4IC7B

Crystal structure of the erk5 kinase domain in complex with an mkk5 binding fragment
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
123
structure length
123
Chain Sequence
VLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGLKVNTRAGPSQSGRHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism for the specific assembly and activation of the extracellular signal regulated kinase 5 (ERK5) module.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 7
total genus 21
structure length 123
sequence length 123
chains with identical sequence E
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2012-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4ic7B00
3IBEA 4NPNA 3JW0X 2KOXA 2LVPA 4K7UA 3V62A 4GDKA 2UYZB 2V4LA 3OLMD 2C5LC 3V6CB 2IO2B 3M95A 3RUIB 2M17A 1OQYA 2J0JA 4FULA 3LJ3A 2DAFA 3R3MA 3NOBA 3QWZB 4I6NB 4ZDVA 4B95A 2FUHB 2KXJA 3VQIA 2XK5B 1I35A 4HWIB 4AJWA 1WYWB 2K1FA 5G55A 3DCGA 4XC2A 3EFUA 2MBBB 1R4NI 2NBVB 2WYQA 3NZUA 1XQQA 4NNJB 3K9OB 4HLEA 1V81A 2IO3B 1H4RA 2KNBA 2KQSA 3RULA 2LUEA 4HVBA 2GMIC 2O6VA 5JHBA 4NJ7A 2Z0DB 4FBJB 4NAWB 3VUWA 4KIKA 3ML9A 1E8ZA 4ASWC 5D94A 1KM7A 2K6DB 4GOCA 3TMPB 4MGZE 2R2OA 3QX1A 2LVQA 3DBLI 1UBQA 4HJKA 2FCMA 3ONSA 1YQBA 5J17A 3TL5A 1NDDA 4B9KA 3NZSA 3H9DA 3RYTA 1NI2A 2LRUA 3SU8X 3KUDB 1YD8U 4KSLC 4E71A 4CHKA 3I3TB 3TIXA 2IY1B 1QZEA 3ALBA 3DVNU 1V5OA 1WXMA 2PPHA 4BFRA 3KYCD 2MP2A 4BBNC 2LI5A 3RD2A 2RD0A 4ANVA 3WAOA 2ZVNA 1WMHA 2N7EA 3ML8A 1IPGA 4F7ZA 2KC2A 3R66C 3U8ZA 4G50A 2FIFA 4ICVA 3IVFA 4LCDE 2KVRA 2LXAA 2LD9A 4W9CA 5CHFA 2K8BA 3IHPC 1YJ1A 1WGRA 5LXHA 1WGDA 4WJQA 2PJHA 3NY5A 2EMTA 2CR5A 4MSQB 1EF5A 3ECIA 4IM0A 4OVVA 2KFKA 4GN1A 1OEYJ 3T8MA 3AU5A 3D32A 2KD0A 1WRDB 1S1QB 1WF9A 2NPTA 4EFOA 4IW0A 3KYDD 1L7YA 2DHZA 2GOWA 3PHXB 3QQ8B 3ZNID 5DPSA 1J8CA 1UD7A 4LJOB 4ZRKA 4HCPB 2AL6A 1P9DU 3ZKJC 3BY4B 1RRBA 1XT9B 2G4SA 2MLBA 2MRPA 2N1WA 2KHWB 2N7DA 4K81A 4GXBA 1Q0WB 2KMAA 4G11A 3ZNZB 3DQVA 1ZW7A 3L08A 2LVOA 1V5TA 2L3ZA 2ZPYA 3N3KB 3VDZA 3WAMA 1SGHA 3H1UA 4JGHB 4NQKE 4GGQA 5L83A 5KHQA 1WJ6A 3ZTCA 2WX1A 2Y5BB 3KUZA 3CMMB 4MSMB 3ZRCA 1WE6A 2DYBA 4G0NB 1OGWA 3OAWA 4A3OA 4BOZB 5DPWA 2LZ6A 3U30A 4AUQC 4W9EA 1UGMA 2V1YA 4JQWC 3SDLC 3PVLA 4DDGD 1GG3A 4M0WB 3O65B 4WWOA 3V61A 2JZZA 1V49A 1AARA 1V6EA 1WXSA 4AJYB 2M1MA 4ANXA 1WI0A 2DZKA 4PS7A 3R7QA 2J0MA 4MGIE 1Z2MA 4DBGA 3HM3A 2NS5A 3SD5A 3VVWB 2KFJA 4EZJA 2FIDA 3DOWA 1WR6E 3PV1A 2RR9A 4IM2A 2PE9A 4I6LB 3ZO5B 1NBFC 3PS6A 4EUTA 1ZGUB 3WIMA 4A20A 2K8CA 4MGYE 3ZNGC 2BYFA 3TJPA 2L05A 2MCNB 2CHZA 3V60A 3IG3A 3ZLZA 4K7WA 4W9JA 5DCNA 4A3PA 4FHJA 4TUUA 3DVNV 2LGYA 3PT2B 1WH3A 2WDTB 2L00B 1WY8A 2FNJB 2Z0EB 2AL3A 4CO7A 1UZXB 5IAAC 2DX5B 5CHWA 4IUMB 4FADA 1Y8RC 2N9EB 3QC8B 2K25A 1A5RA 1IP9A 3PPAA 2G45B 5IA7A 2DYMA 3EHVA 3K9PB 2KJHB 2KDFB 3W1SA 2BF8B 3PTFC 2G4DB 2N1VA 3Q3JA 2D07B 2Z59B 3DVGX 2PE6B 2REXA 4JLCA 2I1KA 3A9JB 3AXCA 5G2NA 2ZNVC 2C7MB 4JL9A 2BYEA 2LRWA 3RZFA 2ZJDA 2NR2A 1RLFA 3QHTA 4IG7B 4MM3A 1YX5B 3VTWA 3SHQA 1Q5WB 4LJPB 4NY0A 3L0WB 5HKHA 3UQAA 1ISNA 1WM2A 5L95C 4KDLB 4YL8A 4HDOA 3W1YA 3VXWA 2KZRA 3X0WA 3H7PA 3DBRI 2RPQA 4BKTA 4ANUA 1LQBA 3B08A 4GSWA 4F1SA 3CF6E 1EF1A 4WWPA 1CMXB 2OJRA 1FXTB 4KSKC 4XZ4A 3M63B 4OVUA 3CSTA 2KQ7A 1M94A 2HD5B 3H7PB 4LDTB 1P98A 2JRIB 5LLIA 4BKSD 4FJZA 4AP4C 1WJNA 1S3SG 2GBKA 2KJ6A 2ZPNA 1WE7A 2KWUB 3KVFB 4AWJA 4W9DA 3A4RA 3QJZA 2N9XA 3TCAA 1WJ4A 2LJ5A 1TTNA 3Q3FA 4HCNB 2BYVE 3DVGY 4E3CA 4GIVA 1Z5SB 3VH3B 2D11A 2MBQA 2I1JA 1WZ0A 4MELA 3WANA 2JVCA 3KH0A 1BT0A 2L0FA 3W1SC 3VTUA 3VUXA 1K8RB 2IO0B 3PGEA 4RM9A 3A9JA 3EECA 3PLVA 3VFKA 5AZFA 2WX0A 3LDZE 2O6VB 1KJTA 2DZIA 4WJNA 4KDIC 4KVGB 3M3JA 3WA0A 4IWQA 3ZDMC 3L54A 1WR1A 2N9PC 4W9LA 1R4MI 3X23A 3QIJA 4II2B 3HIZA 4IWOA 2AWTA 2KANA 4URKA 5J2RA 4KV2A 2ZZPB 1C1YB 1X1MA 2FAZA 1TGZB 4MDKE 4J6IA 2O6VD 4W9FA 1V80A 5KHOA 2YLMA 2KC1A 4BOSC 3RT3B 1L2NA 4GDKB 3AI5A 3L13A 3S2AA 2XBBC 5LXIB 1E8WA 2XEWA 3UF8A 1TBEA 4FHKA 4ZRJA 2VRRB 3HM6X 3U7DA 5JZEB 2NPTB 1G6JA 5E6NA 1D3ZA 5TR5A 4W9KA 2KFKB 5CHVC 2MBEA 4K1RB 2M4NA 5DPRA 5AZHA 3MTNB 2JXXA 3APDA 5D7GA 1T0YA 3APFA 2ZEQA 3HK0A 3QARA 2LWPA 2ASQA 1UBIA 4DXAB 4FN2A 2CHWA 4CYEA 2ZCCA 4WWNA 2FCNA 2JUOA 3ZW3A 3DPDA 4I6PA 3L17A 2D3GA 3C0RB 3UGBB 3ZDTA 2XK5A 4F8CB 1H8CA 2OOBB 4K7SA 2A4ZA 1GC7A 1WGGA 4EZKA 1E7UA 2EKEC 2LGXA 5JHAA 4BKSA 1RAXA 4GDLB 3ZRFA 2BKRB 3NS8A 3PLUA 3PRPB 3QA8A 2BKFA 1EO6A 2CHXA 3BINA 3OJ3A 1GJZA 1YX6B 2A5UA 1TZ1A 2C9WB 2KWVB 4MEMA 4AOFA 3N30A 4DWFA 2KN5A 2NBUA 2HJ8A 2O2VA 4IM3A 2IO1B 5GMVA 3ZNHB 2MBOA 2MSED 1E8XA 4G3XB 3ZIMA 1WIAA 2KLGA 3PREA 4EKUA 2KDIA 2KK8A 3KW5B 4KIKB 2KO3A 3NHEB 4JIOU 5CTRC 4BBNF 3QK0A 2R2QA 4KZCA 2LXCA 1HE8A 4DHJD 3N32A 5AZGA 3MJWA 3GZNI 2V3SA 1J19A 4NQLB 4FJYA 2K6QA 1ZKHA 1UH6A 1GNUA 2YVCA 1JRUA 4MH0E 2GBMA 1WMHB 1SIFA 2ZCBA 3MHSD 3V6EB 2MP2B 2DAJA 5CX3A 4GB9A 2C7NB 3KUCB 1WGHA 2L8JA 1GC6A 5FR6A 4ANWA 1WXVA 4DHZE 2W9NA 4M8NA 3ZTDA 2MBHA 4MJSA 2BWFA 2B3AA 4IWPA 2IZVB 4WQOB 2K8HA 4HXDA 5E6PA 4FA6A 3A9KB 1PQSA 2ZVOA 5C23A 3HHMA 3DBHI 4GU2A 2PEAA 3PHWB 2M8SA 4WAAA 1UELA 2KJRA 1P0RA 3JSVB 4RMAA 4ZYNA 3PSEB 2DZMA 2D10A 2NVUI 4NAWA 3UIPB 3RZWC 3L16A 2KTFA 2GBNA 3JYUA 2DENB 1E90A 2HTHA 3QAQA 2KDEB 2KTRA 1E7VA 3DDCB 2K39A 2C60A 1Q1OA 2JF5A 5D2MB 3JSVA 4WJOA 3VH4B 4DHJB 4PYUA 4ZRIA 4EOYA 3UINB 3ENEA 2L76A 1WGYA 1OTRB 1F9JA 2D2QA 3PRZA 4ICUA 2NCNA 1WXAA 1E8YA 1WX9A 2RGFA 3A9KA 4II3B 2QHOA 4WJPA 3B0AA 2CU1A 5D6JB 3APCA 4HDQA 1U4AA 3T9LA 2JRHA 3TBLD 4TQ0A 2KKCA 4DHZB 1I42A 3B1LX 3VTVA 1YIWA 4NJ6A 4X57B 2EMSA 3PZDA 3H7SA 2JY6A 5E6OA 4TQ1A 3R7RA 4MGKE 2L0TA 2JZ3B 1C3TA 1IYFA 1WX7A 2GBJA 5JH5C 2CS4A 2KMCA 2JPHA 3WALA 2CKHB 3DBSA 2KLCA 2BGFA 1SE9A 2MX2A 2FCQA 2KTRB 2KDBA 4HPMB 2L7RA 1MG8A 2IYDB 2GBRA 4DK5A 4IC7B 4TV3A 4PYZA 2JT4B 2N4FA 4KZ0A 4EZLA 3EC8A 1WFYA 4E74A 1V86A 2IBIB 2J7QB 5BO4B 1WX8A 2MW5A 4RM8A 3ZVVA 3A1QB 2KWCA 4FLHA 2FCSA 4XX5A 1VD2A 4GMVA 1P1AA 3UQBA 1OEYA 1J0GA 3RCZA 3VAWA 3VUYA 4EEWA 1E5WA 2M0XA 3A4SC 2J0KA 2MWSB 3A33B 3AULA 3H6NA 3PRMB 4W9HA 2MQJA 5J18A 5DPTA 1GUAB 1LM8B 4MJSB 4M8MA 3M62B 4B6WA 2AYOB 3WAPA 4W9IA 5EDSA 3JVZX 3P2BA 2UWQA 2WWZA 4GDLA 4LDTD 3QCAA 1EUVB 1V9JA 2G3QB 4HPLB 3ZUNA 2LGDA 1WJUA 4N9F4 3A1QA 2ZNVB 1KOTA 2AEHA 2RSUA 1KLVA 1P3QU 2HE7A 3OJ4B 1WM3A 2DYOA 4BVUC 2BWES 4BKGA 2JWZA 3GOEA 3L10B 4PS3A 2IY0B 1XD3B 1VCBA 1LXDA 2KX3A 3VHTC 4P7IA 5AEKB 1V2YA 3UIOB 3CSFA 1WZ3A 5C1ZA 2C7HA 4TKNA 3AU4A 4FJVB 2MA9B 2BPSA 2KX0A 1RFAA 3IFWB 2LASA 1LFDA 4W9GA 4PS8A 2DZJA 2NBWB 2O2VB 4DDID 4HK2A
chains in the Genus database with same CATH superfamily
