4IC7B

Crystal structure of the erk5 kinase domain in complex with an mkk5 binding fragment
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
123
structure length
123
Chain Sequence
VLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGLKVNTRAGPSQSGRHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 7
publication title Structural mechanism for the specific assembly and activation of the extracellular signal regulated kinase 5 (ERK5) module.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 21
structure length 123
sequence length 123
chains with identical sequence E
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2012-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4ic7B00
4MEMA 3TJPA 3PRZA 3UIPB 5DCNA 3NY5A 4NJ6A 3Q3FA 2LVQA 2IO1B 1YX6B 3VXWA 3RT3B 1V80A 3DOWA 2LWPA 1RAXA 3LDZE 1V5OA 4A20A 2XK5A 2ZCBA 4K81A 1YJ1A 3KYCD 3L16A 2KMCA 5E6PA 3VAWA 4DBGA 3W1YA 3O65B 1A5RA 2JT4B 4BKGA 3CSTA 3DQVA 2WYQA 3Q3JA 3PREA 5KHQA 3AXCA 1V81A 2CU1A 4FJVB 4GN1A 3ZNHB 4BOSC 2G3QB 3DVGY 1NBFC 2L3ZA 2DZJA 4MGKE 3GOEA 2O6VD 3M63B 1P9DU 2LGDA 3ZRCA 3VH3B 4TUUA 2K25A 2V3SA 3HM6X 1UD7A 5CX3A 1WE7A 2BPSA 3QHTA 2NPTA 5LXIB 2KANA 4IW0A 2NBVB 3JSVB 2KDEB 3MTNB 3D32A 3R3MA 2MP2B 1JRUA 1WRDB 3DPDA 3WAOA 1I42A 4ICUA 3ZW3A 3IG3A 2WWZA 2K6DB 2O2VA 2LRWA 4PS8A 3NOBA 2UWQA 2EKEC 1V9JA 2G4SA 2ZNVB 1WXSA 2L7RA 4GXBA 1U4AA 4A3OA 1V49A 2LGYA 5AZGA 2D10A 3ZRFA 2FCQA 4PYZA 3PGEA 3L54A 4FJZA 2ZVOA 4F8CB 3ZKJC 4OVUA 5KHOA 2CHZA 2G45B 1WYWB 4ZRJA 5C23A 3VTWA 4IWPA 2RPQA 2C5LC 3DBHI 4KIKA 2AL6A 2DENB 3PRMB 3QA8A 1LXDA 4JQWC 3H9DA 2DX5B 3QX1A 1GNUA 1WGGA 2JUOA 3ENEA 1WIAA 2IO0B 4F7ZA 1E7UA 2MA9B 1G6JA 3HM3A 4NY0A 2FIFA 2GBKA 2L0TA 3CSFA 3EECA 2KDIA 4FADA 4IG7B 4IM0A 2Y5BB 2PJHA 4IM2A 5L83A 3DDCB 2C9WB 4WWOA 3PS6A 4AOFA 2BGFA 2LZ6A 1GC7A 2DYBA 3RCZA 3DVNU 2HTHA 2FAZA 2KTRA 4MGIE 3KUDB 5J17A 2M17A 4KZCA 3SD5A 1D3ZA 1AARA 1WH3A 1V86A 3PHWB 1XD3B 3PZDA 3TBLD 3APFA 1EF1A 2KX0A 4EZKA 3M62B 3A9JA 1OEYA 4K7WA 1WR6E 4BKSA 4DK5A 1KLVA 4FULA 4IUMB 3ALBA 2KNBA 2NBUA 4DDID 2N7EA 2K1FA 4BBNC 4W9HA 1H8CA 4NAWB 5L95C 4MDKE 1EF5A 1UGMA 2GMIC 3ZNZB 1WXAA 2LGXA 5E6NA 4E3CA 2KJHB 1V2YA 5G55A 3KW5B 1WE6A 3QIJA 2NVUI 3WAPA 3L17A 2KK8A 3VTUA 4ZDVA 5J2RA 3PT2B 2N7DA 3KVFB 2D11A 2FCNA 4W9LA 2B3AA 3ZUNA 2JVCA 1LQBA 2REXA 4MGZE 2JF5A 3ZTDA 2DAFA 3P2BA 4GDKA 2N4FA 4WJPA 4MJSA 2ZPNA 2MBBB 4W9DA 1R4NI 4HJKA 2K8BA 2NS5A 3JW0X 1C1YB 4FN2A 4I6NB 4DDGD 2KD0A 2I1KA 4KZ0A 2MLBA 2OJRA 3A1QA 3B0AA 3L08A 2A4ZA 2BYFA 4G0NB 4KSKC 3SHQA 5D94A 1SIFA 2D2QA 4FA6A 3T8MA 4MSQB 2HJ8A 3TIXA 3WAMA 4GGQA 5G2NA 2L00B 4AWJA 3ZDMC 2DZKA 2ZEQA 4CHKA 4DHZE 4NJ7A 1I35A 1E90A 1WMHA 2JXXA 4II2B 4JL9A 3WALA 5LXHA 3ZVVA 1ZW7A 4ASWC 3WANA 3OAWA 4HWIB 4M8NA 4WQOB 4LJPB 3QK0A 3JYUA 3JVZX 4KSLC 4HPMB 3KYDD 2DHZA 4HK2A 5D7GA 3HHMA 1WX9A 2KZRA 3N30A 2KMAA 1H4RA 3H1UA 2MSED 3PVLA 1BT0A 3AU5A 3APDA 4I6PA 4WJOA 2AWTA 2O6VB 2Z0EB 4JGHB 1WXMA 3ZTCA 4LJOB 4CO7A 1WXVA 3AULA 4BKSD 3V60A 3UGBB 4MM3A 4IC7B 1V6EA 2KWCA 2L76A 4W9IA 3TL5A 1ISNA 2KJRA 1RLFA 4YL8A 4E74A 4HCNB 3T9LA 2N1WA 5IA7A 1IYFA 2KX3A 3PHXB 1J19A 3PLVA 2WDTB 1R4MI 2KHWB 4JIOU 1LM8B 4KV2A 3S2AA 3DCGA 2C7MB 4EUTA 4GDLB 2KO3A 4W9JA 4W9KA 1WGHA 4P7IA 4XC2A 5DPRA 5FR6A 2MCNB 1OGWA 3R7QA 2M8SA 3V6EB 2MBHA 5E6OA 1WX8A 3U7DA 3L0WB 1GUAB 4WWPA 3RUIB 1S1QB 2WX0A 3KUCB 3R7RA 3MJWA 4WJNA 2MWSB 2OOBB 3HIZA 5CHWA 3X23A 1YD8U 3BINA 3N32A 2BYVE 5DPWA 2K8CA 2LXAA 4JLCA 2KFKB 1GG3A 1KM7A 4HDQA 5AZFA 4MSMB 2LI5A 4BOZB 2KJ6A 4AP4C 2KDFB 1P3QU 4NQKE 1WF9A 3IBEA 1WX7A 5JZEB 1TZ1A 1WM2A 4WJQA 2HE7A 4TKNA 1Z2MA 1MG8A 2HD5B 5D2MB 2C7NB 1GC6A 3A4SC 3VQIA 2IYDB 1PQSA 2M0XA 2AL3A 2MX2A 1T0YA 4IWOA 3RZFA 2L0FA 3H7PB 2V4LA 4RM9A 1E8WA 5HKHA 3UQAA 2LUEA 3KH0A 2EMSA 2RSUA 3IFWB 5JHBA 1WMHB 3ZNGC 1C3TA 3QC8B 2AYOB 1E7VA 1V5TA 2N9PC 3SU8X 1Z5SB 3N3KB 2XK5B 1YQBA 2KQ7A 3OLMD 3B08A 1UH6A 4G50A 3VFKA 1LFDA 3IVFA 1E8YA 2CHWA 2KC1A 1WFYA 2DAJA 3IHPC 5CTRC 2CR5A 2IO3B 4G11A 2BF8B 2Z59B 3AU4A 2KVRA 4W9CA 4ANWA 3JSVA 3ZLZA 3ECIA 2MP2A 2KWVB 2W9NA 2MRPA 1UBIA 3QCAA 2GBRA 4GOCA 5EDSA 2BWES 3RZWC 2LD9A 2NPTB 2PE9A 3VDZA 2M1MA 2JRIB 2KFJA 3NZSA 4K7SA 2O2VB 3RD2A 3ML8A 4RMAA 3KUZA 1YX5B 2PE6B 5IAAC 3A9KA 3UINB 3H6NA 3L13A 3X0WA 4FJYA 4MH0E 1Q0WB 4BKTA 2JPHA 1IPGA 4ANVA 4IWQA 1X1MA 2N9XA 2JY6A 4TQ1A 2QHOA 3ZDTA 4KIKB 2KKCA 4NNJB 3SDLC 2YVCA 4M8MA 4G3XB 3CMMB 3WA0A 3PTFC 1L7YA 4B9KA 2GOWA 3AI5A 2LXCA 3NS8A 2IBIB 5DPSA 2MBOA 3A4RA 4W9EA 4J6IA 2V1YA 4K7UA 2RD0A 3UIOB 3M95A 2XBBC 4ANXA 3DBSA 1WZ0A 1KJTA 2LASA 3PV1A 1VD2A 1Y8RC 3QJZA 1S3SG 2IO2B 3PRPB 4ZYNA 1FXTB 2KTRB 4TQ0A 2KTFA 4X57B 5TR5A 4WWNA 2IZVB 4FHKA 2J0MA 3VUXA 3UF8A 3VH4B 4NAWA 4M0WB 1OTRB 2IY0B 5AEKB 2GBJA 2J0KA 3A9JB 4EKUA 2D3GA 3H7SA 2DZIA 2GBMA 1XT9B 4LCDE 1J0GA 4GSWA 2N9EB 4CYEA 2R2OA 1E5WA 1WM3A 5JHAA 4PYUA 1Q5WB 3PLUA 3DVNV 4ICVA 2R2QA 4HCPB 2CKHB 3ZO5B 2FNJB 3K9PB 3QWZB 2NBWB 1WGDA 1RFAA 2BYEA 5CHFA 2K6QA 2I1JA 2NR2A 2EMTA 4I6LB 2ASQA 3HK0A 5GMVA 1WY8A 1SE9A 3GZNI 4GDKB 1ZKHA 1SGHA 2LVOA 3L10B 3RULA 2KOXA 2KLGA 4MJSB 4MELA 3W1SC 2LJ5A 4FLHA 1M94A 3ONSA 3QAQA 4PS3A 2RGFA 4XZ4A 1Q1OA 4HDOA 3DBLI 5DPTA 3DBRI 2FIDA 3A1QB 1OQYA 4HPLB 4OVVA 4W9GA 4DWFA 1UBQA 1OEYJ 3BY4B 4EZJA 1GJZA 1QZEA 4IM3A 4ZRKA 2PEAA 1CMXB 4B6WA 3A9KB 1EUVB 4K1RB 4GIVA 3C0RB 5CHVC 2ZPYA 2FUHB 2GBNA 2J0JA 3UQBA 4LDTD 4HXDA 2AEHA 4URKA 3I3TB 2Z0DB 2J7QB 1L2NA 4LDTB 2CS4A 1ZGUB 2PPHA 3K9OB 2L8JA 1NDDA 4RM8A 2ZNVC 3VTVA 3V6CB 3ZIMA 3CF6E 4TV3A 2KWUB 2KLCA 5BO4B 4F1SA 3VVWB 4AUQC 1UZXB 4KDIC 4EZLA 2KC2A 3NHEB 4HLEA 2FCSA 4FHJA 4GMVA 2C7HA 2BKRB 2NCNA 3QARA 2BWFA 3W1SA 2D07B 1P1AA 4ANUA 2MW5A 3EC8A 3V62A 4KVGB 2KQSA 1WJ6A 1F9JA 2O6VA 4EEWA 1WR1A 3DVGX 2N1VA 3PSEB 1WGRA 1TTNA 2G4DB 4E71A 3QQ8B 2KN5A 1IP9A 1K8RB 3VUYA 2ZJDA 2JZ3B 3LJ3A 4B95A 1HE8A 3OJ4B 4A3PA 2JRHA 2A5UA 2BKFA 2K8HA 4EOYA 2JZZA 3VHTC 4DHZB 1WI0A 4BFRA 5AZHA 2DYOA 3EFUA 4GU2A 3U30A 5JH5C 2MBEA 2LVPA 4N9F4 2K39A 3NZUA 1WJNA 4GDLA 4EFOA 4NPNA 1KOTA 2ZCCA 2XEWA 2UYZB 1UELA 3TMPB 4NQLB 3ZNID 1WGYA 2L05A 4XX5A 2ZVNA 4WAAA 3B1LX 4DHJD 1P0RA 1YIWA 4KDLB 4AJYB 4HVBA 1E8XA 3OJ3A 2CHXA 1EO6A 4W9FA 4DHJB 2MBQA 2VRRB 3RYTA 3VUWA 1J8CA 2IY1B 2LRUA 3M3JA 1WJ4A 2JWZA 1NI2A 2KFKA 1E8ZA 2DYMA 4ZRIA 3TCAA 3WIMA 3U8ZA 4DXAB 1RRBA 3R66C 4BBNF 2M4NA 2ZZPB 3APCA 1VCBA 3ML9A 4PS7A 4BVUC 2MQJA 1TBEA 1WJUA 1P98A 4GB9A 2RR9A 4AJWA 3PPAA 5J18A 1WZ3A 2KDBA 2WX1A 3EHVA 3MHSD 2KXJA 2C60A 2DZMA 3V61A 4FBJB 1TGZB 4MGYE 3A33B 4II3B 5D6JB 5C1ZA 2FCMA 1XQQA 5LLIA 3H7PA 2YLMA
chains in the Genus database with same CATH superfamily
