4ICGC

N-terminal dimerization domain of h-ns in complex with hha (salmonella typhimurium)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
LTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding protein H-NS
publication title Structural Insights into the Regulation of Foreign Genes in Salmonella by the Hha/H-NS Complex.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. lt2
molecule tags Dna binding protein
total genus 14
structure length 67
sequence length 67
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF05321 HHA Haemolysin expression modulating protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.40 Mainly Alpha Up-down Bundle Monooxygenase HHA 4icgC00
2MW2A 2JQTA 1JW2A 2K5SA 4ICGC
chains in the Genus database with same CATH superfamily
4J2DA 1FZ9E 3NHGA 3SNNA 3NCIA 4FJ5A 3HGKE 4ICGC 3SCXA 4JS4A 1FZ0E 2HD0A 3N1BA 4X5NA 4DTSA 4M3XA 4AI6A 1MMOG 3SQ0A 2VJ4A 3SQ2A 4DTPA 3CQ8A 2VIXA 2RCUA 3RMAA 4FJGA 1FYZE 1FZIE 1XVCE 4I9QA 2FW3A 3CFRA 1XVFE 3CFPA 3LZJA 4HCBA 4RL5A 2JHAA 4M42A 4FJJA 1P22A 2JH9A 3NGIA 3TAGA 2OZMA 4M3YA 1XL3C 4FJ9A 4I6JB 4E4BA 3HP9A 1FPOA 3CFOA 4EYWA 1IG9A 2MW2A 5H37A 2OVRB 3V7DB 1XVEE 2JHCA 3C6NB 4DU1A 4JRQA 4FJ8A 2E32A 4DU4A 4DU3A 2FYOA 4FVMA 1XU5E 2YB5A 3C94A 3HL8A 4M3ZA 4FK0A 3QEPA 4HCCA 4AKGA 3QEXA 4J2EA 3TAFA 1XMHE 2JH8A 1XVGE 4DTNA 3S9HA 2B7MA 3TL8B 1CLQA 1MHYG 4DTMA 1XU3E 2OZSA 4M45A 1IH7A 3OGMB 4FJLA 1FZ6E 2P1PB 4DTRA 2VJ5A 3KD5E 4FJXA 4M3TA 3K2OA 3J2PA 4DTXA 4IT5A 4ADNA 5IZ7A 3QETA 2H4TA 3RMDA 2OYQA 4FJ7A 4DTJA 4FJNA 4KI4A 2JPNA 4E3SA 3RMBA 2P5OA 3QESA 3NAEA 1LDKE 3E4YA 4X5MA 3MKSB 1FZHE 1FZ8E 4QNCA 3UO3A 3LDBA 4EP9A 3LZIA 1Q9XA 3SPZA 4FJHA 4DTUA 3SQ1A 4M3RA 4ADOA 1FZ5E 4EPHA 2OVQB 2RKHA 2P1QB 3SJJA 4J2BA 1MHZG 4JRPA 4KHWA 4KHNA 4FK2A 1XMFE 2JHPA 3RMCA 1XVBE 1WAJA 2QXFA 4RG8A 3SPYA 3LD8A 3RWUA 1XVDE 2LF6A 2P5GA 4M3UA 2DY4A 1FZ1E 3E4WA 3QERA 4KHSA 3QEWA 3N1EA 4QNDA 3NE6A 2PFVA 3SUQA 1FZ7E 4RNGA 4M41A 1NEXB 3C95A 3WSOA 4KHUA 2B1EA 3UIQA 3OGKB 3QEVA 2B8IA 2JQTA 4B08A 2LF3A 4GAMC 3QNNA 3J27A 1FZ4E 3L1NA 4KHYA 1XMGE 3TABA 3SUOA 3SI6A 3QEIA 4FJIA 4KI6A 4FK4A 2P1MB 2MZWB 1JW2A 4DTOA 2P1NB 3NDKA 2DTUA 3TAEA 3LDSA 1FS1A 5IBKB 4J2AA 4JS5A 4KHQA 3L8BA 2PFTA 3HGLA 4FJMA 3C6PB 2K5SA 1WAFA 5IREA 2OVPB 1FZ3E 2E31A 3UO2A 3SVIA 2ATQA 3QNOA 3C6OB 3OGLB 2DEBA 4M3WA 3BVOA 3L0MA 3TJYA 1Q9YA 4AKIA 1FXXA 4AKHA 2MMBA 4I9LA 3L2OB 1FZ2E 3SUNA 1N1CA 3SQ4A 4FJKA 1MTYG 3KD1E 2P1OB 3SUPA
chains in the Genus database with same CATH topology
2MW2A 2JQTA 1JW2A 2K5SA 4ICGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MW2 A;  2JQT A;  1JW2 A;  2K5S A;  4ICG C; 
