4ICGC

N-terminal dimerization domain of h-ns in complex with hha (salmonella typhimurium)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
LTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding protein H-NS
publication title Structural Insights into the Regulation of Foreign Genes in Salmonella by the Hha/H-NS Complex.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. lt2
molecule tags Dna binding protein
total genus 14
structure length 67
sequence length 67
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF05321 HHA Haemolysin expression modulating protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.40 Mainly Alpha Up-down Bundle Monooxygenase HHA 4icgC00
4ICGC 1JW2A 2K5SA 2JQTA 2MW2A
chains in the Genus database with same CATH superfamily
3LZIA 4M3UA 3QEIA 1FXXA 2OVRB 3C6PB 4DTNA 4DTRA 1NEXB 2OYQA 1FZ4E 1FZ8E 4FJGA 4KHNA 4FJ9A 2MZWB 3TJYA 3UO3A 2FW3A 3SCXA 3MKSB 4J2DA 2RCUA 2VJ4A 1XMGE 2RKHA 2K5SA 3QEWA 3NAEA 2OZSA 4ADNA 3K2OA 4AKHA 3OGMB 3J2PA 3NCIA 4FVMA 3SPZA 2LF6A 4RG8A 3OGLB 4FJXA 3QEVA 4HCBA 3QNNA 2OVPB 3WSOA 4EPHA 1WAJA 1XVGE 4QNCA 3E4YA 4M3WA 3LDBA 4IT5A 4FJ8A 4M45A 3RWUA 3SPYA 3SUOA 2ATQA 3HGKE 1FZ5E 4KHYA 1FZ0E 4M41A 1FZ2E 4EYWA 3SVIA 4AI6A 4FJKA 4J2BA 2DEBA 4KHUA 2E31A 3HGLA 3SQ1A 1LDKE 2DY4A 3QNOA 4FK4A 4AKGA 3S9HA 4FJJA 2DTUA 4FJIA 2JQTA 4X5NA 2P5GA 4DU3A 3NDKA 4FK2A 4I9QA 3L0MA 1P22A 1XVDE 3CFOA 3TABA 4M3ZA 4DTXA 3NGIA 3SUQA 3OGKB 2OVQB 4FJHA 4FJ7A 3SI6A 4QNDA 3LZJA 1IH7A 1FZ1E 4DTUA 4JRQA 1FPOA 3SUPA 2P5OA 2OZMA 4M3XA 4JS4A 3LD8A 1FYZE 4I6JB 4GAMC 4E3SA 1MTYG 3RMCA 4KHSA 2JPNA 4ADOA 3CFPA 1Q9YA 3L1NA 2JHAA 2P1NB 1XVFE 4RNGA 5IBKB 3QEXA 5H37A 2FYOA 4DTPA 3TAFA 4DTOA 3CFRA 3C6OB 3N1BA 1XVEE 1XU5E 2P1QB 3L8BA 2YB5A 1XVBE 1XVCE 2P1OB 3C95A 1Q9XA 4AKIA 2LF3A 1MMOG 3QERA 2VJ5A 2VIXA 3TAEA 3L2OB 2B1EA 4RL5A 3UO2A 1FZHE 4B08A 4JRPA 3QETA 4ICGC 2MMBA 3SQ0A 2QXFA 4M3RA 3NE6A 4M3YA 3KD1E 3HP9A 3UIQA 2JHPA 1WAFA 3RMAA 1XMHE 1FZ7E 1XMFE 3SQ4A 4J2AA 3CQ8A 4DU1A 1XL3C 2H4TA 1FS1A 1MHZG 4X5MA 2HD0A 3SUNA 1FZ9E 4FK0A 4I9LA 1FZ6E 2PFVA 2PFTA 4FJ5A 3V7DB 4M42A 4FJMA 1MHYG 4HCCA 3BVOA 1CLQA 1FZ3E 3C94A 4KHWA 4JS5A 3KD5E 2E32A 1JW2A 3HL8A 3TL8B 3SJJA 4KI6A 3C6NB 4FJLA 4EP9A 3N1EA 4DTSA 4DTMA 4E4BA 1IG9A 3RMBA 1N1CA 1XU3E 2B8IA 4KI4A 4KHQA 2P1MB 3TAGA 2B7MA 3SNNA 2JH9A 2JHCA 3LDSA 4DTJA 1FZIE 4J2EA 2MW2A 4FJNA 3NHGA 4M3TA 3SQ2A 3J27A 2P1PB 4DU4A 3QESA 5IZ7A 2JH8A 3RMDA 5IREA 3E4WA 3QEPA
chains in the Genus database with same CATH topology
4ICGC 1JW2A 2K5SA 2JQTA 2MW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ICG C;  1JW2 A;  2K5S A;  2JQT A;  2MW2 A; 
