5DPW A;  2LUE A;  3N32 A;  1HE8 A;  4KV2 A;  3ZRF A;  4GDL A;  4XZ4 A;  3RUI B;  3VQI A;  2LD9 A;  4JGH B;  2KTR A;  5CHW A;  3R7R A;  2WX0 A;  1WIA A;  4RM8 A;  5DPR A;  5AZG A;  2ZPY A;  1WXA A;  2FCM A;  1TGZ B;  1TBE A;  2FAZ A;  2JPH A;  3NZS A;  3OJ3 A;  4W9D A;  1OGW A;  2AEH A;  2M17 A;  3MTN B;  2ZPN A;  2G3Q B;  2IO0 B;  2ASQ A;  3C0R B;  4ZDV A;  2DYO A;  3AUL A;  3KUD B;  4HDQ A;  1WE6 A;  1X1M A;  2YLM A;  4N9F 4;  5DPT A;  4K7W A;  5D7G A;  1V5O A;  1WGY A;  1GC6 A;  3A4S C;  3RD2 A;  2K6D B;  1SGH A;  3ZTD A;  2B3A A;  1SIF A;  3BIN A;  4BBN C;  1K8R B;  2WX1 A;  4IWP A;  3DCG A;  3ZNH B;  1GNU A;  4WJQ A;  1XQQ A;  4G3X B;  3DVN U;  3DBL I;  1VD2 A;  3WAO A;  3BY4 B;  3U8Z A;  4MSM B;  2LRW A;  3V61 A;  2K25 A;  1LM8 B;  1P9D U;  2KQ7 A;  5C1Z A;  1S3S G;  2EKE C;  1V9J A;  2D11 A;  1WJ4 A;  4W9L A;  2UYZ B;  2K8B A;  2DAJ A;  1ISN A;  4IM3 A;  2HE7 A;  4ANX A;  5D2M B;  4ZRI A;  3B1L X;  4MJS B;  5KHO A;  1UD7 A;  1ZW7 A;  4RM9 A;  1P0R A;  3H7P A;  3DVG Y;  1V80 A;  3OJ4 B;  4K81 A;  1GG3 A;  3UQB A;  4BKS D;  4ANU A;  3UQA A;  3QQ8 B;  2KN5 A;  4DBG A;  4HPM B;  2LGX A;  1GJZ A;  1YIW A;  1I35 A;  3EFU A;  3RCZ A;  2K6Q A;  2RGF A;  3HM3 A;  4NQL B;  4HK2 A;  2ZNV C;  2NBV B;  1E8X A;  4W9K A;  4A3O A;  3IBE A;  1UGM A;  5LLI A;  3ZIM A;  4CHK A;  2KFK A;  3ENE A;  4LDT D;  2NS5 A;  3QK0 A;  4W9G A;  5JHA A;  2IO3 B;  4HCN B;  1L7Y A;  1UBQ A;  2JY6 A;  2KFK B;  4II3 B;  4NAW B;  1WGH A;  2PJH A;  1ZKH A;  1FXT B;  2AYO B;  4KDL B;  4M0W B;  4IUM B;  4AJW A;  4FN2 A;  2J0K A;  3V6C B;  3LJ3 A;  4YL8 A;  2GBR A;  1WYW B;  1KM7 A;  2G4S A;  2ZJD A;  1CMX B;  2LXC A;  3TCA A;  1G6J A;  2PE6 B;  2IYD B;  2K1F A;  4ICU A;  2N9P C;  2LAS A;  3QJZ A;  1Q5W B;  4GIV A;  2KDE B;  3VDZ A;  1LQB A;  2M4N A;  4KDI C;  5J2R A;  3R3M A;  2L05 A;  2PE9 A;  3AU4 A;  5E6O A;  5IAA C;  4B6W A;  4JL9 A;  4NPN A;  2HTH A;  1OEY J;  2M1M A;  4JQW C;  2D10 A;  3ZRC A;  3RYT A;  4AWJ A;  1TZ1 A;  3PLU A;  2KDF B;  5EDS A;  2C7N B;  2EMT A;  1S1Q B;  2MQJ A;  2JRH A;  3WAL A;  3L17 A;  1UBI A;  2DYM A;  2VRR B;  1WE7 A;  1V49 A;  2ZZP B;  2ZVN A;  1KLV A;  1C1Y B;  1P1A A;  1IPG A;  1WMH B;  1WXS A;  2GBJ A;  4IG7 B;  2R2O A;  2ZCB A;  4XC2 A;  3PZD A;  4EZL A;  5JH5 C;  4FJY A;  3UIO B;  1A5R A;  3A4R A;  2NPT B;  1RLF A;  2MBQ A;  5CHV C;  3ZNI D;  2J0M A;  2WYQ A;  4DXA B;  3L10 B;  1V86 A;  3S2A A;  2LRU A;  1V6E A;  2QHO A;  4IM0 A;  3A9K B;  1I42 A;  5AZH A;  4LJP B;  2CR5 A;  2C5L C;  2KJ6 A;  3IHP C;  1IYF A;  5KHQ A;  4ZRJ A;  3D32 A;  2BKF A;  4WWO A;  1SE9 A;  2BF8 B;  4WWP A;  2FNJ B;  2JT4 B;  2A5U A;  2MLB A;  2MSE D;  3A9J A;  2MBB B;  5JHB A;  2LVO A;  3HK0 A;  3B0A A;  3KUC B;  1C3T A;  3PHX B;  3A9J B;  2OJR A;  3ZNG C;  2RPQ A;  1E8Z A;  3L54 A;  2FIF A;  4IC7 B;  3ZTC A;  4B9K A;  1TTN A;  3MJW A;  3KUZ A;  3PHW B;  3ZKJ C;  3PSE B;  1WJN A;  4IM2 A;  2DZI A;  