1QKZA 2RDHA 4AS1A 1RWSA 1C4PA 3Q3FA 1V1PB 2IO1B 3RT3B 3LDZE 2OEDA 1V5OA 2ZCBA 4DXFA 1L0XB 3KYCD 2BS2B 2Q5WD 1N60A 4WWMA 3W1YA 1A5RA 4Q2JA 3CSTA 1HTQA 2WYQA 3BVMA 2IPKD 4FJVB 2Z8LA 3ZNHB 4BOSC 3MC0B 1MHXA 1MPEA 3ZRCA 1N6ZA 1FMAD 3MC8A 1QOBA 2BPSA 2INNE 2NPTA 2X8XX 5LXIB 3Q8CA 3PZ8A 4RF1A 1FCCC 2LRWA 1E7PB 1C4AA 1V9JA 4B0EA 4N58A 3FAHA 1V49A 4LTUA 4FJZA 2ZVOA 4PT5A 4XGAB 4ZRJA 2G45B 1WYWB 4JE3B 4IWPA 2IGHA 2ON8A 4KIKA 3QA8A 4NJCA 3H9DA 3QX1A 2W3RA 3MP9A 1WIAA 1E7UA 1G6JA 4XWWA 4NY0A 2NTTA 4XDDA 3EFCA 2M56B 1C79A 3RNFC 4WWOA 3RCZA 2DYBA 1PYWD 4J3OD 4MGIE 1SJHD 5J17A 3SD5A 1T0SC 1EF1A 3A9JA 1OEYA 4K7WA 4BKSA 4DK5A 1KLVA 4FULA 1ENFA 2JQRB 4IUMB 2NBUA 3R8BA 2V0GA 1H8CA 4NAWB 5L95C 2LGXA 2GLSA 3KW5B 3VTUA 3PT2B 2N7DA 2WDVB 2INPE 4W9LA 1VLBA 2JVCA 2DAFA 5AUKA 1FXAA 2N4FA 4MJSA 3KQ4A 4FN2A 1TS3A 3W5UB 1P7FA 3RPFC 4XYCA 2WNMA 3AE4B 2JZPA 1SIFA 2AQ2B 3AM9A 3NJTA 2D3BA 4AWJA 2ZEQA 2KACA 1WMHA 4II2B 4JL9A 1I4XA 5MPOA 2IGDA 3AE2B 4HWIB 4ARCA 3Q8EA 4HPMB 3KYDD 4EE2A 2WXJA 3N30A 3PO0A 3PVLA 4CO7A 3ZGZA 1LO5D 4LLGM 3UGBB 2L76A 2KJRA 4HCNB 5IA7A 2KX3A 2QIEB 1LM8B 2ACZB 2JXTA 4M01A 3DCGA 4C7YA 3U2SC 2KO3A 4XC2A 1FCLA 1JCKB 2IJ0A 2X38A 1KLGD 1WX8A 3U7DA 3L0WB 1GUAB 2UU7A 1TZOA 2LEKA 3SFDB 1N62A 3BINA 3N32A 4C4VB 5DPWA 3Q8FA 1GG3A 2MHJA 1T0QC 2LI5A 1NYRA 2K9XA 1D6EC 1MI0A 1P3QU 2WXFA 1FNWA 4WJQA 3VRAB 2HE7A 2C7NB 3VQIA 1PQSA 1XLOA 2M0XA 4NZLB 2BQQA 3BZDB 1ZXHA 3RZFA 3TEZA 2V4LA 4M0WA 4YTPB 5HKHA 2LUEA 2RSUA 1C3TA 3MJ5A 2OJWA 1L6VA 1YMHE 2PTLA 3B08A 1YJIA 1E8YA 1WFYA 4JX1C 3IHPC 5CTRC 2IO3B 3N1YC 3JSVA 2MP2A 1UF0A 4GOCA 2BWES 4XE0A 2NPTB 3EUB2 2AQ1B 1Q10A 3VDZA 1N5XA 2JRIB 4M00A 1MJDA 4YWGG 4RMAA 4YSYB 1YJJA 3ZJVA 1P7EA 1IPGA 2JY6A 4KIKB 2KKCA 3AE3B 3I63C 4NNJB 3SDLC 4G3XB 1I4GA 3CMMB 3WA0A 5H8YE 1L7YA 4YSXB 2IBIB 1J7CA 4K7UA 4YTMB 3M95A 2XBBC 4ANXA 1KJTA 1Y8RC 2WXIA 1ZXIA 1S3SG 2JSVX 3P42A 2KTFA 2J0MA 3VUXA 2BBCA 3L4PA 2J0KA 3A9JB 4ZRPA 1XT9B 3P4PB 3DWGC 3RNBC 2LMCA 2R2OA 3BYYB 1NEKB 1WM3A 1Q5WB 3DVNV 4PK1A 3ZO5B 2FNJB 3K9PB 3QWZB 2NBWB 2HTME 3VR9B 3FKYA 2K6QA 4RCOA 5GMVA 2BB5A 3GZNI 3T3OA 1TIFA 1SGHA 3CWIA 2KLGA 4MJSB 4MELA 3W1SC 4FLHA 4US8A 1M94A 2RGFA 2KAJA 1K50A 1Q1OA 4HDOA 2FIDA 4W9GA 4OVVA 3NVVA 4A6QA 1UBQA 1QZEA 4IM3A 4ZRKA 1YN3A 3A9KB 4B6WA 1L4DB 3Q69A 1FNUA 1GPXA 1QLBB 2AEHA 3I3TB 2J7QB 2WU5B 2ZNVC 3VTVA 3ZIMA 1F77A 1UZXB 4KDIC 4P1CC 2MJ3A 4YT0B 3RN9C 3TEXA 4ANUA 2MW5A 4LNOA 4KVGB 4L1BA 2O6VA 2KDMA 2EKIA 1WR1A 2N1VA 1SB3C 3PSEB 1Y56A 1WGRA 4JWSC 2WDQB 2WXKA 3VUYA 1YNTE 2JZ3B 4ZRQA 1HE8A 3B9JA 3EA6A 4A3PA 2BKFA 2K8HA 3NVZA 3VHTC 1WI0A 3Q8BA 3BVZA 2DYOA 3EFUA 2MBEA 1F2RI 3NZUA 1WJNA 4GDLA 4RH6A 1UELA 3SR6A 4NQLB 1WGYA 4XX5A 2ZVNA 1P0RA 4H2AA 2CHXA 4DHJB 3VUWA 1OFFA 2LRUA 2ICIA 3IT4B 1NI2A 4M02A 1E8ZA 4KGRA 2QC8A 3U8ZA 3R66C 4BBNF 1VCBA 3ML9A 4PS7A 1ET6A 1B1ZA 4AJWA 3PPAA 1QILA 2WX1A 2KXJA 4II3B 2I38A 1C78A 1UUPA 2BT6A 1EM7A 3TJPA 5DCNA 3NY5A 2NMQA 3AMZA 2PIAA 1XXGA 1AN8A 1D5XC 4OW0A 1V80A 3DOWA 2LWPA 1IGDA 1PGBA 4A20A 4K81A 3J9CA 1ZP0B 3VAWA 1I4RA 2JT4B 3R2IA 4IDIA 1ZDVA 3C8YA 3Q14C 1V81A 4GN1A 2L3ZA 1DOXA 3GOEA 1P9DU 2LGDA 4A8XC 3WCQA 3NVYA 1TS5A 2V3SA 5CX3A 3QHTA 3NS1A 4IW0A 2NBVB 3JSVB 2WXGA 2MP2B 1JRUA 1WRDB 3WAOA 2WWZA 1TS4A 4WQMA 4ZHPA 2G4SA 2ZNVB 2L7RA 1U4AA 3ZRFA 1FD6A 2CHZA 2RPQA 3AB5A 4AQ7A 1K52A 3DBHI 4JQWC 1WSPA 2M19A 1GNUA 1WGGA 2JUOA 3ENEA 1NYQA 2MA9B 3CSFA 2KDIA 3AE7B 1GB1A 2QILA 2L32A 2Y5CA 3PS6A 2LZ6A 1E9MA 1XLNA 2HTHA 2FAZA 3KUDB 2M17A 4KZCA 1WH3A 1V86A 1XO3A 3KLSX 3PZDA 1D4BA 5FKAC 1UWMA 1WR6E 3TEYA 2LUMA 3KWVA 4DDID 2KNBA 3B2GA 5I4DA 2N7EA 2AX5A 1V1OA 5IO9A 2Y5PA 3AE5B 1V2YA 2JYTA 3HUIA 1WE6A 3WAPA 2NVUI 4RGOS 2KK8A 3KVFB 1NENB 2D11A 3ZUNA 2REXA 2LGIA 3EGRA 3ZTDA 5HHDG 4C4VA 2K8BA 2QEJC 3JW0X 1C1YB 2G1EA 3AH7A 4O1NA 2I1KA 3A1QA 3B0AA 1GAQB 1KF6B 4KSKC 1CQVA 2D3AA 1T3QA 2CJOA 4FA6A 1XEEA 4MSQB 2HJ8A 2K3UA 5G2NA 2L00B 2KT7A 2V3PA 2DZKA 2QMTA 4NJ7A 4DHZE 2JXXA 5LXHA 1QOGA 3ZVVA 1SE2A 4M8NA 3DBRB 1GB4A 4A9AA 1F52A 3JYUA 4KSLC 3VR8B 1YN4A 2DHZA 5D7GA 3HHMA 2KZRA 2V3NA 1BT0A 5EE1A 2AWTA 3Q8AA 2O6VB 3C19A 4HRSA 2MJDA 3IAM1 3AULA 4BKSD 4HKZE 3V60A 4BZAA 3Q3OC 5BYSA 4IC7B 2WXOA 4W9IA 3TL5A 1ISNA 4L23A 1RLFA 4E74A 2IDYA 1DGJA 1HZ5A 2WLBA 1J19A 4L2YA 5BMIA 4EUTA 4GDLB 4W9JA 1WGHA 5E6OA 2QJLA 2OOBB 2WXPA 2K8CA 1YOVB 2LJIA 5AZFA 2KJ6A 2SEBD 3IBEA 1WX7A 5EE9A 1TZ1A 1D5ZC 1MG8A 1KLUD 5D2MB 1GC6A 1VZ8A 2IYDB 2AL3A 3NRZA 1T0YA 4QAYA 1FIQA 3U7ZA 3UQAA 3AEAB 2N9PC 3N3KB 4HJGE 1IBXA 1UH6A 3AECB 2PKOA 2DAJA 4TMAB 2CR5A 2Z59B 4GLSC 2KVRA 3ZLZA 2KWVB 5D3IB 5EDSA 3RZWC 3I57A 4OVZA 2KWDA 2M1MA 2KFJA 3NZSA 4OZBA 1L5PA 3ML8A 1UGJA 3A9KA 3HVDA 3X0WA 4FJYA 3TUOA 1JMLA 1Q0WB 2JPHA 4IWQA 1X1MA 4HKQA 1JALA 1SJED 4B9KA 2GOWA 3AI5A 3NS8A 4MH8A 4WURA 5DPSA 3P4RB 2V1YA 1RYJA 2M0AA 1T5XD 3PV1A 2LASA 1L0VB 1VD2A 3PRPB 1BMLC 1FXTB 1HA5A 1QF6A 4HPPA 2DNFA 4WWNA 1KRHA 2DZIA 2WP9B 2GBMA 1J0GA 2HDEA 4CYEA 2VZKD 1E5WA 3PLUA 3W5VB 1SBBB 3NG0A 2BYEA 2WXHA 1VZ6A 2PLPA 3MFGA 4IOIE 1ZKHA 3L10B 2KOXA 2LJ5A 3QAQA 2RDGA 2W55A 5DPTA 1KTKA 3A1QB 1OQYA 1GJZA 1OEYJ 2FBWB 1SF0A 4EKUA 1XCQL 4K1RB 4GIVA 5CHVC 2FUHB 2GBNA 4LDTD 2LHEA 1R4NB 1UNSA 2CS4A 4RM8A 2KLCA 3ZJUA 3VVWB 3NHEB 3P1MA 4P6VF 1OQQA 2C7HA 2BKRB 1JROA 3W1SA 2D07B 1P1AA 3V62A 4HROA 1WJ6A 1F9JA 4EEWA 2VH1A 3P4QB 3DVGX 1F2RC 2KN5A 3BIID 2EELA 3LJ3A 1SXTA 4BFRA 1CZPA 3AE6B 2LVPA 2K39A 2ZCCA 1N63A 2XEWA 3U52E 2RDBC 3TMPB 3ZNID 1WYGA 2AQ3B 1V8CA 1YIWA 1ZPSA 4WAFA 4MT5A 4RNAA 3OJ3A 4W9FA 2MBQA 1J8CA 2BS3B 1MFWA 4NAMA 3ETRA 2DYMA 4DXAB 1RRBA 1R4MB 2ZZPB 2N0SB 2DBYA 2K22A 1WJUA 1L6UA 3N9YC 2J42A 2RR9A 1WZ3A 3MHSD 3V61A 4FBJB 2DZMA 1TGZB 3AEEB 5D6JB 2FCMA 1F0ZA 3RYTA 3UIPB 1N5WA 1HXYD 2K5PA 2LVQA 1YX6B 3VXWA 4K3CA 5T8IA 1CJEA 2XK5A 3GS2A 3L16A 2KMCA 3O65B 4BKGA 3Q3JA 3PREA 1IBXB 2G3QB 3DVGY 1NBFC 1TJEA 2DZJA 1VDVA 4MGKE 2O6VD 2QDFA 3GB1A 4TUUA 1K51A 1EWCA 3ZQ4A 1KFYB 3HM6X 1UD7A 4ARIA 1WE7A 3IAS1 3T3NA 1C9FA 3D32A 1I42A 3ZW3A 3IG3A 2K6DB 3Q6BA 2DLBA 2O2VA 2DWQA 2UWQA 2EKEC 4USAA 1ZE3D 2LGYA 1XF5L 2FCQA 4PYZA 3PGEA 4F8CB 5FR3A 3BYTB 5C23A 3VTWA 2C5LC 5D3DA 2AL6A 1LXDA 2DX5B 5HFYA 2D5GA 3HM3A 3P4SB 2GBKA 2L0TA 3EECA 4S0RA 2RPVA 4FADA 1EU3A 4IM0A 1C4CA 2Y5BB 3BK1A 2PJHA 4IM2A 2BGFA 4BAXA 3DVNU 2KTRA 1D3ZA 3LXFA 1XLPA 1XD3B 4EZKA 2YEPB 1JWAD 1WXQA 1JWSD 4FXCA 4P1BC 4MDKE 1EF5A 1UGMA 1ZOYB 4E3CA 2KJHB 1XLQA 2H88B 2WS3B 3U4EG 2FCNA 2B3AA 5FK9C 2L83A 2W82A 2MBBB 4W9DA 1D5MC 3N1XC 4HJKA 4DDGD 1DOIA 3L08A 2OJRA 4ZHOA 2QCZA 3SHQA 4A55A 2CJNA 1ZDXA 3AN1A 1E90A 3WALA 1YQ4B 1ZW7A 4ASWC 3WANA 3TEWA 3DBLB 2LFIA 1WX9A 1NVID 1JQ4A 2KMAA 1H4RA 2FUG1 2MSED 3AU5A 3APDA 4I6PA 4WJOA 1KH0A 1WXMA 4LJOB 2PVGC 1WXVA 4MM3A 1V6EA 2KWCA 5EE0A 4YL8A 2N1WA 3PLVA 2WDTB 4LNKA 1ET9A 5C2TB 4JIOU 1QOFA 1WWTA 4P7IA 5FR6A 2MCNB 1OGWA 3R7QA 3V6EB 2MBHA 1YQ3B 1T6BX 3RMKC 4WWPA 3KUCB 3MJWA 2MWSB 3HIZA 3X23A 5CHWA 1YD8U 2JWUA 2BYVE 1PUTA 2CU3A 2LXAA 3B2FA 1KM7A 1PFDA 3DHHC 4MSMB 4AP4C 2KDFB 1JWMD 1WF9A 1Z2MA 2HD5B 5G5GA 4JPSA 2MX2A 3FC4A 1MVKA 4IWOA 1SSNA 2L0FA 4RM9A 1E8WA 3KH0A 2EMSA 5JHBA 5BYQA 3QC8B 2AYOB 1E7VA 1V5TA 3SU8X 1Z5SB 2XK5B 1FO4A 2KVZA 4G50A 1CK1A 3VFKA 3Q3NC 3Q3MC 2KC1A 1AWDA 4XWTA 4DQOC 2BF8B 3RNAC 3GE8C 3ECIA 4C00A 2MRPA 2GBRA 2LD9A 2PE9A 1NI3A 4K7SA 4B0MA 1DOYA 2O2VB 3RD2A 4WH4A 2PE6B 3MHZA 1FFUA 3W9CB 4RF0A 4BKTA 3AE1B 4ANVA 4LNFA 3UI3A 4M8MA 2J52A 1VR9A 2XN9C 2LXCA 1IUEA 4ZYSA 3DHGC 4W9EA 3SFEB 4OZCA 2RD0A 1SE4A 1XCTL 1WZ0A 1EU4A 3TSSA 4ZYNA 2KTRB 4RGNA 4TQ0A 4X57B 5TR5A 4FHKA 4N59A 3UF8A 2ZW0A 1PGXA 1OTRB 5AEKB 2KQ4X 3VRBB 3H7SA 1TKGA 5BMHA 2GI9A 1AW7A 3OWEB 5AUIA 1K53A 4ICVA 2R2QA 2CKHB 1WGKA 4P16A 1WGDA 3RNGC 5CHFA 2I1JA 1V97A 2NR2A 4I6LB 1SEBD 3HK0A 1WY8A 1SE9A 4YSZB 2QSDA 2LVOA 3ZYYX 2BYTA 4PS3A 1HQRD 4XZ4A 3DBRI 4DWFA 4KGSA 5BYRA 4HPLB 3DHIC 3BY4B 2PEAA 1EUVB 2J0JA 4URKA 2Z0DB 4WIPA 1L2NA 2PPHA 1ZGUB 2WGSA 1C76A 