3IBEA 2KOXA 5TSSA 4P1BC 1YOVB 3M95A 1FXIA 2L52A 4ZDVA 3NOBA 4I6NB 1PYWD 1QLBB 2FUHB 4HWIB 2K1FA 2MBBB 1R4NI 2V4IB 2BYTA 1H4RA 2KQSA 4A90A 3N1ZC 2PVOD 4NJ7A 3HRDD 4NAWB 3KWLA 4A55A 1HEZE 4HEA1 1E8ZA 3Q14C 2K22A 4A8XC 1KM7A 2K6DB 3DBLI 4HJKA 4LNKA 5J17A 1NI2A 2LRUA 3KUDB 3T3NA 3TIXA 3ALBA 2PPHA 3P1MA 2K5PA 2ONQA 2ZVNA 2IJ0A 1IPGA 3B2GA 3ML8A 4F7ZA 2LGSA 4ICVA 3IVFA 4W9CA 1JCKB 3DWMA 1V1OA 2K8BA 1DOYA 3ECIA 4IM0A 2KFKA 1OEYJ 1C4AA 2MJEA 2NPTA 4EFOA 5DPSA 4LJOB 1XT9B 2RMMA 2MLBA 2N7DA 3NVVA 2JYTA 3P4RB 1XXGA 3WAMA 5KHQA 1WJ6A 2WX1A 2Y5BB 2D3BA 3OAWA 4A3OA 4AUQC 3U2SC 1SBBB 3Q3OC 1UGMA 3SDLC 1CZPA 3ABVB 4M0WB 3MC0B 2AQ2B 3Q69A 4US9A 4AJYB 1WXSA 2V3PA 2FE8A 1J7CA 3HM3A 2KFJA 2FIDA 2INCC 3I63C 3R2IA 1ZGUB 3ZNGC 2OHFA 2LUMA 2L05A 3V60A 4W9JA 3DVNV 3RNEC 1FRDA 3R2TA 2FNJB 2AL3A 1QOFA 2AQ3B 4IUMB 1IP9A 2BF8B 3PTFC 2G4DB 2N1VA 2Z59B 2I1KA 3AXCA 4JL9A 2BYEA 2ZJDA 1RLFA 4MM3A 1JWMD 3VTWA 3ZJVA 3L0WB 1C4CA 4WWMA 5HKHA 3UQAA 1IGDA 4HDOA 4ANUA 1LQBA 4F1SA 2BB5A 4C00A 2OJRA 5EE9A 1FXTB 3M63B 2KQ7A 1BXTA 2WU2B 3AH7A 4AP4C 1VLBA 2GBKA 2ZPNA 3NRZA 1L5PA 4AWJA 3A4RA 3QJZA 2BYVE 2D11A 2I1JA 1WZ0A 5HI1A 3KH0A 2KACA 2IO0B 1E0ZA 3A9JA 1TJEA 1SE4A 2JZPA 2WX0A 2O6VB 4D2KA 2D3AA 2DZIA 2W54A 4XDDA 2BVCA 2RPVA 1T0QC 4KDIC 3ZDMC 2N9PC 4W9LA 1WSPA 3HIZA 2KDMA 2AWTA 3FC4A 4ZHOA 1TY0A 2E3TA 4KV2A 4MDKE 4JPSA 1KTKA 4J6IA 4A6QA 3C19A 5KHOA 1C76A 1XEEA 4UDUC 3Q2AC 3RT3B 4FHKA 4ZRJA 2NPTB 1G6JA 5E6NA 1D3ZA 3U4EG 1SSNA 3BYTB 2MBEA 2R61A 4K1RB 2M4NA 5DPRA 2JXXA 1HTOA 4WH4A 1UWMA 3APFA 3AE2B 2LWPA 2PVGC 2ASQA 1UBIA 4YTMB 1FCCC 2ZCCA 4WWNA 2E6XA 3VRAB 3DPDA 1MJDA 5BMIA 2SEBD 3ZDTA 1GC7A 5HFYA 4EZKA 4XWTA 2EKEC 1N5WA 1YMHE 4BKSA 4GDLB 2XN9C 3ZRFA 3PLUA 3PRPB 3SFDB 1YX6B 1C4PA 2LHEA 2IO1B 3ZNHB 2WXPA 1E8XA 1ESFA 3HUIA 4WIPA 2R2QA 2LXCA 1HE8A 1ZP0B 2KMMA 1DGJA 4PT5A 5AZGA 3MJWA 1EU4A 1AW7A 4NQLB 4XYCA 2GBMA 2VH1A 2ZCBA 2DAJA 3FKYA 4DHZE 1K53A 1AYFA 5IO9A 4MJSA 2JWUA 2PLPA 2B3AA 1JWAD 5E6PA 2BT6A 5C23A 3HHMA 3DWGC 3PHWB 1KLUD 3AE8B 1EWCA 2DWQA 1BMLC 2DZMA 3U7ZA 3NJTA 3TSSA 1E90A 2HTHA 2KDEB 1E7VA 1PGBA 4AS1A 2JF5A 5D2MB 4DHJB 1XLOA 1QT9A 3ENEA 2L76A 1OTRB 4ICUA 2D2QA 1PGAA 4HJGE 2WDRB 4WJPA 1E8YA 2PMVA 3NS1A 3B0AA 2GLSA 2WS3B 5IKCM 3APCA 1J7BA 3N1YC 1WXQA 1MPEA 2JRHA 4TQ0A 4N59A 3VTVA 1YIWA 3P4SB 2RDHA 3PZDA 1F0ZA 5E6OA 1JWBD 1KFYB 1WX7A 2GBJA 2CS4A 2KMCA 3AE3B 3WALA 2CKHB 1SE9A 2FCQA 2INDC 2KDBA 4HPMB 2WXFA 2GBRA 4DK5A 4PYZA 2N4FA 4EZLA 1NVID 4N6EB 2QEJC 3BWUD 3RNAC 4S0RA 1VD2A 2HJ1A 1SIJA 3AV8A 3A4SC 2WXKA 2MWSB 3A33B 3H6NA 5J18A 4W9HA 2MQJA 2MHJA 4XE0A 5DPTA 1F2RC 1GUAB 4MJSB 4R3DA 3M62B 4B6WA 2AYOB 4GDLA 1EUVB 1JMLA 3EUB2 2TSSA 2RSUA 4LNNA 1KLVA 3DHHC 4BZAA 1WM3A 4BVUC 2BWES 2JWZA 1XD3B 2C7HA 4FJVB 2LEKA 5BYQA 2LASA 3Q8BA 1F52A 1N62A 2XNAC 3E9SA 4NPNA 3JW0X 5FK9C 2J42A 4KGTA 4GDKA 4MT5A 3V62A 1VDVA 1FPYA 2JQRB 2C5LC 2V4LA 3OLMD 3V6CB 3RUIB 1C77A 2J0JA 4FULA 3R3MA 3QWZB 2KQ4X 3EA6A 2KXJA 3KLSX 1PFDA 3EFUA 2IDYA 3OWEB 1P7FA 4HLEA 1V81A 4KX6B 2IO3B 1SB3C 1QOAA 2LUEA 2O6VA 5JHBA 1XO3A 1ET6A 4FBJB 5D94A 1XLPA 4PK1A 1UGJA 3TMPB 1I4QA 1L6VA 2R2OA 1UBQA 2FCMA 4LK0M 3TL5A 1QF6A 4B9KA 3NZSA 3H9DA 3SU8X 1RM6C 4YSYB 3ZGZA 1R4NB 3Q8CA 1WXMA 4BFRA 5AUKA 4BBNC 2MP2A 3RNFC 2MH7A 3R66C 2FIFA 4RGTA 1OFFA 4Q2JA 3BK2A 1ZXHA 4KGRA 3URYA 4YWGG 1JRPA 3GP7A 3IHPC 1WGDA 2AQ1B 4WJQA 3DBLB 4OVVA 3AE1B 3D32A 1S1QB 3KYDD 2GOWA 3LXFA 4RNAA 3Q8AA 1RRBA 1EM7A 2WXHA 1Q0WB 2YEPF 1ZW7A 2LVOA 2PIAA 4NQKE 3CMMB 1FNWA 2K9XA 3V05A 3PO0A 2V1YA 3W5VB 4DDGD 1GG3A 3Q3NC 4FXCA 2DZKA 4PS7A 4MGIE 1Z2MA 1ZDXA 3SD5A 3VVWB 1WR6E 2RR9A 4IM2A 2PE9A 4EUTA 3RI7C 3TEZA 2SAKA 2BYFA 1HZ5A 1P7EA 2MCNB 2CHZA 4TSSA 3IG3A 2N7JA 4A3PA 2WDVB 3GB1A 1FFVA 3PT2B 1WH3A 4LNIA 2Z0EB 2GB1A 1UZXB 4FADA 2N9EB 1GB4A 2K25A 3PPAA 2G45B 2DYMA 3EHVA 3K9PB 3Q3JA 3TEWA 2D07B 4HKZE 2REXA 1SJHD 2K3UA 2C7MB 2LRWA 3QHTA 4IG7B 5IN7A 1WM2A 5L95C 4YL8A 1VRAB 3VXWA 3BYYB 3DBRI 2LFIA 3CF6E 4HRSA 4WWPA 1CMXB 1SEBD 4XZ4A 4OVUA 3IT4B 3RNBC 3L4PA 3CSTA 4LDTB 4BKSD 2JRIB 1WJNA 2KJ6A 4DQOC 3Q3FA 1YJIA 4GIVA 3VH3B 4MELA 4P6VF 2JVCA 5GXGB 1BT0A 3W1SC 4P16A 1K8RB 4IKGA 3PGEA 3PLVA 1ET9A 3N20C 1L0VB 5HHDG 3Q8EA 3M3JA 3WA0A 5T8IA 3FILB 3QIJA 4QAYA 1IBXB 4IWOA 2IGDA 4OZBA 4URKA 5J2RA 2ZZPB 1C1YB 1GOZA 2O6VD 1V80A 2KC1A 4BOSC 4GDKB 3S2AA 5LXIB 1E8WA 5D3IB 2VRRB 1QOBA 1T0YA 2ZEQA 3GS2A 3HK0A 3IXSA 4JWSC 1YQ4B 1SXTA 2JUOA 3C0RB 2XK5A 1DOXA 2V0GA 2OJWA 5AUIA 1KRHA 5JHAA 3HVDA 1TS3A 2X8XX 1NI3A 1TT5B 3QA8A 1DYQA 2L83A 1TIFA 3BINA 2A5UA 2C9WB 1TZ1A 2KWVB 2N0SB 3N30A 2HJ8A 1OQQA 1V1PA 3RN9C 2WXLA 2L32A 3AEFB 2MBOA 4G3XB 1MI0A 3ZIMA 1WIAA 3PREA 4EKUA 1GB1A 3KW5B 4KIKB 2L1AA 4JIOU 4KZCA 4DHJD 3MFGA 3RPFC 3BVMA 1C79A 3P4QB 1JALA 2M0AA 2QIEB 2YVCA 1GNUA 4MH0E 3MHSD 2MP2B 2C7NB 4MACA 4M00A 1T3QA 1GC6A 1WXVA 5G5GA 4RGMA 1ZXIA 1IUEA 1K51A 2BWFA 4FA6A 3VR8B 4O1NA 2VH2A 2ZVOA 3MC9A 3P4PB 4GU2A 4ZOHC 2PEAA 1KH0A 1B9RA 4WAAA 1UELA 3JSVB 1P0RA 2ON8A 1N61A 2D10A 3UIPB 3RZWC 3L16A 3I5JC 3JYUA 1XCTL 1ZOYB 3I9V1 3DDCB 3FAHA 4GLSC 2C60A 1MVKA 3VH4B 1AWDA 3ETRA 5H92C 4ZRIA 4EOYA 1V97A 3AB5A 2NCNA 1I4HA 4OVZA 3A9KA 1WX9A 2MJ3A 2QHOA 4C4VB 4LLGM 5D6JB 4RF1A 4HDQA 4DXGA 2N9LA 1SJED 1FRRA 4HPPA 1I7HA 3AEDB 2EMSA 4TQ1A 1UF0A 5JH5C 5EE0A 4CQNA 4YT0B 2L7RA 4LNFA 4KZ0A 4IDIA 4E74A 2FUG1 3ZVVA 2FCSA 2QSDA 3W2DA 1P1AA 1J0GA 3RCZA 3RNCC 3VAWA 3W9CB 2M0XA 2HTME 4JX1C 4NJCA 4W9IA 5EDSA 4LDTD 2BW2A 4HPLB 1WJUA 2Z8LA 1KOTA 2AEHA 1YJJA 2JXTA 3AE5B 2DYOA 4BKGA 3GOEA 4C80A 2QDFA 2IY0B 2EELA 2NMQA 2FBWB 2V9HA 1YNTE 3H8HA 4P7IA 1RYJA 1WZ3A 5C1ZA 2BPSA 1RFAA 1XLNA 4PS8A 2O2VB 2NBWB 4BAXA 3LB8C 5LNK1 3BVZA 2LVPA 2UYZB 2JX5A 4IOIE 3ZQ4A 5BMHA 2M17A 2BQQA 1WGKA 3LJ3A 2ZW0A 2G1EA 1WYWB 4XC2A 1TS4A 2NBVB 4NNJB 3K9OB 3ZJTA 5EE1A 2IGHA 1DOIA 3RULA 4HVBA 4KIKA 4M02A 1N63A 4ASWC 3TEXA 1TKGA 2K0PA 1V1PB 3E56A 1JWSD 3ONSA 1STEA 3MC8A 1NDDA 3RYTA 1ROEA 4KSLC 4CHKA 1QZEA 2HDEA 3DBHB 1V5OA 3DVNU 2DBYA 2LI5A 5JXVA 2RD0A 4ANVA 2CJNA 2J52A 2KC2A 4LCDE 1N5XA 2LD9A 2X38A 5CHFA 1YJ1A 5LXHA 2EMTA 4MSQB 4GN1A 3T8MA 4DXFA 3AU5A 1E7PB 1EU3A 1WRDB 1WF9A 3Q8FA 1L7YA 3T3OA 1FIQA 1J8CA 1UD7A 4HCPB 1P9DU 2NTTA 3BY4B 1KLGD 3LYYA 2KHWB 2BS4B 4GXBA 3DQVA 3N3KB 3L08A 1V5TA 1JW9D 3VDZA 3NZ3A 1SGHA 4JGHB 4MSMB 2LGIA 1WE6A 4G0NB 1OGWA 1N60A 2W82A 3PVLA 1NENB 3O65B 2W3RA 4JE3B 1F77A 3N1XC 2WXQA 3R7QA 2J0MA 4US8A 3PV1A 2NTSA 1NBFC 3PS6A 3WIMA 3TJPA 1UNSA 4TUUA 1Q10A 1NYQA 2WDTB 4CO7A 1WY8A 1FEHA 5CHWA 1Y8RC 2ACZB 3QC8B 1A5RA 1B1ZA 1L0YB 3AE9B 4YSZB 5IA7A 2KJHB 1SE2A 1ZPSA 3DVGX 2PE6B 4JLCA 1NYRA 3A9JB 4KKJA 5G2NA 2NR2A 1YX5B 1Q5WB 3HVZA 3AEGB 4KDLB 4RGNA 5IP4D 2KZRA 3B08A 4KSKC 3B9JA 5LLIA 4FJZA 1E9MA 1CQVA 2N9XA 2BS2B 1WJ4A 1TTNA 2LJ5A 4HCNB 5G5HA 3AE7B 4MM3B 2DLBA 1Z5SB 2ICIA 2MBQA 3WANA 4KGSA 3VTUA 3VUXA 4RM9A 3PZ7A 5AZFA 2JSVX 5IOIA 4HKQA 5EE3A 2Y5CA 4KVGB 4KKIA 3X23A 2WXNA 1PDXA 5I4DA 3GZNB 2YLMA 1L2NA 3L13A 3OG5A 2WXOA 1FCLA 2KAJA 3DBRB 3U7DA 5JZEB 1ZDVA 4W9KA 3KQ4A 5CHVC 1IGCA 5AZHA 2W55A 3EFCA 4A9AA 3QARA 2CHWA 2FCNA 4NZLB 3UGBB 2D3GA 1LO5D 1H8CA 4K7SA 4K3CA 2LGXA 5C3JB 3MP9A 1FNUA 1BUIC 2BKRB 2JU6X 3KWVA 1I4GA 2D5GA 2CHXA 5BYSA 3OJ3A 4AOFA 2BBCA 4MEMA 2NBUA 2O2VA 1AN8A 4RH6A 4K3BA 2MSED 2LMCA 2KLGA 3P42A 2KK8A 5CTRC 3QK0A 3SEBA 3DHGC 3N32A 4ARIA 2KT7A 3GZNI 4WAFA 1WRIA 3AE6B 1T0RC 1UH6A 4XDCA 1SIFA 3NVYA 5CX3A 3KUCB 1ZUD2 2JYEA 5FR6A 5HG2A 4H2AA 2W9NA 4YXDB 4HROA 2LJIA 3ZTDA 1MG4A 3SR6A 2W3SA 4IWPA 4WQOB 4L2YA 1E6EB 1PQSA 1ACCA 2WXMA 3MJ5A 2M8SA 4RMAA 2GBNA 2DENB 2H89B 2LHDA 1F1HA 3QAQA 2KTRA 5E6JA 2WU5B 1Q1OA 3NG0A 4WJOA 4PYUA 4L1BA 3UINB 2D3CA 1WGYA 1F9JA 3PRZA 1VZ8A 2RGFA 3Q3MC 2CU1A 1FD6A 3T9LA 1I42A 2KKCA 3V3XA 2PTLA 1N6ZA 1PGXA 4X57B 3AEEB 2JY6A 3R7RA 1C3TA 1RFKA 4MGKE 2JZ3B 2PW9A 1IYFA 3DBSA 1Y56A 2KLCA 2KTRB 1MG8A 2IYDB 4IC7B 2JT4B 1RWSA 2OEDA 2IBIB 1GPXA 5MPOA 2YEPB 4FLHA 1D5MC 4XX5A 4B0EA 4L23A 1OEYA 3UQBA 3VUYA 2J0KA 