4ICVA

Ubiquitin-like domain of human tubulin folding cofactor e - crystal form b
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
84
structure length
84
Chain Sequence
b'QLLTLKIKYPHQLDQKVLEKQLPGSMTIQKVKGLLSRLLKVPVSDLLLSYESPKKPGREIELENDLKSLQFYSVENGDCLLVRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tubulin-specific chaperone E
publication title The structure of the complex between alpha-tubulin, TBCE and TBCB reveals a tubulin dimer dissociation mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 22
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14560 Ubiquitin_2 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4icvA00
3PRPB 2MBEA 3V62A 1WH3A 4ASWC 4J6IA 1WM3A 4BFRA 5JHAA 3KW5B 4IWPA 4DXAB 1Z5SB 2ASQA 1EF5A 1OQYA 3DDCB 1WYWB 1WJNA 1WE7A 2KO3A 2MLBA 4IM2A 4WJNA 4FBJB 4YL8A 4K7WA 1P0RA 2N7DA 4K1RB 1ZKHA 5LLIA 2J0KA 4ANUA 3KUCB 3WALA 2IZVB 4HLEA 5LXIB 2KNBA 3W1YA 2OOBB 3PZDA 2O2VA 3QWZB 3PSEB 5JH5C 1EO6A 4HCPB 3W1SC 1E7UA 2C7NB 2GBRA 3WAMA 2D3GA 2MQJA 2ZZPB 4CO7A 3VDZA 4GN1A 1WGRA 4EOYA 2BYFA 2EMSA 4HPLB 1LQBA 1LM8B 2LRWA 4TQ1A 4B6WA 4MDKE 4F8CB 1WX7A 1WI0A 4ZRKA 3EECA 3MJWA 2OJRA 2ZJDA 1NI2A 4NNJB 4EZKA 5D6JB 2L7RA 2ZVOA 2KOXA 3ML8A 3VTWA 3PPAA 3L17A 4FJYA 4LCDE 4NQKE 4WQOB 5C1ZA 2RGFA 3H7PA 4PYUA 2JY6A 2KANA 2XK5A 3DBLI 3NOBA 2GMIC 3VAWA 4II2B 4WAAA 1F9JA 3MHSD 3TL5A 4HCNB 4K7SA 3A4RA 4OVUA 2M1MA 3ENEA 5CHFA 3Q3JA 4ZRJA 4EZLA 2IBIB 3U7DA 3ZDTA 2KMAA 4ANVA 1WRDB 2Y5BB 1MG8A 3MTNB 3UIPB 1UGMA 1WZ0A 2UWQA 2CKHB 2O2VB 4MJSB 3ZVVA 3UINB 4KVGB 2AL6A 1E8XA 4WWPA 5E6NA 3D32A 3VHTC 3ZNID 1IYFA 1P9DU 2LXCA 4GMVA 4EKUA 3RD2A 3SHQA 2AL3A 4EZJA 2W9NA 2MBOA 1NBFC 2KZRA 3SU8X 3VH3B 5EDSA 2KC1A 5CHWA 5HKHA 1WX9A 2O6VA 3QX1A 5DPTA 4ZRIA 1WJ4A 2QHOA 2IO1B 2N1VA 3A1QB 4GIVA 1YQBA 3H7PB 3CMMB 3B1LX 2XK5B 4IUMB 3WIMA 2AEHA 2B3AA 2K1FA 3SD5A 1LFDA 1TGZB 1VCBA 2R2QA 1M94A 4TKNA 2KHWB 1LXDA 2GBNA 3ZW3A 1L2NA 3ALBA 3HHMA 4A3PA 3C0RB 2PE6B 2G45B 2MX2A 3LDZE 2KN5A 3ZNHB 2K8BA 3V6EB 1NDDA 3AXCA 2C60A 3CSFA 3L08A 5BO4B 2FCSA 2LVOA 2NBWB 3WAPA 2KTRB 1EUVB 4AUQC 4AJWA 3QARA 1ZGUB 3VUWA 4ANWA 4BKTA 3ZUNA 3PLVA 4KZCA 2NCNA 2KDEB 4FJVB 4W9KA 1RRBA 3M63B 2DZKA 2DHZA 4N9F4 1E8WA 1GG3A 1WJ6A 1YX5B 4G3XB 2FCNA 5KHQA 2L00B 2LRUA 1FXTB 2I1KA 2O6VB 3UF8A 4ANXA 2I1JA 2L0TA 2ZPYA 5E6PA 4BKGA 4KDIC 4JIOU 2JPHA 2V3SA 5CTRC 2L0FA 4ZDVA 2LD9A 3A9KA 5DPWA 2LZ6A 3V61A 5D94A 3IFWB 1V6EA 3VH4B 4OVVA 3IVFA 2D11A 2CU1A 2NR2A 4IC7B 2G4SA 2D2QA 4PS3A 1P3QU 5AZHA 5E6OA 3DVGX 4E71A 2FAZA 3N3KB 3NZSA 2ZNVC 1WGDA 1KJTA 4FADA 2MSED 2JXXA 1IP9A 1BT0A 4GOCA 4F7ZA 3GZNI 1EF1A 2MBBB 3ZNZB 2DYBA 4FULA 3HK0A 2J7QB 1E8YA 2LVQA 3AULA 4EEWA 2FNJB 2LASA 3JSVA 2LXAA 2WX0A 4HWIB 4NY0A 2NS5A 3CF6E 4X57B 4EUTA 3ZDMC 1I42A 3CSTA 3R66C 1GC7A 4KZ0A 3PS6A 1C3TA 1UD7A 4GDLB 3PV1A 2BGFA 1WJUA 2L8JA 3P2BA 2CR5A 4MJSA 3ECIA 4HDOA 2C5LC 3A9KB 1RFAA 2N9XA 2MCNB 2LWPA 3JYUA 3TIXA 1WX8A 2ZCBA 3PRMB 2LJ5A 2FCMA 2KQSA 1U4AA 1X1MA 1YJ1A 4W9EA 1C1YB 4MM3A 2O6VD 4B9KA 3EFUA 3A4SC 4KSLC 1Q1OA 4M8NA 4LJPB 4W9HA 4LJOB 2DENB 3A1QA 3PTFC 3L0WB 3H7SA 1WE6A 3N30A 1RAXA 2ZPNA 3BY4B 4W9JA 2LI5A 4G0NB 2KC2A 2N9EB 2BWES 2ZEQA 3JSVB 2LGDA 2K6DB 1WZ3A 4K81A 4TV3A 1WGGA 1V5OA 3QC8B 1WGHA 3BINA 2D07B 4HJKA 3TBLD 2REXA 1E90A 2BYVE 2KLCA 4W9LA 3DVNV 3N32A 3NS8A 2KQ7A 2KLGA 2PJHA 3DCGA 3H9DA 3R3MA 3S2AA 3VUXA 3B0AA 3U30A 3ZRFA 1HE8A 4RMAA 2IO2B 2KTRA 4PS8A 4BKSA 2WX1A 3EC8A 4FJZA 4DBGA 2A4ZA 2LVPA 4HPMB 5C23A 3RULA 3HM3A 1XQQA 2L76A 5TR5A 1V86A 5CX3A 1WR6E 2CHXA 2BPSA 4IWQA 3OLMD 4MELA 1OEYA 2FIFA 1OGWA 3KUDB 3L16A 3T9LA 2CS4A 4ZYNA 5D2MB 3DBRI 3APDA 4PYZA 4GDKA 2MBHA 4LDTB 3TJPA 1WXVA 2WWZA 3H1UA 4WJPA 3T8MA 3APCA 4FHKA 1ZW7A 1OTRB 3AU4A 1UBIA 4BVUC 1YD8U 2JF5A 3UQBA 4FA6A 5L95C 1R4NI 1WMHA 2BYEA 1GNUA 4DK5A 3QJZA 2MWSB 2M4NA 4JLCA 3IBEA 2DAFA 2JUOA 3DBSA 1UZXB 3RCZA 2VRRB 4GGQA 2IY1B 1YX6B 1QZEA 2JRHA 3L13A 5G55A 5J17A 1V81A 2J0JA 1KOTA 1I35A 4I6LB 1VD2A 1GJZA 1SGHA 3M95A 2KTFA 3ZRCA 2LUEA 1AARA 4W9DA 4NQLB 3NZUA 1WM2A 2EKEC 3K9PB 2L05A 2WYQA 3L10B 2KJ6A 3RZWC 1K8RB 4GDLA 2Z0DB 2JWZA 4TUUA 1V49A 4GDKB 2CHZA 2CHWA 2WDTB 4DDGD 4DDID 2KDIA 1V9JA 3DVNU 3EHVA 3DOWA 4WWOA 3A33B 3L54A 2G4DB 1UBQA 3QCAA 2DAJA 2MRPA 3RUIB 3OAWA 2NBVB 4BBNF 1G6JA 3W1SA 1P1AA 2ZVNA 4AJYB 1WMHB 3LJ3A 3QQ8B 3Q3FA 1CMXB 3VTVA 2RD0A 4BBNC 2L3ZA 2R2OA 2MP2B 2IYDB 2ZCCA 3KVFB 4IM3A 1Z2MA 2N1WA 4GXBA 4LDTD 4MSMB 4XX5A 3DPDA 3O65B 1WXMA 1SIFA 2NBUA 3PREA 2BWFA 4EFOA 2FUHB 5AEKB 1D3ZA 1R4MI 3ZKJC 4G11A 2DZMA 4HVBA 4II3B 4M0WB 5J18A 2C7HA 1KLVA 2BKRB 2PEAA 3A9JB 2JZZA 4JL9A 3X0WA 2BKFA 3UQAA 4AOFA 2KWVB 4E74A 4KDLB 2NPTA 3GOEA 4G50A 1TZ1A 1GUAB 3RYTA 3ZIMA 2PE9A 3NHEB 5FR6A 4CHKA 4GU2A 2N7EA 2KD0A 4BKSD 2DX5B 1WGYA 1V80A 5AZGA 2RPQA 4JQWC 1SE9A 1TTNA 3HM6X 2KFKA 2YVCA 3VXWA 3PT2B 1Q5WB 2KK8A 1WXAA 3IG3A 2HTHA 4MGZE 5DCNA 3AI5A 3HIZA 3PHXB 4NJ7A 1T0YA 4NPNA 1OEYJ 2C9WB 4A20A 3UGBB 3M3JA 2K8CA 2JT4B 2MA9B 1V5TA 2BF8B 3ZTCA 3APFA 5DPRA 5D7GA 4PS7A 4DHZB 1J0GA 4HXDA 2C7MB 5JZEB 1WFYA 2IO3B 3DBHI 4GSWA 3ZLZA 2KDFB 2HE7A 2FCQA 1P98A 1E7VA 2DYOA 4WJOA 2K6QA 2KX3A 2G3QB 2J0MA 2V1YA 2NPTB 1V2YA 2KKCA 2KMCA 4F1SA 2RR9A 2KDBA 1RLFA 2KXJA 1JRUA 3ML9A 3KYDD 4NAWA 4DHJB 5AZFA 1UELA 1GC6A 2DZIA 2JZ3B 1Y8RC 2UYZB 4MGKE 4MEMA 3WANA 4I6NB 3PLUA 4DHZE 3WA0A 3X23A 4I6PA 2KFKB 3U8ZA 