#chains in the Genus database with same CATH topology
 4J2D A;  1FZ9 E;  3NHG A;  3SNN A;  3NCI A;  4FJ5 A;  3HGK E;  4ICG C;  3SCX A;  4JS4 A;  1FZ0 E;  2HD0 A;  3N1B A;  4X5N A;  4DTS A;  4M3X A;  4AI6 A;  1MMO G;  3SQ0 A;  2VJ4 A;  3SQ2 A;  4DTP A;  3CQ8 A;  2VIX A;  2RCU A;  3RMA A;  4FJG A;  1FYZ E;  1FZI E;  1XVC E;  4I9Q A;  2FW3 A;  3CFR A;  1XVF E;  3CFP A;  3LZJ A;  4HCB A;  4RL5 A;  2JHA A;  4M42 A;  4FJJ A;  1P22 A;  2JH9 A;  3NGI A;  3TAG A;  2OZM A;  4M3Y A;  1XL3 C;  4FJ9 A;  4I6J B;  4E4B A;  3HP9 A;  1FPO A;  3CFO A;  4EYW A;  1IG9 A;  2MW2 A;  5H37 A;  2OVR B;  3V7D B;  1XVE E;  2JHC A;  3C6N B;  4DU1 A;  4JRQ A;  4FJ8 A;  2E32 A;  4DU4 A;  4DU3 A;  2FYO A;  4FVM A;  1XU5 E;  2YB5 A;  3C94 A;  3HL8 A;  4M3Z A;  4FK0 A;  3QEP A;  4HCC A;  4AKG A;  3QEX A;  4J2E A;  3TAF A;  1XMH E;  2JH8 A;  1XVG E;  4DTN A;  3S9H A;  2B7M A;  3TL8 B;  1CLQ A;  1MHY G;  4DTM A;  1XU3 E;  2OZS A;  4M45 A;  1IH7 A;  3OGM B;  4FJL A;  1FZ6 E;  2P1P B;  4DTR A;  2VJ5 A;  3KD5 E;  4FJX A;  4M3T A;  3K2O A;  3J2P A;  4DTX A;  4IT5 A;  4ADN A;  5IZ7 A;  3QET A;  2H4T A;  3RMD A;  2OYQ A;  4FJ7 A;  4DTJ A;  4FJN A;  4KI4 A;  2JPN A;  4E3S A;  3RMB A;  2P5O A;  3QES A;  3NAE A;  1LDK E;  3E4Y A;  4X5M A;  3MKS B;  1FZH E;  1FZ8 E;  4QNC A;  3UO3 A;  3LDB A;  4EP9 A;  3LZI A;  1Q9X A;  3SPZ A;  4FJH A;  4DTU A;  3SQ1 A;  4M3R A;  4ADO A;  1FZ5 E;  4EPH A;  2OVQ B;  2RKH A;  2P1Q B;  3SJJ A;  4J2B A;  1MHZ G;  4JRP A;  4KHW A;  4KHN A;  4FK2 A;  1XMF E;  2JHP A;  3RMC A;  1XVB E;  1WAJ A;  2QXF A;  4RG8 A;  3SPY A;  3LD8 A;  3RWU A;  1XVD E;  2LF6 A;  2P5G A;  4M3U A;  2DY4 A;  1FZ1 E;  3E4W A;  3QER A;  4KHS A;  3QEW A;  3N1E A;  4QND A;  3NE6 A;  2PFV A;  3SUQ A;  1FZ7 E;  4RNG A;  4M41 A;  1NEX B;  3C95 A;  3WSO A;  4KHU A;  2B1E A;  3UIQ A;  3OGK B;  3QEV A;  2B8I A;  2JQT A;  4B08 A;  2LF3 A;  4GAM C;  3QNN A;  3J27 A;  1FZ4 E;  3L1N A;  4KHY A;  1XMG E;  3TAB A;  3SUO A;  3SI6 A;  3QEI A;  4FJI A;  4KI6 A;  4FK4 A;  2P1M B;  2MZW B;  1JW2 A;  4DTO A;  2P1N B;  3NDK A;  2DTU A;  3TAE A;  3LDS A;  1FS1 A;  5IBK B;  4J2A A;  4JS5 A;  4KHQ A;  3L8B A;  2PFT A;  3HGL A;  4FJM A;  3C6P B;  2K5S A;  1WAF A;  5IRE A;  2OVP B;  1FZ3 E;  2E31 A;  3UO2 A;  3SVI A;  2ATQ A;  3QNO A;  3C6O B;  3OGL B;  2DEB A;  4M3W A;  3BVO A;  3L0M A;  3TJY A;  1Q9Y A;  4AKI A;  1FXX A;  4AKH A;  2MMB A;  4I9L A;  3L2O B;  1FZ2 E;  3SUN A;  1N1C A;  3SQ4 A;  4FJK A;  1MTY G;  3KD1 E;  2P1O B;  3SUP A; 
#chains in the Genus database with same CATH homology
 2MW2 A;  2JQT A;  1JW2 A;  2K5S A;  4ICG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...