4OW0A 3AULA 3PRMB 1YN4A 1LM8B 1L4DB 4M8MA 3EGRA 2KYWA 4P1CC 4C4VA 3JVZX 3P2BA 2UWQA 2N9KA 3QCAA 2G3QB 2LGDA 4N9F4 3A1QA 1HQRD 2CJOA 1P3QU 3OJ4B 3PZ8A 2M56B 4OHJA 4REZA 3SFEB 4PS3A 1LXDA 2KX3A 1FM0D 3VHTC 3CSFA 4TKNA 3AU4A 2MA9B 4YSXB 4W9GA 3AEAB 4DDID 4RFBA 4K7UA 2WHIA 3GE8C 2IO2B 5FR3A 1OQYA 2WXJA 4WURA 1TS5A 1HZ6A 2DAFA 3N9YC 3RMKC 3VRBB 4B95A 1SF0A 3VQIA 2XK5B 1I35A 4AJWA 5G55A 3DCGA 2EKIA 2WYQA 3NZUA 1XQQA 2KNBA 2GMIC 2Z0DB 2WXGA 3VUWA 3ML9A 1CK1A 1NEKB 3UI3A 4GOCA 5BYRA 4MGZE 2IPKD 1TZOA 2LVQA 2QMTA 3QX1A 1XF5L 3NVWA 1YQBA 4JWUC 1YD8U 4E71A 3I3TB 2IY1B 3KYCD 3RD2A 3WAOA 1HTQA 1WMHA 2N7EA 3U8ZA 4G50A 1IBXA 1TKYA 2KVRA 2LXAA 4MH8A 1UUPA 1JROA 2WDQB 3VR9B 1WGRA 2PJHA 3NY5A 4TMAB 2CR5A 1EF5A 2I38A 2PKOA 1UWXA 2KD0A 4IW0A 2DHZA 3PHXB 3QQ8B 3ZNID 1TYGB 4ZRKA 3ZKJC 2AL6A 3GE3C 2G4SA 2MEKA 2MRPA 2N1WA 1QILA 3BZDB 4K81A 2KMAA 4G11A 3ZNZB 3AECB 2L3ZA 2ZPYA 3P63A 3H1UA 1K52A 4GGQA 5L83A 2WXIA 1QOGA 3ZTCA 3KUZA 1E10A 3ZRCA 2DYBA 1F2RI 2Y3AA 3FILA 4BOZB 5DPWA 2LZ6A 3U30A 2I2YA 4W9EA 4JQWC 1L4ZB 1ENFA 4WWOA 3V61A 2JZZA 1V49A 1AARA 1V6EA 2KN4A 2M1MA 2Y5PA 3O13A 4ANXA 1WI0A 3ZYYX 4DBGA 2NS5A 2DNFA 5D3DA 4EZJA 3DOWA 3ZO5B 4I6LB 2INNE 4A20A 4C7YA 4S17A 2K8CA 4MGYE 1M4VA 3ZLZA 4K7WA 5DCNA 1I4RA 4FHJA 1CJEA 2LGYA 2L00B 1MFWA 5IAAC 1PUTA 2DX5B 3MHZA 4AQ7A 3ZXVA 2RDBC 2KDFB 3W1SA 5BMGA 3NVZA 1FO4A 4XWWA 2ZNVC 1R4MB 2H88B 2INPE 3RZFA 1HA5A 1FNVA 1GAQB 3AMZA 2WP9B 2BS3B 1VZ7A 3SHQA 4LJPB 4NY0A 1ISNA 3W1YA 3X0WA 3H7PA 2RPQA 1QQRA 4BKTA 4GSWA 3CIRB 1EF1A 2QCZA 1M94A 2HD5B 3H7PB 2MJDA 1P98A 4N58A 1SE3A 1S3SG 1WE7A 2KWUB 1L6UA 3KVFB 4ACFA 1I4PA 3RFZB 2BB6A 4W9DA 3TCAA 3TUOA 1VR9A 3DVGY 3IT6B 4E3CA 2L0FA 1R7SA 3EECA 3DHIC 3VFKA 3LDZE 1XCQL 4M0WA 1KJTA 4WJNA 4IWQA 3NUHB 4C56C 3L54A 1WR1A 1R4MI 4II2B 1T0SC 1TY2A 2GI9A 2KANA 1C78A 1X1MA 2FAZA 1TGZB 4W9FA 3AI5A 2XBBC 2XEWA 2WQYB 3UF8A 1TBEA 2QC8A 3HM6X 1FFUA 5TR5A 4ZYSA 2KFKB 5H8YE 3MTNB 3CWIA 3APDA 1WWTA 5D7GA 3U52E 4ARCA 4DXAB 4FN2A 4CYEA 3R8BA 3TEYA 3ZW3A 4I6PA 3L17A 1VZ6A 1WYGA 1V8CA 4ZRQA 4WQMA 4F8CB 2OOBB 1J7AA 2A4ZA 1TS2A 1WGGA 1E7UA 1RAXA 1A70A 1C9FA 4ZHPA 3NS8A 2GRIA 2BKFA 1JWUD 1EO6A 2B76B 1GJZA 1FMAD 4RF0A 4DWFA 2WNMA 4B0MA 2KN5A 4LTUA 4IM3A 3Q6BA 5GMVA 3BIID 1YN3A 4OZAA 2KDIA 3AN1A 2KO3A 3NHEB 4BBNF 1L0XB 4YTNB 3ZXRA 2V3SA 1J19A 4FJYA 2K6QA 1ZKHA 1JRUA 1WMHB 2ZW1A 3AEBB 3V6EB 1VJKA 4GB9A 4YTPB 1WGHA 2L8JA 3B2FA 4ANWA 2VZKB 1HXYD 4M8NA 2WGSA 1LGRA 4M01A 2MBHA 4NAMA 2IZVB 1MHXA 2K8HA 1EWYC 4HXDA 3A9KB 3AE4B 4EE2A 3BVGA 3DBHI 2J53A 4XGAB 1KF6B 2KJRA 4ZYNA 3PSEB 4NAWA 2NVUI 4ZRPA 1FXAA 2KTFA 4LNOA 2KVZA 3IAM1 1OQRA 2WLBA 3ZJUA 1YN5A 2K39A 2Q5WD 2IGGA 4USAA 3JSVA 1YQ3B 3I57A 2G9HD 2RDGA 2AX5A 3C8YA 1WXAA 4II3B 2QJLA 1K50A 1U4AA 3TBLD 4DHZB 3B1LX 5FKAC 4NJ6A 5C2TB 2V3NA 4J3OD 3H7SA 2L0TA 1D4BA 3AM9A 1D6EC 2JPHA 2BGFA 2MX2A 4ITKA 4TV3A 3EC8A 1WFYA 2KWDA 1V86A 2J7QB 5BO4B 3W5UB 1WX8A 1D5ZC 2MW5A 4RM8A 3A1QB 1MHHE 2KWCA 4GMVA 2UU7A 4OZCA 4EEWA 2VZKD 3WCQA 1E5WA 2M19A 3BK1A 2CU3A 3WAPA 2BTEA 4C7ZA 2WWZA 3J9CA 3ZUNA 1V9JA 2ZNVB 2QILA 2HE7A 2WXRA 1D5XC 1XLQA 1T5XD 3L10B 4RCOA 1I4XA 3RNGC 1QKZA 1VCBA 1JQ4A 5AEKB 4RGOS 1V2YA 1T6BX 3UIOB 2KX0A 3IFWB 3IAS1 2J4XA 1LFDA 2DZJA 1ZE3D 1TKEA 4HK2A
chains in the Genus database with same CATH topology
3IBEA 4NPNA 3JW0X 2KOXA 2LVPA 4K7UA 3V62A 4GDKA 2UYZB 2V4LA 3OLMD 2C5LC 3V6CB 2IO2B 3M95A 3RUIB 2M17A 1OQYA 2J0JA 4FULA 3LJ3A 2DAFA 3R3MA 3NOBA 3QWZB 4I6NB 4ZDVA 4B95A 2FUHB 2KXJA 3VQIA 2XK5B 1I35A 4HWIB 4AJWA 1WYWB 2K1FA 5G55A 3DCGA 4XC2A 3EFUA 2MBBB 1R4NI 2NBVB 2WYQA 3NZUA 1XQQA 4NNJB 3K9OB 4HLEA 1V81A 2IO3B 1H4RA 2KNBA 2KQSA 3RULA 2LUEA 4HVBA 2GMIC 2O6VA 5JHBA 4NJ7A 2Z0DB 4FBJB 4NAWB 3VUWA 4KIKA 3ML9A 1E8ZA 4ASWC 5D94A 1KM7A 2K6DB 4GOCA 3TMPB 4MGZE 2R2OA 3QX1A 2LVQA 3DBLI 1UBQA 4HJKA 2FCMA 3ONSA 1YQBA 5J17A 3TL5A 1NDDA 4B9KA 3NZSA 3H9DA 3RYTA 1NI2A 2LRUA 3SU8X 3KUDB 1YD8U 4KSLC 4E71A 4CHKA 3I3TB 3TIXA 2IY1B 1QZEA 3ALBA 3DVNU 1V5OA 1WXMA 2PPHA 4BFRA 3KYCD 2MP2A 4BBNC 2LI5A 3RD2A 2RD0A 4ANVA 3WAOA 2ZVNA 1WMHA 2N7EA 3ML8A 1IPGA 4F7ZA 2KC2A 3R66C 3U8ZA 4G50A 2FIFA 4ICVA 3IVFA 4LCDE 2KVRA 2LXAA 2LD9A 4W9CA 5CHFA 2K8BA 3IHPC 1YJ1A 1WGRA 5LXHA 1WGDA 4WJQA 2PJHA 3NY5A 2EMTA 2CR5A 4MSQB 1EF5A 3ECIA 4IM0A 4OVVA 2KFKA 4GN1A 1OEYJ 3T8MA 3AU5A 3D32A 2KD0A 1WRDB 1S1QB 1WF9A 2NPTA 4EFOA 4IW0A 3KYDD 1L7YA 2DHZA 2GOWA 3PHXB 3QQ8B 3ZNID 5DPSA 1J8CA 1UD7A 4LJOB 4ZRKA 4HCPB 2AL6A 1P9DU 3ZKJC 3BY4B 1RRBA 1XT9B 2G4SA 2MLBA 2MRPA 2N1WA 2KHWB 2N7DA 4K81A 4GXBA 1Q0WB 2KMAA 4G11A 3ZNZB 3DQVA 1ZW7A 3L08A 2LVOA 1V5TA 2L3ZA 2ZPYA 3N3KB 3VDZA 3WAMA 1SGHA 3H1UA 4JGHB 4NQKE 4GGQA 5L83A 5KHQA 1WJ6A 3ZTCA 2WX1A 2Y5BB 3KUZA 3CMMB 4MSMB 3ZRCA 1WE6A 2DYBA 4G0NB 1OGWA 3OAWA 4A3OA 4BOZB 5DPWA 2LZ6A 3U30A 4AUQC 4W9EA 1UGMA 2V1YA 4JQWC 3SDLC 3PVLA 4DDGD 1GG3A 4M0WB 3O65B 4WWOA 3V61A 2JZZA 1V49A 1AARA 1V6EA 1WXSA 4AJYB 2M1MA 4ANXA 1WI0A 2DZKA 4PS7A 3R7QA 2J0MA 4MGIE 1Z2MA 4DBGA 3HM3A 2NS5A 3SD5A 3VVWB 2KFJA 4EZJA 2FIDA 3DOWA 1WR6E 3PV1A 2RR9A 4IM2A 2PE9A 4I6LB 3ZO5B 1NBFC 3PS6A 4EUTA 1ZGUB 3WIMA 4A20A 2K8CA 4MGYE 3ZNGC 2BYFA 3TJPA 2L05A 2MCNB 2CHZA 3V60A 3IG3A 3ZLZA 4K7WA 4W9JA 5DCNA 4A3PA 4FHJA 4TUUA 3DVNV 2LGYA 3PT2B 1WH3A 2WDTB 2L00B 1WY8A 2FNJB 2Z0EB 2AL3A 4CO7A 1UZXB 5IAAC 2DX5B 5CHWA 4IUMB 4FADA 1Y8RC 2N9EB 3QC8B 2K25A 1A5RA 1IP9A 3PPAA 2G45B 5IA7A 2DYMA 3EHVA 3K9PB 2KJHB 2KDFB 3W1SA 2BF8B 3PTFC 2G4DB 2N1VA 3Q3JA 2D07B 2Z59B 3DVGX 2PE6B 2REXA 4JLCA 2I1KA 3A9JB 3AXCA 5G2NA 2ZNVC 2C7MB 4JL9A 2BYEA 2LRWA 3RZFA 2ZJDA 2NR2A 1RLFA 3QHTA 4IG7B 4MM3A 1YX5B 3VTWA 3SHQA 1Q5WB 4LJPB 4NY0A 3L0WB 5HKHA 3UQAA 1ISNA 1WM2A 5L95C 4KDLB 4YL8A 4HDOA 3W1YA 3VXWA 2KZRA 3X0WA 3H7PA 3DBRI 2RPQA 4BKTA 4ANUA 1LQBA 3B08A 4GSWA 4F1SA 3CF6E 1EF1A 4WWPA 1CMXB 2OJRA 1FXTB 4KSKC 4XZ4A 3M63B 4OVUA 3CSTA 2KQ7A 1M94A 2HD5B 3H7PB 4LDTB 1P98A 2JRIB 5LLIA 4BKSD 4FJZA 4AP4C 1WJNA 1S3SG 2GBKA 2KJ6A 2ZPNA 1WE7A 2KWUB 3KVFB 4AWJA 4W9DA 3A4RA 3QJZA 2N9XA 3TCAA 1WJ4A 2LJ5A 1TTNA 3Q3FA 4HCNB 2BYVE 3DVGY 4E3CA 4GIVA 1Z5SB 3VH3B 2D11A 2MBQA 2I1JA 1WZ0A 4MELA 3WANA 2JVCA 3KH0A 1BT0A 2L0FA 3W1SC 3VTUA 3VUXA 1K8RB 2IO0B 3PGEA 4RM9A 3A9JA 3EECA 3PLVA 3VFKA 5AZFA 2WX0A 3LDZE 2O6VB 1KJTA 2DZIA 4WJNA 4KDIC 4KVGB 3M3JA 3WA0A 4IWQA 3ZDMC 3L54A 1WR1A 2N9PC 4W9LA 1R4MI 3X23A 3QIJA 4II2B 3HIZA 4IWOA 2AWTA 2KANA 4URKA 5J2RA 4KV2A 2ZZPB 1C1YB 1X1MA 2FAZA 1TGZB 4MDKE 4J6IA 2O6VD 4W9FA 1V80A 5KHOA 2YLMA 2KC1A 4BOSC 3RT3B 1L2NA 4GDKB 3AI5A 3L13A 3S2AA 2XBBC 5LXIB 1E8WA 2XEWA 3UF8A 1TBEA 4FHKA 4ZRJA 2VRRB 3HM6X 3U7DA 5JZEB 2NPTB 1G6JA 5E6NA 1D3ZA 5TR5A 4W9KA 2KFKB 5CHVC 2MBEA 4K1RB 2M4NA 5DPRA 5AZHA 3MTNB 2JXXA 3APDA 5D7GA 1T0YA 3APFA 2ZEQA 3HK0A 3QARA 2LWPA 2ASQA 1UBIA 4DXAB 4FN2A 2CHWA 4CYEA 2ZCCA 4WWNA 2FCNA 2JUOA 3ZW3A 3DPDA 4I6PA 3L17A 2D3GA 3C0RB 3UGBB 3ZDTA 2XK5A 4F8CB 1H8CA 2OOBB 4K7SA 2A4ZA 1GC7A 1WGGA 4EZKA 1E7UA 2EKEC 2LGXA 5JHAA 4BKSA 1RAXA 4GDLB 3ZRFA 2BKRB 3NS8A 3PLUA 3PRPB 3QA8A 2BKFA 1EO6A 2CHXA 3BINA 3OJ3A 1GJZA 1YX6B 2A5UA 1TZ1A 2C9WB 2KWVB 4MEMA 4AOFA 3N30A 4DWFA 2KN5A 2NBUA 2HJ8A 2O2VA 4IM3A 2IO1B 5GMVA 3ZNHB 2MBOA 2MSED 1E8XA 4G3XB 3ZIMA 1WIAA 2KLGA 3PREA 4EKUA 2KDIA 2KK8A 3KW5B 4KIKB 2KO3A 3NHEB 4JIOU 5CTRC 