2K8HA 3UIOB 4RM8A 4KIKA 4ICUA 3QIJA 4GB9A 4AWJA 2MW5A 1E8ZA 3KUZA 3IHPC 2JRIB 4XC2A 1WR1A 2GBKA 4IG7B 4IWOA 3B08A 2D10A 1S3SG 3JVZX 4JGHB 3RT3B 1WIAA 3WAOA 3VQIA 4DWFA 4W9FA 4MH0E 4A3OA 2V4LA 1ISNA 2LGXA 3K9OB 5IAAC 3V60A 3QK0A 4RM9A 4BOZB 3RZFA 5IA7A 4MGYE 2A5UA 2IY0B 2K25A 2KJHB 2YLMA 4NAWB 2MP2A 3TMPB 1PQSA 4P7IA 4IW0A 4HK2A 2M0XA 4M8MA 1TBEA 2KWUB 3OJ3A 3H6NA 4B95A 2DYMA 2IO0B 2KX0A 3QHTA 4HDQA 4K7UA 3QA8A 1S1QB 1Q0WB 1YIWA 5DPSA 5G2NA 2AYOB 2N9PC 4KIKB 2GOWA 2KWCA 2HJ8A 4BOSC 3A9JA 2NVUI 4URKA 2K39A 3M62B 5KHOA 5GMVA 1L7YA 4FLHA 4DHJD 3PHWB 2Z0EB 2KVRA 4CYEA 1KM7A 5L83A 1H4RA 3NY5A 2AWTA 2Z59B 2RSUA 2GBMA 4KSKC 3VFKA 4FN2A 1UH6A 2LGYA 3ZO5B 5J2RA 3TCAA 2M17A 2MBQA 1E5WA 3AU5A 3PGEA 3DVGY 2XBBC 4AP4C 1WXSA 3KH0A 2FIDA 2KJRA 2EMTA 5JHBA 1A5RA 3PVLA 3VTUA 4IM0A 2DZJA 3VVWB 4WJQA 1J8CA 2M8SA 3R7QA 2HD5B 3ZNGC 3V6CB 4TQ0A 4XZ4A 3ONSA 3I3TB 4W9IA 1XT9B 4WWNA 1H8CA 2JVCA 4ICVA 4MSQB 4NJ6A 3VUYA 1WF9A 1IPGA 3QAQA 4E3CA 1WY8A 2PPHA 2ZNVB 3ZTDA 4W9GA 1XD3B 3SDLC 3PRZA 3JW0X 4MGIE 3KYCD 3DQVA 2N4FA 4FHJA 5CHVC 5LXHA 1J19A 2XEWA 4KV2A 4W9CA 2GBJA 3OJ4B 2KFJA 3R7RA
chains in the Genus database with same CATH superfamily
1AYFA 1WM3A 4RFBA 1SB3C 3KW5B 4IWPA 3VR9B 1R4MB 3NVVA 2IJ0A 1JQ4A 2IGDA 2K3UA 3AE1B 3B9JA 3WALA 2IZVB 2KNBA 3IXSA 3N9YC 3P4RB 3W1SC 1E7UA 2GBRA 2D3GA 1DYQA 4CO7A 1WGRA 1LQBA 2LRWA 4F8CB 4ZRKA 2OJRA 2ZJDA 5D6JB 3VTWA 4P16A 2ON8A 5I4DA 4WQOB 5C1ZA 1AW7A 4PYUA 2JY6A 3DBLI 2GMIC 4US8A 2SEBD 1F9JA 4OVUA 4ANVA 1WRDB 3MTNB 3UIPB 4A9AA 1YOVB 4XGAB 1ET9A 2INNE 3RNBC 3UINB 3T3OA 2VZKB 3VHTC 4GMVA 3RD2A 4KGSA 5IP4D 5H8YE 3AE9B 1FMAD 1WJ4A 2H88B 2IO1B 1UWMA 3H7PB 3CMMB 2N0SB 2XK5B 2B3AA 5HG2A 1M94A 2KHWB 3ZW3A 1L2NA 3HHMA 3C0RB 2PE6B 1OFFA 4FXCA 3LDZE 3V6EB 3V3XA 3AXCA 1XLNA 2NBWB 3WAPA 2KTRB 3Q2AC 4AUQC 4ANWA 3ZUNA 2PW9A 3PLVA 3P4PB 2DZKA 4HRSA 1ET6A 4G3XB 2L32A 3RMKC 3UF8A 2I1KA 4ANXA 3OG5A 2I1JA 2IDYA 4ZHPA 2MHJA 5E6PA 4BKGA 3I5JC 3CWIA 5CTRC 1L0YB 3A9KA 2LZ6A 2G4SA 5AZHA 1TS5A 3N3KB 2Y5CA 2MSED 3GZNI 4FULA 5FK9C 1KF6B 2J7QB 3AULA 2LASA 4LNKA 1XXGA 2E6XA 1IUEA 4HJGE 3R66C 1FO4A 3AEAB 1C9FA 4GDLB 3PV1A 1KFYB 1L5PA 2JU6X 2D5GA 1N63A 4MJSA 4RGNA 1OQQA 1AWDA 2QC8A 2MCNB 3JYUA 3TIXA 2ZCBA 3W5UB 4XE0A 2KQSA 4UDUC 5C2TB 4KSLC 2E3TA 3Q8CA 4W9HA 2DENB 3PTFC 2LHDA 3L0WB 1RYJA 2MJEA 2KC2A 4OW0A 2BWES 2JXTA 2ZEQA 1QILA 1E10A 2AQ3B 2KQ4X 1T0RC 3P42A 1V5OA 3TBLD 2D07B 3FAHA 2BYVE 4W9LA 1I4PA 2KLCA 1XF5L 3DVNV 4C56C 3H9DA 3ZRFA 4HPPA 3U30A 3BYTB 1D5ZC 4N58A 3KQ4A 4RH6A 1WGKA 2A4ZA 4YTMB 3RULA 3HM3A 4C7ZA 1D6EC 4MM3B 1OEYA 2FIFA 2FUG1 3L16A 4ZYNA 2L52A 2PKOA 3APDA 4PYZA 2MBHA 4RNAA 3TJPA 2DLBA 1HEZE 1ZW7A 1PUTA 4HEA1 1UBIA 1YD8U 5T8IA 2L1AA 5EE3A 4IDIA 1ROEA 5TSSA 4DQOC 3ZQ4A 1L0XB 3RCZA 5G55A 3U2SC 1KOTA 3AE6B 4CQNA 2KTFA 2BBCA 1WM2A 3DHGC 1K8RB 1LO5D 4GDKB 2CHWA 2WDTB 3I9V1 2WDRB 2KDIA 1V9JA 3EHVA 3ZJVA 2CU3A 3QCAA 2MRPA 2G9HD 3LYYA 3W1SA 1WMHB 3LJ3A 1FM0D 3Q3FA 2RD0A 2L3ZA 2MP2B 2IYDB 2ZCCA 4MSMB 1Z2MA 3O65B 2NBUA 2I2YA 1N60A 4EFOA 2FUHB 1D3ZA 1R4MI 2UU7A 4HVBA 4II3B 4M0WB 1KLVA 3UQAA 4A55A 4E74A 1EM7A 1MPEA 5BYQA 1PDXA 2PE9A 3NHEB 5FR6A 1SIJA 4JQWC 2AQ2B 3HM6X 2BB5A 4DXFA 1Q5WB 1XEEA 5DCNA 1ZOYB 1YMHE 4WQMA 2MJDA 1VLBA 2BF8B 3APFA 4BAXA 1WYGA 4HXDA 1T5XD 5JZEB 2AQ1B 1WFYA 2IO3B 2IPKD 4GSWA 1P98A 2FCQA 2K6QA 5EE1A 2J0MA 4F1SA 2RR9A 4NAWA 4DHJB 1JRUA 2V0GA 2K9XA 4I6NB 3BVZA 4DHZE 1L0VB 2KFKB 2K8HA 4ICUA 2B76B 4OZAA 3NUHB 4GB9A 1IGDA 2MW5A 1E8ZA 1F52A 4IG7B 4IWOA 1WIAA 2WXHA 1TKEA 4W9FA 2J4XA 4MH0E 1C4PA 1JCKB 5HFYA 2INDC 5IAAC 1RWSA 2WXOA 1I7HA 4WH4A 2KJHB 1FCLA 4B95A 1TKYA 3DBRB 2DYMA 2KX0A 4K7UA 2AYOB 2N9PC 4YTPB 4BOSC 2HJ8A 1TS2A 3A9JA 2NVUI 1PYWD 4URKA 3M62B 5KHOA 3MP9A 4XWWA 5HI1A 1FD6A 2Z59B 2QSDA 4KSKC 4FN2A 1UH6A 3EFCA 4NJCA 1GOZA 3ZO5B 3TCAA 2M17A 3ZJUA 4JX1C 2QJLA 5IKCM 3NRZA 2EMTA 2WXNA 3GS2A 1A5RA 4M01A 2NTTA 1J8CA 3V6CB 3ONSA 3I3TB 1VZ8A 3E56A 4ZYSA 3ZTDA 4N6EB 2N9LA 3SFEB 2K0PA 5CHVC 4PK1A 4KV2A 3R7RA 2I38A 2MBEA 4OVZA 4ASWC 4J6IA 5IO9A 2Y3AA 2ASQA 2WDVB 1OQYA 1WYWB 2AX5A 3C19A 1EWYC 4FBJB 4K7WA 1P0RA 2N7DA 2V3PA 5LLIA 3KUCB 5LXIB 2PLPA 3W1YA 3PZDA 1QOFA 1HTQA 1EO6A 4RGMA 2C7NB 3VDZA 1XLPA 4TQ1A 1SE3A 4S0RA 1YNTE 3MJWA 2RDGA 2KOXA 4FJYA 4LCDE 2OJWA 3H7PA 4IKGA 2KANA 2XK5A 3VAWA 3A4RA 3ENEA 3Q3JA 3DBHB 2JYTA 1SE4A 3U7DA 3RNEC 3BWUD 2Y5BB 1MG8A 3EA6A 3RFZB 4AQ7A 1WZ0A 2UWQA 1ZXIA 2BYTA 4RCOA 2AL6A 1N5XA 1N5WA 4WWPA 5E6NA 5MPOA 2WQYB 4AS1A 1P9DU 1TYGB 2D3CA 1GAQB 3SHQA 1JROA 2MBOA 3Q6BA 2KZRA 3VH3B 2M19A 5CHWA 3CIRB 5HKHA 1WX9A 2BS4B 1DOIA 4ZRIA 5BMIA 2WXRA 1FEHA 1FXIA 1LFDA 2LEKA 2R2QA 4TKNA 2GBNA 3ALBA 4A3PA 4DXGA 2G45B 2QMTA 2MJ3A 3P4SB 2MX2A 3ZNHB 2KN5A 4OHJA 4YXDB 1NDDA 2C60A 3L08A 1JRPA 2LVOA 1CJEA 2J42A 1EUVB 3QARA 1VJKA 4BKTA 5JXVA 4KZCA 2NCNA 3R2TA 4FJVB 3AB5A 3M63B 2DHZA 2W3RA 2IGHA 1WJ6A 2JSVX 2FCNA 4OZBA 1FXTB 4JIOU 2V3SA 3Q3OC 4LNNA 2VZKD 3VR8B 5D94A 3RN9C 1ZDVA 2V3NA 4OVVA 3Q8BA 1XO3A 1P3QU 5G5GA 5E6OA 3DVGX 4E71A 2GB1A 4M02A 3RI7C 4REZA 1BT0A 4GOCA 1WXQA 1VDVA 2W54A 1UNSA 2MBBB 2X38A 2QDFA 3AEGB 3HK0A 3Q8EA 2BVCA 2LXAA 2WX0A 3RNFC 4EUTA 1I42A 1GC7A 2KAJA 2BGFA 2L8JA 3P2BA 1D5XC 1ZE3D 2C5LC 4TMAB 1JW9D 2WDQB 2LWPA 2DBYA 4A8XC 4YT0B 2FCMA 4WURA 4MM3A 4XDCA 3EFUA 4M8NA 4LJPB 1R7SA 3MC8A 2GI9A 3A1QA 1RAXA 2BQQA 2Z8LA 3PZ8A 2LGIA 4G0NB 