3K9OB 1NDDA 3CF6E 2WDRB 4TV3A 5BO4B 4F1SA 2WXNA 4AUQC 4JWUC 4EZLA 2KC2A 2W54A 4HLEA 1UWXA 1I7HA 3QARA 2BWFA 4LK0M 1FM0D 2INDC 1BXTA 1TTNA 1I4PA 2G4DB 1IP9A 2ZJDA 2JYEA 3OJ4B 2JRHA 4MM3B 4EOYA 2JZZA 4DHZB 5JH5C 4GU2A 3KWLA 2RMMA 3N1ZC 4N9F4 4REZA 4A90A 1E0ZA 3NVWA 2H89B 1JRPA 4WAAA 3AEGB 4DHJD 4HVBA 4AJYB 1E8XA 3V3XA 3DWMA 2IY1B 3H8HA 1WJ4A 3HVZA 2KFKA 4ZRIA 3TCAA 3WIMA 1ZUD2 2M4NA 3APCA 3I9V1 4GB9A 1E10A 5GXGB 5J18A 4YXDB 2SAKA 3EHVA 2C60A 1FRDA 3A33B 3LB8C 1XQQA 3R7RA 3H7PA 2YLMA 4MEMA 5E6JA 3PRZA 3BWUD 4NJ6A 2BS4B 2KMMA 1RAXA 3PZ7A 4C56C 1YJ1A 1HZ6A 3RNCC 2IGGA 1FFVA 5E6PA 4DBGA 2N7JA 3DQVA 5EE3A 5KHQA 3AXCA 2CU1A 5LNK1 4ITKA 3M63B 3ZXVA 3VH3B 2K25A 1STEA 2ONQA 2KANA 2KDEB 3MTNB 3R3MA 3DPDA 4ICUA 4PS8A 3NOBA 4N6EB 1PDXA 1E6EB 1WXSA 4GXBA 1WRIA 4A3OA 5G5HA 5AZGA 2D10A 2V4IB 3L54A 1FXIA 3ZKJC 4OVUA 5KHOA 2MH7A 3PRMB 2DENB 2WXMA 5H92C 2IO0B 1RM6C 4F7ZA 2GRIA 4OZAA 3RI7C 2K0PA 2FIFA 2MEKA 2B76B 4IG7B 5L83A 2WHIA 3DDCB 1QT9A 1JWUD 2C9WB 4AOFA 3AE9B 3NZ3A 4RGMA 1GC7A 3ZXRA 1AARA 3FILA 2HJ1A 3PHWB 1J7BA 3TBLD 2WU2B 2KX0A 3APFA 3NUHB 3M62B 5TSSA 2BW2A 3ALBA 2K1FA 4BBNC 4W9HA 2BB6A 2GMIC 1R7SA 3ZNZB 1WXAA 5JXVA 5E6NA 2E3TA 2D3CA 5G55A 2PW9A 3QIJA 4ZDVA 3L17A 5J2RA 3P63A 4MGZE 1LQBA 2JF5A 3AEFB 1FRRA 3P2BA 4GDKA 1DYQA 4WJPA 1PGAA 2ZPNA 1B9RA 4KKJA 1R4NI 4DXGA 1SE3A 2NS5A 4I6NB 2KD0A 4KZ0A 2MLBA 2JX5A 2A4ZA 2BYFA 2GB1A 4G0NB 1VRAB 5D94A 3URYA 2D2QA 3T8MA 3TIXA 3WAMA 4GGQA 3RNEC 3ZDMC 3AEBB 3GZNB 4CHKA 1I35A 2LHDA 1BUIC 1JW9D 3OAWA 4WQOB 4LJPB 3QK0A 4OHJA 3JVZX 4HK2A 2LGSA 5HI1A 3H1UA 3RFZB 1L0YB 3ABVB 3BVGA 1TS2A 4JGHB 2Z0EB 3ZTCA 4CQNA 1TKYA 2PMVA 3T9LA 2V9HA 1IYFA 3PHXB 1L4ZB 1R4MI 2KHWB 4C80A 2FE8A 4KV2A 3S2AA 2C7MB 3Q2AC 4C7ZA 4W9KA 5DPRA 2M8SA 3RUIB 1S1QB 2WX0A 1FPYA 4US9A 4TSSA 4WJNA 2R61A 3AEDB 1LGRA 4JLCA 2KFKB 1T0RC 3GP7A 4HDQA 4YTNB 1RFKA 3SEBA 1IGCA 4BOZB 4NQKE 5JZEB 1WM2A 2PVOD 4TKNA 2Y3AA 1JWBD 3A4SC 1V1PA 3H7PB 1I4HA 3IFWB 2TSSA 1WMHB 3ZNGC 1MG4A 4K3BA 2WXLA 1YQBA 2KQ7A 4UDUC 3OLMD 3AE8B 1LFDA 3IVFA 2CHWA 3AV8A 1TYGB 5BMGA 4G11A 3AU4A 4W9CA 4KGTA 4ANWA 1N61A 5HG2A 2W9NA 1UBIA 3QCAA 5IOIA 4XDCA 4RFBA 3O13A 2E6XA 4IKGA 1C77A 2JU6X 4RGTA 3KUZA 1YX5B 5IAAC 1YN5A 3UINB 3H6NA 3L13A 4MH0E 4D2KA 3E9SA 2N9XA 4TQ1A 2QHOA 3ZDTA 5IKCM 2YVCA 4R3DA 3PTFC 3OG5A 3IT6B 2BVCA 2WXRA 2MBOA 3A4RA 1FNVA 2KN4A 1ESFA 4J6IA 4MACA 3DBHB 3UIOB 1A70A 1VZ7A 3DBSA 3QJZA 2YEPF 2IO2B 2IZVB 3FILB 3VH4B 4NAWA 4ACFA 4M0WB 2IY0B 3MC9A 2GBJA 5C3JB 4LNNA 2D3GA 4LCDE 4GSWA 1ACCA 2N9EB 4KX6B 5JHAA 2NTSA 4PYUA 2MJEA 2VZKB 3HRDD 4HCPB 5IN7A 1RFAA 2L52A 2W3SA 2EMTA 1HEZE 2ASQA 2OHFA 4GDKB 3RULA 3CIRB 3ONSA 1M4VA 3DBLI 1J7AA 4EZJA 1CMXB 3C0RB 3UQBA 2ZPYA 1TT5B 3W2DA 4HEA1 4HXDA 1HTOA 2INCC 1I4QA 4LDTB 1SIJA 2L8JA 3V6CB 2KWUB 1MHHE 3IXSA 2FCSA 4FHJA 4GMVA 1ROEA 2NCNA 2N9LA 3EC8A 2KQSA 1TKEA 2KYWA 2G9HD 3R2TA 3E56A 1AYFA 4E71A 1OQRA 3QQ8B 1K8RB 4B95A 2A5UA 1EWYC 2L1AA 5AZHA 3U30A 4KKIA 2BTEA 4ZOHC 5IP4D 4EFOA 1GOZA 2XNAC 4NPNA 1KOTA 2UYZB 2WXQA 2N9KA 2I2YA 2L05A 3B1LX 4KDLB 2VH2A 1EO6A 1QOAA 2VRRB 2ZW1A 3M3JA 3I5JC 1F1HA 1QQRA 2JWZA 3BK2A 1TY0A 4LNIA 4S17A 2WQYB 1VJKA 3N20C 2J4XA 4BVUC 2MQJA 3V05A 1TBEA 1P98A 1TY2A 2J53A 3LYYA 2KDBA 1FEHA 4MGYE 5C1ZA 3GE3C 5LLIA 3ZJTA
chains in the Genus database with same CATH topology
4MEMA 3TJPA 3PRZA 3UIPB 5DCNA 3NY5A 4NJ6A 3Q3FA 2LVQA 2IO1B 1YX6B 3VXWA 3RT3B 1V80A 3DOWA 2LWPA 1RAXA 3LDZE 1V5OA 4A20A 2XK5A 2ZCBA 4K81A 1YJ1A 3KYCD 3L16A 2KMCA 5E6PA 3VAWA 4DBGA 3W1YA 3O65B 1A5RA 2JT4B 4BKGA 3CSTA 3DQVA 2WYQA 3Q3JA 3PREA 5KHQA 3AXCA 1V81A 2CU1A 4FJVB 4GN1A 3ZNHB 4BOSC 2G3QB 3DVGY 1NBFC 2L3ZA 2DZJA 4MGKE 3GOEA 2O6VD 3M63B 1P9DU 2LGDA 3ZRCA 3VH3B 4TUUA 2K25A 2V3SA 3HM6X 1UD7A 5CX3A 1WE7A 2BPSA 3QHTA 2NPTA 5LXIB 2KANA 4IW0A 2NBVB 3JSVB 2KDEB 3MTNB 3D32A 3R3MA 2MP2B 1JRUA 1WRDB 3DPDA 3WAOA 1I42A 4ICUA 3ZW3A 3IG3A 2WWZA 2K6DB 2O2VA 2LRWA 4PS8A 3NOBA 2UWQA 2EKEC 1V9JA 2G4SA 2ZNVB 1WXSA 2L7RA 4GXBA 1U4AA 4A3OA 1V49A 2LGYA 5AZGA 2D10A 3ZRFA 2FCQA 4PYZA 3PGEA 3L54A 4FJZA 2ZVOA 4F8CB 3ZKJC 4OVUA 5KHOA 2CHZA 2G45B 1WYWB 4ZRJA 5C23A 3VTWA 4IWPA 2RPQA 2C5LC 3DBHI 4KIKA 2AL6A 2DENB 3PRMB 3QA8A 1LXDA 4JQWC 3H9DA 2DX5B 3QX1A 1GNUA 1WGGA 2JUOA 3ENEA 1WIAA 2IO0B 4F7ZA 1E7UA 2MA9B 1G6JA 3HM3A 4NY0A 2FIFA 2GBKA 2L0TA 3CSFA 3EECA 2KDIA 4FADA 4IG7B 4IM0A 2Y5BB 2PJHA 4IM2A 5L83A 3DDCB 2C9WB 4WWOA 3PS6A 4AOFA 2BGFA 2LZ6A 1GC7A 2DYBA 3RCZA 3DVNU 2HTHA 2FAZA 2KTRA 4MGIE 3KUDB 5J17A 2M17A 4KZCA 3SD5A 1D3ZA 1AARA 1WH3A 1V86A 3PHWB 1XD3B 3PZDA 3TBLD 3APFA 1EF1A 2KX0A 4EZKA 3M62B 3A9JA 1OEYA 4K7WA 1WR6E 4BKSA 4DK5A 1KLVA 4FULA 4IUMB 3ALBA 2KNBA 2NBUA 4DDID 2N7EA 2K1FA 4BBNC 4W9HA 1H8CA 4NAWB 5L95C 4MDKE 1EF5A 1UGMA 2GMIC 3ZNZB 1WXAA 2LGXA 5E6NA 4E3CA 2KJHB 1V2YA 5G55A 3KW5B 1WE6A 3QIJA 2NVUI 3WAPA 3L17A 2KK8A 3VTUA 4ZDVA 5J2RA 3PT2B 2N7DA 3KVFB 2D11A 2FCNA 4W9LA 2B3AA 3ZUNA 2JVCA 1LQBA 2REXA 4MGZE 2JF5A 3ZTDA 2DAFA 3P2BA 4GDKA 2N4FA 4WJPA 4MJSA 2ZPNA 2MBBB 4W9DA 1R4NI 4HJKA 2K8BA 2NS5A 3JW0X 1C1YB 4FN2A 4I6NB 4DDGD 2KD0A 2I1KA 4KZ0A 2MLBA 2OJRA 3A1QA 3B0AA 3L08A 2A4ZA 2BYFA 4G0NB 4KSKC 3SHQA 5D94A 1SIFA 2D2QA 4FA6A 3T8MA 4MSQB 2HJ8A 3TIXA 3WAMA 4GGQA 5G2NA 2L00B 4AWJA 3ZDMC 2DZKA 2ZEQA 4CHKA 4DHZE 4NJ7A 1I35A 1E90A 1WMHA 2JXXA 4II2B 4JL9A 3WALA 5LXHA 3ZVVA 1ZW7A 4ASWC 3WANA 3OAWA 4HWIB 4M8NA 4WQOB 4LJPB 3QK0A 3JYUA 3JVZX 4KSLC 4HPMB 3KYDD 2DHZA 4HK2A 5D7GA 3HHMA 1WX9A 2KZRA 3N30A 2KMAA 1H4RA 3H1UA 2MSED 3PVLA 1BT0A 3AU5A 3APDA 4I6PA 4WJOA 2AWTA 2O6VB 2Z0EB 4JGHB 1WXMA 3ZTCA 4LJOB 4CO7A 1WXVA 3AULA 4BKSD 3V60A 3UGBB 4MM3A 4IC7B 1V6EA 2KWCA 2L76A 4W9IA 3TL5A 1ISNA 2KJRA 1RLFA 4YL8A 4E74A 4HCNB 3T9LA 2N1WA 5IA7A 1IYFA 2KX3A 3PHXB 1J19A 3PLVA 2WDTB 1R4MI 2KHWB 4JIOU 1LM8B 4KV2A 3S2AA 3DCGA 2C7MB 4EUTA 4GDLB 2KO3A 4W9JA 4W9KA 1WGHA 4P7IA 4XC2A 5DPRA 5FR6A 2MCNB 1OGWA 3R7QA 2M8SA 3V6EB 2MBHA 5E6OA 1WX8A 3U7DA 3L0WB 1GUAB 4WWPA 3RUIB 1S1QB 2WX0A 3KUCB 3R7RA 3MJWA 4WJNA 2MWSB 2OOBB 3HIZA 5CHWA 3X23A 1YD8U 3BINA 3N32A 2BYVE 5DPWA 2K8CA 2LXAA 4JLCA 2KFKB 1GG3A 1KM7A 4HDQA 5AZFA 4MSMB 2LI5A 4BOZB 2KJ6A 4AP4C 2KDFB 1P3QU 4NQKE 1WF9A 3IBEA 1WX7A 5JZEB 1TZ1A 1WM2A 4WJQA 2HE7A 4TKNA 1Z2MA 1MG8A 2HD5B 5D2MB 2C7NB 1GC6A 3A4SC 3VQIA 2IYDB 1PQSA 2M0XA 2AL3A 2MX2A 1T0YA 4IWOA 3RZFA 2L0FA 3H7PB 2V4LA 4RM9A 1E8WA 5HKHA 3UQAA 2LUEA 3KH0A 2EMSA 2RSUA 3IFWB 5JHBA 1WMHB 3ZNGC 1C3TA 3QC8B 2AYOB 1E7VA 1V5TA 2N9PC 3SU8X 1Z5SB 3N3KB 2XK5B 1YQBA 2KQ7A 3OLMD 3B08A 1UH6A 4G50A 3VFKA 1LFDA 3IVFA 1E8YA 2CHWA 2KC1A 1WFYA 2DAJA 3IHPC 5CTRC 2CR5A 2IO3B 4G11A 2BF8B 2Z59B 3AU4A 2KVRA 4W9CA 4ANWA 3JSVA 3ZLZA 3ECIA 2MP2A 2KWVB 2W9NA 2MRPA 1UBIA 3QCAA 2GBRA 4GOCA 5EDSA 2BWES 3RZWC 2LD9A 2NPTB 2PE9A 3VDZA 2M1MA 2JRIB 2KFJA 3NZSA 4K7SA 2O2VB 3RD2A 3ML8A 4RMAA 3KUZA 1YX5B 2PE6B 5IAAC 3A9KA 3UINB 3H6NA 3L13A 3X0WA 4FJYA 4MH0E 1Q0WB 4BKTA 2JPHA 1IPGA 4ANVA 4IWQA 1X1MA 2N9XA 2JY6A 4TQ1A 2QHOA 3ZDTA 4KIKB 2KKCA 4NNJB 3SDLC 2YVCA 4M8MA 4G3XB 3CMMB 3WA0A 3PTFC 1L7YA 4B9KA 2GOWA 3AI5A 2LXCA 3NS8A 2IBIB 5DPSA 2MBOA 3A4RA 4W9EA 4J6IA 2V1YA 4K7UA 2RD0A 3UIOB 3M95A 2XBBC 4ANXA 3DBSA 1WZ0A 1KJTA 2LASA 3PV1A 1VD2A 1Y8RC 3QJZA 1S3SG 2IO2B 3PRPB 4ZYNA 1FXTB 2KTRB 4TQ0A 2KTFA 4X57B 5TR5A 4WWNA 