4BBNF 3QK0A 2R2QA 4KZCA 2LXCA 1HE8A 4DHJD 3N32A 5AZGA 3MJWA 3GZNI 2V3SA 1J19A 4NQLB 4FJYA 2K6QA 1ZKHA 1UH6A 1GNUA 2YVCA 1JRUA 4MH0E 2GBMA 1WMHB 1SIFA 2ZCBA 3MHSD 3V6EB 2MP2B 2DAJA 5CX3A 4GB9A 2C7NB 3KUCB 1WGHA 2L8JA 1GC6A 5FR6A 4ANWA 1WXVA 4DHZE 2W9NA 4M8NA 3ZTDA 2MBHA 4MJSA 2BWFA 2B3AA 4IWPA 2IZVB 4WQOB 2K8HA 4HXDA 5E6PA 4FA6A 3A9KB 1PQSA 2ZVOA 5C23A 3HHMA 3DBHI 4GU2A 2PEAA 3PHWB 2M8SA 4WAAA 1UELA 2KJRA 1P0RA 3JSVB 4RMAA 4ZYNA 3PSEB 2DZMA 2D10A 2NVUI 4NAWA 3UIPB 3RZWC 3L16A 2KTFA 2GBNA 3JYUA 2DENB 1E90A 2HTHA 3QAQA 2KDEB 2KTRA 1E7VA 3DDCB 2K39A 2C60A 1Q1OA 2JF5A 5D2MB 3JSVA 4WJOA 3VH4B 4DHJB 4PYUA 4ZRIA 4EOYA 3UINB 3ENEA 2L76A 1WGYA 1OTRB 1F9JA 2D2QA 3PRZA 4ICUA 2NCNA 1WXAA 1E8YA 1WX9A 2RGFA 3A9KA 4II3B 2QHOA 4WJPA 3B0AA 2CU1A 5D6JB 3APCA 4HDQA 1U4AA 3T9LA 2JRHA 3TBLD 4TQ0A 2KKCA 4DHZB 1I42A 3B1LX 3VTVA 1YIWA 4NJ6A 4X57B 2EMSA 3PZDA 3H7SA 2JY6A 5E6OA 4TQ1A 3R7RA 4MGKE 2L0TA 2JZ3B 1C3TA 1IYFA 1WX7A 2GBJA 5JH5C 2CS4A 2KMCA 2JPHA 3WALA 2CKHB 3DBSA 2KLCA 2BGFA 1SE9A 2MX2A 2FCQA 2KTRB 2KDBA 4HPMB 2L7RA 1MG8A 2IYDB 2GBRA 4DK5A 4IC7B 4TV3A 4PYZA 2JT4B 2N4FA 4KZ0A 4EZLA 3EC8A 1WFYA 4E74A 1V86A 2IBIB 2J7QB 5BO4B 1WX8A 2MW5A 4RM8A 3ZVVA 3A1QB 2KWCA 4FLHA 2FCSA 4XX5A 1VD2A 4GMVA 1P1AA 3UQBA 1OEYA 1J0GA 3RCZA 3VAWA 3VUYA 4EEWA 1E5WA 2M0XA 3A4SC 2J0KA 2MWSB 3A33B 3AULA 3H6NA 3PRMB 4W9HA 2MQJA 5J18A 5DPTA 1GUAB 1LM8B 4MJSB 4M8MA 3M62B 4B6WA 2AYOB 3WAPA 4W9IA 5EDSA 3JVZX 3P2BA 2UWQA 2WWZA 4GDLA 4LDTD 3QCAA 1EUVB 1V9JA 2G3QB 4HPLB 3ZUNA 2LGDA 1WJUA 4N9F4 3A1QA 2ZNVB 1KOTA 2AEHA 2RSUA 1KLVA 1P3QU 2HE7A 3OJ4B 1WM3A 2DYOA 4BVUC 2BWES 4BKGA 2JWZA 3GOEA 3L10B 4PS3A 2IY0B 1XD3B 1VCBA 1LXDA 2KX3A 3VHTC 4P7IA 5AEKB 1V2YA 3UIOB 3CSFA 1WZ3A 5C1ZA 2C7HA 4TKNA 3AU4A 4FJVB 2MA9B 2BPSA 2KX0A 1RFAA 3IFWB 2LASA 1LFDA 4W9GA 4PS8A 2DZJA 2NBWB 2O2VB 4DDID 4HK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IBE A;  4NPN A;  3JW0 X;  2KOX A;  2LVP A;  4K7U A;  3V62 A;  4GDK A;  2UYZ B;  2V4L A;  3OLM D;  2C5L C;  3V6C B;  2IO2 B;  3M95 A;  3RUI B;  2M17 A;  1OQY A;  2J0J A;  4FUL A;  3LJ3 A;  2DAF A;  3R3M A;  3NOB A;  3QWZ B;  4I6N B;  4ZDV A;  4B95 A;  2FUH B;  2KXJ A;  3VQI A;  2XK5 B;  1I35 A;  4HWI B;  4AJW A;  1WYW B;  2K1F A;  5G55 A;  3DCG A;  4XC2 A;  3EFU A;  2MBB B;  1R4N I;  2NBV B;  2WYQ A;  3NZU A;  1XQQ A;  4NNJ B;  3K9O B;  4HLE A;  1V81 A;  2IO3 B;  1H4R A;  2KNB A;  2KQS A;  3RUL A;  2LUE A;  4HVB A;  2GMI C;  2O6V A;  5JHB A;  4NJ7 A;  2Z0D B;  4FBJ B;  4NAW B;  3VUW A;  4KIK A;  3ML9 A;  1E8Z A;  4ASW C;  5D94 A;  1KM7 A;  2K6D B;  4GOC A;  3TMP B;  4MGZ E;  2R2O A;  3QX1 A;  2LVQ A;  3DBL I;  1UBQ A;  4HJK A;  2FCM A;  3ONS A;  1YQB A;  5J17 A;  3TL5 A;  1NDD A;  4B9K A;  3NZS A;  3H9D A;  3RYT A;  1NI2 A;  2LRU A;  3SU8 X;  3KUD B;  1YD8 U;  4KSL C;  4E71 A;  4CHK A;  3I3T B;  3TIX A;  2IY1 B;  1QZE A;  3ALB A;  3DVN U;  1V5O A;  1WXM A;  2PPH A;  4BFR A;  3KYC D;  2MP2 A;  4BBN C;  2LI5 A;  3RD2 A;  2RD0 A;  4ANV A;  3WAO A;  2ZVN A;  1WMH A;  2N7E A;  3ML8 A;  1IPG A;  4F7Z A;  2KC2 A;  3R66 C;  3U8Z A;  4G50 A;  2FIF A;  4ICV A;  3IVF A;  4LCD E;  2KVR A;  2LXA A;  2LD9 A;  4W9C A;  5CHF A;  2K8B A;  3IHP C;  1YJ1 A;  1WGR A;  5LXH A;  1WGD A;  4WJQ A;  2PJH A;  3NY5 A;  2EMT A;  2CR5 A;  4MSQ B;  1EF5 A;  3ECI A;  4IM0 A;  4OVV A;  2KFK A;  4GN1 A;  1OEY J;  3T8M A;  3AU5 A;  3D32 A;  2KD0 A;  1WRD B;  1S1Q B;  1WF9 A;  2NPT A;  4EFO A;  4IW0 A;  3KYD D;  1L7Y A;  2DHZ A;  2GOW A;  3PHX B;  3QQ8 B;  3ZNI D;  5DPS A;  1J8C A;  1UD7 A;  4LJO B;  4ZRK A;  4HCP B;  2AL6 A;  1P9D U;  3ZKJ C;  3BY4 B;  1RRB A;  1XT9 B;  2G4S A;  2MLB A;  2MRP A;  2N1W A;  2KHW B;  2N7D A;  4K81 A;  4GXB A;  1Q0W B;  2KMA A;  4G11 A;  3ZNZ B;  3DQV A;  1ZW7 A;  3L08 A;  2LVO A;  1V5T A;  2L3Z A;  2ZPY A;  3N3K B;  3VDZ A;  3WAM A;  1SGH A;  3H1U A;  4JGH B;  4NQK E;  4GGQ A;  5L83 A;  5KHQ A;  1WJ6 A;  3ZTC A;  2WX1 A;  2Y5B B;  3KUZ A;  3CMM B;  4MSM B;  3ZRC A;  1WE6 A;  2DYB A;  4G0N B;  1OGW A;  3OAW A;  4A3O A;  4BOZ B;  5DPW A;  2LZ6 A;  3U30 A;  4AUQ C;  4W9E A;  1UGM A;  2V1Y A;  4JQW C;  3SDL C;  3PVL A;  4DDG D;  1GG3 A;  4M0W B;  3O65 B;  4WWO A;  3V61 A;  2JZZ A;  1V49 A;  1AAR A;  1V6E A;  1WXS A;  4AJY B;  2M1M A;  4ANX A;  1WI0 A;  2DZK A;  4PS7 A;  3R7Q A;  2J0M A;  4MGI E;  1Z2M A;  4DBG A;  3HM3 A;  2NS5 A;  3SD5 A;  3VVW B;  2KFJ A;  4EZJ A;  2FID A;  3DOW A;  1WR6 E;  3PV1 A;  2RR9 A;  4IM2 A;  2PE9 A;  4I6L B;  3ZO5 B;  1NBF C;  3PS6 A;  4EUT A;  1ZGU B;  3WIM A;  4A20 A;  2K8C A;  4MGY E;  3ZNG C;  2BYF A;  3TJP A;  2L05 A;  2MCN B;  2CHZ A;  3V60 A;  3IG3 A;  3ZLZ A;  4K7W A;  4W9J A;  5DCN A;  4A3P A;  4FHJ A;  4TUU A;  3DVN V;  2LGY A;  3PT2 B;  1WH3 A;  2WDT B;  2L00 B;  1WY8 A;  2FNJ B;  2Z0E B;  2AL3 A;  4CO7 A;  1UZX B;  5IAA C;  2DX5 B;  5CHW A;  4IUM B;  4FAD A;  1Y8R C;  2N9E B;  3QC8 B;  2K25 A;  1A5R A;  1IP9 A;  3PPA A;  2G45 B;  5IA7 A;  2DYM A;  3EHV A;  3K9P B;  2KJH B;  2KDF B;  3W1S A;  2BF8 B;  3PTF C;  2G4D B;  2N1V A;  3Q3J A;  2D07 B;  2Z59 B;  3DVG X;  2PE6 B;  2REX A;  4JLC A;  2I1K A;  3A9J B;  3AXC A;  5G2N A;  2ZNV C;  2C7M B;  4JL9 A;  2BYE A;  2LRW A;  3RZF A;  2ZJD A;  2NR2 A;  1RLF A;  3QHT A;  4IG7 B;  4MM3 A;  1YX5 B;  3VTW A;  3SHQ A;  1Q5W B;  4LJP B;  4NY0 A;  3L0W B;  5HKH A;  3UQA A;  1ISN A;  1WM2 A;  5L95 C;  4KDL B;  4YL8 A;  4HDO A;  3W1Y A;  3VXW A;  2KZR A;  3X0W A;  3H7P A;  3DBR I;  2RPQ A;  4BKT A;  4ANU A;  1LQB A;  3B08 A;  4GSW A;  4F1S A;  3CF6 E;  1EF1 A;  4WWP A;  1CMX B;  2OJR A;  1FXT B;  4KSK C;  4XZ4 A;  3M63 B;  4OVU A;  3CST A;  2KQ7 A;  1M94 A;  2HD5 B;  3H7P B;  4LDT B;  1P98 A;  2JRI B;  5LLI A;  4BKS D;  4FJZ A;  4AP4 C;  1WJN A;  1S3S G;  2GBK A;  2KJ6 A;  2ZPN A;  1WE7 A;  2KWU B;  3KVF B;  4AWJ A;  4W9D A;  3A4R A;  3QJZ A;  2N9X A;  3TCA A;  1WJ4 A;  2LJ5 A;  1TTN A;  3Q3F A;  4HCN B;  2BYV E;  3DVG Y;  4E3C A;  4GIV A;  1Z5S B;  3VH3 B;  2D11 A;  2MBQ A;  2I1J A;  1WZ0 A;  4MEL A;  3WAN A;  2JVC A;  3KH0 A;  1BT0 A;  2L0F A;  3W1S C;  3VTU A;  3VUX A;  1K8R B;  2IO0 B;  3PGE A;  4RM9 A;  3A9J A;  3EEC A;  3PLV A;  3VFK A;  5AZF A;  2WX0 A;  3LDZ E;  2O6V B;  1KJT A;  2DZI A;  4WJN A;  4KDI C;  4KVG B;  3M3J A;  3WA0 A;  4IWQ A;  3ZDM C;  3L54 A;  1WR1 A;  2N9P C;  4W9L A;  1R4M I;  3X23 A;  3QIJ A;  4II2 B;  3HIZ A;  4IWO A;  2AWT A;  2KAN A;  4URK A;  5J2R A;  4KV2 A;  2ZZP B;  1C1Y B;  1X1M A;  2FAZ A;  1TGZ B;  4MDK E;  4J6I A;  2O6V D;  4W9F A;  1V80 A;  5KHO A;  2YLM A;  2KC1 A;  4BOS C;  3RT3 B;  1L2N A;  4GDK B;  3AI5 A;  3L13 A;  3S2A A;  2XBB C;  5LXI B;  1E8W A;  2XEW A;  3UF8 A;  1TBE A;  4FHK A;  4ZRJ A;  2VRR B;  3HM6 X;  3U7D A;  5JZE B;  2NPT B;  1G6J A;  5E6N A;  1D3Z A;  5TR5 A;  4W9K A;  2KFK B;  5CHV C;  2MBE A;  4K1R B;  2M4N A;  5DPR A;  5AZH A;  3MTN B;  2JXX A;  3APD A;  5D7G A;  1T0Y A;  3APF A;  2ZEQ A;  3HK0 A;  3QAR A;  2LWP A;  2ASQ A;  1UBI A;  4DXA B;  4FN2 A;  2CHW A;  4CYE A;  2ZCC A;  4WWN A;  2FCN A;  2JUO A;  3ZW3 A;  3DPD A;  4I6P A;  3L17 A;  2D3G A;  3C0R B;  3UGB B;  3ZDT A;  2XK5 A;  4F8C B;  1H8C A;  