2KDMA 1STEA 4K81A 2K6DB 1WZ3A 1HXYD 1WGGA 4TV3A 1B1ZA 4HJKA 1WWTA 1F77A 3NS8A 2KLGA 2PJHA 1SXTA 2HTME 2W55A 3B0AA 3MFGA 1HE8A 4KX6B 2WXKA 2RMMA 1PGAA 3AV8A 4PS8A 2WX1A 3N20C 4LNOA 4DBGA 2LVPA 1XQQA 2L76A 1N61A 2LFIA 5CX3A 4LNIA 4KKJA 1OGWA 3NVZA 3T9LA 5D2MB 3DBRI 4GDKA 1WXVA 2PVGC 4ARIA 4FHKA 2QEJC 3ZYYX 3AU4A 3N1ZC 2INCC 2JF5A 2Q5WD 1L6UA 4ACFA 5L95C 1R4NI 1WMHA 3AE3B 1GNUA 2WXGA 1UZXB 2VRRB 1I4XA 1E6EB 4GGQA 1YX6B 1QZEA 2WU5B 5J17A 1FPYA 2LUMA 2L83A 1VD2A 4M0WA 1L4ZB 2QILA 1AARA 2D3AA 3L10B 2KJ6A 3RZWC 2N9KA 1V49A 3GE8C 3J9CA 4DDID 1UBQA 3U7ZA 3BK2A 3VRBB 2PMVA 3AEBB 1MVKA 3U52E 3WCQA 2PVOD 4BBNC 2R2OA 4IM3A 2N1WA 4GXBA 4XX5A 1WXMA 1SIFA 3ZKJC 2DZMA 1VZ7A 4JL9A 3GOEA 1MHXA 5BMGA 4GU2A 4CHKA 2KD0A 5AZGA 1V80A 3AEEB 2WXIA 2CJNA 2BS3B 2KFKA 2YVCA 3VXWA 1NI3A 1KRHA 3HIZA 2KWDA 4NJ7A 1QQRA 1C4CA 1T0YA 4NPNA 4YSYB 1OEYJ 3UGBB 1UWXA 2JT4B 1IGCA 1V5TA 3ZTCA 4DHZB 2C7MB 4RF1A 3DBHI 2KDFB 2DYOA 2G3QB 2KKCA 1J7BA 1RLFA 2KDBA 3KYDD 2FE8A 1UELA 1SE2A 2DZIA 3WANA 1Y8RC 2UYZB 4MEMA 1SBBB 2KYWA 3PLUA 2W3SA 4I6PA 1HZ5A 5IN7A 3AE7B 1S3SG 3RT3B 4A3OA 1N6ZA 2LGXA 1FFUA 3V60A 4ITKA 4RM9A 5IA7A 4MGYE 3HUIA 2A5UA 3PO0A 2K25A 3TMPB 4P7IA 4HK2A 2MEKA 3H6NA 2IO0B 3QHTA 4HDQA 3DHIC 4YWGG 5D3DA 1T0SC 4KIKB 2GOWA 1UGJA 3UI3A 2K39A 1L7YA 4DHJD 3PHWB 2YEPF 2Z0EB 3ETRA 2ACZB 3HRDD 3NY5A 2AWTA 3R8BA 1QT9A 3BVMA 3VFKA 5BMHA 2LGYA 4N59A 5J2RA 2MBQA 1E5WA 1NENB 3DWGC 3B2GA 3PVLA 2DZJA 2BW2A 1T6BX 4W9IA 1XT9B 2JVCA 4MSQB 3VUYA 1IPGA 4E3CA 2ZNVB 4W9GA 3SDLC 4MGIE 1MG4A 1IBXA 3GE3C 3FILB 1J7CA 2QCZA 3SEBA 3OJ4B 2GRIA 3RNAC 3NVYA 2KT7A 4MT5A 3IT6B 2ONQA 1MFWA 4BFRA 3FKYA 1Z5SB 1UUPA 1EF5A 1XLOA 4B0EA 2MLBA 4IM2A 5AUIA 3BK1A 1ZKHA 2R61A 3SFDB 4ANUA 5BYRA 4LTUA 2OOBB 5JH5C 3PSEB 1V1PB 4HCPB 1M4VA 3AE4B 2EMSA 1LM8B 4B6WA 4MDKE 1WX7A 1ACCA 3EECA 4NNJB 4EZKA 4MACA 2ZVOA 3ML8A 1ESFA 2HDEA 4YSZB 4TSSA 3R2IA 3RNCC 4II2B 2MH7A 4XDDA 3MHSD 3TL5A 1B9RA 4HCNB 2M1MA 4EZLA 4R3DA 3ZDTA 5EE0A 1T3QA 1UGMA 4C7YA 2XN9C 2O2VB 1K51A 4MJSB 3V05A 4KVGB 1E8XA 1JMLA 3E9SA 3D32A 4RF0A 2LXCA 4EKUA 5GXGB 1NVID 3SU8X 5EDSA 1DOXA 1V1OA 3QX1A 2WS3B 2QHOA 1YQBA 1E0ZA 3WIMA 2K1FA 5FR3A 1LXDA 3ZXVA 2WLBA 3TEZA 1R4NB 1EU4A 2K8BA 3CSFA 2FCSA 1ZGUB 4EE2A 4XYCA 1RRBA 1YX5B 5KHQA 2L00B 2LRUA 2O6VB 1LGRA 2N7JA 1FRDA 2FBWB 2ZPYA 3Q14C 4KDIC 2RDBC 1JWBD 2JPHA 2LD9A 1ENFA 1FFVA 3V61A 3IFWB 1V6EA 3VH4B 2KACA 3IVFA 2D11A 3GB1A 4PS3A 2ZNVC 3B2FA 1KJTA 4Q2JA 4IOIE 3H8HA 4FADA 2KVZA 2JXXA 2V9HA 1IP9A 4F7ZA 1EF1A 3ZNZB 1L6VA 4KKIA 1E8YA 2FNJB 4HWIB 2NS5A 3CF6E 1E9MA 3LB8C 3ZDMC 3CSTA 2WP9B 3AE5B 2KN4A 4KZ0A 4L2YA 1UD7A 2CR5A 3ECIA 3ZGZA 2N9XA 3RNGC 1AN8A 3PRMB 2LJ5A 1EU3A 2VH2A 3NZ3A 1YJ1A 2W82A 3A4SC 1Q1OA 3URYA 3H7SA 3AECB 3N30A 2ZPNA 4WWMA 2LI5A 2N9EB 3JSVB 1E7PB 1WGHA 1HA5A 2RDHA 1E90A 3S2AA 3R3MA 2IO2B 2KTRA 1KLUD 3EC8A 4BZAA 4FJZA 4HPMB 5C23A 5E6JA 4JE3B 2WXFA 2BPSA 4MELA 3OLMD 1HZ6A 3Q8AA 2KMMA 3BIID 4LDTB 1QF6A 2WWZA 3H1UA 4WJPA 3MC0B 2LGSA 3ABVB 1ZDXA 1C77A 4BVUC 3UQBA 1SJHD 3FC4A 4YSXB 4O1NA 2MWSB 2M4NA 5LNK1 2DAFA 2JUOA 3NS1A 2WHIA 3L13A 2JRHA 1V81A 2J0JA 3VRAB 1I35A 3BVGA 4P1CC 4HKQA 1GJZA 1SGHA 1UF0A 2K5PA 3ZRCA 1FCCC 3SR6A 4NQLB 3NZUA 2EKEC 3K9PB 5G5HA 1FNVA 2L05A 3PZ7A 4GDLA 2G1EA 2Z0DB 2CHZA 2V4IB 3LXFA 4DDGD 4LLGM 1JWMD 4US9A 3DOWA 3A33B 3L54A 1TKGA 2G4DB 4ZRPA 2DAJA 1G6JA 1P1AA 3QQ8B 1D5MC 3DPDA 2BWFA 4C4VB 5AEKB 4XWTA 3L4PA 1BMLC 4G11A 2C7HA 2BKRB 3A9JB 2IGGA 2WU2B 3X0WA 1TS4A 2KWVB 4KDLB 4G50A 3EUB2 3RYTA 3ZIMA 1J7AA 2N7EA 4MH8A 4HROA 4P1BC 1TTNA 3RPFC 3AM9A 1P7EA 4H2AA 3PT2B 4A90A 1WXAA 3IG3A 3N1YC 2C9WB 4A20A 3M3JA 2MA9B 1PGXA 1J0GA 1TIFA 1E7VA 4WJOA 1XCQL 1YQ4B 2V1YA 2NPTB 3ML9A 5AZFA 1GC6A 2WXLA 3MC9A 4D2KA 3WA0A 3AMZA 3X23A 1C4AA 3TEWA 3UIOB 4RM8A 2J53A 4KIKA 3QIJA 2JRIB 1WR1A 2GBKA 4B0MA 3B08A 2D10A 3JVZX 4JGHB 2M56B 2K22A 4DWFA 1K53A 2V4LA 3DWMA 4C00A 1ISNA 3AH7A 3QK0A 3Q3MC 4BOZB 1ZPSA 2TSSA 2IY0B 2YLMA 2MP2A 3U4EG 1PQSA 1C78A 4IW0A 2KWUB 3TEYA 1ZXHA 3QA8A 1S1QB 4S17A 5DPSA 2BS2B 5G2NA 2NMQA 5GMVA 4FLHA 5BYSA 2WXMA 3FILA 1C79A 2DNFA 1I4RA 2RSUA 2GBMA 1NYRA 3PGEA 1F0ZA 3KH0A 2WXJA 3Q8FA 2FIDA 5JHBA 3VTUA 4WJQA 3R7QA 2RPVA 3ZNGC 4TQ0A 4ICVA 1HTOA 4NJ6A 2NTSA 4K3CA 1TY0A 1V1PA 5H92C 4ZRQA 1XD3B 1I4HA 1Q10A 3PRZA 3JW0X 3N1XC 1D4BA 3DQVA 2N4FA 4FHJA 1MHHE 5LXHA 1J19A 4W9CA 2GBJA 4L23A 1FRRA 1C76A 3PRPB 3V62A 1WH3A 5JHAA 4DXAB 3DDCB 1WJNA 1WE7A 2KO3A 4WJNA 4YL8A 4K1RB 2J0KA 4HLEA 1MJDA 2O2VA 3QWZB 3WAMA 2MQJA 2ZZPB 4GN1A 4EOYA 1YN3A 2BYFA 4HPLB 3W9CB 1WI0A 2SAKA 1NI2A 2L7RA 2BTEA 4ZHOA 3PPAA 3L17A 2JWUA 4NQKE 3AEDB 2RGFA 3NOBA 4WAAA 1V97A 2M0AA 4K7SA 5CHFA 4ZRJA 2IBIB 2WGSA 2KMAA 4J3OD 3IAS1 3EGRA 4C80A 2CKHB 3ZVVA 3AE8B 4WIPA 2WNMA 3ZNID 1IYFA 2AL3A 4EZJA 3Q69A 2W9NA 2JZPA 1NBFC 2KC1A 2HJ1A 4WAFA 1QKZA 2O6VA 5DPTA 1FNWA 1JWSD 2N1VA 3A1QB 4GIVA 1QOGA 1N62A 3NVWA 3B1LX 4IUMB 1SF0A 2AEHA 3SD5A 1TGZB 1VCBA 1Y56A 1VR9A 2OEDA 2LJIA 1QLBB 1YJIA 4KGRA 1DGJA 3AN1A 5BO4B 2PIAA 4JWUC 4AJWA 4OZCA 3VUWA 4W9KA 2KDEB 4N9F4 1E8WA 1GG3A 1L4DB 4NZLB 2EELA 2L0TA 3BZDB 1KTKA 2L0FA 4ZDVA 1XCTL 5DPWA 1JWAD 1CK1A 2CU1A 2NR2A 4IC7B 3KLSX 2D2QA 3DHHC 2LMCA 2FAZA 1YJJA 3NZSA 5AUKA 1K52A 1WGDA 1WSPA 3W5VB 1VZ6A 2DYBA 2LVQA 5IOIA 4EEWA 3JSVA 4NY0A 4X57B 1TJEA 2OHFA 3PS6A 1C3TA 1KH0A 1WJUA 3GP7A 4K3BA 1TT5B 4PT5A 4HDOA 1XLQA 3A9KB 2D3BA 