2IZVB 4FHKA 2J0MA 3VUXA 3UF8A 3VH4B 4NAWA 4M0WB 1OTRB 2IY0B 5AEKB 2GBJA 2J0KA 3A9JB 4EKUA 2D3GA 3H7SA 2DZIA 2GBMA 1XT9B 4LCDE 1J0GA 4GSWA 2N9EB 4CYEA 2R2OA 1E5WA 1WM3A 5JHAA 4PYUA 1Q5WB 3PLUA 3DVNV 4ICVA 2R2QA 4HCPB 2CKHB 3ZO5B 2FNJB 3K9PB 3QWZB 2NBWB 1WGDA 1RFAA 2BYEA 5CHFA 2K6QA 2I1JA 2NR2A 2EMTA 4I6LB 2ASQA 3HK0A 5GMVA 1WY8A 1SE9A 3GZNI 4GDKB 1ZKHA 1SGHA 2LVOA 3L10B 3RULA 2KOXA 2KLGA 4MJSB 4MELA 3W1SC 2LJ5A 4FLHA 1M94A 3ONSA 3QAQA 4PS3A 2RGFA 4XZ4A 1Q1OA 4HDOA 3DBLI 5DPTA 3DBRI 2FIDA 3A1QB 1OQYA 4HPLB 4OVVA 4W9GA 4DWFA 1UBQA 1OEYJ 3BY4B 4EZJA 1GJZA 1QZEA 4IM3A 4ZRKA 2PEAA 1CMXB 4B6WA 3A9KB 1EUVB 4K1RB 4GIVA 3C0RB 5CHVC 2ZPYA 2FUHB 2GBNA 2J0JA 3UQBA 4LDTD 4HXDA 2AEHA 4URKA 3I3TB 2Z0DB 2J7QB 1L2NA 4LDTB 2CS4A 1ZGUB 2PPHA 3K9OB 2L8JA 1NDDA 4RM8A 2ZNVC 3VTVA 3V6CB 3ZIMA 3CF6E 4TV3A 2KWUB 2KLCA 5BO4B 4F1SA 3VVWB 4AUQC 1UZXB 4KDIC 4EZLA 2KC2A 3NHEB 4HLEA 2FCSA 4FHJA 4GMVA 2C7HA 2BKRB 2NCNA 3QARA 2BWFA 3W1SA 2D07B 1P1AA 4ANUA 2MW5A 3EC8A 3V62A 4KVGB 2KQSA 1WJ6A 1F9JA 2O6VA 4EEWA 1WR1A 3DVGX 2N1VA 3PSEB 1WGRA 1TTNA 2G4DB 4E71A 3QQ8B 2KN5A 1IP9A 1K8RB 3VUYA 2ZJDA 2JZ3B 3LJ3A 4B95A 1HE8A 3OJ4B 4A3PA 2JRHA 2A5UA 2BKFA 2K8HA 4EOYA 2JZZA 3VHTC 4DHZB 1WI0A 4BFRA 5AZHA 2DYOA 3EFUA 4GU2A 3U30A 5JH5C 2MBEA 2LVPA 4N9F4 2K39A 3NZUA 1WJNA 4GDLA 4EFOA 4NPNA 1KOTA 2ZCCA 2XEWA 2UYZB 1UELA 3TMPB 4NQLB 3ZNID 1WGYA 2L05A 4XX5A 2ZVNA 4WAAA 3B1LX 4DHJD 1P0RA 1YIWA 4KDLB 4AJYB 4HVBA 1E8XA 3OJ3A 2CHXA 1EO6A 4W9FA 4DHJB 2MBQA 2VRRB 3RYTA 3VUWA 1J8CA 2IY1B 2LRUA 3M3JA 1WJ4A 2JWZA 1NI2A 2KFKA 1E8ZA 2DYMA 4ZRIA 3TCAA 3WIMA 3U8ZA 4DXAB 1RRBA 3R66C 4BBNF 2M4NA 2ZZPB 3APCA 1VCBA 3ML9A 4PS7A 4BVUC 2MQJA 1TBEA 1WJUA 1P98A 4GB9A 2RR9A 4AJWA 3PPAA 5J18A 1WZ3A 2KDBA 2WX1A 3EHVA 3MHSD 2KXJA 2C60A 2DZMA 3V61A 4FBJB 1TGZB 4MGYE 3A33B 4II3B 5D6JB 5C1ZA 2FCMA 1XQQA 5LLIA 3H7PA 2YLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MEM A;  3TJP A;  3PRZ A;  3UIP B;  5DCN A;  3NY5 A;  4NJ6 A;  3Q3F A;  2LVQ A;  2IO1 B;  1YX6 B;  3VXW A;  3RT3 B;  1V80 A;  3DOW A;  2LWP A;  1RAX A;  3LDZ E;  1V5O A;  4A20 A;  2XK5 A;  2ZCB A;  4K81 A;  1YJ1 A;  3KYC D;  3L16 A;  2KMC A;  5E6P A;  3VAW A;  4DBG A;  3W1Y A;  3O65 B;  1A5R A;  2JT4 B;  4BKG A;  3CST A;  3DQV A;  2WYQ A;  3Q3J A;  3PRE A;  5KHQ A;  3AXC A;  1V81 A;  2CU1 A;  4FJV B;  4GN1 A;  3ZNH B;  4BOS C;  2G3Q B;  3DVG Y;  1NBF C;  2L3Z A;  2DZJ A;  4MGK E;  3GOE A;  2O6V D;  3M63 B;  1P9D U;  2LGD A;  3ZRC A;  3VH3 B;  4TUU A;  2K25 A;  2V3S A;  3HM6 X;  1UD7 A;  5CX3 A;  1WE7 A;  2BPS A;  3QHT A;  2NPT A;  5LXI B;  2KAN A;  4IW0 A;  2NBV B;  3JSV B;  2KDE B;  3MTN B;  3D32 A;  3R3M A;  2MP2 B;  1JRU A;  1WRD B;  3DPD A;  3WAO A;  1I42 A;  4ICU A;  3ZW3 A;  3IG3 A;  2WWZ A;  2K6D B;  2O2V A;  2LRW A;  4PS8 A;  3NOB A;  2UWQ A;  2EKE C;  1V9J A;  2G4S A;  2ZNV B;  1WXS A;  2L7R A;  4GXB A;  1U4A A;  4A3O A;  1V49 A;  2LGY A;  5AZG A;  2D10 A;  3ZRF A;  2FCQ A;  4PYZ A;  3PGE A;  3L54 A;  4FJZ A;  2ZVO A;  4F8C B;  3ZKJ C;  4OVU A;  5KHO A;  2CHZ A;  2G45 B;  1WYW B;  4ZRJ A;  5C23 A;  3VTW A;  4IWP A;  2RPQ A;  2C5L C;  3DBH I;  4KIK A;  2AL6 A;  2DEN B;  3PRM B;  3QA8 A;  1LXD A;  4JQW C;  3H9D A;  2DX5 B;  3QX1 A;  1GNU A;  1WGG A;  2JUO A;  3ENE A;  1WIA A;  2IO0 B;  4F7Z A;  1E7U A;  2MA9 B;  1G6J A;  3HM3 A;  4NY0 A;  2FIF A;  2GBK A;  2L0T A;  3CSF A;  3EEC A;  2KDI A;  4FAD A;  4IG7 B;  4IM0 A;  2Y5B B;  2PJH A;  4IM2 A;  5L83 A;  3DDC B;  2C9W B;  4WWO A;  3PS6 A;  4AOF A;  2BGF A;  2LZ6 A;  1GC7 A;  2DYB A;  3RCZ A;  3DVN U;  2HTH A;  2FAZ A;  2KTR A;  4MGI E;  3KUD B;  5J17 A;  2M17 A;  4KZC A;  3SD5 A;  1D3Z A;  1AAR A;  1WH3 A;  1V86 A;  3PHW B;  1XD3 B;  3PZD A;  3TBL D;  3APF A;  1EF1 A;  2KX0 A;  4EZK A;  3M62 B;  3A9J A;  1OEY A;  4K7W A;  1WR6 E;  4BKS A;  4DK5 A;  1KLV A;  4FUL A;  4IUM B;  3ALB A;  2KNB A;  2NBU A;  4DDI D;  2N7E A;  2K1F A;  4BBN C;  4W9H A;  1H8C A;  4NAW B;  5L95 C;  4MDK E;  1EF5 A;  1UGM A;  2GMI C;  3ZNZ B;  1WXA A;  2LGX A;  5E6N A;  4E3C A;  2KJH B;  1V2Y A;  5G55 A;  3KW5 B;  1WE6 A;  3QIJ A;  2NVU I;  3WAP A;  3L17 A;  2KK8 A;  3VTU A;  4ZDV A;  5J2R A;  3PT2 B;  2N7D A;  3KVF B;  2D11 A;  2FCN A;  4W9L A;  2B3A A;  3ZUN A;  2JVC A;  1LQB A;  2REX A;  4MGZ E;  2JF5 A;  3ZTD A;  2DAF A;  3P2B A;  4GDK A;  2N4F A;  4WJP A;  4MJS A;  2ZPN A;  2MBB B;  4W9D A;  1R4N I;  4HJK A;  2K8B A;  2NS5 A;  3JW0 X;  1C1Y B;  4FN2 A;  4I6N B;  4DDG D;  2KD0 A;  2I1K A;  4KZ0 A;  2MLB A;  2OJR A;  3A1Q A;  3B0A A;  3L08 A;  2A4Z A;  2BYF A;  4G0N B;  4KSK C;  3SHQ A;  5D94 A;  1SIF A;  2D2Q A;  4FA6 A;  3T8M A;  4MSQ B;  2HJ8 A;  3TIX A;  3WAM A;  4GGQ A;  5G2N A;  2L00 B;  4AWJ A;  3ZDM C;  2DZK A;  2ZEQ A;  4CHK A;  4DHZ E;  4NJ7 A;  1I35 A;  1E90 A;  1WMH A;  2JXX A;  4II2 B;  4JL9 A;  3WAL A;  5LXH A;  3ZVV A;  1ZW7 A;  4ASW C;  3WAN A;  3OAW A;  4HWI B;  4M8N A;  4WQO B;  4LJP B;  3QK0 A;  3JYU A;  3JVZ X;  4KSL C;  4HPM B;  3KYD D;  2DHZ A;  4HK2 A;  5D7G A;  3HHM A;  1WX9 A;  2KZR A;  3N30 A;  2KMA A;  1H4R A;  3H1U A;  2MSE D;  3PVL A;  1BT0 A;  3AU5 A;  3APD A;  4I6P A;  4WJO A;  2AWT A;  2O6V B;  2Z0E B;  4JGH B;  1WXM A;  3ZTC A;  4LJO B;  4CO7 A;  1WXV A;  3AUL A;  4BKS D;  3V60 A;  3UGB B;  4MM3 A;  4IC7 B;  1V6E A;  2KWC A;  2L76 A;  4W9I A;  3TL5 A;  1ISN A;  2KJR A;  1RLF A;  4YL8 A;  4E74 A;  4HCN B;  3T9L A;  2N1W A;  5IA7 A;  1IYF A;  2KX3 A;  3PHX B;  1J19 A;  3PLV A;  2WDT B;  1R4M I;  2KHW B;  4JIO U;  1LM8 B;  4KV2 A;  3S2A A;  3DCG A;  2C7M B;  4EUT A;  4GDL B;  2KO3 A;  4W9J A;  4W9K A;  1WGH A;  4P7I A;  4XC2 A;  5DPR A;  5FR6 A;  2MCN B;  1OGW A;  3R7Q A;  2M8S A;  3V6E B;  2MBH A;  5E6O A;  1WX8 A;  3U7D A;  3L0W B;  1GUA B;  4WWP A;  3RUI B;  1S1Q B;  2WX0 A;  3KUC B;  3R7R A;  3MJW A;  4WJN A;  2MWS B;  2OOB B;  3HIZ A;  5CHW A;  3X23 A;  1YD8 U;  3BIN A;  3N32 A;  2BYV E;  5DPW A;  2K8C A;  2LXA A;  4JLC A;  2KFK B;  1GG3 A;  1KM7 A;  4HDQ A;  5AZF A;  4MSM B;  2LI5 A;  4BOZ B;  2KJ6 A;  4AP4 C;  2KDF B;  1P3Q U;  4NQK E;  1WF9 A;  3IBE A;  1WX7 A;  5JZE B;  1TZ1 A;  1WM2 A;  4WJQ A;  2HE7 A;  4TKN A;  1Z2M A;  1MG8 A;  2HD5 B;  5D2M B;  2C7N B;  1GC6 A;  3A4S C;  3VQI A;  2IYD B;  1PQS A;  2M0X A;  2AL3 A;  2MX2 A;  1T0Y A;  4IWO A;  3RZF A;  2L0F A;  3H7P B;  2V4L A;  4RM9 A;  1E8W A;  5HKH A;  3UQA A;  2LUE A;  3KH0 A;  2EMS A;  2RSU A;  3IFW B;  5JHB A;  1WMH B;  3ZNG C;  1C3T A;  3QC8 B;  2AYO B;  1E7V A;  1V5T A;  2N9P C;  3SU8 X;  1Z5S B;  3N3K B;  2XK5 B;  1YQB A;  2KQ7 A;  3OLM D;  3B08 A;  1UH6 A;  4G50 A;  3VFK A;  1LFD A;  3IVF A;  1E8Y A;  2CHW A;  2KC1 A;  1WFY A;  2DAJ A;  3IHP C;  5CTR C;  2CR5 A;  2IO3 B;  4G11 A;  2BF8 B;  2Z59 B;  3AU4 A;  2KVR A;  4W9C A;  4ANW A;  3JSV A;  3ZLZ A;  3ECI A;  2MP2 A;  2KWV B;  2W9N A;  2MRP A;  1UBI A;  3QCA A;  2GBR A;  4GOC A;  5EDS A;  2BWE S;  3RZW C;  2LD9 A;  2NPT B;  2PE9 A;  3VDZ A;  2M1M A;  2JRI B;  2KFJ A;  3NZS A;  4K7S A;  2O2V B;  3RD2 A;  3ML8 A;  4RMA A;  3KUZ A;  1YX5 B;  2PE6 B;  5IAA C;  3A9K A;  3UIN B;  3H6N A;  3L13 A;  3X0W A;  4FJY A;  4MH0 E;  1Q0W B;  4BKT