2OOB B;  4K7S A;  2A4Z A;  1GC7 A;  1WGG A;  4EZK A;  1E7U A;  2EKE C;  2LGX A;  5JHA A;  4BKS A;  1RAX A;  4GDL B;  3ZRF A;  2BKR B;  3NS8 A;  3PLU A;  3PRP B;  3QA8 A;  2BKF A;  1EO6 A;  2CHX A;  3BIN A;  3OJ3 A;  1GJZ A;  1YX6 B;  2A5U A;  1TZ1 A;  2C9W B;  2KWV B;  4MEM A;  4AOF A;  3N30 A;  4DWF A;  2KN5 A;  2NBU A;  2HJ8 A;  2O2V A;  4IM3 A;  2IO1 B;  5GMV A;  3ZNH B;  2MBO A;  2MSE D;  1E8X A;  4G3X B;  3ZIM A;  1WIA A;  2KLG A;  3PRE A;  4EKU A;  2KDI A;  2KK8 A;  3KW5 B;  4KIK B;  2KO3 A;  3NHE B;  4JIO U;  5CTR C;  4BBN F;  3QK0 A;  2R2Q A;  4KZC A;  2LXC A;  1HE8 A;  4DHJ D;  3N32 A;  5AZG A;  3MJW A;  3GZN I;  2V3S A;  1J19 A;  4NQL B;  4FJY A;  2K6Q A;  1ZKH A;  1UH6 A;  1GNU A;  2YVC A;  1JRU A;  4MH0 E;  2GBM A;  1WMH B;  1SIF A;  2ZCB A;  3MHS D;  3V6E B;  2MP2 B;  2DAJ A;  5CX3 A;  4GB9 A;  2C7N B;  3KUC B;  1WGH A;  2L8J A;  1GC6 A;  5FR6 A;  4ANW A;  1WXV A;  4DHZ E;  2W9N A;  4M8N A;  3ZTD A;  2MBH A;  4MJS A;  2BWF A;  2B3A A;  4IWP A;  2IZV B;  4WQO B;  2K8H A;  4HXD A;  5E6P A;  4FA6 A;  3A9K B;  1PQS A;  2ZVO A;  5C23 A;  3HHM A;  3DBH I;  4GU2 A;  2PEA A;  3PHW B;  2M8S A;  4WAA A;  1UEL A;  2KJR A;  1P0R A;  3JSV B;  4RMA A;  4ZYN A;  3PSE B;  2DZM A;  2D10 A;  2NVU I;  4NAW A;  3UIP B;  3RZW C;  3L16 A;  2KTF A;  2GBN A;  3JYU A;  2DEN B;  1E90 A;  2HTH A;  3QAQ A;  2KDE B;  2KTR A;  1E7V A;  3DDC B;  2K39 A;  2C60 A;  1Q1O A;  2JF5 A;  5D2M B;  3JSV A;  4WJO A;  3VH4 B;  4DHJ B;  4PYU A;  4ZRI A;  4EOY A;  3UIN B;  3ENE A;  2L76 A;  1WGY A;  1OTR B;  1F9J A;  2D2Q A;  3PRZ A;  4ICU A;  2NCN A;  1WXA A;  1E8Y A;  1WX9 A;  2RGF A;  3A9K A;  4II3 B;  2QHO A;  4WJP A;  3B0A A;  2CU1 A;  5D6J B;  3APC A;  4HDQ A;  1U4A A;  3T9L A;  2JRH A;  3TBL D;  4TQ0 A;  2KKC A;  4DHZ B;  1I42 A;  3B1L X;  3VTV A;  1YIW A;  4NJ6 A;  4X57 B;  2EMS A;  3PZD A;  3H7S A;  2JY6 A;  5E6O A;  4TQ1 A;  3R7R A;  4MGK E;  2L0T A;  2JZ3 B;  1C3T A;  1IYF A;  1WX7 A;  2GBJ A;  5JH5 C;  2CS4 A;  2KMC A;  2JPH A;  3WAL A;  2CKH B;  3DBS A;  2KLC A;  2BGF A;  1SE9 A;  2MX2 A;  2FCQ A;  2KTR B;  2KDB A;  4HPM B;  2L7R A;  1MG8 A;  2IYD B;  2GBR A;  4DK5 A;  4IC7 B;  4TV3 A;  4PYZ A;  2JT4 B;  2N4F A;  4KZ0 A;  4EZL A;  3EC8 A;  1WFY A;  4E74 A;  1V86 A;  2IBI B;  2J7Q B;  5BO4 B;  1WX8 A;  2MW5 A;  4RM8 A;  3ZVV A;  3A1Q B;  2KWC A;  4FLH A;  2FCS A;  4XX5 A;  1VD2 A;  4GMV A;  1P1A A;  3UQB A;  1OEY A;  1J0G A;  3RCZ A;  3VAW A;  3VUY A;  4EEW A;  1E5W A;  2M0X A;  3A4S C;  2J0K A;  2MWS B;  3A33 B;  3AUL A;  3H6N A;  3PRM B;  4W9H A;  2MQJ A;  5J18 A;  5DPT A;  1GUA B;  1LM8 B;  4MJS B;  4M8M A;  3M62 B;  4B6W A;  2AYO B;  3WAP A;  4W9I A;  5EDS A;  3JVZ X;  3P2B A;  2UWQ A;  2WWZ A;  4GDL A;  4LDT D;  3QCA A;  1EUV B;  1V9J A;  2G3Q B;  4HPL B;  3ZUN A;  2LGD A;  1WJU A;  4N9F 4;  3A1Q A;  2ZNV B;  1KOT A;  2AEH A;  2RSU A;  1KLV A;  1P3Q U;  2HE7 A;  3OJ4 B;  1WM3 A;  2DYO A;  4BVU C;  2BWE S;  4BKG A;  2JWZ A;  3GOE A;  3L10 B;  4PS3 A;  2IY0 B;  1XD3 B;  1VCB A;  1LXD A;  2KX3 A;  3VHT C;  4P7I A;  5AEK B;  1V2Y A;  3UIO B;  3CSF A;  1WZ3 A;  5C1Z A;  2C7H A;  4TKN A;  3AU4 A;  4FJV B;  2MA9 B;  2BPS A;  2KX0 A;  1RFA A;  3IFW B;  2LAS A;  1LFD A;  4W9G A;  4PS8 A;  2DZJ A;  2NBW B;  2O2V B;  4DDI D;  4HK2 A; 
#chains in the Genus database with same CATH topology
 3IBE A;  2KOX A;  5TSS A;  4P1B C;  1YOV B;  3M95 A;  1FXI A;  2L52 A;  4ZDV A;  3NOB A;  4I6N B;  1PYW D;  1QLB B;  2FUH B;  4HWI B;  2K1F A;  2MBB B;  1R4N I;  2V4I B;  2BYT A;  1H4R A;  2KQS A;  4A90 A;  3N1Z C;  2PVO D;  4NJ7 A;  3HRD D;  4NAW B;  3KWL A;  4A55 A;  1HEZ E;  4HEA 1;  1E8Z A;  3Q14 C;  2K22 A;  4A8X C;  1KM7 A;  2K6D B;  3DBL I;  4HJK A;  4LNK A;  5J17 A;  1NI2 A;  2LRU A;  3KUD B;  3T3N A;  3TIX A;  3ALB A;  2PPH A;  3P1M A;  2K5P A;  2ONQ A;  2ZVN A;  2IJ0 A;  1IPG A;  3B2G A;  3ML8 A;  4F7Z A;  2LGS A;  4ICV A;  3IVF A;  4W9C A;  1JCK B;  3DWM A;  1V1O A;  2K8B A;  1DOY A;  3ECI A;  4IM0 A;  2KFK A;  1OEY J;  1C4A A;  2MJE A;  2NPT A;  4EFO A;  5DPS A;  4LJO B;  1XT9 B;  2RMM A;  2MLB A;  2N7D A;  3NVV A;  2JYT A;  3P4R B;  1XXG A;  3WAM A;  5KHQ A;  1WJ6 A;  2WX1 A;  2Y5B B;  2D3B A;  3OAW A;  4A3O A;  4AUQ C;  3U2S C;  1SBB B;  3Q3O C;  1UGM A;  3SDL C;  1CZP A;  3ABV B;  4M0W B;  3MC0 B;  2AQ2 B;  3Q69 A;  4US9 A;  4AJY B;  1WXS A;  2V3P A;  2FE8 A;  1J7C A;  3HM3 A;  2KFJ A;  2FID A;  2INC C;  3I63 C;  3R2I A;  1ZGU B;  3ZNG C;  2OHF A;  2LUM A;  2L05 A;  3V60 A;  4W9J A;  3DVN V;  3RNE C;  1FRD A;  3R2T A;  2FNJ B;  2AL3 A;  1QOF A;  2AQ3 B;  4IUM B;  1IP9 A;  2BF8 B;  3PTF C;  2G4D B;  2N1V A;  2Z59 B;  2I1K A;  3AXC A;  4JL9 A;  2BYE A;  2ZJD A;  1RLF A;  4MM3 A;  1JWM D;  3VTW A;  3ZJV A;  3L0W B;  1C4C A;  4WWM A;  5HKH A;  3UQA A;  1IGD A;  4HDO A;  4ANU A;  1LQB A;  4F1S A;  2BB5 A;  4C00 A;  2OJR A;  5EE9 A;  1FXT B;  3M63 B;  2KQ7 A;  1BXT A;  2WU2 B;  3AH7 A;  4AP4 C;  1VLB A;  2GBK A;  2ZPN A;  3NRZ A;  1L5P A;  4AWJ A;  3A4R A;  3QJZ A;  2BYV E;  2D11 A;  2I1J A;  1WZ0 A;  5HI1 A;  3KH0 A;  2KAC A;  2IO0 B;  1E0Z A;  3A9J A;  1TJE A;  1SE4 A;  2JZP A;  2WX0 A;  2O6V B;  4D2K A;  2D3A A;  2DZI A;  2W54 A;  4XDD A;  2BVC A;  2RPV A;  1T0Q C;  4KDI C;  3ZDM C;  2N9P C;  4W9L A;  1WSP A;  3HIZ A;  2KDM A;  2AWT A;  3FC4 A;  4ZHO A;  1TY0 A;  2E3T A;  4KV2 A;  4MDK E;  4JPS A;  1KTK A;  4J6I A;  4A6Q A;  3C19 A;  5KHO A;  1C76 A;  1XEE A;  4UDU C;  3Q2A C;  3RT3 B;  4FHK A;  4ZRJ A;  2NPT B;  1G6J A;  5E6N A;  1D3Z A;  3U4E G;  1SSN A;  3BYT B;  2MBE A;  2R61 A;  4K1R B;  2M4N A;  5DPR A;  2JXX A;  1HTO A;  4WH4 A;  1UWM A;  3APF A;  3AE2 B;  2LWP A;  2PVG C;  2ASQ A;  1UBI A;  4YTM B;  1FCC C;  2ZCC A;  4WWN A;  2E6X A;  3VRA B;  3DPD A;  1MJD A;  5BMI A;  2SEB D;  3ZDT A;  1GC7 A;  5HFY A;  4EZK A;  4XWT A;  2EKE C;  1N5W A;  1YMH E;  4BKS A;  4GDL B;  2XN9 C;  3ZRF A;  3PLU A;  3PRP B;  3SFD B;  1YX6 B;  1C4P A;  2LHE A;  2IO1 B;  3ZNH B;  2WXP A;  1E8X A;  1ESF A;  3HUI A;  4WIP A;  2R2Q A;  2LXC A;  1HE8 A;  1ZP0 B;  2KMM A;  1DGJ A;  4PT5 A;  5AZG A;  3MJW A;  1EU4 A;  1AW7 A;  4NQL B;  4XYC A;  2GBM A;  2VH1 A;  2ZCB A;  2DAJ A;  3FKY A;  4DHZ E;  1K53 A;  1AYF A;  5IO9 A;  4MJS A;  2JWU A;  2PLP A;  2B3A A;  1JWA D;  5E6P A;  2BT6 A;  5C23 A;  3HHM A;  3DWG C;  3PHW B;  1KLU D;  3AE8 B;  1EWC A;  2DWQ A;  1BML C;  2DZM A;  3U7Z A;  3NJT A;  3TSS A;  1E90 A;  2HTH A;  2KDE B;  1E7V A;  1PGB A;  4AS1 A;  2JF5 A;  5D2M B;  4DHJ B;  1XLO A;  1QT9 A;  3ENE A;  2L76 A;  1OTR B;  4ICU A;  2D2Q A;  1PGA A;  4HJG E;  2WDR B;  4WJP A;  1E8Y A;  2PMV A;  3NS1 A;  3B0A A;  2GLS A;  2WS3 B;  5IKC M;  3APC A;  1J7B A;  3N1Y C;  1WXQ A;  1MPE A;  2JRH A;  4TQ0 A;  4N59 A;  3VTV A;  1YIW A;  3P4S B;  2RDH A;  3PZD A;  1F0Z A;  5E6O A;  1JWB D;  1KFY B;  1WX7 A;  2GBJ A;  2CS4 A;  2KMC A;  3AE3 B;  3WAL A;  2CKH B;  1SE9 A;  2FCQ A;  2IND C;  2KDB A;  4HPM B;  2WXF A;  2GBR A;  4DK5 A;  4PYZ A;  2N4F A;  4EZL A;  1NVI D;  4N6E B;  2QEJ C;  3BWU D;  3RNA C;  4S0R A;  1VD2 A;  2HJ1 A;  1SIJ A;  3AV8 A;  3A4S C;  2WXK