1RFAA 3AEFB 4HKZE 1WX8A 1RFKA 3KWVA 3TSSA 1U4AA 1X1MA 4W9EA 1C1YB 1OQRA 2O6VD 4B9KA 1PGBA 2DWQA 4LJOB 3W2DA 1WE6A 3AE2B 1A70A 3BY4B 4W9JA 3ZJTA 1TY2A 2BT6A 1MI0A 2LGDA 4NAMA 3QC8B 3BINA 2REXA 5HHDG 2EKIA 3N32A 3TEXA 2KQ7A 3DCGA 1RM6C 3VUXA 4RMAA 4LK0M 3I63C 4BKSA 1QOBA 2ICIA 3DBLB 5TR5A 1V86A 1EWCA 1WR6E 1ZP0B 2CHXA 4IWQA 3KUDB 2CS4A 1YN5A 4LNFA 3T8MA 3NG0A 1FXAA 3APCA 1OTRB 3P63A 4FA6A 1FNUA 2BYEA 4DK5A 3QJZA 4JLCA 2LHEA 3IBEA 1JWUD 1P7FA 3DBSA 4QAYA 4JPSA 1V8CA 4ARCA 4C4VA 2IY1B 1T0QC 2YEPB 3KWLA 4I6LB 3ZXRA 3M95A 2LUEA 4W9DA 2WYQA 1CZPA 2VH1A 1NEKB 1YQ3B 2JWZA 3O13A 4TUUA 1SSNA 3DVNU 4WWOA 2H89B 1K50A 1F2RC 2JX5A 1F1HA 3RUIB 3OAWA 2NBVB 4BBNF 1I4GA 2ZVNA 4AJYB 2X8XX 1CMXB 3VTVA 1BXTA 3KVFB 4RGTA 4LDTD 3PREA 2CJOA 2WXQA 2WXPA 2Y5PA 2GLSA 5J18A 2PEAA 2JZZA 2BKFA 4AOFA 2NPTA 1TZ1A 1GUAB 4BKSD 2DX5B 1WGYA 2JYEA 3OWEB 2RPQA 1DOYA 1SE9A 1I4QA 3IAM1 3GZNB 2KK8A 1PFDA 3I57A 2HTHA 4MGZE 1VRAB 3AI5A 3PHXB 2K8CA 5DPRA 5D7GA 4PS7A 1ZUD2 1CQVA 1SEBD 3ZLZA 2PTLA 2HE7A 2KX3A 3HVZA 1IBXB 1V2YA 2KMCA 3MJ5A 2KXJA 2JZ3B 4MGKE 4GLSC 1GPXA 2BB6A 3T3NA 3U8ZA 3NJTA 1WRIA 4AWJA 3KUZA 2ZW1A 1GB4A 3IHPC 4XC2A 3MHZA 1BUIC 4KGTA 1SJED 4L1BA 4P6VF 3VQIA 4RGOS 3WAOA 2XNAC 2JQRB 5EE9A 3K9OB 1QOAA 1TS3A 1HQRD 3RZFA 3BYYB 1JALA 2J52A 4NAWB 4M8MA 2M0XA 1GB1A 1TBEA 3OJ3A 1FIQA 1KLGD 1Q0WB 1YIWA 4JWSC 2KWCA 4M00A 3IT4B 1TZOA 1F2RI 3C8YA 4YTNB 2KVRA 5FKAC 4CYEA 1KM7A 5L83A 1H4RA 4A6QA 2INPE 3P1MA 3AU5A 4AP4C 3DVGY 2XBBC 1WXSA 2KJRA 4USAA 4IM0A 3VVWB 5D3IB 2M8SA 4ZOHC 2HD5B 3Q3NC 4XZ4A 1H8CA 4WWNA 3HVDA 1WF9A 3P4QB 3QAQA 1WY8A 2PPHA 5C3JB 1NYQA 3KYCD 1YN4A 3TUOA 2QIEB 2XEWA 2ZW0A 2KFJA
chains in the Genus database with same CATH topology
3PRPB 2MBEA 3V62A 1WH3A 4ASWC 4J6IA 1WM3A 4BFRA 5JHAA 3KW5B 4IWPA 4DXAB 1Z5SB 2ASQA 1EF5A 1OQYA 3DDCB 1WYWB 1WJNA 1WE7A 2KO3A 2MLBA 4IM2A 4WJNA 4FBJB 4YL8A 4K7WA 1P0RA 2N7DA 4K1RB 1ZKHA 5LLIA 2J0KA 4ANUA 3KUCB 3WALA 2IZVB 4HLEA 5LXIB 2KNBA 3W1YA 2OOBB 3PZDA 2O2VA 3QWZB 3PSEB 5JH5C 1EO6A 4HCPB 3W1SC 1E7UA 2C7NB 2GBRA 3WAMA 2D3GA 2MQJA 2ZZPB 4CO7A 3VDZA 4GN1A 1WGRA 4EOYA 2BYFA 2EMSA 4HPLB 1LQBA 1LM8B 2LRWA 4TQ1A 4B6WA 4MDKE 4F8CB 1WX7A 1WI0A 4ZRKA 3EECA 3MJWA 2OJRA 2ZJDA 1NI2A 4NNJB 4EZKA 5D6JB 2L7RA 2ZVOA 2KOXA 3ML8A 3VTWA 3PPAA 3L17A 4FJYA 4LCDE 4NQKE 4WQOB 5C1ZA 2RGFA 3H7PA 4PYUA 2JY6A 2KANA 2XK5A 3DBLI 3NOBA 2GMIC 3VAWA 4II2B 4WAAA 1F9JA 3MHSD 3TL5A 4HCNB 4K7SA 3A4RA 4OVUA 2M1MA 3ENEA 5CHFA 3Q3JA 4ZRJA 4EZLA 2IBIB 3U7DA 3ZDTA 2KMAA 4ANVA 1WRDB 2Y5BB 1MG8A 3MTNB 3UIPB 1UGMA 1WZ0A 2UWQA 2CKHB 2O2VB 4MJSB 3ZVVA 3UINB 4KVGB 2AL6A 1E8XA 4WWPA 5E6NA 3D32A 3VHTC 3ZNID 1IYFA 1P9DU 2LXCA 4GMVA 4EKUA 3RD2A 3SHQA 2AL3A 4EZJA 2W9NA 2MBOA 1NBFC 2KZRA 3SU8X 3VH3B 5EDSA 2KC1A 5CHWA 5HKHA 1WX9A 2O6VA 3QX1A 5DPTA 4ZRIA 1WJ4A 2QHOA 2IO1B 2N1VA 3A1QB 4GIVA 1YQBA 3H7PB 3CMMB 3B1LX 2XK5B 4IUMB 3WIMA 2AEHA 2B3AA 2K1FA 3SD5A 1LFDA 1TGZB 1VCBA 2R2QA 1M94A 4TKNA 2KHWB 1LXDA 2GBNA 3ZW3A 1L2NA 3ALBA 3HHMA 4A3PA 3C0RB 2PE6B 2G45B 2MX2A 3LDZE 2KN5A 3ZNHB 2K8BA 3V6EB 1NDDA 3AXCA 2C60A 3CSFA 3L08A 5BO4B 2FCSA 2LVOA 2NBWB 3WAPA 2KTRB 1EUVB 4AUQC 4AJWA 3QARA 1ZGUB 3VUWA 4ANWA 4BKTA 3ZUNA 3PLVA 4KZCA 2NCNA 2KDEB 4FJVB 4W9KA 1RRBA 3M63B 2DZKA 2DHZA 4N9F4 1E8WA 1GG3A 1WJ6A 1YX5B 4G3XB 2FCNA 5KHQA 2L00B 2LRUA 1FXTB 2I1KA 2O6VB 3UF8A 4ANXA 2I1JA 2L0TA 2ZPYA 5E6PA 4BKGA 4KDIC 4JIOU 2JPHA 2V3SA 5CTRC 2L0FA 4ZDVA 2LD9A 3A9KA 5DPWA 2LZ6A 3V61A 5D94A 3IFWB 1V6EA 3VH4B 4OVVA 3IVFA 2D11A 2CU1A 2NR2A 4IC7B 2G4SA 2D2QA 4PS3A 1P3QU 5AZHA 5E6OA 3DVGX 4E71A 2FAZA 3N3KB 3NZSA 2ZNVC 1WGDA 1KJTA 4FADA 2MSED 2JXXA 1IP9A 1BT0A 4GOCA 4F7ZA 3GZNI 1EF1A 2MBBB 3ZNZB 2DYBA 4FULA 3HK0A 2J7QB 1E8YA 2LVQA 3AULA 4EEWA 2FNJB 2LASA 3JSVA 2LXAA 2WX0A 4HWIB 4NY0A 2NS5A 3CF6E 4X57B 4EUTA 3ZDMC 1I42A 3CSTA 3R66C 1GC7A 4KZ0A 3PS6A 1C3TA 1UD7A 4GDLB 3PV1A 2BGFA 1WJUA 2L8JA 3P2BA 2CR5A 4MJSA 3ECIA 4HDOA 2C5LC 3A9KB 1RFAA 2N9XA 2MCNB 2LWPA 3JYUA 3TIXA 1WX8A 2ZCBA 3PRMB 2LJ5A 2FCMA 2KQSA 1U4AA 1X1MA 1YJ1A 4W9EA 1C1YB 4MM3A 2O6VD 4B9KA 3EFUA 3A4SC 4KSLC 1Q1OA 4M8NA 4LJPB 4W9HA 4LJOB 2DENB 3A1QA 3PTFC 3L0WB 3H7SA 1WE6A 3N30A 1RAXA 2ZPNA 3BY4B 4W9JA 2LI5A 4G0NB 2KC2A 2N9EB 2BWES 2ZEQA 3JSVB 2LGDA 2K6DB 1WZ3A 4K81A 4TV3A 1WGGA 1V5OA 3QC8B 1WGHA 3BINA 2D07B 4HJKA 3TBLD 2REXA 1E90A 2BYVE 2KLCA 4W9LA 3DVNV 3N32A 3NS8A 2KQ7A 2KLGA 2PJHA 3DCGA 3H9DA 3R3MA 3S2AA 3VUXA 3B0AA 3U30A 3ZRFA 1HE8A 4RMAA 2IO2B 2KTRA 4PS8A 4BKSA 2WX1A 3EC8A 4FJZA 4DBGA 2A4ZA 2LVPA 4HPMB 5C23A 3RULA 3HM3A 1XQQA 2L76A 5TR5A 1V86A 5CX3A 1WR6E 2CHXA 2BPSA 4IWQA 3OLMD 4MELA 1OEYA 2FIFA 1OGWA 3KUDB 3L16A 3T9LA 2CS4A 4ZYNA 5D2MB 3DBRI 3APDA 4PYZA 4GDKA 2MBHA 4LDTB 3TJPA 1WXVA 2WWZA 3H1UA 4WJPA 3T8MA 3APCA 4FHKA 1ZW7A 1OTRB 3AU4A 1UBIA 4BVUC 1YD8U 2JF5A 3UQBA 4FA6A 5L95C 1R4NI 1WMHA 2BYEA 1GNUA 4DK5A 3QJZA 2MWSB 2M4NA 4JLCA 3IBEA 2DAFA 2JUOA 3DBSA 1UZXB 3RCZA 2VRRB 4GGQA 2IY1B 1YX6B 1QZEA 2JRHA 3L13A 5G55A 5J17A 1V81A 2J0JA 1KOTA 1I35A 4I6LB 1VD2A 1GJZA 1SGHA 3M95A 2KTFA 3ZRCA 2LUEA 1AARA 4W9DA 4NQLB 3NZUA 1WM2A 2EKEC 3K9PB 2L05A 2WYQA 3L10B 2KJ6A 3RZWC 1K8RB 4GDLA 2Z0DB 2JWZA 4TUUA 1V49A 4GDKB 2CHZA 2CHWA 2WDTB 4DDGD 4DDID 2KDIA 1V9JA 3DVNU 3EHVA 3DOWA 4WWOA 3A33B 3L54A 2G4DB 1UBQA 3QCAA 2DAJA 2MRPA 3RUIB 3OAWA 2NBVB 4BBNF 1G6JA 3W1SA 1P1AA 2ZVNA 4AJYB 