A;  2JPH A;  1IPG A;  4ANV A;  4IWQ A;  1X1M A;  2N9X A;  2JY6 A;  4TQ1 A;  2QHO A;  3ZDT A;  4KIK B;  2KKC A;  4NNJ B;  3SDL C;  2YVC A;  4M8M A;  4G3X B;  3CMM B;  3WA0 A;  3PTF C;  1L7Y A;  4B9K A;  2GOW A;  3AI5 A;  2LXC A;  3NS8 A;  2IBI B;  5DPS A;  2MBO A;  3A4R A;  4W9E A;  4J6I A;  2V1Y A;  4K7U A;  2RD0 A;  3UIO B;  3M95 A;  2XBB C;  4ANX A;  3DBS A;  1WZ0 A;  1KJT A;  2LAS A;  3PV1 A;  1VD2 A;  1Y8R C;  3QJZ A;  1S3S G;  2IO2 B;  3PRP B;  4ZYN A;  1FXT B;  2KTR B;  4TQ0 A;  2KTF A;  4X57 B;  5TR5 A;  4WWN A;  2IZV B;  4FHK A;  2J0M A;  3VUX A;  3UF8 A;  3VH4 B;  4NAW A;  4M0W B;  1OTR B;  2IY0 B;  5AEK B;  2GBJ A;  2J0K A;  3A9J B;  4EKU A;  2D3G A;  3H7S A;  2DZI A;  2GBM A;  1XT9 B;  4LCD E;  1J0G A;  4GSW A;  2N9E B;  4CYE A;  2R2O A;  1E5W A;  1WM3 A;  5JHA A;  4PYU A;  1Q5W B;  3PLU A;  3DVN V;  4ICV A;  2R2Q A;  4HCP B;  2CKH B;  3ZO5 B;  2FNJ B;  3K9P B;  3QWZ B;  2NBW B;  1WGD A;  1RFA A;  2BYE A;  5CHF A;  2K6Q A;  2I1J A;  2NR2 A;  2EMT A;  4I6L B;  2ASQ A;  3HK0 A;  5GMV A;  1WY8 A;  1SE9 A;  3GZN I;  4GDK B;  1ZKH A;  1SGH A;  2LVO A;  3L10 B;  3RUL A;  2KOX A;  2KLG A;  4MJS B;  4MEL A;  3W1S C;  2LJ5 A;  4FLH A;  1M94 A;  3ONS A;  3QAQ A;  4PS3 A;  2RGF A;  4XZ4 A;  1Q1O A;  4HDO A;  3DBL I;  5DPT A;  3DBR I;  2FID A;  3A1Q B;  1OQY A;  4HPL B;  4OVV A;  4W9G A;  4DWF A;  1UBQ A;  1OEY J;  3BY4 B;  4EZJ A;  1GJZ A;  1QZE A;  4IM3 A;  4ZRK A;  2PEA A;  1CMX B;  4B6W A;  3A9K B;  1EUV B;  4K1R B;  4GIV A;  3C0R B;  5CHV C;  2ZPY A;  2FUH B;  2GBN A;  2J0J A;  3UQB A;  4LDT D;  4HXD A;  2AEH A;  4URK A;  3I3T B;  2Z0D B;  2J7Q B;  1L2N A;  4LDT B;  2CS4 A;  1ZGU B;  2PPH A;  3K9O B;  2L8J A;  1NDD A;  4RM8 A;  2ZNV C;  3VTV A;  3V6C B;  3ZIM A;  3CF6 E;  4TV3 A;  2KWU B;  2KLC A;  5BO4 B;  4F1S A;  3VVW B;  4AUQ C;  1UZX B;  4KDI C;  4EZL A;  2KC2 A;  3NHE B;  4HLE A;  2FCS A;  4FHJ A;  4GMV A;  2C7H A;  2BKR B;  2NCN A;  3QAR A;  2BWF A;  3W1S A;  2D07 B;  1P1A A;  4ANU A;  2MW5 A;  3EC8 A;  3V62 A;  4KVG B;  2KQS A;  1WJ6 A;  1F9J A;  2O6V A;  4EEW A;  1WR1 A;  3DVG X;  2N1V A;  3PSE B;  1WGR A;  1TTN A;  2G4D B;  4E71 A;  3QQ8 B;  2KN5 A;  1IP9 A;  1K8R B;  3VUY A;  2ZJD A;  2JZ3 B;  3LJ3 A;  4B95 A;  1HE8 A;  3OJ4 B;  4A3P A;  2JRH A;  2A5U A;  2BKF A;  2K8H A;  4EOY A;  2JZZ A;  3VHT C;  4DHZ B;  1WI0 A;  4BFR A;  5AZH A;  2DYO A;  3EFU A;  4GU2 A;  3U30 A;  5JH5 C;  2MBE A;  2LVP A;  4N9F 4;  2K39 A;  3NZU A;  1WJN A;  4GDL A;  4EFO A;  4NPN A;  1KOT A;  2ZCC A;  2XEW A;  2UYZ B;  1UEL A;  3TMP B;  4NQL B;  3ZNI D;  1WGY A;  2L05 A;  4XX5 A;  2ZVN A;  4WAA A;  3B1L X;  4DHJ D;  1P0R A;  1YIW A;  4KDL B;  4AJY B;  4HVB A;  1E8X A;  3OJ3 A;  2CHX A;  1EO6 A;  4W9F A;  4DHJ B;  2MBQ A;  2VRR B;  3RYT A;  3VUW A;  1J8C A;  2IY1 B;  2LRU A;  3M3J A;  1WJ4 A;  2JWZ A;  1NI2 A;  2KFK A;  1E8Z A;  2DYM A;  4ZRI A;  3TCA A;  3WIM A;  3U8Z A;  4DXA B;  1RRB A;  3R66 C;  4BBN F;  2M4N A;  2ZZP B;  3APC A;  1VCB A;  3ML9 A;  4PS7 A;  4BVU C;  2MQJ A;  1TBE A;  1WJU A;  1P98 A;  4GB9 A;  2RR9 A;  4AJW A;  3PPA A;  5J18 A;  1WZ3 A;  2KDB A;  2WX1 A;  3EHV A;  3MHS D;  2KXJ A;  2C60 A;  2DZM A;  3V61 A;  4FBJ B;  1TGZ B;  4MGY E;  3A33 B;  4II3 B;  5D6J B;  5C1Z A;  2FCM A;  1XQQ A;  5LLI A;  3H7P A;  2YLM A; 
#chains in the Genus database with same CATH topology
 1QKZ A;  2RDH A;  4AS1 A;  1RWS A;  1C4P A;  3Q3F A;  1V1P B;  2IO1 B;  3RT3 B;  3LDZ E;  2OED A;  1V5O A;  2ZCB A;  4DXF A;  1L0X B;  3KYC D;  2BS2 B;  2Q5W D;  1N60 A;  4WWM A;  3W1Y A;  1A5R A;  4Q2J A;  3CST A;  1HTQ A;  2WYQ A;  3BVM A;  2IPK D;  4FJV B;  2Z8L A;  3ZNH B;  4BOS C;  3MC0 B;  1MHX A;  1MPE A;  3ZRC A;  1N6Z A;  1FMA D;  3MC8 A;  1QOB A;  2BPS A;  2INN E;  2NPT A;  2X8X X;  5LXI B;  3Q8C A;  3PZ8 A;  4RF1 A;  1FCC C;  2LRW A;  1E7P B;  1C4A A;  1V9J A;  4B0E A;  4N58 A;  3FAH A;  1V49 A;  4LTU A;  4FJZ A;  2ZVO A;  4PT5 A;  4XGA B;  4ZRJ A;  2G45 B;  1WYW B;  4JE3 B;  4IWP A;  2IGH A;  2ON8 A;  4KIK A;  3QA8 A;  4NJC A;  3H9D A;  3QX1 A;  2W3R A;  3MP9 A;  1WIA A;  1E7U A;  1G6J A;  4XWW A;  4NY0 A;  2NTT A;  4XDD A;  3EFC A;  2M56 B;  1C79 A;  3RNF C;  4WWO A;  3RCZ A;  2DYB A;  1PYW D;  4J3O D;  4MGI E;  1SJH D;  5J17 A;  3SD5 A;  1T0S C;  1EF1 A;  3A9J A;  1OEY A;  4K7W A;  4BKS A;  4DK5 A;  1KLV A;  4FUL A;  1ENF A;  2JQR B;  4IUM B;  2NBU A;  3R8B A;  2V0G A;  1H8C A;  4NAW B;  5L95 C;  2LGX A;  2GLS A;  3KW5 B;  3VTU A;  3PT2 B;  2N7D A;  2WDV B;  2INP E;  4W9L A;  1VLB A;  2JVC A;  2DAF A;  5AUK A;  1FXA A;  2N4F A;  4MJS A;  3KQ4 A;  4FN2 A;  1TS3 A;  3W5U B;  1P7F A;  3RPF C;  4XYC A;  2WNM A;  3AE4 B;  2JZP A;  1SIF A;  2AQ2 B;  3AM9 A;  3NJT A;  2D3B A;  4AWJ A;  2ZEQ A;  2KAC A;  1WMH A;  4II2 B;  4JL9 A;  1I4X A;  5MPO A;  2IGD A;  3AE2 B;  4HWI B;  4ARC A;  3Q8E A;  4HPM B;  3KYD D;  4EE2 A;  2WXJ A;  3N30 A;  3PO0 A;  3PVL A;  4CO7 A;  3ZGZ A;  1LO5 D;  4LLG M;  3UGB B;  2L76 A;  2KJR A;  4HCN B;  5IA7 A;  2KX3 A;  2QIE B;  1LM8 B;  2ACZ B;  2JXT A;  4M01 A;  3DCG A;  4C7Y A;  3U2S C;  2KO3 A;  4XC2 A;  1FCL A;  1JCK B;  2IJ0 A;  2X38 A;  1KLG D;  1WX8 A;  3U7D A;  3L0W B;  1GUA B;  2UU7 A;  1TZO A;  2LEK A;  3SFD B;  1N62 A;  3BIN A;  3N32 A;  4C4V B;  5DPW A;  3Q8F A;  1GG3 A;  2MHJ A;  1T0Q C;  2LI5 A;  1NYR A;  2K9X A;  1D6E C;  1MI0 A;  1P3Q U;  2WXF A;  1FNW A;  4WJQ A;  3VRA B;  2HE7 A;  2C7N B;  3VQI A;  1PQS A;  1XLO A;  2M0X A;  4NZL B;  2BQQ A;  3BZD B;  1ZXH A;  3RZF A;  3TEZ A;  2V4L A;  4M0W A;  4YTP B;  5HKH A;  2LUE A;  2RSU A;  1C3T A;  3MJ5 A;  2OJW A;  1L6V A;  1YMH E;  2PTL A;  3B08 A;  1YJI A;  1E8Y A;  1WFY A;  4JX1 C;  3IHP C;  5CTR C;  2IO3 B;  3N1Y C;  3JSV A;  2MP2 A;  1UF0 A;  4GOC A;  2BWE S;  4XE0 A;  2NPT B;  3EUB 2;  2AQ1 B;  1Q10 A;  3VDZ A;  1N5X A;  2JRI B;  4M00 A;  1MJD A;  4YWG G;  4RMA A;  4YSY B;  1YJJ A;  3ZJV A;  1P7E A;  1IPG A;  2JY6 A;  4KIK B;  2KKC A;  3AE3 B;  3I63 C;  4NNJ B;  3SDL C;  4G3X B;  1I4G A;  3CMM B;  3WA0 A;  5H8Y E;  1L7Y A;  4YSX B;  2IBI B;  1J7C A;  4K7U A;  4YTM B;  3M95 A;  2XBB C;  4ANX A;  1KJT A;  1Y8R C;  2WXI A;  1ZXI A;  1S3S G;  2JSV X;  3P42 A;  2KTF A;  2J0M A;  3VUX A;  2BBC A;  3L4P A;  2J0K A;  3A9J B;  4ZRP A;  1XT9 B;  3P4P B;  3DWG C;  3RNB C;  2LMC A;  2R2O A;  3BYY B;  1NEK B;  1WM3 A;  1Q5W B;  3DVN V;  4PK1 A;  3ZO5 B;  2FNJ B;  3K9P B;  3QWZ B;  2NBW B;  2HTM E;  3VR9 B;  3FKY A;  2K6Q A;  4RCO A;  5GMV A;  2BB5 A;  3GZN I;  3T3O A;  1TIF A;  1SGH A;  3CWI A;  2KLG A;  4MJS B;  4MEL A;  3W1S C;  4FLH A;  4US8 A;  1M94 A;  2RGF A;  2KAJ A;  1K50 A;  1Q1O A;  4HDO A;  2FID A;  4W9G A;  4OVV A;  3NVV A;  4A6Q A;  1UBQ A;  1QZE A;  4IM3 A;  4ZRK A;  1YN3 A;  3A9K B;  4B6W A;  1L4D B;  3Q69 A;  1FNU A;  1GPX A;  1QLB B;  2AEH A;  3I3T B;  2J7Q B;  2WU5 B;  2ZNV C;  3VTV A;  3ZIM A;  1F77 A;  1UZX B;  4KDI C;  4P1C C;  2MJ3 A;  4YT0 B;  3RN9 C;  3TEX A;  4ANU A;  2MW5 A;  4LNO A;  4KVG B;  4L1B A;  2O6V A;  2KDM A;  2EKI A;  1WR1 A;  2N1V A;  1SB3 C;  3PSE B;  1Y56 A;  1WGR A;  4JWS C;  2WDQ B;  2WXK A;  3VUY A;  1YNT