A;  2MWS B;  3A33 B;  3H6N A;  5J18 A;  4W9H A;  2MQJ A;  2MHJ A;  4XE0 A;  5DPT A;  1F2R C;  1GUA B;  4MJS B;  4R3D A;  3M62 B;  4B6W A;  2AYO B;  4GDL A;  1EUV B;  1JML A;  3EUB 2;  2TSS A;  2RSU A;  4LNN A;  1KLV A;  3DHH C;  4BZA A;  1WM3 A;  4BVU C;  2BWE S;  2JWZ A;  1XD3 B;  2C7H A;  4FJV B;  2LEK A;  5BYQ A;  2LAS A;  3Q8B A;  1F52 A;  1N62 A;  2XNA C;  3E9S A;  4NPN A;  3JW0 X;  5FK9 C;  2J42 A;  4KGT A;  4GDK A;  4MT5 A;  3V62 A;  1VDV A;  1FPY A;  2JQR B;  2C5L C;  2V4L A;  3OLM D;  3V6C B;  3RUI B;  1C77 A;  2J0J A;  4FUL A;  3R3M A;  3QWZ B;  2KQ4 X;  3EA6 A;  2KXJ A;  3KLS X;  1PFD A;  3EFU A;  2IDY A;  3OWE B;  1P7F A;  4HLE A;  1V81 A;  4KX6 B;  2IO3 B;  1SB3 C;  1QOA A;  2LUE A;  2O6V A;  5JHB A;  1XO3 A;  1ET6 A;  4FBJ B;  5D94 A;  1XLP A;  4PK1 A;  1UGJ A;  3TMP B;  1I4Q A;  1L6V A;  2R2O A;  1UBQ A;  2FCM A;  4LK0 M;  3TL5 A;  1QF6 A;  4B9K A;  3NZS A;  3H9D A;  3SU8 X;  1RM6 C;  4YSY B;  3ZGZ A;  1R4N B;  3Q8C A;  1WXM A;  4BFR A;  5AUK A;  4BBN C;  2MP2 A;  3RNF C;  2MH7 A;  3R66 C;  2FIF A;  4RGT A;  1OFF A;  4Q2J A;  3BK2 A;  1ZXH A;  4KGR A;  3URY A;  4YWG G;  1JRP A;  3GP7 A;  3IHP C;  1WGD A;  2AQ1 B;  4WJQ A;  3DBL B;  4OVV A;  3AE1 B;  3D32 A;  1S1Q B;  3KYD D;  2GOW A;  3LXF A;  4RNA A;  3Q8A A;  1RRB A;  1EM7 A;  2WXH A;  1Q0W B;  2YEP F;  1ZW7 A;  2LVO A;  2PIA A;  4NQK E;  3CMM B;  1FNW A;  2K9X A;  3V05 A;  3PO0 A;  2V1Y A;  3W5V B;  4DDG D;  1GG3 A;  3Q3N C;  4FXC A;  2DZK A;  4PS7 A;  4MGI E;  1Z2M A;  1ZDX A;  3SD5 A;  3VVW B;  1WR6 E;  2RR9 A;  4IM2 A;  2PE9 A;  4EUT A;  3RI7 C;  3TEZ A;  2SAK A;  2BYF A;  1HZ5 A;  1P7E A;  2MCN B;  2CHZ A;  4TSS A;  3IG3 A;  2N7J A;  4A3P A;  2WDV B;  3GB1 A;  1FFV A;  3PT2 B;  1WH3 A;  4LNI A;  2Z0E B;  2GB1 A;  1UZX B;  4FAD A;  2N9E B;  1GB4 A;  2K25 A;  3PPA A;  2G45 B;  2DYM A;  3EHV A;  3K9P B;  3Q3J A;  3TEW A;  2D07 B;  4HKZ E;  2REX A;  1SJH D;  2K3U A;  2C7M B;  2LRW A;  3QHT A;  4IG7 B;  5IN7 A;  1WM2 A;  5L95 C;  4YL8 A;  1VRA B;  3VXW A;  3BYY B;  3DBR I;  2LFI A;  3CF6 E;  4HRS A;  4WWP A;  1CMX B;  1SEB D;  4XZ4 A;  4OVU A;  3IT4 B;  3RNB C;  3L4P A;  3CST A;  4LDT B;  4BKS D;  2JRI B;  1WJN A;  2KJ6 A;  4DQO C;  3Q3F A;  1YJI A;  4GIV A;  3VH3 B;  4MEL A;  4P6V F;  2JVC A;  5GXG B;  1BT0 A;  3W1S C;  4P16 A;  1K8R B;  4IKG A;  3PGE A;  3PLV A;  1ET9 A;  3N20 C;  1L0V B;  5HHD G;  3Q8E A;  3M3J A;  3WA0 A;  5T8I A;  3FIL B;  3QIJ A;  4QAY A;  1IBX B;  4IWO A;  2IGD A;  4OZB A;  4URK A;  5J2R A;  2ZZP B;  1C1Y B;  1GOZ A;  2O6V D;  1V80 A;  2KC1 A;  4BOS C;  4GDK B;  3S2A A;  5LXI B;  1E8W A;  5D3I B;  2VRR B;  1QOB A;  1T0Y A;  2ZEQ A;  3GS2 A;  3HK0 A;  3IXS A;  4JWS C;  1YQ4 B;  1SXT A;  2JUO A;  3C0R B;  2XK5 A;  1DOX A;  2V0G A;  2OJW A;  5AUI A;  1KRH A;  5JHA A;  3HVD A;  1TS3 A;  2X8X X;  1NI3 A;  1TT5 B;  3QA8 A;  1DYQ A;  2L83 A;  1TIF A;  3BIN A;  2A5U A;  2C9W B;  1TZ1 A;  2KWV B;  2N0S B;  3N30 A;  2HJ8 A;  1OQQ A;  1V1P A;  3RN9 C;  2WXL A;  2L32 A;  3AEF B;  2MBO A;  4G3X B;  1MI0 A;  3ZIM A;  1WIA A;  3PRE A;  4EKU A;  1GB1 A;  3KW5 B;  4KIK B;  2L1A A;  4JIO U;  4KZC A;  4DHJ D;  3MFG A;  3RPF C;  3BVM A;  1C79 A;  3P4Q B;  1JAL A;  2M0A A;  2QIE B;  2YVC A;  1GNU A;  4MH0 E;  3MHS D;  2MP2 B;  2C7N B;  4MAC A;  4M00 A;  1T3Q A;  1GC6 A;  1WXV A;  5G5G A;  4RGM A;  1ZXI A;  1IUE A;  1K51 A;  2BWF A;  4FA6 A;  3VR8 B;  4O1N A;  2VH2 A;  2ZVO A;  3MC9 A;  3P4P B;  4GU2 A;  4ZOH C;  2PEA A;  1KH0 A;  1B9R A;  4WAA A;  1UEL A;  3JSV B;  1P0R A;  2ON8 A;  1N61 A;  2D10 A;  3UIP B;  3RZW C;  3L16 A;  3I5J C;  3JYU A;  1XCT L;  1ZOY B;  3I9V 1;  3DDC B;  3FAH A;  4GLS C;  2C60 A;  1MVK A;  3VH4 B;  1AWD A;  3ETR A;  5H92 C;  4ZRI A;  4EOY A;  1V97 A;  3AB5 A;  2NCN A;  1I4H A;  4OVZ A;  3A9K A;  1WX9 A;  2MJ3 A;  2QHO A;  4C4V B;  4LLG M;  5D6J B;  4RF1 A;  4HDQ A;  4DXG A;  2N9L A;  1SJE D;  1FRR A;  4HPP A;  1I7H A;  3AED B;  2EMS A;  4TQ1 A;  1UF0 A;  5JH5 C;  5EE0 A;  4CQN A;  4YT0 B;  2L7R A;  4LNF A;  4KZ0 A;  4IDI A;  4E74 A;  2FUG 1;  3ZVV A;  2FCS A;  2QSD A;  3W2D A;  1P1A A;  1J0G A;  3RCZ A;  3RNC C;  3VAW A;  3W9C B;  2M0X A;  2HTM E;  4JX1 C;  4NJC A;  4W9I A;  5EDS A;  4LDT D;  2BW2 A;  4HPL B;  1WJU A;  2Z8L A;  1KOT A;  2AEH A;  1YJJ A;  2JXT A;  3AE5 B;  2DYO A;  4BKG A;  3GOE A;  4C80 A;  2QDF A;  2IY0 B;  2EEL A;  2NMQ A;  2FBW B;  2V9H A;  1YNT E;  3H8H A;  4P7I A;  1RYJ A;  1WZ3 A;  5C1Z A;  2BPS A;  1RFA A;  1XLN A;  4PS8 A;  2O2V B;  2NBW B;  4BAX A;  3LB8 C;  5LNK 1;  3BVZ A;  2LVP A;  2UYZ B;  2JX5 A;  4IOI E;  3ZQ4 A;  5BMH A;  2M17 A;  2BQQ A;  1WGK A;  3LJ3 A;  2ZW0 A;  2G1E A;  1WYW B;  4XC2 A;  1TS4 A;  2NBV B;  4NNJ B;  3K9O B;  3ZJT A;  5EE1 A;  2IGH A;  1DOI A;  3RUL A;  4HVB A;  4KIK A;  4M02 A;  1N63 A;  4ASW C;  3TEX A;  1TKG A;  2K0P A;  1V1P B;  3E56 A;  1JWS D;  3ONS A;  1STE A;  3MC8 A;  1NDD A;  3RYT A;  1ROE A;  4KSL C;  4CHK A;  1QZE A;  2HDE A;  3DBH B;  1V5O A;  3DVN U;  2DBY A;  2LI5 A;  5JXV A;  2RD0 A;  4ANV A;  2CJN A;  2J52 A;  2KC2 A;  4LCD E;  1N5X A;  2LD9 A;  2X38 A;  5CHF A;  1YJ1 A;  5LXH A;  2EMT A;  4MSQ B;  4GN1 A;  3T8M A;  4DXF A;  3AU5 A;  1E7P B;  1EU3 A;  1WRD B;  1WF9 A;  3Q8F A;  1L7Y A;  3T3O A;  1FIQ A;  1J8C A;  1UD7 A;  4HCP B;  1P9D U;  2NTT A;  3BY4 B;  1KLG D;  3LYY A;  2KHW B;  2BS4 B;  4GXB A;  3DQV A;  3N3K B;  3L08 A;  1V5T A;  1JW9 D;  3VDZ A;  3NZ3 A;  1SGH A;  4JGH B;  4MSM B;  2LGI A;  1WE6 A;  4G0N B;  1OGW A;  1N60 A;  2W82 A;  3PVL A;  1NEN B;  3O65 B;  2W3R A;  4JE3 B;  1F77 A;  3N1X C;  2WXQ A;  3R7Q A;  2J0M A;  4US8 A;  3PV1 A;  2NTS A;  1NBF C;  3PS6 A;  3WIM A;  3TJP A;  1UNS A;  4TUU A;  1Q10 A;  1NYQ A;  2WDT B;  4CO7 A;  1WY8 A;  1FEH A;  5CHW A;  1Y8R C;  2ACZ B;  3QC8 B;  1A5R A;  1B1Z A;  1L0Y B;  3AE9 B;  4YSZ B;  5IA7 A;  2KJH B;  1SE2 A;  1ZPS A;  3DVG X;  2PE6 B;  4JLC A;  1NYR A;  3A9J B;  4KKJ A;  5G2N A;  2NR2 A;  1YX5 B;  1Q5W B;  3HVZ A;  3AEG B;  4KDL B;  4RGN A;  5IP4 D;  2KZR A;  3B08 A;  4KSK C;  3B9J A;  5LLI A;  4FJZ A;  1E9M A;  1CQV A;  2N9X A;  2BS2 B;  1WJ4 A;  1TTN A;  2LJ5 A;  4HCN B;  5G5H A;  3AE7 B;  4MM3 B;  2DLB A;  1Z5S B;  2ICI A;  2MBQ A;  3WAN A;  4KGS A;  3VTU A;  3VUX A;  4RM9 A;  3PZ7 A;  5AZF A;  2JSV X;  5IOI A;  4HKQ A;  5EE3 A;  2Y5C A;  4KVG B;  4KKI A;  3X23 A;  2WXN A;  1PDX A;  5I4D A;  3GZN B;  2YLM A;  1L2N A;  3L13 A;  3OG5 A;  2WXO A;  1FCL A;  2KAJ A;  3DBR B;  3U7D A;  5JZE B;  1ZDV A;  4W9K A;  3KQ4 A;  5CHV C;  1IGC A;  5AZH A;  2W55 A;  3EFC A;  4A9A A;  3QAR A;  2CHW A;  2FCN A;  4NZL B;  3UGB B;  2D3G A;  1LO5 D;  1H8C A;  4K7S A;  4K3C A;  2LGX A;  5C3J B;  3MP9 A;  1FNU A;  1BUI C;  2BKR B;  2JU6 X;  3KWV A;  1I4G A;  2D5G A;  2CHX A;  5BYS A;  3OJ3 A;  4AOF A;  2BBC A;  4MEM A;  2NBU A;  2O2V A;  1AN8 A;  4RH6 A;  4K3B A;  2MSE D;  2LMC A;  2KLG A;  3P42 A;  2KK8 A;  5CTR C;  3QK0 A;  3SEB A;  3DHG C;  3N32 A;  4ARI A;  2KT7 A;  3GZN I;  4WAF A;  1WRI A;  3AE6 B;  1T0R C;  1UH6 A;  4XDC A;  1SIF A;  3NVY A;  5CX3 A;  3KUC B;  1ZUD 2;  2JYE A;  5FR6 