4ICGC

N-terminal dimerization domain of h-ns in complex with hha (salmonella typhimurium)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
LTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Regulation of Foreign Genes in Salmonella by the Hha/H-NS Complex.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. lt2
molecule tags Dna binding protein
molecule keywords DNA-binding protein H-NS
total genus 14
structure length 67
sequence length 67
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF05321 HHA Haemolysin expression modulating protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.40 Mainly Alpha Up-down Bundle Monooxygenase HHA 4icgC00
2MW2A 2K5SA 4ICGC 1JW2A 2JQTA
chains in the Genus database with same CATH superfamily
3SUPA 3TABA 4DTXA 1JW2A 3QETA 1XVEE 3NHGA 1MTYG 1FZ6E 2JH9A 1Q9XA 4M3ZA 2P5GA 1IH7A 1XVBE 2P1MB 2MW2A 3RWUA 2H4TA 3SVIA 2FYOA 2PFVA 3RMAA 2JQTA 1FZ5E 3NAEA 1N1CA 2VJ5A 4EYWA 4M3XA 1MHYG 3SPZA 2YB5A 1MHZG 3C6PB 4M45A 3CFPA 4KHNA 1XVGE 1CLQA 3UIQA 3C95A 2P1OB 4DU4A 4I6JB 3QEPA 3SI6A 4RNGA 3SCXA 4JS5A 3SQ1A 1XL3C 3L2OB 3LD8A 3LDSA 1WAJA 3L0MA 3QESA 3L8BA 4HCCA 4KHSA 3SUQA 4M3WA 2RCUA 4I9QA 4JRQA 4DTSA 5IREA 4DU1A 4FJ8A 2K5SA 3CFOA 4X5NA 4DTRA 3SUOA 3E4YA 1FXXA 3UO2A 4JS4A 3K2OA 3SPYA 3NDKA 4ADOA 2OZMA 3LZJA 2MZWB 3RMDA 3N1EA 3NE6A 3QERA 2JHPA 4FK4A 3OGLB 4AKIA 4FJNA 2B8IA 3BVOA 1FZ7E 2P1PB 4QNCA 4M42A 2PFTA 4EPHA 4JRPA 3HP9A 4M3RA 4AKGA 2JH8A 1FZIE 2VIXA 1P22A 4IT5A 1MMOG 1FZ9E 3TAGA 4M3UA 2P1NB 3CQ8A 2E32A 3TJYA 1XU5E 1XVFE 2P1QB 3SJJA 4FJMA 1XU3E 3TAEA 3HGLA 3LDBA 4FJIA 1NEXB 2VJ4A 4FK0A 4KHQA 4J2DA 2E31A 4KHUA 2ATQA 1XMFE 3E4WA 3C6OB 4X5MA 1Q9YA 4FJLA 2OYQA 1FZ0E 2DEBA 3QEXA 4M3YA 2JHAA 3QEIA 5IBKB 3C6NB 2LF3A 4FJ5A 2B1EA 1FZ1E 1WAFA 2OVPB 4KHYA 1LDKE 4DTJA 4FJXA 4HCBA 4J2AA 1FZ3E 3SUNA 3LZIA 3NGIA 3RMBA 4J2EA 4EP9A 1XMHE 4RG8A 3SQ0A 3C94A 2P5OA 3S9HA 1FS1A 2QXFA 4RL5A 3WSOA 1FYZE 3V7DB 3J27A 4DTUA 2DY4A 3KD5E 3J2PA 4FJJA 4ADNA 2LF6A 2OVQB 4M3TA 2JHCA 3OGKB 3NCIA 4FJ9A 4M41A 1FZHE 3SQ4A 2OZSA 1XVCE 2JPNA 4FJHA 3QEWA 1XMGE 5IZ7A 4QNDA 3N1BA 4FK2A 4FJKA 3HGKE 4DU3A 4AKHA 4KI6A 1FZ2E 4KI4A 3UO3A 3QNOA 4E3SA 4B08A 2RKHA 5H37A 2FW3A 2MMBA 3HL8A 3TAFA 3SNNA 1FZ8E 4FJ7A 1XVDE 2OVRB 3QEVA 4GAMC 4KHWA 4I9LA 3L1NA 3CFRA 2HD0A 4DTNA 4DTOA 4AI6A 3MKSB 2DTUA 1FPOA 1IG9A 3QNNA 4DTMA 4FVMA 4DTPA 1FZ4E 3TL8B 4E4BA 4FJGA 4ICGC 3RMCA 2B7MA 3OGMB 3KD1E 3SQ2A 4J2BA
chains in the Genus database with same CATH topology
2MW2A 2K5SA 4ICGC 1JW2A 2JQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MW2 A;  2K5S A;  4ICG C;  1JW2 A;  2JQT A; 
#chains in the Genus database with same CATH topology
