4ICGC

N-terminal dimerization domain of h-ns in complex with hha (salmonella typhimurium)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
b'LTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding protein H-NS
publication title Structural Insights into the Regulation of Foreign Genes in Salmonella by the Hha/H-NS Complex.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. lt2
molecule tags Dna binding protein
total genus 14
structure length 67
sequence length 67
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF05321 HHA Haemolysin expression modulating protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.40 Mainly Alpha Up-down Bundle Monooxygenase HHA 4icgC00
4ICGC 1JW2A 2K5SA 2JQTA 2MW2A
chains in the Genus database with same CATH superfamily
3L8BA 4DTUA 4AKGA 1Q9YA 2FW3A 1FZIE 3C6OB 3SNNA 1WAFA 1MTYG 4J2AA 1JW2A 3TAGA 3SUPA 1FPOA 1XVDE 4KHYA 1XVCE 1MHYG 3K2OA 2OVRB 2MW2A 3HL8A 2OZMA 3QESA 3C6PB 3HP9A 1FZ5E 4M45A 4ADNA 3NHGA 3SQ0A 2DY4A 4FJLA 4M3XA 5H37A 3V7DB 1XVFE 3SVIA 4QNDA 3CFPA 4E3SA 3TAFA 4M3RA 4FJIA 4I9LA 1CLQA 2OVPB 2RKHA 4DTOA 2VJ4A 3NGIA 3SPZA 4FJXA 3SQ2A 4J2DA 3UIQA 1P22A 3NCIA 1XVGE 3S9HA 2B7MA 3UO3A 3CFRA 1FZ0E 2VIXA 2LF3A 4FK2A 4M3YA 3LDBA 2JHCA 3N1BA 4RNGA 4KHQA 4RL5A 2JHAA 3OGLB 4EPHA 4J2EA 4FJJA 4FJ8A 1FZHE 2P5OA 3OGMB 4I9QA 2PFVA 4FK4A 2JPNA 3QEXA 3CFOA 1FZ3E 1Q9XA 1LDKE 2JHPA 2B1EA 4DU1A 3L2OB 3QNOA 1N1CA 2JQTA 4HCBA 4DTNA 4RG8A 4GAMC 4FJMA 4ICGC 2E31A 4AKHA 3RMBA 4B08A 2RCUA 2OZSA 1IH7A 2MZWB 3SQ4A 3N1EA 1FZ7E 2YB5A 2ATQA 4I6JB 1XU3E 4DU4A 4FJ5A 1XVEE 4ADOA 2JH9A 1FZ2E 4FVMA 2P1OB 4KI4A 4QNCA 4JRPA 3RMAA 3KD1E 2HD0A 2JH8A 3QEIA 1FZ6E 3NDKA 4DU3A 3RWUA 3SUOA 4M3UA 3J27A 3MKSB 4DTJA 3TAEA 4JRQA 4FJGA 4M3ZA 4FJ9A 1XMGE 3OGKB 4M41A 2DEBA 3BVOA 3HGKE 3RMCA 3QERA 1FZ9E 4HCCA 4J2BA 1XMHE 4EP9A 2MMBA 2QXFA 4FJNA 3LDSA 3UO2A 5IBKB 4DTSA 1FXXA 4JS4A 2H4TA 3QEWA 3QEVA 2P1QB 2PFTA 1XU5E 4DTPA 3L1NA 4KHSA 3TABA 2P1PB 2LF6A 4E4BA 1MMOG 3C6NB 3SUNA 1IG9A 4FJHA 3LZIA 3SUQA 2P1MB 3WSOA 3CQ8A 3SPYA 2OYQA 2OVQB 3LD8A 4AI6A 4KHUA 4M42A 2E32A 4FJ7A 2P5GA 4KHWA 1FZ1E 5IZ7A 3QEPA 5IREA 3TL8B 3LZJA 4DTMA 1FZ4E 3QNNA 4M3TA 3SI6A 4KHNA 1WAJA 3C94A 4KI6A 1FZ8E 1FYZE 1XMFE 3SQ1A 3J2PA 3HGLA 3E4WA 4EYWA 3SCXA 1XL3C 2VJ5A 4IT5A 4X5NA 3NAEA 2FYOA 2DTUA 3C95A 4DTRA 3TJYA 4JS5A 3QETA 2P1NB 4AKIA 4DTXA 3RMDA 3KD5E 1XVBE 4FK0A 3NE6A 1FS1A 3SJJA 3L0MA 1NEXB 4X5MA 2K5SA 4FJKA 1MHZG 2B8IA 3E4YA 4M3WA
chains in the Genus database with same CATH topology
4ICGC 1JW2A 2K5SA 2JQTA 2MW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ICG C;  1JW2 A;  2K5S A;  2JQT A;  2MW2 A; 