A;  5HG2 A;  4H2A A;  2W9N A;  4YXD B;  4HRO A;  2LJI A;  3ZTD A;  1MG4 A;  3SR6 A;  2W3S A;  4IWP A;  4WQO B;  4L2Y A;  1E6E B;  1PQS A;  1ACC A;  2WXM A;  3MJ5 A;  2M8S A;  4RMA A;  2GBN A;  2DEN B;  2H89 B;  2LHD A;  1F1H A;  3QAQ A;  2KTR A;  5E6J A;  2WU5 B;  1Q1O A;  3NG0 A;  4WJO A;  4PYU A;  4L1B A;  3UIN B;  2D3C A;  1WGY A;  1F9J A;  3PRZ A;  1VZ8 A;  2RGF A;  3Q3M C;  2CU1 A;  1FD6 A;  3T9L A;  1I42 A;  2KKC A;  3V3X A;  2PTL A;  1N6Z A;  1PGX A;  4X57 B;  3AEE B;  2JY6 A;  3R7R A;  1C3T A;  1RFK A;  4MGK E;  2JZ3 B;  2PW9 A;  1IYF A;  3DBS A;  1Y56 A;  2KLC A;  2KTR B;  1MG8 A;  2IYD B;  4IC7 B;  2JT4 B;  1RWS A;  2OED A;  2IBI B;  1GPX A;  5MPO A;  2YEP B;  4FLH A;  1D5M C;  4XX5 A;  4B0E A;  4L23 A;  1OEY A;  3UQB A;  3VUY A;  2J0K A;  4OW0 A;  3AUL A;  3PRM B;  1YN4 A;  1LM8 B;  1L4D B;  4M8M A;  3EGR A;  2KYW A;  4P1C C;  4C4V A;  3JVZ X;  3P2B A;  2UWQ A;  2N9K A;  3QCA A;  2G3Q B;  2LGD A;  4N9F 4;  3A1Q A;  1HQR D;  2CJO A;  1P3Q U;  3OJ4 B;  3PZ8 A;  2M56 B;  4OHJ A;  4REZ A;  3SFE B;  4PS3 A;  1LXD A;  2KX3 A;  1FM0 D;  3VHT C;  3CSF A;  4TKN A;  3AU4 A;  2MA9 B;  4YSX B;  4W9G A;  3AEA B;  4DDI D;  4RFB A;  4K7U A;  2WHI A;  3GE8 C;  2IO2 B;  5FR3 A;  1OQY A;  2WXJ A;  4WUR A;  1TS5 A;  1HZ6 A;  2DAF A;  3N9Y C;  3RMK C;  3VRB B;  4B95 A;  1SF0 A;  3VQI A;  2XK5 B;  1I35 A;  4AJW A;  5G55 A;  3DCG A;  2EKI A;  2WYQ A;  3NZU A;  1XQQ A;  2KNB A;  2GMI C;  2Z0D B;  2WXG A;  3VUW A;  3ML9 A;  1CK1 A;  1NEK B;  3UI3 A;  4GOC A;  5BYR A;  4MGZ E;  2IPK D;  1TZO A;  2LVQ A;  2QMT A;  3QX1 A;  1XF5 L;  3NVW A;  1YQB A;  4JWU C;  1YD8 U;  4E71 A;  3I3T B;  2IY1 B;  3KYC D;  3RD2 A;  3WAO A;  1HTQ A;  1WMH A;  2N7E A;  3U8Z A;  4G50 A;  1IBX A;  1TKY A;  2KVR A;  2LXA A;  4MH8 A;  1UUP A;  1JRO A;  2WDQ B;  3VR9 B;  1WGR A;  2PJH A;  3NY5 A;  4TMA B;  2CR5 A;  1EF5 A;  2I38 A;  2PKO A;  1UWX A;  2KD0 A;  4IW0 A;  2DHZ A;  3PHX B;  3QQ8 B;  3ZNI D;  1TYG B;  4ZRK A;  3ZKJ C;  2AL6 A;  3GE3 C;  2G4S A;  2MEK A;  2MRP A;  2N1W A;  1QIL A;  3BZD B;  4K81 A;  2KMA A;  4G11 A;  3ZNZ B;  3AEC B;  2L3Z A;  2ZPY A;  3P63 A;  3H1U A;  1K52 A;  4GGQ A;  5L83 A;  2WXI A;  1QOG A;  3ZTC A;  3KUZ A;  1E10 A;  3ZRC A;  2DYB A;  1F2R I;  2Y3A A;  3FIL A;  4BOZ B;  5DPW A;  2LZ6 A;  3U30 A;  2I2Y A;  4W9E A;  4JQW C;  1L4Z B;  1ENF A;  4WWO A;  3V61 A;  2JZZ A;  1V49 A;  1AAR A;  1V6E A;  2KN4 A;  2M1M A;  2Y5P A;  3O13 A;  4ANX A;  1WI0 A;  3ZYY X;  4DBG A;  2NS5 A;  2DNF A;  5D3D A;  4EZJ A;  3DOW A;  3ZO5 B;  4I6L B;  2INN E;  4A20 A;  4C7Y A;  4S17 A;  2K8C A;  4MGY E;  1M4V A;  3ZLZ A;  4K7W A;  5DCN A;  1I4R A;  4FHJ A;  1CJE A;  2LGY A;  2L00 B;  1MFW A;  5IAA C;  1PUT A;  2DX5 B;  3MHZ A;  4AQ7 A;  3ZXV A;  2RDB C;  2KDF B;  3W1S A;  5BMG A;  3NVZ A;  1FO4 A;  4XWW A;  2ZNV C;  1R4M B;  2H88 B;  2INP E;  3RZF A;  1HA5 A;  1FNV A;  1GAQ B;  3AMZ A;  2WP9 B;  2BS3 B;  1VZ7 A;  3SHQ A;  4LJP B;  4NY0 A;  1ISN A;  3W1Y A;  3X0W A;  3H7P A;  2RPQ A;  1QQR A;  4BKT A;  4GSW A;  3CIR B;  1EF1 A;  2QCZ A;  1M94 A;  2HD5 B;  3H7P B;  2MJD A;  1P98 A;  4N58 A;  1SE3 A;  1S3S G;  1WE7 A;  2KWU B;  1L6U A;  3KVF B;  4ACF A;  1I4P A;  3RFZ B;  2BB6 A;  4W9D A;  3TCA A;  3TUO A;  1VR9 A;  3DVG Y;  3IT6 B;  4E3C A;  2L0F A;  1R7S A;  3EEC A;  3DHI C;  3VFK A;  3LDZ E;  1XCQ L;  4M0W A;  1KJT A;  4WJN A;  4IWQ A;  3NUH B;  4C56 C;  3L54 A;  1WR1 A;  1R4M I;  4II2 B;  1T0S C;  1TY2 A;  2GI9 A;  2KAN A;  1C78 A;  1X1M A;  2FAZ A;  1TGZ B;  4W9F A;  3AI5 A;  2XBB C;  2XEW A;  2WQY B;  3UF8 A;  1TBE A;  2QC8 A;  3HM6 X;  1FFU A;  5TR5 A;  4ZYS A;  2KFK B;  5H8Y E;  3MTN B;  3CWI A;  3APD A;  1WWT A;  5D7G A;  3U52 E;  4ARC A;  4DXA B;  4FN2 A;  4CYE A;  3R8B A;  3TEY A;  3ZW3 A;  4I6P A;  3L17 A;  1VZ6 A;  1WYG A;  1V8C A;  4ZRQ A;  4WQM A;  4F8C B;  2OOB B;  1J7A A;  2A4Z A;  1TS2 A;  1WGG A;  1E7U A;  1RAX A;  1A70 A;  1C9F A;  4ZHP A;  3NS8 A;  2GRI A;  2BKF A;  1JWU D;  1EO6 A;  2B76 B;  1GJZ A;  1FMA D;  4RF0 A;  4DWF A;  2WNM A;  4B0M A;  2KN5 A;  4LTU A;  4IM3 A;  3Q6B A;  5GMV A;  3BII D;  1YN3 A;  4OZA A;  2KDI A;  3AN1 A;  2KO3 A;  3NHE B;  4BBN F;  1L0X B;  4YTN B;  3ZXR A;  2V3S A;  1J19 A;  4FJY A;  2K6Q A;  1ZKH A;  1JRU A;  1WMH B;  2ZW1 A;  3AEB B;  3V6E B;  1VJK A;  4GB9 A;  4YTP B;  1WGH A;  2L8J A;  3B2F A;  4ANW A;  2VZK B;  1HXY D;  4M8N A;  2WGS A;  1LGR A;  4M01 A;  2MBH A;  4NAM A;  2IZV B;  1MHX A;  2K8H A;  1EWY C;  4HXD A;  3A9K B;  3AE4 B;  4EE2 A;  3BVG A;  3DBH I;  2J53 A;  4XGA B;  1KF6 B;  2KJR A;  4ZYN A;  3PSE B;  4NAW A;  2NVU I;  4ZRP A;  1FXA A;  2KTF A;  4LNO A;  2KVZ A;  3IAM 1;  1OQR A;  2WLB A;  3ZJU A;  1YN5 A;  2K39 A;  2Q5W D;  2IGG A;  4USA A;  3JSV A;  1YQ3 B;  3I57 A;  2G9H D;  2RDG A;  2AX5 A;  3C8Y A;  1WXA A;  4II3 B;  2QJL A;  1K50 A;  1U4A A;  3TBL D;  4DHZ B;  3B1L X;  5FKA C;  4NJ6 A;  5C2T B;  2V3N A;  4J3O D;  3H7S A;  2L0T A;  1D4B A;  3AM9 A;  1D6E C;  2JPH A;  2BGF A;  2MX2 A;  4ITK A;  4TV3 A;  3EC8 A;  1WFY A;  2KWD A;  1V86 A;  2J7Q B;  5BO4 B;  3W5U B;  1WX8 A;  1D5Z C;  2MW5 A;  4RM8 A;  3A1Q B;  1MHH E;  2KWC A;  4GMV A;  2UU7 A;  4OZC A;  4EEW A;  2VZK D;  3WCQ A;  1E5W A;  2M19 A;  3BK1 A;  2CU3 A;  3WAP A;  2BTE A;  4C7Z A;  2WWZ A;  3J9C A;  3ZUN A;  1V9J A;  2ZNV B;  2QIL A;  2HE7 A;  2WXR A;  1D5X C;  1XLQ A;  1T5X D;  3L10 B;  4RCO A;  1I4X A;  3RNG C;  1QKZ A;  1VCB A;  1JQ4 A;  5AEK B;  4RGO S;  1V2Y A;  1T6B X;  3UIO B;  2KX0 A;  3IFW B;  3IAS 1;  2J4X A;  1LFD A;  2DZJ A;  1ZE3 D;  1TKE A;  4HK2 A; 
#chains in the Genus database with same CATH homology
 3IBE A;  4NPN A;  3JW0 X;  2KOX A;  2LVP A;  4K7U A;  3V62 A;  4GDK A;  2UYZ B;  2V4L A;  3OLM D;  2C5L C;  3V6C B;  2IO2 B;  3M95 A;  3RUI B;  2M17 A;  1OQY A;  2J0J A;  4FUL A;  3LJ3 A;  2DAF A;  3R3M A;  3NOB A;  3QWZ B;  4I6N B;  4ZDV A;  4B95 A;  2FUH B;  2KXJ A;  3VQI A;  2XK5 B;  1I35 A;  4HWI B;  4AJW A;  1WYW B;  2K1F A;  5G55 A;  3DCG A;  4XC2 A;  3EFU A;  2MBB B;  1R4N I;  2NBV B;  2WYQ A;  3NZU A;  1XQQ A;  4NNJ B;  3K9O B;  4HLE A;  1V81 A;  2IO3 B;  1H4R A;  2KNB A;  2KQS A;  3RUL A;  2LUE A;  4HVB A;  2GMI C;  2O6V A;  5JHB A;  4NJ7 A;  2Z0D B;  4FBJ B;  4NAW B;  3VUW A;  4KIK A;  3ML9 A;  1E8Z A;  4ASW C;  5D94 A;  1KM7 A;  2K6D B;  4GOC A;  3TMP B;  4MGZ E;  2R2O A;  3QX1 A;  2LVQ A;  3DBL I;  1UBQ A;  4HJK A;  2FCM A;  3ONS A;  1YQB A;  5J17 A;  3TL5 A;  1NDD A;  4B9K A;  3NZS A;  3H9D A;  3RYT A;  1NI2 A;  2LRU A;  3SU8 X;  3KUD B;  1YD8 U;  4KSL C;  4E71 A;  4CHK A;  3I3T B;  3TIX A;  2IY1 B;  1QZE A;  3ALB A;  3DVN U;  1V5O A;  1WXM A;  2PPH A;  4BFR A;  3KYC D;  2MP2 A;  4BBN C;  2LI5 A;  3RD2 A;  2RD0 A;  4ANV A;  3WAO A;  2ZVN A;  1WMH A;  2N7E A;  3ML8 A;  1IPG A;  4F7Z A;  2KC2 A;  3R66 C;  3U8Z A;  4G50 A;  2FIF A;  4ICV A;  3IVF A;  4LCD E;  2KVR A;  2LXA A;  2LD9 A;  4W9C A;  5CHF A;  2K8B A;  3IHP C;  1YJ1 A;  1WGR A;  5LXH A;  1WGD A;  4WJQ A;  2PJH A;  3NY5 A;  2EMT A;  2CR5 A;  4MSQ B;  1EF5 A;  3ECI A;  4IM0 A;  4OVV A;  2KFK A;  4GN1 A;  1OEY J;  3T8M A;  