 3SUP A;  3TAB A;  4DTX A;  1JW2 A;  3QET A;  1XVE E;  3NHG A;  1MTY G;  1FZ6 E;  2JH9 A;  1Q9X A;  4M3Z A;  2P5G A;  1IH7 A;  1XVB E;  2P1M B;  2MW2 A;  3RWU A;  2H4T A;  3SVI A;  2FYO A;  2PFV A;  3RMA A;  2JQT A;  1FZ5 E;  3NAE A;  1N1C A;  2VJ5 A;  4EYW A;  4M3X A;  1MHY G;  3SPZ A;  2YB5 A;  1MHZ G;  3C6P B;  4M45 A;  3CFP A;  4KHN A;  1XVG E;  1CLQ A;  3UIQ A;  3C95 A;  2P1O B;  4DU4 A;  4I6J B;  3QEP A;  3SI6 A;  4RNG A;  3SCX A;  4JS5 A;  3SQ1 A;  1XL3 C;  3L2O B;  3LD8 A;  3LDS A;  1WAJ A;  3L0M A;  3QES A;  3L8B A;  4HCC A;  4KHS A;  3SUQ A;  4M3W A;  2RCU A;  4I9Q A;  4JRQ A;  4DTS A;  5IRE A;  4DU1 A;  4FJ8 A;  2K5S A;  3CFO A;  4X5N A;  4DTR A;  3SUO A;  3E4Y A;  1FXX A;  3UO2 A;  4JS4 A;  3K2O A;  3SPY A;  3NDK A;  4ADO A;  2OZM A;  3LZJ A;  2MZW B;  3RMD A;  3N1E A;  3NE6 A;  3QER A;  2JHP A;  4FK4 A;  3OGL B;  4AKI A;  4FJN A;  2B8I A;  3BVO A;  1FZ7 E;  2P1P B;  4QNC A;  4M42 A;  2PFT A;  4EPH A;  4JRP A;  3HP9 A;  4M3R A;  4AKG A;  2JH8 A;  1FZI E;  2VIX A;  1P22 A;  4IT5 A;  1MMO G;  1FZ9 E;  3TAG A;  4M3U A;  2P1N B;  3CQ8 A;  2E32 A;  3TJY A;  1XU5 E;  1XVF E;  2P1Q B;  3SJJ A;  4FJM A;  1XU3 E;  3TAE A;  3HGL A;  3LDB A;  4FJI A;  1NEX B;  2VJ4 A;  4FK0 A;  4KHQ A;  4J2D A;  2E31 A;  4KHU A;  2ATQ A;  1XMF E;  3E4W A;  3C6O B;  4X5M A;  1Q9Y A;  4FJL A;  2OYQ A;  1FZ0 E;  2DEB A;  3QEX A;  4M3Y A;  2JHA A;  3QEI A;  5IBK B;  3C6N B;  2LF3 A;  4FJ5 A;  2B1E A;  1FZ1 E;  1WAF A;  2OVP B;  4KHY A;  1LDK E;  4DTJ A;  4FJX A;  4HCB A;  4J2A A;  1FZ3 E;  3SUN A;  3LZI A;  3NGI A;  3RMB A;  4J2E A;  4EP9 A;  1XMH E;  4RG8 A;  3SQ0 A;  3C94 A;  2P5O A;  3S9H A;  1FS1 A;  2QXF A;  4RL5 A;  3WSO A;  1FYZ E;  3V7D B;  3J27 A;  4DTU A;  2DY4 A;  3KD5 E;  3J2P A;  4FJJ A;  4ADN A;  2LF6 A;  2OVQ B;  4M3T A;  2JHC A;  3OGK B;  3NCI A;  4FJ9 A;  4M41 A;  1FZH E;  3SQ4 A;  2OZS A;  1XVC E;  2JPN A;  4FJH A;  3QEW A;  1XMG E;  5IZ7 A;  4QND A;  3N1B A;  4FK2 A;  4FJK A;  3HGK E;  4DU3 A;  4AKH A;  4KI6 A;  1FZ2 E;  4KI4 A;  3UO3 A;  3QNO A;  4E3S A;  4B08 A;  2RKH A;  5H37 A;  2FW3 A;  2MMB A;  3HL8 A;  3TAF A;  3SNN A;  1FZ8 E;  4FJ7 A;  1XVD E;  2OVR B;  3QEV A;  4GAM C;  4KHW A;  4I9L A;  3L1N A;  3CFR A;  2HD0 A;  4DTN A;  4DTO A;  4AI6 A;  3MKS B;  2DTU A;  1FPO A;  1IG9 A;  3QNN A;  4DTM A;  4FVM A;  4DTP A;  1FZ4 E;  3TL8 B;  4E4B A;  4FJG A;  4ICG C;  3RMC A;  2B7M A;  3OGM B;  3KD1 E;  3SQ2 A;  4J2B A; 
#chains in the Genus database with same CATH homology
 2MW2 A;  2K5S A;  4ICG C;  1JW2 A;  2JQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...