#chains in the Genus database with same CATH topology
 3LZI A;  4M3U A;  3QEI A;  1FXX A;  2OVR B;  3C6P B;  4DTN A;  4DTR A;  1NEX B;  2OYQ A;  1FZ4 E;  1FZ8 E;  4FJG A;  4KHN A;  4FJ9 A;  2MZW B;  3TJY A;  3UO3 A;  2FW3 A;  3SCX A;  3MKS B;  4J2D A;  2RCU A;  2VJ4 A;  1XMG E;  2RKH A;  2K5S A;  3QEW A;  3NAE A;  2OZS A;  4ADN A;  3K2O A;  4AKH A;  3OGM B;  3J2P A;  3NCI A;  4FVM A;  3SPZ A;  2LF6 A;  4RG8 A;  3OGL B;  4FJX A;  3QEV A;  4HCB A;  3QNN A;  2OVP B;  3WSO A;  4EPH A;  1WAJ A;  1XVG E;  4QNC A;  3E4Y A;  4M3W A;  3LDB A;  4IT5 A;  4FJ8 A;  4M45 A;  3RWU A;  3SPY A;  3SUO A;  2ATQ A;  3HGK E;  1FZ5 E;  4KHY A;  1FZ0 E;  4M41 A;  1FZ2 E;  4EYW A;  3SVI A;  4AI6 A;  4FJK A;  4J2B A;  2DEB A;  4KHU A;  2E31 A;  3HGL A;  3SQ1 A;  1LDK E;  2DY4 A;  3QNO A;  4FK4 A;  4AKG A;  3S9H A;  4FJJ A;  2DTU A;  4FJI A;  2JQT A;  4X5N A;  2P5G A;  4DU3 A;  3NDK A;  4FK2 A;  4I9Q A;  3L0M A;  1P22 A;  1XVD E;  3CFO A;  3TAB A;  4M3Z A;  4DTX A;  3NGI A;  3SUQ A;  3OGK B;  2OVQ B;  4FJH A;  4FJ7 A;  3SI6 A;  4QND A;  3LZJ A;  1IH7 A;  1FZ1 E;  4DTU A;  4JRQ A;  1FPO A;  3SUP A;  2P5O A;  2OZM A;  4M3X A;  4JS4 A;  3LD8 A;  1FYZ E;  4I6J B;  4GAM C;  4E3S A;  1MTY G;  3RMC A;  4KHS A;  2JPN A;  4ADO A;  3CFP A;  1Q9Y A;  3L1N A;  2JHA A;  2P1N B;  1XVF E;  4RNG A;  5IBK B;  3QEX A;  5H37 A;  2FYO A;  4DTP A;  3TAF A;  4DTO A;  3CFR A;  3C6O B;  3N1B A;  1XVE E;  1XU5 E;  2P1Q B;  3L8B A;  2YB5 A;  1XVB E;  1XVC E;  2P1O B;  3C95 A;  1Q9X A;  4AKI A;  2LF3 A;  1MMO G;  3QER A;  2VJ5 A;  2VIX A;  3TAE A;  3L2O B;  2B1E A;  4RL5 A;  3UO2 A;  1FZH E;  4B08 A;  4JRP A;  3QET A;  4ICG C;  2MMB A;  3SQ0 A;  2QXF A;  4M3R A;  3NE6 A;  4M3Y A;  3KD1 E;  3HP9 A;  3UIQ A;  2JHP A;  1WAF A;  3RMA A;  1XMH E;  1FZ7 E;  1XMF E;  3SQ4 A;  4J2A A;  3CQ8 A;  4DU1 A;  1XL3 C;  2H4T A;  1FS1 A;  1MHZ G;  4X5M A;  2HD0 A;  3SUN A;  1FZ9 E;  4FK0 A;  4I9L A;  1FZ6 E;  2PFV A;  2PFT A;  4FJ5 A;  3V7D B;  4M42 A;  4FJM A;  1MHY G;  4HCC A;  3BVO A;  1CLQ A;  1FZ3 E;  3C94 A;  4KHW A;  4JS5 A;  3KD5 E;  2E32 A;  1JW2 A;  3HL8 A;  3TL8 B;  3SJJ A;  4KI6 A;  3C6N B;  4FJL A;  4EP9 A;  3N1E A;  4DTS A;  4DTM A;  4E4B A;  1IG9 A;  3RMB A;  1N1C A;  1XU3 E;  2B8I A;  4KI4 A;  4KHQ A;  2P1M B;  3TAG A;  2B7M A;  3SNN A;  2JH9 A;  2JHC A;  3LDS A;  4DTJ A;  1FZI E;  4J2E A;  2MW2 A;  4FJN A;  3NHG A;  4M3T A;  3SQ2 A;  3J27 A;  2P1P B;  4DU4 A;  3QES A;  5IZ7 A;  2JH8 A;  3RMD A;  5IRE A;  3E4W A;  3QEP A; 
#chains in the Genus database with same CATH homology
 4ICG C;  1JW2 A;  2K5S A;  2JQT A;  2MW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...