E;  2JZ3 B;  4ZRQ A;  1HE8 A;  3B9J A;  3EA6 A;  4A3P A;  2BKF A;  2K8H A;  3NVZ A;  3VHT C;  1WI0 A;  3Q8B A;  3BVZ A;  2DYO A;  3EFU A;  2MBE A;  1F2R I;  3NZU A;  1WJN A;  4GDL A;  4RH6 A;  1UEL A;  3SR6 A;  4NQL B;  1WGY A;  4XX5 A;  2ZVN A;  1P0R A;  4H2A A;  2CHX A;  4DHJ B;  3VUW A;  1OFF A;  2LRU A;  2ICI A;  3IT4 B;  1NI2 A;  4M02 A;  1E8Z A;  4KGR A;  2QC8 A;  3U8Z A;  3R66 C;  4BBN F;  1VCB A;  3ML9 A;  4PS7 A;  1ET6 A;  1B1Z A;  4AJW A;  3PPA A;  1QIL A;  2WX1 A;  2KXJ A;  4II3 B;  2I38 A;  1C78 A;  1UUP A;  2BT6 A;  1EM7 A;  3TJP A;  5DCN A;  3NY5 A;  2NMQ A;  3AMZ A;  2PIA A;  1XXG A;  1AN8 A;  1D5X C;  4OW0 A;  1V80 A;  3DOW A;  2LWP A;  1IGD A;  1PGB A;  4A20 A;  4K81 A;  3J9C A;  1ZP0 B;  3VAW A;  1I4R A;  2JT4 B;  3R2I A;  4IDI A;  1ZDV A;  3C8Y A;  3Q14 C;  1V81 A;  4GN1 A;  2L3Z A;  1DOX A;  3GOE A;  1P9D U;  2LGD A;  4A8X C;  3WCQ A;  3NVY A;  1TS5 A;  2V3S A;  5CX3 A;  3QHT A;  3NS1 A;  4IW0 A;  2NBV B;  3JSV B;  2WXG A;  2MP2 B;  1JRU A;  1WRD B;  3WAO A;  2WWZ A;  1TS4 A;  4WQM A;  4ZHP A;  2G4S A;  2ZNV B;  2L7R A;  1U4A A;  3ZRF A;  1FD6 A;  2CHZ A;  2RPQ A;  3AB5 A;  4AQ7 A;  1K52 A;  3DBH I;  4JQW C;  1WSP A;  2M19 A;  1GNU A;  1WGG A;  2JUO A;  3ENE A;  1NYQ A;  2MA9 B;  3CSF A;  2KDI A;  3AE7 B;  1GB1 A;  2QIL A;  2L32 A;  2Y5C A;  3PS6 A;  2LZ6 A;  1E9M A;  1XLN A;  2HTH A;  2FAZ A;  3KUD B;  2M17 A;  4KZC A;  1WH3 A;  1V86 A;  1XO3 A;  3KLS X;  3PZD A;  1D4B A;  5FKA C;  1UWM A;  1WR6 E;  3TEY A;  2LUM A;  3KWV A;  4DDI D;  2KNB A;  3B2G A;  5I4D A;  2N7E A;  2AX5 A;  1V1O A;  5IO9 A;  2Y5P A;  3AE5 B;  1V2Y A;  2JYT A;  3HUI A;  1WE6 A;  3WAP A;  2NVU I;  4RGO S;  2KK8 A;  3KVF B;  1NEN B;  2D11 A;  3ZUN A;  2REX A;  2LGI A;  3EGR A;  3ZTD A;  5HHD G;  4C4V A;  2K8B A;  2QEJ C;  3JW0 X;  1C1Y B;  2G1E A;  3AH7 A;  4O1N A;  2I1K A;  3A1Q A;  3B0A A;  1GAQ B;  1KF6 B;  4KSK C;  1CQV A;  2D3A A;  1T3Q A;  2CJO A;  4FA6 A;  1XEE A;  4MSQ B;  2HJ8 A;  2K3U A;  5G2N A;  2L00 B;  2KT7 A;  2V3P A;  2DZK A;  2QMT A;  4NJ7 A;  4DHZ E;  2JXX A;  5LXH A;  1QOG A;  3ZVV A;  1SE2 A;  4M8N A;  3DBR B;  1GB4 A;  4A9A A;  1F52 A;  3JYU A;  4KSL C;  3VR8 B;  1YN4 A;  2DHZ A;  5D7G A;  3HHM A;  2KZR A;  2V3N A;  1BT0 A;  5EE1 A;  2AWT A;  3Q8A A;  2O6V B;  3C19 A;  4HRS A;  2MJD A;  3IAM 1;  3AUL A;  4BKS D;  4HKZ E;  3V60 A;  4BZA A;  3Q3O C;  5BYS A;  4IC7 B;  2WXO A;  4W9I A;  3TL5 A;  1ISN A;  4L23 A;  1RLF A;  4E74 A;  2IDY A;  1DGJ A;  1HZ5 A;  2WLB A;  1J19 A;  4L2Y A;  5BMI A;  4EUT A;  4GDL B;  4W9J A;  1WGH A;  5E6O A;  2QJL A;  2OOB B;  2WXP A;  2K8C A;  1YOV B;  2LJI A;  5AZF A;  2KJ6 A;  2SEB D;  3IBE A;  1WX7 A;  5EE9 A;  1TZ1 A;  1D5Z C;  1MG8 A;  1KLU D;  5D2M B;  1GC6 A;  1VZ8 A;  2IYD B;  2AL3 A;  3NRZ A;  1T0Y A;  4QAY A;  1FIQ A;  3U7Z A;  3UQA A;  3AEA B;  2N9P C;  3N3K B;  4HJG E;  1IBX A;  1UH6 A;  3AEC B;  2PKO A;  2DAJ A;  4TMA B;  2CR5 A;  2Z59 B;  4GLS C;  2KVR A;  3ZLZ A;  2KWV B;  5D3I B;  5EDS A;  3RZW C;  3I57 A;  4OVZ A;  2KWD A;  2M1M A;  2KFJ A;  3NZS A;  4OZB A;  1L5P A;  3ML8 A;  1UGJ A;  3A9K A;  3HVD A;  3X0W A;  4FJY A;  3TUO A;  1JML A;  1Q0W B;  2JPH A;  4IWQ A;  1X1M A;  4HKQ A;  1JAL A;  1SJE D;  4B9K A;  2GOW A;  3AI5 A;  3NS8 A;  4MH8 A;  4WUR A;  5DPS A;  3P4R B;  2V1Y A;  1RYJ A;  2M0A A;  1T5X D;  3PV1 A;  2LAS A;  1L0V B;  1VD2 A;  3PRP B;  1BML C;  1FXT B;  1HA5 A;  1QF6 A;  4HPP A;  2DNF A;  4WWN A;  1KRH A;  2DZI A;  2WP9 B;  2GBM A;  1J0G A;  2HDE A;  4CYE A;  2VZK D;  1E5W A;  3PLU A;  3W5V B;  1SBB B;  3NG0 A;  2BYE A;  2WXH A;  1VZ6 A;  2PLP A;  3MFG A;  4IOI E;  1ZKH A;  3L10 B;  2KOX A;  2LJ5 A;  3QAQ A;  2RDG A;  2W55 A;  5DPT A;  1KTK A;  3A1Q B;  1OQY A;  1GJZ A;  1OEY J;  2FBW B;  1SF0 A;  4EKU A;  1XCQ L;  4K1R B;  4GIV A;  5CHV C;  2FUH B;  2GBN A;  4LDT D;  2LHE A;  1R4N B;  1UNS A;  2CS4 A;  4RM8 A;  2KLC A;  3ZJU A;  3VVW B;  3NHE B;  3P1M A;  4P6V F;  1OQQ A;  2C7H A;  2BKR B;  1JRO A;  3W1S A;  2D07 B;  1P1A A;  3V62 A;  4HRO A;  1WJ6 A;  1F9J A;  4EEW A;  2VH1 A;  3P4Q B;  3DVG X;  1F2R C;  2KN5 A;  3BII D;  2EEL A;  3LJ3 A;  1SXT A;  4BFR A;  1CZP A;  3AE6 B;  2LVP A;  2K39 A;  2ZCC A;  1N63 A;  2XEW A;  3U52 E;  2RDB C;  3TMP B;  3ZNI D;  1WYG A;  2AQ3 B;  1V8C A;  1YIW A;  1ZPS A;  4WAF A;  4MT5 A;  4RNA A;  3OJ3 A;  4W9F A;  2MBQ A;  1J8C A;  2BS3 B;  1MFW A;  4NAM A;  3ETR A;  2DYM A;  4DXA B;  1RRB A;  1R4M B;  2ZZP B;  2N0S B;  2DBY A;  2K22 A;  1WJU A;  1L6U A;  3N9Y C;  2J42 A;  2RR9 A;  1WZ3 A;  3MHS D;  3V61 A;  4FBJ B;  2DZM A;  1TGZ B;  3AEE B;  5D6J B;  2FCM A;  1F0Z A;  3RYT A;  3UIP B;  1N5W A;  1HXY D;  2K5P A;  2LVQ A;  1YX6 B;  3VXW A;  4K3C A;  5T8I A;  1CJE A;  2XK5 A;  3GS2 A;  3L16 A;  2KMC A;  3O65 B;  4BKG A;  3Q3J A;  3PRE A;  1IBX B;  2G3Q B;  3DVG Y;  1NBF C;  1TJE A;  2DZJ A;  1VDV A;  4MGK E;  2O6V D;  2QDF A;  3GB1 A;  4TUU A;  1K51 A;  1EWC A;  3ZQ4 A;  1KFY B;  3HM6 X;  1UD7 A;  4ARI A;  1WE7 A;  3IAS 1;  3T3N A;  1C9F A;  3D32 A;  1I42 A;  3ZW3 A;  3IG3 A;  2K6D B;  3Q6B A;  2DLB A;  2O2V A;  2DWQ A;  2UWQ A;  2EKE C;  4USA A;  1ZE3 D;  2LGY A;  1XF5 L;  2FCQ A;  4PYZ A;  3PGE A;  4F8C B;  5FR3 A;  3BYT B;  5C23 A;  3VTW A;  2C5L C;  5D3D A;  2AL6 A;  1LXD A;  2DX5 B;  5HFY A;  2D5G A;  3HM3 A;  3P4S B;  2GBK A;  2L0T A;  3EEC A;  4S0R A;  2RPV A;  4FAD A;  1EU3 A;  4IM0 A;  1C4C A;  2Y5B B;  3BK1 A;  2PJH A;  4IM2 A;  2BGF A;  4BAX A;  3DVN U;  2KTR A;  1D3Z A;  3LXF A;  1XLP A;  1XD3 B;  4EZK A;  2YEP B;  1JWA D;  1WXQ A;  1JWS D;  4FXC A;  4P1B C;  4MDK E;  1EF5 A;  1UGM A;  1ZOY B;  4E3C A;  2KJH B;  1XLQ A;  2H88 B;  2WS3 B;  3U4E G;  2FCN A;  2B3A A;  5FK9 C;  2L83 A;  2W82 A;  2MBB B;  4W9D A;  1D5M C;  3N1X C;  4HJK A;  4DDG D;  1DOI A;  3L08 A;  2OJR A;  4ZHO A;  2QCZ A;  3SHQ A;  4A55 A;  2CJN A;  1ZDX A;  3AN1 A;  1E90 A;  3WAL A;  1YQ4 B;  1ZW7 A;  4ASW C;  3WAN A;  3TEW A;  3DBL B;  2LFI A;  1WX9 A;  1NVI D;  1JQ4 A;  2KMA A;  1H4R A;  2FUG 1;  2MSE D;  3AU5 A;  3APD A;  4I6P A;  4WJO A;  1KH0 A;  1WXM A;  4LJO B;  2PVG C;  1WXV A;  4MM3 A;  1V6E A;  2KWC A;  5EE0 A;  4YL8 A;  2N1W A;  3PLV A;  2WDT B;  4LNK A;  1ET9 A;  5C2T B;  4JIO U;  1QOF A;  1WWT A;  4P7I A;  5FR6 A;  2MCN B;  1OGW A;  3R7Q A;  3V6E B;  2MBH A;  1YQ3 B;  1T6B X;  3RMK C;  4WWP A;  3KUC B;  3MJW A;  2MWS B;  3HIZ A;  3X23 A;  5CHW A;  1YD8 U;  2JWU A;  2BYV E;  1PUT A;  2CU3 A;  2LXA A;  3B2F A;  1KM7 A;  1PFD A;  3DHH C;  4MSM B;  4AP4 C;  2KDF B;  1JWM D;  1WF9 A;  1Z2M A;  2HD5 B;  5G5G A;  4JPS A;  2MX2 A;  3FC4 A;  1MVK A;  4IWO A;  1SSN A;  2L0F A;  4RM9 A;  1E8W A;  3KH0 A;  2EMS A;  5JHB A;  5BYQ A;  3QC8 B;  2AYO B;  1E7V A;  1V5T A;  3SU8 X;  1Z5S B;  2XK5 B;  1FO4 A;  2KVZ A;  4G50 A;  1CK1 A;  3VFK A;  3Q3N C;  3Q3M C;  2KC1 A;  1AWD A;  4XWT A;  4DQO C;  2BF8 B;  3RNA C;  3GE8 C;  3ECI A;  4C00 A;  2MRP A;  2GBR A;  2LD9 A;  2PE9 A;  1NI3 A;  4K7S A;  4B0M A;  1DOY A;  2O2V B;  3RD2 A;  4WH4 A;  2PE6 B;  3MHZ A;  1FFU A;  3W9C B;  4RF0 A;  4BKT A;  3AE1 B;  4ANV A;  4LNF A;  3UI3 A;  