1WMHB 3LJ3A 3QQ8B 3Q3FA 1CMXB 3VTVA 2RD0A 4BBNC 2L3ZA 2R2OA 2MP2B 2IYDB 2ZCCA 3KVFB 4IM3A 1Z2MA 2N1WA 4GXBA 4LDTD 4MSMB 4XX5A 3DPDA 3O65B 1WXMA 1SIFA 2NBUA 3PREA 2BWFA 4EFOA 2FUHB 5AEKB 1D3ZA 1R4MI 3ZKJC 4G11A 2DZMA 4HVBA 4II3B 4M0WB 5J18A 2C7HA 1KLVA 2BKRB 2PEAA 3A9JB 2JZZA 4JL9A 3X0WA 2BKFA 3UQAA 4AOFA 2KWVB 4E74A 4KDLB 2NPTA 3GOEA 4G50A 1TZ1A 1GUAB 3RYTA 3ZIMA 2PE9A 3NHEB 5FR6A 4CHKA 4GU2A 2N7EA 2KD0A 4BKSD 2DX5B 1WGYA 1V80A 5AZGA 2RPQA 4JQWC 1SE9A 1TTNA 3HM6X 2KFKA 2YVCA 3VXWA 3PT2B 1Q5WB 2KK8A 1WXAA 3IG3A 2HTHA 4MGZE 5DCNA 3AI5A 3HIZA 3PHXB 4NJ7A 1T0YA 4NPNA 1OEYJ 2C9WB 4A20A 3UGBB 3M3JA 2K8CA 2JT4B 2MA9B 1V5TA 2BF8B 3ZTCA 3APFA 5DPRA 5D7GA 4PS7A 4DHZB 1J0GA 4HXDA 2C7MB 5JZEB 1WFYA 2IO3B 3DBHI 4GSWA 3ZLZA 2KDFB 2HE7A 2FCQA 1P98A 1E7VA 2DYOA 4WJOA 2K6QA 2KX3A 2G3QB 2J0MA 2V1YA 2NPTB 1V2YA 2KKCA 2KMCA 4F1SA 2RR9A 2KDBA 1RLFA 2KXJA 1JRUA 3ML9A 3KYDD 4NAWA 4DHJB 5AZFA 1UELA 1GC6A 2DZIA 2JZ3B 1Y8RC 2UYZB 4MGKE 4MEMA 3WANA 4I6NB 3PLUA 4DHZE 3WA0A 3X23A 4I6PA 2KFKB 3U8ZA 2K8HA 3UIOB 4RM8A 4KIKA 4ICUA 3QIJA 4GB9A 4AWJA 2MW5A 1E8ZA 3KUZA 3IHPC 2JRIB 4XC2A 1WR1A 2GBKA 4IG7B 4IWOA 3B08A 2D10A 1S3SG 3JVZX 4JGHB 3RT3B 1WIAA 3WAOA 3VQIA 4DWFA 4W9FA 4MH0E 4A3OA 2V4LA 1ISNA 2LGXA 3K9OB 5IAAC 3V60A 3QK0A 4RM9A 4BOZB 3RZFA 5IA7A 4MGYE 2A5UA 2IY0B 2K25A 2KJHB 2YLMA 4NAWB 2MP2A 3TMPB 1PQSA 4P7IA 4IW0A 4HK2A 2M0XA 4M8MA 1TBEA 2KWUB 3OJ3A 3H6NA 4B95A 2DYMA 2IO0B 2KX0A 3QHTA 4HDQA 4K7UA 3QA8A 1S1QB 1Q0WB 1YIWA 5DPSA 5G2NA 2AYOB 2N9PC 4KIKB 2GOWA 2KWCA 2HJ8A 4BOSC 3A9JA 2NVUI 4URKA 2K39A 3M62B 5KHOA 5GMVA 1L7YA 4FLHA 4DHJD 3PHWB 2Z0EB 2KVRA 4CYEA 1KM7A 5L83A 1H4RA 3NY5A 2AWTA 2Z59B 2RSUA 2GBMA 4KSKC 3VFKA 4FN2A 1UH6A 2LGYA 3ZO5B 5J2RA 3TCAA 2M17A 2MBQA 1E5WA 3AU5A 3PGEA 3DVGY 2XBBC 4AP4C 1WXSA 3KH0A 2FIDA 2KJRA 2EMTA 5JHBA 1A5RA 3PVLA 3VTUA 4IM0A 2DZJA 3VVWB 4WJQA 1J8CA 2M8SA 3R7QA 2HD5B 3ZNGC 3V6CB 4TQ0A 4XZ4A 3ONSA 3I3TB 4W9IA 1XT9B 4WWNA 1H8CA 2JVCA 4ICVA 4MSQB 4NJ6A 3VUYA 1WF9A 1IPGA 3QAQA 4E3CA 1WY8A 2PPHA 2ZNVB 3ZTDA 4W9GA 1XD3B 3SDLC 3PRZA 3JW0X 4MGIE 3KYCD 3DQVA 2N4FA 4FHJA 5CHVC 5LXHA 1J19A 2XEWA 4KV2A 4W9CA 2GBJA 3OJ4B 2KFJA 3R7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PRP B;  2MBE A;  3V62 A;  1WH3 A;  4ASW C;  4J6I A;  1WM3 A;  4BFR A;  5JHA A;  3KW5 B;  4IWP A;  4DXA B;  1Z5S B;  2ASQ A;  1EF5 A;  1OQY A;  3DDC B;  1WYW B;  1WJN A;  1WE7 A;  2KO3 A;  2MLB A;  4IM2 A;  4WJN A;  4FBJ B;  4YL8 A;  4K7W A;  1P0R A;  2N7D A;  4K1R B;  1ZKH A;  5LLI A;  2J0K A;  4ANU A;  3KUC B;  3WAL A;  2IZV B;  4HLE A;  5LXI B;  2KNB A;  3W1Y A;  2OOB B;  3PZD A;  2O2V A;  3QWZ B;  3PSE B;  5JH5 C;  1EO6 A;  4HCP B;  3W1S C;  1E7U A;  2C7N B;  2GBR A;  3WAM A;  2D3G A;  2MQJ A;  2ZZP B;  4CO7 A;  3VDZ A;  4GN1 A;  1WGR A;  4EOY A;  2BYF A;  2EMS A;  4HPL B;  1LQB A;  1LM8 B;  2LRW A;  4TQ1 A;  4B6W A;  4MDK E;  4F8C B;  1WX7 A;  1WI0 A;  4ZRK A;  3EEC A;  3MJW A;  2OJR A;  2ZJD A;  1NI2 A;  4NNJ B;  4EZK A;  5D6J B;  2L7R A;  2ZVO A;  2KOX A;  3ML8 A;  3VTW A;  3PPA A;  3L17 A;  4FJY A;  4LCD E;  4NQK E;  4WQO B;  5C1Z A;  2RGF A;  3H7P A;  4PYU A;  2JY6 A;  2KAN A;  2XK5 A;  3DBL I;  3NOB A;  2GMI C;  3VAW A;  4II2 B;  4WAA A;  1F9J A;  3MHS D;  3TL5 A;  4HCN B;  4K7S A;  3A4R A;  4OVU A;  2M1M A;  3ENE A;  5CHF A;  3Q3J A;  4ZRJ A;  4EZL A;  2IBI B;  3U7D A;  3ZDT A;  2KMA A;  4ANV A;  1WRD B;  2Y5B B;  1MG8 A;  3MTN B;  3UIP B;  1UGM A;  1WZ0 A;  2UWQ A;  2CKH B;  2O2V B;  4MJS B;  3ZVV A;  3UIN B;  4KVG B;  2AL6 A;  1E8X A;  4WWP A;  5E6N A;  3D32 A;  3VHT C;  3ZNI D;  1IYF A;  1P9D U;  2LXC A;  4GMV A;  4EKU A;  3RD2 A;  3SHQ A;  2AL3 A;  4EZJ A;  2W9N A;  2MBO A;  1NBF C;  2KZR A;  3SU8 X;  3VH3 B;  5EDS A;  2KC1 A;  5CHW A;  5HKH A;  1WX9 A;  2O6V A;  3QX1 A;  5DPT A;  4ZRI A;  1WJ4 A;  2QHO A;  2IO1 B;  2N1V A;  3A1Q B;  4GIV A;  1YQB A;  3H7P B;  3CMM B;  3B1L X;  2XK5 B;  4IUM B;  3WIM A;  2AEH A;  2B3A A;  2K1F A;  3SD5 A;  1LFD A;  1TGZ B;  1VCB A;  2R2Q A;  1M94 A;  4TKN A;  2KHW B;  1LXD A;  2GBN A;  3ZW3 A;  1L2N A;  3ALB A;  3HHM A;  4A3P A;  3C0R B;  2PE6 B;  2G45 B;  2MX2 A;  3LDZ E;  2KN5 A;  3ZNH B;  2K8B A;  3V6E B;  1NDD A;  3AXC A;  2C60 A;  3CSF A;  3L08 A;  5BO4 B;  2FCS A;  2LVO A;  2NBW B;  3WAP A;  2KTR B;  1EUV B;  4AUQ C;  4AJW A;  3QAR A;  1ZGU B;  3VUW A;  4ANW A;  4BKT A;  3ZUN A;  3PLV A;  4KZC A;  2NCN A;  2KDE B;  4FJV B;  4W9K A;  1RRB A;  3M63 B;  2DZK A;  2DHZ A;  4N9F 4;  1E8W A;  1GG3 A;  1WJ6 A;  1YX5 B;  4G3X B;  2FCN A;  5KHQ A;  2L00 B;  2LRU A;  1FXT B;  2I1K A;  2O6V B;  3UF8 A;  4ANX A;  2I1J A;  2L0T A;  2ZPY A;  5E6P A;  4BKG A;  4KDI C;  4JIO U;  2JPH A;  2V3S A;  5CTR C;  2L0F A;  4ZDV A;  2LD9 A;  3A9K A;  5DPW A;  2LZ6 A;  3V61 A;  5D94 A;  3IFW B;  1V6E A;  3VH4 B;  4OVV A;  3IVF A;  2D11 A;  2CU1 A;  2NR2 A;  4IC7 B;  2G4S A;  2D2Q A;  4PS3 A;  1P3Q U;  5AZH A;  5E6O A;  3DVG X;  4E71 A;  2FAZ A;  3N3K B;  3NZS A;  2ZNV C;  1WGD A;  1KJT A;  4FAD A;  2MSE D;  2JXX A;  1IP9 A;  1BT0 A;  4GOC A;  4F7Z A;  3GZN I;  1EF1 A;  2MBB B;  3ZNZ B;  2DYB A;  4FUL A;  3HK0 A;  2J7Q B;  1E8Y A;  2LVQ A;  3AUL A;  4EEW A;  2FNJ B;  2LAS A;  3JSV A;  2LXA A;  2WX0 A;  4HWI B;  4NY0 A;  2NS5 A;  3CF6 E;  4X57 B;  4EUT A;  