#chains in the Genus database with same CATH topology
 3L8B A;  4DTU A;  4AKG A;  1Q9Y A;  2FW3 A;  1FZI E;  3C6O B;  3SNN A;  1WAF A;  1MTY G;  4J2A A;  1JW2 A;  3TAG A;  3SUP A;  1FPO A;  1XVD E;  4KHY A;  1XVC E;  1MHY G;  3K2O A;  2OVR B;  2MW2 A;  3HL8 A;  2OZM A;  3QES A;  3C6P B;  3HP9 A;  1FZ5 E;  4M45 A;  4ADN A;  3NHG A;  3SQ0 A;  2DY4 A;  4FJL A;  4M3X A;  5H37 A;  3V7D B;  1XVF E;  3SVI A;  4QND A;  3CFP A;  4E3S A;  3TAF A;  4M3R A;  4FJI A;  4I9L A;  1CLQ A;  2OVP B;  2RKH A;  4DTO A;  2VJ4 A;  3NGI A;  3SPZ A;  4FJX A;  3SQ2 A;  4J2D A;  3UIQ A;  1P22 A;  3NCI A;  1XVG E;  3S9H A;  2B7M A;  3UO3 A;  3CFR A;  1FZ0 E;  2VIX A;  2LF3 A;  4FK2 A;  4M3Y A;  3LDB A;  2JHC A;  3N1B A;  4RNG A;  4KHQ A;  4RL5 A;  2JHA A;  3OGL B;  4EPH A;  4J2E A;  4FJJ A;  4FJ8 A;  1FZH E;  2P5O A;  3OGM B;  4I9Q A;  2PFV A;  4FK4 A;  2JPN A;  3QEX A;  3CFO A;  1FZ3 E;  1Q9X A;  1LDK E;  2JHP A;  2B1E A;  4DU1 A;  3L2O B;  3QNO A;  1N1C A;  2JQT A;  4HCB A;  4DTN A;  4RG8 A;  4GAM C;  4FJM A;  4ICG C;  2E31 A;  4AKH A;  3RMB A;  4B08 A;  2RCU A;  2OZS A;  1IH7 A;  2MZW B;  3SQ4 A;  3N1E A;  1FZ7 E;  2YB5 A;  2ATQ A;  4I6J B;  1XU3 E;  4DU4 A;  4FJ5 A;  1XVE E;  4ADO A;  2JH9 A;  1FZ2 E;  4FVM A;  2P1O B;  4KI4 A;  4QNC A;  4JRP A;  3RMA A;  3KD1 E;  2HD0 A;  2JH8 A;  3QEI A;  1FZ6 E;  3NDK A;  4DU3 A;  3RWU A;  3SUO A;  4M3U A;  3J27 A;  3MKS B;  4DTJ A;  3TAE A;  4JRQ A;  4FJG A;  4M3Z A;  4FJ9 A;  1XMG E;  3OGK B;  4M41 A;  2DEB A;  3BVO A;  3HGK E;  3RMC A;  3QER A;  1FZ9 E;  4HCC A;  4J2B A;  1XMH E;  4EP9 A;  2MMB A;  2QXF A;  4FJN A;  3LDS A;  3UO2 A;  5IBK B;  4DTS A;  1FXX A;  4JS4 A;  2H4T A;  3QEW A;  3QEV A;  2P1Q B;  2PFT A;  1XU5 E;  4DTP A;  3L1N A;  4KHS A;  3TAB A;  2P1P B;  2LF6 A;  4E4B A;  1MMO G;  3C6N B;  3SUN A;  1IG9 A;  4FJH A;  3LZI A;  3SUQ A;  2P1M B;  3WSO A;  3CQ8 A;  3SPY A;  2OYQ A;  2OVQ B;  3LD8 A;  4AI6 A;  4KHU A;  4M42 A;  2E32 A;  4FJ7 A;  2P5G A;  4KHW A;  1FZ1 E;  5IZ7 A;  3QEP A;  5IRE A;  3TL8 B;  3LZJ A;  4DTM A;  1FZ4 E;  3QNN A;  4M3T A;  3SI6 A;  4KHN A;  1WAJ A;  3C94 A;  4KI6 A;  1FZ8 E;  1FYZ E;  1XMF E;  3SQ1 A;  3J2P A;  3HGL A;  3E4W A;  4EYW A;  3SCX A;  1XL3 C;  2VJ5 A;  4IT5 A;  4X5N A;  3NAE A;  2FYO A;  2DTU A;  3C95 A;  4DTR A;  3TJY A;  4JS5 A;  3QET A;  2P1N B;  4AKI A;  4DTX A;  3RMD A;  3KD5 E;  1XVB E;  4FK0 A;  3NE6 A;  1FS1 A;  3SJJ A;  3L0M A;  1NEX B;  4X5M A;  2K5S A;  4FJK A;  1MHZ G;  2B8I A;  3E4Y A;  4M3W A; 
#chains in the Genus database with same CATH homology
 4ICG C;  1JW2 A;  2K5S A;  2JQT A;  2MW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...