4M8M A;  2J52 A;  1VR9 A;  2XN9 C;  2LXC A;  1IUE A;  4ZYS A;  3DHG C;  4W9E A;  3SFE B;  4OZC A;  2RD0 A;  1SE4 A;  1XCT L;  1WZ0 A;  1EU4 A;  3TSS A;  4ZYN A;  2KTR B;  4RGN A;  4TQ0 A;  4X57 B;  5TR5 A;  4FHK A;  4N59 A;  3UF8 A;  2ZW0 A;  1PGX A;  1OTR B;  5AEK B;  2KQ4 X;  3VRB B;  3H7S A;  1TKG A;  5BMH A;  2GI9 A;  1AW7 A;  3OWE B;  5AUI A;  1K53 A;  4ICV A;  2R2Q A;  2CKH B;  1WGK A;  4P16 A;  1WGD A;  3RNG C;  5CHF A;  2I1J A;  1V97 A;  2NR2 A;  4I6L B;  1SEB D;  3HK0 A;  1WY8 A;  1SE9 A;  4YSZ B;  2QSD A;  2LVO A;  3ZYY X;  2BYT A;  4PS3 A;  1HQR D;  4XZ4 A;  3DBR I;  4DWF A;  4KGS A;  5BYR A;  4HPL B;  3DHI C;  3BY4 B;  2PEA A;  1EUV B;  2J0J A;  4URK A;  2Z0D B;  4WIP A;  1L2N A;  2PPH A;  1ZGU B;  2WGS A;  1C76 A;  3K9O B;  1NDD A;  3CF6 E;  2WDR B;  4TV3 A;  5BO4 B;  4F1S A;  2WXN A;  4AUQ C;  4JWU C;  4EZL A;  2KC2 A;  2W54 A;  4HLE A;  1UWX A;  1I7H A;  3QAR A;  2BWF A;  4LK0 M;  1FM0 D;  2IND C;  1BXT A;  1TTN A;  1I4P A;  2G4D B;  1IP9 A;  2ZJD A;  2JYE A;  3OJ4 B;  2JRH A;  4MM3 B;  4EOY A;  2JZZ A;  4DHZ B;  5JH5 C;  4GU2 A;  3KWL A;  2RMM A;  3N1Z C;  4N9F 4;  4REZ A;  4A90 A;  1E0Z A;  3NVW A;  2H89 B;  1JRP A;  4WAA A;  3AEG B;  4DHJ D;  4HVB A;  4AJY B;  1E8X A;  3V3X A;  3DWM A;  2IY1 B;  3H8H A;  1WJ4 A;  3HVZ A;  2KFK A;  4ZRI A;  3TCA A;  3WIM A;  1ZUD 2;  2M4N A;  3APC A;  3I9V 1;  4GB9 A;  1E10 A;  5GXG B;  5J18 A;  4YXD B;  2SAK A;  3EHV A;  2C60 A;  1FRD A;  3A33 B;  3LB8 C;  1XQQ A;  3R7R A;  3H7P A;  2YLM A;  4MEM A;  5E6J A;  3PRZ A;  3BWU D;  4NJ6 A;  2BS4 B;  2KMM A;  1RAX A;  3PZ7 A;  4C56 C;  1YJ1 A;  1HZ6 A;  3RNC C;  2IGG A;  1FFV A;  5E6P A;  4DBG A;  2N7J A;  3DQV A;  5EE3 A;  5KHQ A;  3AXC A;  2CU1 A;  5LNK 1;  4ITK A;  3M63 B;  3ZXV A;  3VH3 B;  2K25 A;  1STE A;  2ONQ A;  2KAN A;  2KDE B;  3MTN B;  3R3M A;  3DPD A;  4ICU A;  4PS8 A;  3NOB A;  4N6E B;  1PDX A;  1E6E B;  1WXS A;  4GXB A;  1WRI A;  4A3O A;  5G5H A;  5AZG A;  2D10 A;  2V4I B;  3L54 A;  1FXI A;  3ZKJ C;  4OVU A;  5KHO A;  2MH7 A;  3PRM B;  2DEN B;  2WXM A;  5H92 C;  2IO0 B;  1RM6 C;  4F7Z A;  2GRI A;  4OZA A;  3RI7 C;  2K0P A;  2FIF A;  2MEK A;  2B76 B;  4IG7 B;  5L83 A;  2WHI A;  3DDC B;  1QT9 A;  1JWU D;  2C9W B;  4AOF A;  3AE9 B;  3NZ3 A;  4RGM A;  1GC7 A;  3ZXR A;  1AAR A;  3FIL A;  2HJ1 A;  3PHW B;  1J7B A;  3TBL D;  2WU2 B;  2KX0 A;  3APF A;  3NUH B;  3M62 B;  5TSS A;  2BW2 A;  3ALB A;  2K1F A;  4BBN C;  4W9H A;  2BB6 A;  2GMI C;  1R7S A;  3ZNZ B;  1WXA A;  5JXV A;  5E6N A;  2E3T A;  2D3C A;  5G55 A;  2PW9 A;  3QIJ A;  4ZDV A;  3L17 A;  5J2R A;  3P63 A;  4MGZ E;  1LQB A;  2JF5 A;  3AEF B;  1FRR A;  3P2B A;  4GDK A;  1DYQ A;  4WJP A;  1PGA A;  2ZPN A;  1B9R A;  4KKJ A;  1R4N I;  4DXG A;  1SE3 A;  2NS5 A;  4I6N B;  2KD0 A;  4KZ0 A;  2MLB A;  2JX5 A;  2A4Z A;  2BYF A;  2GB1 A;  4G0N B;  1VRA B;  5D94 A;  3URY A;  2D2Q A;  3T8M A;  3TIX A;  3WAM A;  4GGQ A;  3RNE C;  3ZDM C;  3AEB B;  3GZN B;  4CHK A;  1I35 A;  2LHD A;  1BUI C;  1JW9 D;  3OAW A;  4WQO B;  4LJP B;  3QK0 A;  4OHJ A;  3JVZ X;  4HK2 A;  2LGS A;  5HI1 A;  3H1U A;  3RFZ B;  1L0Y B;  3ABV B;  3BVG A;  1TS2 A;  4JGH B;  2Z0E B;  3ZTC A;  4CQN A;  1TKY A;  2PMV A;  3T9L A;  2V9H A;  1IYF A;  3PHX B;  1L4Z B;  1R4M I;  2KHW B;  4C80 A;  2FE8 A;  4KV2 A;  3S2A A;  2C7M B;  3Q2A C;  4C7Z A;  4W9K A;  5DPR A;  2M8S A;  3RUI B;  1S1Q B;  2WX0 A;  1FPY A;  4US9 A;  4TSS A;  4WJN A;  2R61 A;  3AED B;  1LGR A;  4JLC A;  2KFK B;  1T0R C;  3GP7 A;  4HDQ A;  4YTN B;  1RFK A;  3SEB A;  1IGC A;  4BOZ B;  4NQK E;  5JZE B;  1WM2 A;  2PVO D;  4TKN A;  2Y3A A;  1JWB D;  3A4S C;  1V1P A;  3H7P B;  1I4H A;  3IFW B;  2TSS A;  1WMH B;  3ZNG C;  1MG4 A;  4K3B A;  2WXL A;  1YQB A;  2KQ7 A;  4UDU C;  3OLM D;  3AE8 B;  1LFD A;  3IVF A;  2CHW A;  3AV8 A;  1TYG B;  5BMG A;  4G11 A;  3AU4 A;  4W9C A;  4KGT A;  4ANW A;  1N61 A;  5HG2 A;  2W9N A;  1UBI A;  3QCA A;  5IOI A;  4XDC A;  4RFB A;  3O13 A;  2E6X A;  4IKG A;  1C77 A;  2JU6 X;  4RGT A;  3KUZ A;  1YX5 B;  5IAA C;  1YN5 A;  3UIN B;  3H6N A;  3L13 A;  4MH0 E;  4D2K A;  3E9S A;  2N9X A;  4TQ1 A;  2QHO A;  3ZDT A;  5IKC M;  2YVC A;  4R3D A;  3PTF C;  3OG5 A;  3IT6 B;  2BVC A;  2WXR A;  2MBO A;  3A4R A;  1FNV A;  2KN4 A;  1ESF A;  4J6I A;  4MAC A;  3DBH B;  3UIO B;  1A70 A;  1VZ7 A;  3DBS A;  3QJZ A;  2YEP F;  2IO2 B;  2IZV B;  3FIL B;  3VH4 B;  4NAW A;  4ACF A;  4M0W B;  2IY0 B;  3MC9 A;  2GBJ A;  5C3J B;  4LNN A;  2D3G A;  4LCD E;  4GSW A;  1ACC A;  2N9E B;  4KX6 B;  5JHA A;  2NTS A;  4PYU A;  2MJE A;  2VZK B;  3HRD D;  4HCP B;  5IN7 A;  1RFA A;  2L52 A;  2W3S A;  2EMT A;  1HEZ E;  2ASQ A;  2OHF A;  4GDK B;  3RUL A;  3CIR B;  3ONS A;  1M4V A;  3DBL I;  1J7A A;  4EZJ A;  1CMX B;  3C0R B;  3UQB A;  2ZPY A;  1TT5 B;  3W2D A;  4HEA 1;  4HXD A;  1HTO A;  2INC C;  1I4Q A;  4LDT B;  1SIJ A;  2L8J A;  3V6C B;  2KWU B;  1MHH E;  3IXS A;  2FCS A;  4FHJ A;  4GMV A;  1ROE A;  2NCN A;  2N9L A;  3EC8 A;  2KQS A;  1TKE A;  2KYW A;  2G9H D;  3R2T A;  3E56 A;  1AYF A;  4E71 A;  1OQR A;  3QQ8 B;  1K8R B;  4B95 A;  2A5U A;  1EWY C;  2L1A A;  5AZH A;  3U30 A;  4KKI A;  2BTE A;  4ZOH C;  5IP4 D;  4EFO A;  1GOZ A;  2XNA C;  4NPN A;  1KOT A;  2UYZ B;  2WXQ A;  2N9K A;  2I2Y A;  2L05 A;  3B1L X;  4KDL B;  2VH2 A;  1EO6 A;  1QOA A;  2VRR B;  2ZW1 A;  3M3J A;  3I5J C;  1F1H A;  1QQR A;  2JWZ A;  3BK2 A;  1TY0 A;  4LNI A;  4S17 A;  2WQY B;  1VJK A;  3N20 C;  2J4X A;  4BVU C;  2MQJ A;  3V05 A;  1TBE A;  1P98 A;  1TY2 A;  2J53 A;  3LYY A;  2KDB A;  1FEH A;  4MGY E;  5C1Z A;  3GE3 C;  5LLI A;  3ZJT A; 
#chains in the Genus database with same CATH homology
 4MEM A;  3TJP A;  3PRZ A;  3UIP B;  5DCN A;  3NY5 A;  4NJ6 A;  3Q3F A;  2LVQ A;  2IO1 B;  1YX6 B;  3VXW A;  3RT3 B;  1V80 A;  3DOW A;  2LWP A;  1RAX A;  3LDZ E;  1V5O A;  4A20 A;  2XK5 A;  2ZCB A;  4K81 A;  1YJ1 A;  3KYC D;  3L16 A;  2KMC A;  5E6P A;  3VAW A;  4DBG A;  3W1Y A;  3O65 B;  1A5R A;  2JT4 B;  4BKG A;  3CST A;  3DQV A;  2WYQ A;  3Q3J A;  3PRE A;  5KHQ A;  3AXC A;  1V81 A;  2CU1 A;  4FJV B;  4GN1 A;  3ZNH B;  4BOS C;  2G3Q B;  3DVG Y;  1NBF C;  2L3Z A;  2DZJ A;  4MGK E;  3GOE A;  2O6V D;  3M63 B;  1P9D U;  2LGD A;  3ZRC A;  3VH3 B;  4TUU A;  2K25 A;  2V3S A;  3HM6 X;  1UD7 A;  5CX3 A;  1WE7 A;  2BPS A;  3QHT A;  2NPT A;  5LXI B;  2KAN A;  4IW0 A;  2NBV B;  3JSV B;  2KDE B;  3MTN B;  3D32 A;  3R3M A;  2MP2 B;  1JRU A;  1WRD B;  3DPD A;  3WAO A;  1I42 A;  4ICU A;  3ZW3 A;  3IG3 A;  2WWZ A;  2K6D B;  2O2V A;  2LRW A;  4PS8 A;  3NOB A;  2UWQ A;  2EKE C;  1V9J A;  2G4S A;  2ZNV B;  1WXS A;  2L7R A;  4GXB A;  1U4A A;  4A3O A;  1V49 A;  2LGY A;  5AZG A;  2D10 A;  3ZRF A;  2FCQ A;  4PYZ A;  3PGE A;  3L54 A;  4FJZ A;  2ZVO A;  4F8C B;  3ZKJ C;  4OVU A;  5KHO A;  2CHZ A;  2G45 B;  1WYW B;  4ZRJ A;  5C23 A;  3VTW A;  4IWP A;  2RPQ A;  2C5L C;  3DBH I;  4KIK A;  2AL6 A;  2DEN B;  3PRM B;  3QA8 A;  1LXD A;  4JQW C;  3H9D A;  2DX5 B;  3QX1 A;  1GNU A;  1WGG A;  2JUO A;  3ENE A;  1WIA A;  2IO0 B;  4F7Z A;  1E7U A;  2MA9 B;  1G6J A;  3HM3 A;  4NY0 A;  2FIF A;  2GBK A;  2L0T A;  3CSF A;  3EEC