3ZDM C;  1I42 A;  3CST A;  3R66 C;  1GC7 A;  4KZ0 A;  3PS6 A;  1C3T A;  1UD7 A;  4GDL B;  3PV1 A;  2BGF A;  1WJU A;  2L8J A;  3P2B A;  2CR5 A;  4MJS A;  3ECI A;  4HDO A;  2C5L C;  3A9K B;  1RFA A;  2N9X A;  2MCN B;  2LWP A;  3JYU A;  3TIX A;  1WX8 A;  2ZCB A;  3PRM B;  2LJ5 A;  2FCM A;  2KQS A;  1U4A A;  1X1M A;  1YJ1 A;  4W9E A;  1C1Y B;  4MM3 A;  2O6V D;  4B9K A;  3EFU A;  3A4S C;  4KSL C;  1Q1O A;  4M8N A;  4LJP B;  4W9H A;  4LJO B;  2DEN B;  3A1Q A;  3PTF C;  3L0W B;  3H7S A;  1WE6 A;  3N30 A;  1RAX A;  2ZPN A;  3BY4 B;  4W9J A;  2LI5 A;  4G0N B;  2KC2 A;  2N9E B;  2BWE S;  2ZEQ A;  3JSV B;  2LGD A;  2K6D B;  1WZ3 A;  4K81 A;  4TV3 A;  1WGG A;  1V5O A;  3QC8 B;  1WGH A;  3BIN A;  2D07 B;  4HJK A;  3TBL D;  2REX A;  1E90 A;  2BYV E;  2KLC A;  4W9L A;  3DVN V;  3N32 A;  3NS8 A;  2KQ7 A;  2KLG A;  2PJH A;  3DCG A;  3H9D A;  3R3M A;  3S2A A;  3VUX A;  3B0A A;  3U30 A;  3ZRF A;  1HE8 A;  4RMA A;  2IO2 B;  2KTR A;  4PS8 A;  4BKS A;  2WX1 A;  3EC8 A;  4FJZ A;  4DBG A;  2A4Z A;  2LVP A;  4HPM B;  5C23 A;  3RUL A;  3HM3 A;  1XQQ A;  2L76 A;  5TR5 A;  1V86 A;  5CX3 A;  1WR6 E;  2CHX A;  2BPS A;  4IWQ A;  3OLM D;  4MEL A;  1OEY A;  2FIF A;  1OGW A;  3KUD B;  3L16 A;  3T9L A;  2CS4 A;  4ZYN A;  5D2M B;  3DBR I;  3APD A;  4PYZ A;  4GDK A;  2MBH A;  4LDT B;  3TJP A;  1WXV A;  2WWZ A;  3H1U A;  4WJP A;  3T8M A;  3APC A;  4FHK A;  1ZW7 A;  1OTR B;  3AU4 A;  1UBI A;  4BVU C;  1YD8 U;  2JF5 A;  3UQB A;  4FA6 A;  5L95 C;  1R4N I;  1WMH A;  2BYE A;  1GNU A;  4DK5 A;  3QJZ A;  2MWS B;  2M4N A;  4JLC A;  3IBE A;  2DAF A;  2JUO A;  3DBS A;  1UZX B;  3RCZ A;  2VRR B;  4GGQ A;  2IY1 B;  1YX6 B;  1QZE A;  2JRH A;  3L13 A;  5G55 A;  5J17 A;  1V81 A;  2J0J A;  1KOT A;  1I35 A;  4I6L B;  1VD2 A;  1GJZ A;  1SGH A;  3M95 A;  2KTF A;  3ZRC A;  2LUE A;  1AAR A;  4W9D A;  4NQL B;  3NZU A;  1WM2 A;  2EKE C;  3K9P B;  2L05 A;  2WYQ A;  3L10 B;  2KJ6 A;  3RZW C;  1K8R B;  4GDL A;  2Z0D B;  2JWZ A;  4TUU A;  1V49 A;  4GDK B;  2CHZ A;  2CHW A;  2WDT B;  4DDG D;  4DDI D;  2KDI A;  1V9J A;  3DVN U;  3EHV A;  3DOW A;  4WWO A;  3A33 B;  3L54 A;  2G4D B;  1UBQ A;  3QCA A;  2DAJ A;  2MRP A;  3RUI B;  3OAW A;  2NBV B;  4BBN F;  1G6J A;  3W1S A;  1P1A A;  2ZVN A;  4AJY B;  1WMH B;  3LJ3 A;  3QQ8 B;  3Q3F A;  1CMX B;  3VTV A;  2RD0 A;  4BBN C;  2L3Z A;  2R2O A;  2MP2 B;  2IYD B;  2ZCC A;  3KVF B;  4IM3 A;  1Z2M A;  2N1W A;  4GXB A;  4LDT D;  4MSM B;  4XX5 A;  3DPD A;  3O65 B;  1WXM A;  1SIF A;  2NBU A;  3PRE A;  2BWF A;  4EFO A;  2FUH B;  5AEK B;  1D3Z A;  1R4M I;  3ZKJ C;  4G11 A;  2DZM A;  4HVB A;  4II3 B;  4M0W B;  5J18 A;  2C7H A;  1KLV A;  2BKR B;  2PEA A;  3A9J B;  2JZZ A;  4JL9 A;  3X0W A;  2BKF A;  3UQA A;  4AOF A;  2KWV B;  4E74 A;  4KDL B;  2NPT A;  3GOE A;  4G50 A;  1TZ1 A;  1GUA B;  3RYT A;  3ZIM A;  2PE9 A;  3NHE B;  5FR6 A;  4CHK A;  4GU2 A;  2N7E A;  2KD0 A;  4BKS D;  2DX5 B;  1WGY A;  1V80 A;  5AZG A;  2RPQ A;  4JQW C;  1SE9 A;  1TTN A;  3HM6 X;  2KFK A;  2YVC A;  3VXW A;  3PT2 B;  1Q5W B;  2KK8 A;  1WXA A;  3IG3 A;  2HTH A;  4MGZ E;  5DCN A;  3AI5 A;  3HIZ A;  3PHX B;  4NJ7 A;  1T0Y A;  4NPN A;  1OEY J;  2C9W B;  4A20 A;  3UGB B;  3M3J A;  2K8C A;  2JT4 B;  2MA9 B;  1V5T A;  2BF8 B;  3ZTC A;  3APF A;  5DPR A;  5D7G A;  4PS7 A;  4DHZ B;  1J0G A;  4HXD A;  2C7M B;  5JZE B;  1WFY A;  2IO3 B;  3DBH I;  4GSW A;  3ZLZ A;  2KDF B;  2HE7 A;  2FCQ A;  1P98 A;  1E7V A;  2DYO A;  4WJO A;  2K6Q A;  2KX3 A;  2G3Q B;  2J0M A;  2V1Y A;  2NPT B;  1V2Y A;  2KKC A;  2KMC A;  4F1S A;  2RR9 A;  2KDB A;  1RLF A;  2KXJ A;  1JRU A;  3ML9 A;  3KYD D;  4NAW A;  4DHJ B;  5AZF A;  1UEL A;  1GC6 A;  2DZI A;  2JZ3 B;  1Y8R C;  2UYZ B;  4MGK E;  4MEM A;  3WAN A;  4I6N B;  3PLU A;  4DHZ E;  3WA0 A;  3X23 A;  4I6P A;  2KFK B;  3U8Z A;  2K8H A;  3UIO B;  4RM8 A;  4KIK A;  4ICU A;  3QIJ A;  4GB9 A;  4AWJ A;  2MW5 A;  1E8Z A;  3KUZ A;  3IHP C;  2JRI B;  4XC2 A;  1WR1 A;  2GBK A;  4IG7 B;  4IWO A;  3B08 A;  2D10 A;  1S3S G;  3JVZ X;  4JGH B;  3RT3 B;  1WIA A;  3WAO A;  3VQI A;  4DWF A;  4W9F A;  4MH0 E;  4A3O A;  2V4L A;  1ISN A;  2LGX A;  3K9O B;  5IAA C;  3V60 A;  3QK0 A;  4RM9 A;  4BOZ B;  3RZF A;  5IA7 A;  4MGY E;  2A5U A;  2IY0 B;  2K25 A;  2KJH B;  2YLM A;  4NAW B;  2MP2 A;  3TMP B;  1PQS A;  4P7I A;  4IW0 A;  4HK2 A;  2M0X A;  4M8M A;  1TBE A;  2KWU B;  3OJ3 A;  3H6N A;  4B95 A;  2DYM A;  2IO0 B;  2KX0 A;  3QHT A;  4HDQ A;  4K7U A;  3QA8 A;  1S1Q B;  1Q0W B;  1YIW A;  5DPS A;  5G2N A;  2AYO B;  2N9P C;  4KIK B;  2GOW A;  2KWC A;  2HJ8 A;  4BOS C;  3A9J A;  2NVU I;  4URK A;  2K39 A;  3M62 B;  5KHO A;  5GMV A;  1L7Y A;  4FLH A;  4DHJ D;  3PHW B;  2Z0E B;  2KVR A;  4CYE A;  1KM7 A;  5L83 A;  1H4R A;  3NY5 A;  2AWT A;  2Z59 B;  2RSU A;  2GBM A;  4KSK C;  3VFK A;  4FN2 A;  1UH6 A;  2LGY A;  3ZO5 B;  5J2R A;  3TCA A;  2M17 A;  2MBQ A;  1E5W A;  3AU5 A;  3PGE A;  3DVG Y;  2XBB C;  4AP4 C;  1WXS A;  3KH0 A;  2FID A;  2KJR A;  2EMT A;  5JHB A;  1A5R A;  3PVL A;  3VTU A;  4IM0 A;  2DZJ A;  3VVW B;  4WJQ A;  1J8C A;  2M8S A;  3R7Q A;  2HD5 B;  3ZNG C;  3V6C B;  4TQ0 A;  4XZ4 A;  3ONS A;  3I3T B;  4W9I A;  1XT9 B;  4WWN A;  1H8C A;  2JVC A;  4ICV A;  4MSQ B;  4NJ6 A;  3VUY A;  1WF9 A;  1IPG A;  3QAQ A;  4E3C A;  1WY8 A;  2PPH A;  2ZNV B;  3ZTD A;  4W9G A;  1XD3 B;  3SDL C;  3PRZ A;  3JW0 X;  4MGI E;  3KYC D;  3DQV A;  2N4F A;  4FHJ A;  5CHV C;  5LXH A;  1J19 A;  2XEW A;  4KV2 A;  4W9C A;  2GBJ A;  3OJ4 B;  2KFJ A;  3R7R A; 