3AU5 A;  3D32 A;  2KD0 A;  1WRD B;  1S1Q B;  1WF9 A;  2NPT A;  4EFO A;  4IW0 A;  3KYD D;  1L7Y A;  2DHZ A;  2GOW A;  3PHX B;  3QQ8 B;  3ZNI D;  5DPS A;  1J8C A;  1UD7 A;  4LJO B;  4ZRK A;  4HCP B;  2AL6 A;  1P9D U;  3ZKJ C;  3BY4 B;  1RRB A;  1XT9 B;  2G4S A;  2MLB A;  2MRP A;  2N1W A;  2KHW B;  2N7D A;  4K81 A;  4GXB A;  1Q0W B;  2KMA A;  4G11 A;  3ZNZ B;  3DQV A;  1ZW7 A;  3L08 A;  2LVO A;  1V5T A;  2L3Z A;  2ZPY A;  3N3K B;  3VDZ A;  3WAM A;  1SGH A;  3H1U A;  4JGH B;  4NQK E;  4GGQ A;  5L83 A;  5KHQ A;  1WJ6 A;  3ZTC A;  2WX1 A;  2Y5B B;  3KUZ A;  3CMM B;  4MSM B;  3ZRC A;  1WE6 A;  2DYB A;  4G0N B;  1OGW A;  3OAW A;  4A3O A;  4BOZ B;  5DPW A;  2LZ6 A;  3U30 A;  4AUQ C;  4W9E A;  1UGM A;  2V1Y A;  4JQW C;  3SDL C;  3PVL A;  4DDG D;  1GG3 A;  4M0W B;  3O65 B;  4WWO A;  3V61 A;  2JZZ A;  1V49 A;  1AAR A;  1V6E A;  1WXS A;  4AJY B;  2M1M A;  4ANX A;  1WI0 A;  2DZK A;  4PS7 A;  3R7Q A;  2J0M A;  4MGI E;  1Z2M A;  4DBG A;  3HM3 A;  2NS5 A;  3SD5 A;  3VVW B;  2KFJ A;  4EZJ A;  2FID A;  3DOW A;  1WR6 E;  3PV1 A;  2RR9 A;  4IM2 A;  2PE9 A;  4I6L B;  3ZO5 B;  1NBF C;  3PS6 A;  4EUT A;  1ZGU B;  3WIM A;  4A20 A;  2K8C A;  4MGY E;  3ZNG C;  2BYF A;  3TJP A;  2L05 A;  2MCN B;  2CHZ A;  3V60 A;  3IG3 A;  3ZLZ A;  4K7W A;  4W9J A;  5DCN A;  4A3P A;  4FHJ A;  4TUU A;  3DVN V;  2LGY A;  3PT2 B;  1WH3 A;  2WDT B;  2L00 B;  1WY8 A;  2FNJ B;  2Z0E B;  2AL3 A;  4CO7 A;  1UZX B;  5IAA C;  2DX5 B;  5CHW A;  4IUM B;  4FAD A;  1Y8R C;  2N9E B;  3QC8 B;  2K25 A;  1A5R A;  1IP9 A;  3PPA A;  2G45 B;  5IA7 A;  2DYM A;  3EHV A;  3K9P B;  2KJH B;  2KDF B;  3W1S A;  2BF8 B;  3PTF C;  2G4D B;  2N1V A;  3Q3J A;  2D07 B;  2Z59 B;  3DVG X;  2PE6 B;  2REX A;  4JLC A;  2I1K A;  3A9J B;  3AXC A;  5G2N A;  2ZNV C;  2C7M B;  4JL9 A;  2BYE A;  2LRW A;  3RZF A;  2ZJD A;  2NR2 A;  1RLF A;  3QHT A;  4IG7 B;  4MM3 A;  1YX5 B;  3VTW A;  3SHQ A;  1Q5W B;  4LJP B;  4NY0 A;  3L0W B;  5HKH A;  3UQA A;  1ISN A;  1WM2 A;  5L95 C;  4KDL B;  4YL8 A;  4HDO A;  3W1Y A;  3VXW A;  2KZR A;  3X0W A;  3H7P A;  3DBR I;  2RPQ A;  4BKT A;  4ANU A;  1LQB A;  3B08 A;  4GSW A;  4F1S A;  3CF6 E;  1EF1 A;  4WWP A;  1CMX B;  2OJR A;  1FXT B;  4KSK C;  4XZ4 A;  3M63 B;  4OVU A;  3CST A;  2KQ7 A;  1M94 A;  2HD5 B;  3H7P B;  4LDT B;  1P98 A;  2JRI B;  5LLI A;  4BKS D;  4FJZ A;  4AP4 C;  1WJN A;  1S3S G;  2GBK A;  2KJ6 A;  2ZPN A;  1WE7 A;  2KWU B;  3KVF B;  4AWJ A;  4W9D A;  3A4R A;  3QJZ A;  2N9X A;  3TCA A;  1WJ4 A;  2LJ5 A;  1TTN A;  3Q3F A;  4HCN B;  2BYV E;  3DVG Y;  4E3C A;  4GIV A;  1Z5S B;  3VH3 B;  2D11 A;  2MBQ A;  2I1J A;  1WZ0 A;  4MEL A;  3WAN A;  2JVC A;  3KH0 A;  1BT0 A;  2L0F A;  3W1S C;  3VTU A;  3VUX A;  1K8R B;  2IO0 B;  3PGE A;  4RM9 A;  3A9J A;  3EEC A;  3PLV A;  3VFK A;  5AZF A;  2WX0 A;  3LDZ E;  2O6V B;  1KJT A;  2DZI A;  4WJN A;  4KDI C;  4KVG B;  3M3J A;  3WA0 A;  4IWQ A;  3ZDM C;  3L54 A;  1WR1 A;  2N9P C;  4W9L A;  1R4M I;  3X23 A;  3QIJ A;  4II2 B;  3HIZ A;  4IWO A;  2AWT A;  2KAN A;  4URK A;  5J2R A;  4KV2 A;  2ZZP B;  1C1Y B;  1X1M A;  2FAZ A;  1TGZ B;  4MDK E;  4J6I A;  2O6V D;  4W9F A;  1V80 A;  5KHO A;  2YLM A;  2KC1 A;  4BOS C;  3RT3 B;  1L2N A;  4GDK B;  3AI5 A;  3L13 A;  3S2A A;  2XBB C;  5LXI B;  1E8W A;  2XEW A;  3UF8 A;  1TBE A;  4FHK A;  4ZRJ A;  2VRR B;  3HM6 X;  3U7D A;  5JZE B;  2NPT B;  1G6J A;  5E6N A;  1D3Z A;  5TR5 A;  4W9K A;  2KFK B;  5CHV C;  2MBE A;  4K1R B;  2M4N A;  5DPR A;  5AZH A;  3MTN B;  2JXX A;  3APD A;  5D7G A;  1T0Y A;  3APF A;  2ZEQ A;  3HK0 A;  3QAR A;  2LWP A;  2ASQ A;  1UBI A;  4DXA B;  4FN2 A;  2CHW A;  4CYE A;  2ZCC A;  4WWN A;  2FCN A;  2JUO A;  3ZW3 A;  3DPD A;  4I6P A;  3L17 A;  2D3G A;  3C0R B;  3UGB B;  3ZDT A;  2XK5 A;  4F8C B;  1H8C A;  2OOB B;  4K7S A;  2A4Z A;  1GC7 A;  1WGG A;  4EZK A;  1E7U A;  2EKE C;  2LGX A;  5JHA A;  4BKS A;  1RAX A;  4GDL B;  3ZRF A;  2BKR B;  3NS8 A;  3PLU A;  3PRP B;  3QA8 A;  2BKF A;  1EO6 A;  2CHX A;  3BIN A;  3OJ3 A;  1GJZ A;  1YX6 B;  2A5U A;  1TZ1 A;  2C9W B;  2KWV B;  4MEM A;  4AOF A;  3N30 A;  4DWF A;  2KN5 A;  2NBU A;  2HJ8 A;  2O2V A;  4IM3 A;  2IO1 B;  5GMV A;  3ZNH B;  2MBO A;  2MSE D;  1E8X A;  4G3X B;  3ZIM A;  1WIA A;  2KLG A;  3PRE A;  4EKU A;  2KDI A;  2KK8 A;  3KW5 B;  4KIK B;  2KO3 A;  3NHE B;  4JIO U;  5CTR C;  4BBN F;  3QK0 A;  2R2Q A;  4KZC A;  2LXC A;  1HE8 A;  4DHJ D;  3N32 A;  5AZG A;  3MJW A;  3GZN I;  2V3S A;  1J19 A;  4NQL B;  4FJY A;  2K6Q A;  1ZKH A;  1UH6 A;  1GNU A;  2YVC A;  1JRU A;  4MH0 E;  2GBM A;  1WMH B;  1SIF A;  2ZCB A;  3MHS D;  3V6E B;  2MP2 B;  2DAJ A;  5CX3 A;  4GB9 A;  2C7N B;  3KUC B;  1WGH A;  2L8J A;  1GC6 A;  5FR6 A;  4ANW A;  1WXV A;  4DHZ E;  2W9N A;  4M8N A;  3ZTD A;  2MBH A;  4MJS A;  2BWF A;  2B3A A;  4IWP A;  2IZV B;  4WQO B;  2K8H A;  4HXD A;  5E6P A;  4FA6 A;  3A9K B;  1PQS A;  2ZVO A;  5C23 A;  3HHM A;  3DBH I;  4GU2 A;  2PEA A;  3PHW B;  2M8S A;  4WAA A;  1UEL A;  2KJR A;  1P0R A;  3JSV B;  4RMA A;  4ZYN A;  3PSE B;  2DZM A;  2D10 A;  2NVU I;  4NAW A;  3UIP B;  3RZW C;  3L16 A;  2KTF A;  2GBN A;  3JYU A;  2DEN B;  1E90 A;  2HTH A;  3QAQ A;  2KDE B;  2KTR A;  1E7V A;  3DDC B;  2K39 A;  2C60 A;  1Q1O A;  2JF5 A;  5D2M B;  3JSV A;  4WJO A;  3VH4 B;  4DHJ B;  4PYU A;  4ZRI A;  4EOY A;  3UIN B;  3ENE A;  2L76 A;  1WGY A;  1OTR B;  1F9J A;  2D2Q A;  3PRZ A;  4ICU A;  2NCN A;  1WXA A;  1E8Y A;  1WX9 A;  2RGF A;  3A9K A;  4II3 B;  2QHO A;  4WJP A;  3B0A A;  2CU1 A;  5D6J B;  3APC A;  4HDQ A;  1U4A A;  3T9L A;  2JRH A;  3TBL D;  4TQ0 A;  2KKC A;  4DHZ B;  1I42 A;  3B1L X;  3VTV A;  1YIW A;  4NJ6 A;  4X57 B;  2EMS A;  3PZD A;  3H7S A;  2JY6 A;  5E6O A;  4TQ1 A;  3R7R A;  4MGK E;  2L0T A;  2JZ3 B;  1C3T A;  1IYF A;  1WX7 A;  2GBJ A;  5JH5 C;  2CS4 A;  2KMC A;  2JPH A;  3WAL A;  2CKH B;  3DBS A;  2KLC A;  2BGF A;  1SE9 A;  2MX2 A;  2FCQ A;  2KTR B;  2KDB A;  4HPM B;  2L7R A;  1MG8 A;  2IYD B;  2GBR A;  4DK5 A;  4IC7 B;  4TV3 A;  4PYZ A;  2JT4 B;  2N4F A;  4KZ0 A;  4EZL A;  3EC8 A;  1WFY A;  4E74 A;  1V86 A;  2IBI B;  2J7Q B;  5BO4 B;  1WX8 A;  2MW5 A;  4RM8 A;  3ZVV A;  3A1Q B;  2KWC A;  4FLH A;  2FCS A;  4XX5 A;  1VD2 A;  4GMV A;  1P1A A;  3UQB A;  1OEY A;  1J0G A;  3RCZ A;  3VAW A;  3VUY A;  4EEW A;  1E5W A;  2M0X A;  3A4S C;  2J0K A;  2MWS B;  3A33 B;  3AUL A;  3H6N A;  3PRM B;  4W9H A;  2MQJ A;  5J18 A;  5DPT A;  1GUA B;  1LM8 B;  4MJS B;  4M8M A;  3M62 B;  4B6W A;  2AYO B;  3WAP A;  4W9I A;  5EDS A;  3JVZ X;  3P2B A;  2UWQ A;  2WWZ A;  4GDL A;  4LDT D;  3QCA A;  1EUV B;  1V9J A;  2G3Q B;  4HPL B;  3ZUN A;  2LGD A;  1WJU A;  4N9F 4;  3A1Q A;  2ZNV B;  1KOT A;  2AEH A;  2RSU A;  1KLV A;  1P3Q U;  2HE7 A;  3OJ4 B;  1WM3 A;  2DYO A;  4BVU C;  2BWE S;  4BKG A;  2JWZ A;  3GOE A;  3L10 B;  4PS3 A;  2IY0 B;  1XD3 B;  1VCB A;  1LXD A;  2KX3 A;  3VHT C;  4P7I A;  5AEK B;  1V2Y A;  3UIO B;  3CSF A;  1WZ3 A;  5C1Z A;  2C7H A;  4TKN A;  3AU4 A;  4FJV B;  2MA9 B;  2BPS A;  2KX0 A;  1RFA A;  3IFW B;  2LAS A;  1LFD A;  4W9G A;  4PS8 A;  2DZJ A;  2NBW B;  2O2V B;  4DDI D;  4HK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...