A;  2KDI A;  4FAD A;  4IG7 B;  4IM0 A;  2Y5B B;  2PJH A;  4IM2 A;  5L83 A;  3DDC B;  2C9W B;  4WWO A;  3PS6 A;  4AOF A;  2BGF A;  2LZ6 A;  1GC7 A;  2DYB A;  3RCZ A;  3DVN U;  2HTH A;  2FAZ A;  2KTR A;  4MGI E;  3KUD B;  5J17 A;  2M17 A;  4KZC A;  3SD5 A;  1D3Z A;  1AAR A;  1WH3 A;  1V86 A;  3PHW B;  1XD3 B;  3PZD A;  3TBL D;  3APF A;  1EF1 A;  2KX0 A;  4EZK A;  3M62 B;  3A9J A;  1OEY A;  4K7W A;  1WR6 E;  4BKS A;  4DK5 A;  1KLV A;  4FUL A;  4IUM B;  3ALB A;  2KNB A;  2NBU A;  4DDI D;  2N7E A;  2K1F A;  4BBN C;  4W9H A;  1H8C A;  4NAW B;  5L95 C;  4MDK E;  1EF5 A;  1UGM A;  2GMI C;  3ZNZ B;  1WXA A;  2LGX A;  5E6N A;  4E3C A;  2KJH B;  1V2Y A;  5G55 A;  3KW5 B;  1WE6 A;  3QIJ A;  2NVU I;  3WAP A;  3L17 A;  2KK8 A;  3VTU A;  4ZDV A;  5J2R A;  3PT2 B;  2N7D A;  3KVF B;  2D11 A;  2FCN A;  4W9L A;  2B3A A;  3ZUN A;  2JVC A;  1LQB A;  2REX A;  4MGZ E;  2JF5 A;  3ZTD A;  2DAF A;  3P2B A;  4GDK A;  2N4F A;  4WJP A;  4MJS A;  2ZPN A;  2MBB B;  4W9D A;  1R4N I;  4HJK A;  2K8B A;  2NS5 A;  3JW0 X;  1C1Y B;  4FN2 A;  4I6N B;  4DDG D;  2KD0 A;  2I1K A;  4KZ0 A;  2MLB A;  2OJR A;  3A1Q A;  3B0A A;  3L08 A;  2A4Z A;  2BYF A;  4G0N B;  4KSK C;  3SHQ A;  5D94 A;  1SIF A;  2D2Q A;  4FA6 A;  3T8M A;  4MSQ B;  2HJ8 A;  3TIX A;  3WAM A;  4GGQ A;  5G2N A;  2L00 B;  4AWJ A;  3ZDM C;  2DZK A;  2ZEQ A;  4CHK A;  4DHZ E;  4NJ7 A;  1I35 A;  1E90 A;  1WMH A;  2JXX A;  4II2 B;  4JL9 A;  3WAL A;  5LXH A;  3ZVV A;  1ZW7 A;  4ASW C;  3WAN A;  3OAW A;  4HWI B;  4M8N A;  4WQO B;  4LJP B;  3QK0 A;  3JYU A;  3JVZ X;  4KSL C;  4HPM B;  3KYD D;  2DHZ A;  4HK2 A;  5D7G A;  3HHM A;  1WX9 A;  2KZR A;  3N30 A;  2KMA A;  1H4R A;  3H1U A;  2MSE D;  3PVL A;  1BT0 A;  3AU5 A;  3APD A;  4I6P A;  4WJO A;  2AWT A;  2O6V B;  2Z0E B;  4JGH B;  1WXM A;  3ZTC A;  4LJO B;  4CO7 A;  1WXV A;  3AUL A;  4BKS D;  3V60 A;  3UGB B;  4MM3 A;  4IC7 B;  1V6E A;  2KWC A;  2L76 A;  4W9I A;  3TL5 A;  1ISN A;  2KJR A;  1RLF A;  4YL8 A;  4E74 A;  4HCN B;  3T9L A;  2N1W A;  5IA7 A;  1IYF A;  2KX3 A;  3PHX B;  1J19 A;  3PLV A;  2WDT B;  1R4M I;  2KHW B;  4JIO U;  1LM8 B;  4KV2 A;  3S2A A;  3DCG A;  2C7M B;  4EUT A;  4GDL B;  2KO3 A;  4W9J A;  4W9K A;  1WGH A;  4P7I A;  4XC2 A;  5DPR A;  5FR6 A;  2MCN B;  1OGW A;  3R7Q A;  2M8S A;  3V6E B;  2MBH A;  5E6O A;  1WX8 A;  3U7D A;  3L0W B;  1GUA B;  4WWP A;  3RUI B;  1S1Q B;  2WX0 A;  3KUC B;  3R7R A;  3MJW A;  4WJN A;  2MWS B;  2OOB B;  3HIZ A;  5CHW A;  3X23 A;  1YD8 U;  3BIN A;  3N32 A;  2BYV E;  5DPW A;  2K8C A;  2LXA A;  4JLC A;  2KFK B;  1GG3 A;  1KM7 A;  4HDQ A;  5AZF A;  4MSM B;  2LI5 A;  4BOZ B;  2KJ6 A;  4AP4 C;  2KDF B;  1P3Q U;  4NQK E;  1WF9 A;  3IBE A;  1WX7 A;  5JZE B;  1TZ1 A;  1WM2 A;  4WJQ A;  2HE7 A;  4TKN A;  1Z2M A;  1MG8 A;  2HD5 B;  5D2M B;  2C7N B;  1GC6 A;  3A4S C;  3VQI A;  2IYD B;  1PQS A;  2M0X A;  2AL3 A;  2MX2 A;  1T0Y A;  4IWO A;  3RZF A;  2L0F A;  3H7P B;  2V4L A;  4RM9 A;  1E8W A;  5HKH A;  3UQA A;  2LUE A;  3KH0 A;  2EMS A;  2RSU A;  3IFW B;  5JHB A;  1WMH B;  3ZNG C;  1C3T A;  3QC8 B;  2AYO B;  1E7V A;  1V5T A;  2N9P C;  3SU8 X;  1Z5S B;  3N3K B;  2XK5 B;  1YQB A;  2KQ7 A;  3OLM D;  3B08 A;  1UH6 A;  4G50 A;  3VFK A;  1LFD A;  3IVF A;  1E8Y A;  2CHW A;  2KC1 A;  1WFY A;  2DAJ A;  3IHP C;  5CTR C;  2CR5 A;  2IO3 B;  4G11 A;  2BF8 B;  2Z59 B;  3AU4 A;  2KVR A;  4W9C A;  4ANW A;  3JSV A;  3ZLZ A;  3ECI A;  2MP2 A;  2KWV B;  2W9N A;  2MRP A;  1UBI A;  3QCA A;  2GBR A;  4GOC A;  5EDS A;  2BWE S;  3RZW C;  2LD9 A;  2NPT B;  2PE9 A;  3VDZ A;  2M1M A;  2JRI B;  2KFJ A;  3NZS A;  4K7S A;  2O2V B;  3RD2 A;  3ML8 A;  4RMA A;  3KUZ A;  1YX5 B;  2PE6 B;  5IAA C;  3A9K A;  3UIN B;  3H6N A;  3L13 A;  3X0W A;  4FJY A;  4MH0 E;  1Q0W B;  4BKT A;  2JPH A;  1IPG A;  4ANV A;  4IWQ A;  1X1M A;  2N9X A;  2JY6 A;  4TQ1 A;  2QHO A;  3ZDT A;  4KIK B;  2KKC A;  4NNJ B;  3SDL C;  2YVC A;  4M8M A;  4G3X B;  3CMM B;  3WA0 A;  3PTF C;  1L7Y A;  4B9K A;  2GOW A;  3AI5 A;  2LXC A;  3NS8 A;  2IBI B;  5DPS A;  2MBO A;  3A4R A;  4W9E A;  4J6I A;  2V1Y A;  4K7U A;  2RD0 A;  3UIO B;  3M95 A;  2XBB C;  4ANX A;  3DBS A;  1WZ0 A;  1KJT A;  2LAS A;  3PV1 A;  1VD2 A;  1Y8R C;  3QJZ A;  1S3S G;  2IO2 B;  3PRP B;  4ZYN A;  1FXT B;  2KTR B;  4TQ0 A;  2KTF A;  4X57 B;  5TR5 A;  4WWN A;  2IZV B;  4FHK A;  2J0M A;  3VUX A;  3UF8 A;  3VH4 B;  4NAW A;  4M0W B;  1OTR B;  2IY0 B;  5AEK B;  2GBJ A;  2J0K A;  3A9J B;  4EKU A;  2D3G A;  3H7S A;  2DZI A;  2GBM A;  1XT9 B;  4LCD E;  1J0G A;  4GSW A;  2N9E B;  4CYE A;  2R2O A;  1E5W A;  1WM3 A;  5JHA A;  4PYU A;  1Q5W B;  3PLU A;  3DVN V;  4ICV A;  2R2Q A;  4HCP B;  2CKH B;  3ZO5 B;  2FNJ B;  3K9P B;  3QWZ B;  2NBW B;  1WGD A;  1RFA A;  2BYE A;  5CHF A;  2K6Q A;  2I1J A;  2NR2 A;  2EMT A;  4I6L B;  2ASQ A;  3HK0 A;  5GMV A;  1WY8 A;  1SE9 A;  3GZN I;  4GDK B;  1ZKH A;  1SGH A;  2LVO A;  3L10 B;  3RUL A;  2KOX A;  2KLG A;  4MJS B;  4MEL A;  3W1S C;  2LJ5 A;  4FLH A;  1M94 A;  3ONS A;  3QAQ A;  4PS3 A;  2RGF A;  4XZ4 A;  1Q1O A;  4HDO A;  3DBL I;  5DPT A;  3DBR I;  2FID A;  3A1Q B;  1OQY A;  4HPL B;  4OVV A;  4W9G A;  4DWF A;  1UBQ A;  1OEY J;  3BY4 B;  4EZJ A;  1GJZ A;  1QZE A;  4IM3 A;  4ZRK A;  2PEA A;  1CMX B;  4B6W A;  3A9K B;  1EUV B;  4K1R B;  4GIV A;  3C0R B;  5CHV C;  2ZPY A;  2FUH B;  2GBN A;  2J0J A;  3UQB A;  4LDT D;  4HXD A;  2AEH A;  4URK A;  3I3T B;  2Z0D B;  2J7Q B;  1L2N A;  4LDT B;  2CS4 A;  1ZGU B;  2PPH A;  3K9O B;  2L8J A;  1NDD A;  4RM8 A;  2ZNV C;  3VTV A;  3V6C B;  3ZIM A;  3CF6 E;  4TV3 A;  2KWU B;  2KLC A;  5BO4 B;  4F1S A;  3VVW B;  4AUQ C;  1UZX B;  4KDI C;  4EZL A;  2KC2 A;  3NHE B;  4HLE A;  2FCS A;  4FHJ A;  4GMV A;  2C7H A;  2BKR B;  2NCN A;  3QAR A;  2BWF A;  3W1S A;  2D07 B;  1P1A A;  4ANU A;  2MW5 A;  3EC8 A;  3V62 A;  4KVG B;  2KQS A;  1WJ6 A;  1F9J A;  2O6V A;  4EEW A;  1WR1 A;  3DVG X;  2N1V A;  3PSE B;  1WGR A;  1TTN A;  2G4D B;  4E71 A;  3QQ8 B;  2KN5 A;  1IP9 A;  1K8R B;  3VUY A;  2ZJD A;  2JZ3 B;  3LJ3 A;  4B95 A;  1HE8 A;  3OJ4 B;  4A3P A;  2JRH A;  2A5U A;  2BKF A;  2K8H A;  4EOY A;  2JZZ A;  3VHT C;  4DHZ B;  1WI0 A;  4BFR A;  5AZH A;  2DYO A;  3EFU A;  4GU2 A;  3U30 A;  5JH5 C;  2MBE A;  2LVP A;  4N9F 4;  2K39 A;  3NZU A;  1WJN A;  4GDL A;  4EFO A;  4NPN A;  1KOT A;  2ZCC A;  2XEW A;  2UYZ B;  1UEL A;  3TMP B;  4NQL B;  3ZNI D;  1WGY A;  2L05 A;  4XX5 A;  2ZVN A;  4WAA A;  3B1L X;  4DHJ D;  1P0R A;  1YIW A;  4KDL B;  4AJY B;  4HVB A;  1E8X A;  3OJ3 A;  2CHX A;  1EO6 A;  4W9F A;  4DHJ B;  2MBQ A;  2VRR B;  3RYT A;  3VUW A;  1J8C A;  2IY1 B;  2LRU A;  3M3J A;  1WJ4 A;  2JWZ A;  1NI2 A;  2KFK A;  1E8Z A;  2DYM A;  4ZRI A;  3TCA A;  3WIM A;  3U8Z A;  4DXA B;  1RRB A;  3R66 C;  4BBN F;  2M4N A;  2ZZP B;  3APC A;  1VCB A;  3ML9 A;  4PS7 A;  4BVU C;  2MQJ A;  1TBE A;  1WJU A;  1P98 A;  4GB9 A;  2RR9 A;  4AJW A;  3PPA A;  5J18 A;  1WZ3 A;  2KDB A;  2WX1 A;  3EHV A;  3MHS D;  2KXJ A;  2C60 A;  2DZM A;  3V61 A;  4FBJ B;  1TGZ B;  4MGY E;  3A33 B;  4II3 B;  5D6J B;  5C1Z A;  2FCM A;  1XQQ A;  5LLI A;  3H7P A;  2YLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...