#chains in the Genus database with same CATH topology
 1AYF A;  1WM3 A;  4RFB A;  1SB3 C;  3KW5 B;  4IWP A;  3VR9 B;  1R4M B;  3NVV A;  2IJ0 A;  1JQ4 A;  2IGD A;  2K3U A;  3AE1 B;  3B9J A;  3WAL A;  2IZV B;  2KNB A;  3IXS A;  3N9Y C;  3P4R B;  3W1S C;  1E7U A;  2GBR A;  2D3G A;  1DYQ A;  4CO7 A;  1WGR A;  1LQB A;  2LRW A;  4F8C B;  4ZRK A;  2OJR A;  2ZJD A;  5D6J B;  3VTW A;  4P16 A;  2ON8 A;  5I4D A;  4WQO B;  5C1Z A;  1AW7 A;  4PYU A;  2JY6 A;  3DBL I;  2GMI C;  4US8 A;  2SEB D;  1F9J A;  4OVU A;  4ANV A;  1WRD B;  3MTN B;  3UIP B;  4A9A A;  1YOV B;  4XGA B;  1ET9 A;  2INN E;  3RNB C;  3UIN B;  3T3O A;  2VZK B;  3VHT C;  4GMV A;  3RD2 A;  4KGS A;  5IP4 D;  5H8Y E;  3AE9 B;  1FMA D;  1WJ4 A;  2H88 B;  2IO1 B;  1UWM A;  3H7P B;  3CMM B;  2N0S B;  2XK5 B;  2B3A A;  5HG2 A;  1M94 A;  2KHW B;  3ZW3 A;  1L2N A;  3HHM A;  3C0R B;  2PE6 B;  1OFF A;  4FXC A;  3LDZ E;  3V6E B;  3V3X A;  3AXC A;  1XLN A;  2NBW B;  3WAP A;  2KTR B;  3Q2A C;  4AUQ C;  4ANW A;  3ZUN A;  2PW9 A;  3PLV A;  3P4P B;  2DZK A;  4HRS A;  1ET6 A;  4G3X B;  2L32 A;  3RMK C;  3UF8 A;  2I1K A;  4ANX A;  3OG5 A;  2I1J A;  2IDY A;  4ZHP A;  2MHJ A;  5E6P A;  4BKG A;  3I5J C;  3CWI A;  5CTR C;  1L0Y B;  3A9K A;  2LZ6 A;  2G4S A;  5AZH A;  1TS5 A;  3N3K B;  2Y5C A;  2MSE D;  3GZN I;  4FUL A;  5FK9 C;  1KF6 B;  2J7Q B;  3AUL A;  2LAS A;  4LNK A;  1XXG A;  2E6X A;  1IUE A;  4HJG E;  3R66 C;  1FO4 A;  3AEA B;  1C9F A;  4GDL B;  3PV1 A;  1KFY B;  1L5P A;  2JU6 X;  2D5G A;  1N63 A;  4MJS A;  4RGN A;  1OQQ A;  1AWD A;  2QC8 A;  2MCN B;  3JYU A;  3TIX A;  2ZCB A;  3W5U B;  4XE0 A;  2KQS A;  4UDU C;  5C2T B;  4KSL C;  2E3T A;  3Q8C A;  4W9H A;  2DEN B;  3PTF C;  2LHD A;  3L0W B;  1RYJ A;  2MJE A;  2KC2 A;  4OW0 A;  2BWE S;  2JXT A;  2ZEQ A;  1QIL A;  1E10 A;  2AQ3 B;  2KQ4 X;  1T0R C;  3P42 A;  1V5O A;  3TBL D;  2D07 B;  3FAH A;  2BYV E;  4W9L A;  1I4P A;  2KLC A;  1XF5 L;  3DVN V;  4C56 C;  3H9D A;  3ZRF A;  4HPP A;  3U30 A;  3BYT B;  1D5Z C;  4N58 A;  3KQ4 A;  4RH6 A;  1WGK A;  2A4Z A;  4YTM B;  3RUL A;  3HM3 A;  4C7Z A;  1D6E C;  4MM3 B;  1OEY A;  2FIF A;  2FUG 1;  3L16 A;  4ZYN A;  2L52 A;  2PKO A;  3APD A;  4PYZ A;  2MBH A;  4RNA A;  3TJP A;  2DLB A;  1HEZ E;  1ZW7 A;  1PUT A;  4HEA 1;  1UBI A;  1YD8 U;  5T8I A;  2L1A A;  5EE3 A;  4IDI A;  1ROE A;  5TSS A;  4DQO C;  3ZQ4 A;  1L0X B;  3RCZ A;  5G55 A;  3U2S C;  1KOT A;  3AE6 B;  4CQN A;  2KTF A;  2BBC A;  1WM2 A;  3DHG C;  1K8R B;  1LO5 D;  4GDK B;  2CHW A;  2WDT B;  3I9V 1;  2WDR B;  2KDI A;  1V9J A;  3EHV A;  3ZJV A;  2CU3 A;  3QCA A;  2MRP A;  2G9H D;  3LYY A;  3W1S A;  1WMH B;  3LJ3 A;  1FM0 D;  3Q3F A;  2RD0 A;  2L3Z A;  2MP2 B;  2IYD B;  2ZCC A;  4MSM B;  1Z2M A;  3O65 B;  2NBU A;  2I2Y A;  1N60 A;  4EFO A;  2FUH B;  1D3Z A;  1R4M I;  2UU7 A;  4HVB A;  4II3 B;  4M0W B;  1KLV A;  3UQA A;  4A55 A;  4E74 A;  1EM7 A;  1MPE A;  5BYQ A;  1PDX A;  2PE9 A;  3NHE B;  5FR6 A;  1SIJ A;  4JQW C;  2AQ2 B;  3HM6 X;  2BB5 A;  4DXF A;  1Q5W B;  1XEE A;  5DCN A;  1ZOY B;  1YMH E;  4WQM A;  2MJD A;  1VLB A;  2BF8 B;  3APF A;  4BAX A;  1WYG A;  4HXD A;  1T5X D;  5JZE B;  2AQ1 B;  1WFY A;  2IO3 B;  2IPK D;  4GSW A;  1P98 A;  2FCQ A;  2K6Q A;  5EE1 A;  2J0M A;  4F1S A;  2RR9 A;  4NAW A;  4DHJ B;  1JRU A;  2V0G A;  2K9X A;  4I6N B;  3BVZ A;  4DHZ E;  1L0V B;  2KFK B;  2K8H A;  4ICU A;  2B76 B;  4OZA A;  3NUH B;  4GB9 A;  1IGD A;  2MW5 A;  1E8Z A;  1F52 A;  4IG7 B;  4IWO A;  1WIA A;  2WXH A;  1TKE A;  4W9F A;  2J4X A;  4MH0 E;  1C4P A;  1JCK B;  5HFY A;  2IND C;  5IAA C;  1RWS A;  2WXO A;  1I7H A;  4WH4 A;  2KJH B;  1FCL A;  4B95 A;  1TKY A;  3DBR B;  2DYM A;  2KX0 A;  4K7U A;  2AYO B;  2N9P C;  4YTP B;  4BOS C;  2HJ8 A;  1TS2 A;  3A9J A;  2NVU I;  1PYW D;  4URK A;  3M62 B;  5KHO A;  3MP9 A;  4XWW A;  5HI1 A;  1FD6 A;  2Z59 B;  2QSD A;  4KSK C;  4FN2 A;  1UH6 A;  3EFC A;  4NJC A;  1GOZ A;  3ZO5 B;  3TCA A;  2M17 A;  3ZJU A;  4JX1 C;  2QJL A;  5IKC M;  3NRZ A;  2EMT A;  2WXN A;  3GS2 A;  1A5R A;  4M01 A;  2NTT A;  1J8C A;  3V6C B;  3ONS A;  3I3T B;  1VZ8 A;  3E56 A;  4ZYS A;  3ZTD A;  4N6E B;  2N9L A;  3SFE B;  2K0P A;  5CHV C;  4PK1 A;  4KV2 A;  3R7R A;  2I38 A;  2MBE A;  4OVZ A;  4ASW C;  4J6I A;  5IO9 A;  2Y3A A;  2ASQ A;  2WDV B;  1OQY A;  1WYW B;  2AX5 A;  3C19 A;  1EWY C;  4FBJ B;  4K7W A;  1P0R A;  2N7D A;  2V3P A;  5LLI A;  3KUC B;  5LXI B;  2PLP A;  3W1Y A;  3PZD A;  1QOF A;  1HTQ A;  1EO6 A;  4RGM A;  2C7N B;  3VDZ A;  1XLP A;  4TQ1 A;  1SE3 A;  4S0R A;  1YNT E;  3MJW A;  2RDG A;  2KOX A;  4FJY A;  4LCD E;  2OJW A;  3H7P A;  4IKG A;  2KAN A;  2XK5 A;  3VAW A;  3A4R A;  3ENE A;  3Q3J A;  3DBH B;  2JYT A;  1SE4 A;  3U7D A;  3RNE C;  3BWU D;  2Y5B B;  1MG8 A;  3EA6 A;  3RFZ B;  4AQ7 A;  1WZ0 A;  2UWQ A;  1ZXI A;  2BYT A;  4RCO A;  2AL6 A;  1N5X A;  1N5W A;  4WWP A;  5E6N A;  5MPO A;  2WQY B;  4AS1 A;  1P9D U;  1TYG B;  2D3C A;  1GAQ B;  3SHQ A;  1JRO A;  2MBO A;  3Q6B A;  2KZR A;  3VH3 B;  2M19 A;  5CHW A;  3CIR B;  5HKH A;  1WX9 A;  