1U4A A;  1YD8 U;  2KMC A;  4ICV A;  2R2Q A;  1EF1 A;  2JRI B;  2LGD A;  4IW0 A;  2KMA A;  2NBU A;  4GN1 A;  3H1U A;  2DZJ A;  4E74 A;  2JVC A;  2MW5 A;  2KDB A;  4NJ6 A;  2KO3 A;  2NBW B;  5DPS A;  3VUY A;  1YX5 B;  1YX6 B;  2MWS B;  1NBF C;  4DWF A;  4FJV B;  3APF A;  1J8C A;  5FR6 A;  3Q3J A;  2LGY A;  4G0N B;  1J0G A;  3P2B A;  2JF5 A;  3PVL A;  4FHK A;  4JLC A;  1WXM A;  2NVU I;  3W1S A;  1WR6 E;  3ML8 A;  5HKH A;  5G2N A;  4KSK C;  2KOX A;  2N7E A;  4RMA A;  1P98 A;  4DDI D;  2LVQ A;  4TUU A;  3VH4 B;  2ZVO A;  1WF9 A;  3VXW A;  3NY5 A;  3OAW A;  1KOT A;  3KYC D;  3VVW B;  2IZV B;  1RRB A;  2JZ3 B;  4FAD A;  4EKU A;  5C23 A;  2IO2 B;  1J19 A;  2I1J A;  4E3C A;  4W9I A;  2JZZ A;  2M0X A;  2CKH B;  2O6V B;  2KFJ A;  2D2Q A;  3QAQ A;  2RSU A;  3W1Y A;  3PPA A;  2UWQ A;  3ZLZ A;  4ANV A;  2KX0 A;  4MJS A;  4TQ1 A;  2DX5 B;  4GU2 A;  2FUH B;  4TKN A;  3T8M A;  4M8N A;  1E5W A;  1P3Q U;  2GOW A;  4LJO B;  4NQK E;  1OEY A;  2CU1 A;  4HCP B;  2KDI A;  3N30 A;  2K39 A;  3ECI A;  3H9D A;  4BKG A;  4GSW A;  2BKR B;  2EMS A;  1WZ3 A;  4ASW C;  2ZNV B;  2L3Z A;  3PRE A;  2ZEQ A;  2Z0D B;  4K7S A;  4B95 A;  1YJ1 A;  4XX5 A;  2REX A;  3UF8 A;  1L2N A;  1E7U A;  4NAW A;  2N9E B;  3QCA A;  4HPL B;  1H4R A;  3VH3 B;  5TR5 A;  4BKS A;  3SDL C;  2XBB C;  4HVB A;  5G55 A;  3H7S A;  3X23 A;  3JW0 X;  3X0W A;  5AZF A;  3ZNZ B;  3L0W B;  2N1W A;  2Z0E B;  4EZJ A;  2KKC A;  3CF6 E;  3IG3 A;  1WGG A;  3ALB A;  3I3T B;  4FHJ A;  1WY8 A;  4KZC A;  2FCQ A;  2KD0 A;  4GMV A;  4WJO A;  4PYU A;  2LJ5 A;  3KH0 A;  4W9H A;  2HD5 B;  2CHW A;  4KIK A;  3LDZ E;  3K9P B;  1NI2 A;  3CMM B;  4BFR A;  3A33 B;  4MGK E;  4KIK B;  4ANW A;  2DZM A;  2KJH B;  5AEK B;  2CHZ A;  5L83 A;  4LCD E;  4NNJ B;  4AUQ C;  1WGD A;  3GOE A;  4GXB A;  2MA9 B;  2I1K A;  3M95 A;  2C7M B;  3A1Q B;  2L00 B;  2GBM A;  1WMH A;  3IVF A;  1R4N I;  3QWZ B;  3JVZ X;  4W9C A;  2KXJ A;  2C7H A;  4OVU A;  3U30 A;  5IA7 A;  4I6N B;  1AAR A;  2NPT A;  3EC8 A;  2C9W B;  2L0T A;  4HDO A;  1WRD B;  2LXA A;  5BO4 B;  2XK5 B;  3AXC A;  4FJZ A;  1OQY A;  2PEA A;  3T9L A;  4A20 A;  3AI5 A;  1JRU A;  4HLE A;  4CYE A;  4W9E A;  2DHZ A;  2G4D B;  2RD0 A;  3A9K A;  3DPD A;  3V6E B;  3VTV A;  4DHJ B;  2OOB B;  3RT3 B;  2DAF A;  2KX3 A;  3EEC A;  4HXD A;  4W9J A;  4WQO B;  5L95 C;  2KK8 A;  2KLC A;  1PQS A;  1YQB A;  2FID A;  3SHQ A;  1KJT A;  3WAN A;  1V81 A;  1UZX B;  1XT9 B;  4NY0 A;  2MBO A;  2Y5B B;  1Z5S B;  1VCB A;  1WJ6 A;  3MHS D;  4FBJ B;  2KJR A;  4BOZ B;  3QX1 A;  2WWZ A;  1IP9 A;  3NOB A;  5D6J B;  3UIP B;  3B08 A;  3DBR I;  3L16 A;  2MX2 A;  1E8Y A;  2GBN A;  2N1V A;  2YVC A;  3PV1 A;  1NDD A;  3JSV B;  3ZO5 B;  2D07 B;  4GDK B;  3ZDT A;  3ZVV A;  4EZK A;  1E7V A;  1QZE A;  3EHV A;  3VTU A;  4F1S A;  1F9J A;  3Q3F A;  2O2V B;  4MDK E;  1Q1O A;  3GZN I;  3WAM A;  4EFO A;  3PGE A;  4ZRK A;  2V4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...