2BS4 B;  1DOI A;  4ZRI A;  5BMI A;  2WXR A;  1FEH A;  1FXI A;  1LFD A;  2LEK A;  2R2Q A;  4TKN A;  2GBN A;  3ALB A;  4A3P A;  4DXG A;  2G45 B;  2QMT A;  2MJ3 A;  3P4S B;  2MX2 A;  3ZNH B;  2KN5 A;  4OHJ A;  4YXD B;  1NDD A;  2C60 A;  3L08 A;  1JRP A;  2LVO A;  1CJE A;  2J42 A;  1EUV B;  3QAR A;  1VJK A;  4BKT A;  5JXV A;  4KZC A;  2NCN A;  3R2T A;  4FJV B;  3AB5 A;  3M63 B;  2DHZ A;  2W3R A;  2IGH A;  1WJ6 A;  2JSV X;  2FCN A;  4OZB A;  1FXT B;  4JIO U;  2V3S A;  3Q3O C;  4LNN A;  2VZK D;  3VR8 B;  5D94 A;  3RN9 C;  1ZDV A;  2V3N A;  4OVV A;  3Q8B A;  1XO3 A;  1P3Q U;  5G5G A;  5E6O A;  3DVG X;  4E71 A;  2GB1 A;  4M02 A;  3RI7 C;  4REZ A;  1BT0 A;  4GOC A;  1WXQ A;  1VDV A;  2W54 A;  1UNS A;  2MBB B;  2X38 A;  2QDF A;  3AEG B;  3HK0 A;  3Q8E A;  2BVC A;  2LXA A;  2WX0 A;  3RNF C;  4EUT A;  1I42 A;  1GC7 A;  2KAJ A;  2BGF A;  2L8J A;  3P2B A;  1D5X C;  1ZE3 D;  2C5L C;  4TMA B;  1JW9 D;  2WDQ B;  2LWP A;  2DBY A;  4A8X C;  4YT0 B;  2FCM A;  4WUR A;  4MM3 A;  4XDC A;  3EFU A;  4M8N A;  4LJP B;  1R7S A;  3MC8 A;  2GI9 A;  3A1Q A;  1RAX A;  2BQQ A;  2Z8L A;  3PZ8 A;  2LGI A;  4G0N B;  2KDM A;  1STE A;  4K81 A;  2K6D B;  1WZ3 A;  1HXY D;  1WGG A;  4TV3 A;  1B1Z A;  4HJK A;  1WWT A;  1F77 A;  3NS8 A;  2KLG A;  2PJH A;  1SXT A;  2HTM E;  2W55 A;  3B0A A;  3MFG A;  1HE8 A;  4KX6 B;  2WXK A;  2RMM A;  1PGA A;  3AV8 A;  4PS8 A;  2WX1 A;  3N20 C;  4LNO A;  4DBG A;  2LVP A;  1XQQ A;  2L76 A;  1N61 A;  2LFI A;  5CX3 A;  4LNI A;  4KKJ A;  1OGW A;  3NVZ A;  3T9L A;  5D2M B;  3DBR I;  4GDK A;  1WXV A;  2PVG C;  4ARI A;  4FHK A;  2QEJ C;  3ZYY X;  3AU4 A;  3N1Z C;  2INC C;  2JF5 A;  2Q5W D;  1L6U A;  4ACF A;  5L95 C;  1R4N I;  1WMH A;  3AE3 B;  1GNU A;  2WXG A;  1UZX B;  2VRR B;  1I4X A;  1E6E B;  4GGQ A;  1YX6 B;  1QZE A;  2WU5 B;  5J17 A;  1FPY A;  2LUM A;  2L83 A;  1VD2 A;  4M0W A;  1L4Z B;  2QIL A;  1AAR A;  2D3A A;  3L10 B;  2KJ6 A;  3RZW C;  2N9K A;  1V49 A;  3GE8 C;  3J9C A;  4DDI D;  1UBQ A;  3U7Z A;  3BK2 A;  3VRB B;  2PMV A;  3AEB B;  1MVK A;  3U52 E;  3WCQ A;  2PVO D;  4BBN C;  2R2O A;  4IM3 A;  2N1W A;  4GXB A;  4XX5 A;  1WXM A;  1SIF A;  3ZKJ C;  2DZM A;  1VZ7 A;  4JL9 A;  3GOE A;  1MHX A;  5BMG A;  4GU2 A;  4CHK A;  2KD0 A;  5AZG A;  1V80 A;  3AEE B;  2WXI A;  2CJN A;  2BS3 B;  2KFK A;  2YVC A;  3VXW A;  1NI3 A;  1KRH A;  3HIZ A;  2KWD A;  4NJ7 A;  1QQR A;  1C4C A;  1T0Y A;  4NPN A;  4YSY B;  1OEY J;  3UGB B;  1UWX A;  2JT4 B;  1IGC A;  1V5T A;  3ZTC A;  4DHZ B;  2C7M B;  4RF1 A;  3DBH I;  2KDF B;  2DYO A;  2G3Q B;  2KKC A;  1J7B A;  1RLF A;  2KDB A;  3KYD D;  2FE8 A;  1UEL A;  1SE2 A;  2DZI A;  3WAN A;  1Y8R C;  2UYZ B;  4MEM A;  1SBB B;  2KYW A;  3PLU A;  2W3S A;  4I6P A;  1HZ5 A;  5IN7 A;  3AE7 B;  1S3S G;  3RT3 B;  4A3O A;  1N6Z A;  2LGX A;  1FFU A;  3V60 A;  4ITK A;  4RM9 A;  5IA7 A;  4MGY E;  3HUI A;  2A5U A;  3PO0 A;  2K25 A;  3TMP B;  4P7I A;  4HK2 A;  2MEK A;  3H6N A;  2IO0 B;  3QHT A;  4HDQ A;  3DHI C;  4YWG G;  5D3D A;  1T0S C;  4KIK B;  2GOW A;  1UGJ A;  3UI3 A;  2K39 A;  1L7Y A;  4DHJ D;  3PHW B;  2YEP F;  2Z0E B;  3ETR A;  2ACZ B;  3HRD D;  3NY5 A;  2AWT A;  3R8B A;  1QT9 A;  3BVM A;  3VFK A;  5BMH A;  2LGY A;  4N59 A;  5J2R A;  2MBQ A;  1E5W A;  1NEN B;  3DWG C;  3B2G A;  3PVL A;  2DZJ A;  2BW2 A;  1T6B X;  4W9I A;  1XT9 B;  2JVC A;  4MSQ B;  3VUY A;  1IPG A;  4E3C A;  2ZNV B;  4W9G A;  3SDL C;  4MGI E;  1MG4 A;  1IBX A;  3GE3 C;  3FIL B;  1J7C A;  2QCZ A;  3SEB A;  3OJ4 B;  2GRI A;  3RNA C;  3NVY A;  2KT7 A;  4MT5 A;  3IT6 B;  2ONQ A;  1MFW A;  4BFR A;  3FKY A;  1Z5S B;  1UUP A;  1EF5 A;  1XLO A;  4B0E A;  2MLB A;  4IM2 A;  5AUI A;  3BK1 A;  1ZKH A;  2R61 A;  3SFD B;  4ANU A;  5BYR A;  4LTU A;  2OOB B;  5JH5 C;  3PSE B;  1V1P B;  4HCP B;  1M4V A;  3AE4 B;  2EMS A;  1LM8 B;  4B6W A;  4MDK E;  1WX7 A;  1ACC A;  3EEC A;  4NNJ B;  4EZK A;  4MAC A;  2ZVO A;  3ML8 A;  1ESF A;  2HDE A;  4YSZ B;  4TSS A;  3R2I A;  3RNC C;  4II2 B;  2MH7 A;  4XDD A;  3MHS D;  3TL5 A;  1B9R A;  4HCN B;  2M1M A;  4EZL A;  4R3D A;  3ZDT A;  5EE0 A;  1T3Q A;  1UGM A;  4C7Y A;  2XN9 C;  2O2V B;  1K51 A;  4MJS B;  3V05 A;  4KVG B;  1E8X A;  1JML A;  3E9S A;  3D32 A;  4RF0 A;  2LXC A;  4EKU A;  5GXG B;  1NVI D;  3SU8 X;  5EDS A;  1DOX A;  1V1O A;  3QX1 A;  2WS3 B;  2QHO A;  1YQB A;  1E0Z A;  3WIM A;  2K1F A;  5FR3 A;  1LXD A;  3ZXV A;  2WLB A;  3TEZ A;  1R4N B;  1EU4 A;  2K8B A;  3CSF A;  2FCS A;  1ZGU B;  4EE2 A;  4XYC A;  1RRB A;  1YX5 B;  5KHQ A;  2L00 B;  2LRU A;  2O6V B;  1LGR A;  2N7J A;  1FRD A;  2FBW B;  2ZPY A;  3Q14 C;  4KDI C;  2RDB C;  1JWB D;  2JPH A;  2LD9 A;  1ENF A;  1FFV A;  3V61 A;  3IFW B;  1V6E A;  3VH4 B;  2KAC A;  3IVF A;  2D11 A;  3GB1 A;  4PS3 A;  2ZNV C;  3B2F A;  1KJT A;  4Q2J A;  4IOI E;  3H8H A;  4FAD A;  2KVZ A;  2JXX A;  2V9H A;  1IP9 A;  4F7Z A;  1EF1 A;  3ZNZ B;  1L6V A;  4KKI A;  1E8Y A;  2FNJ B;  4HWI B;  2NS5 A;  3CF6 E;  1E9M A;  3LB8 C;  3ZDM C;  3CST A;  2WP9 B;  3AE5 B;  2KN4 A;  4KZ0 A;  4L2Y A;  1UD7 A;  2CR5 A;  3ECI A;  3ZGZ A;  2N9X A;  3RNG C;  1AN8 A;  3PRM B;  2LJ5 A;  1EU3 A;  2VH2 A;  3NZ3 A;  1YJ1 A;  2W82 A;  3A4S C;  1Q1O A;  3URY A;  3H7S A;  3AEC B;  3N30 A;  2ZPN A;  4WWM A;  2LI5 A;  2N9E B;  3JSV B;  1E7P B;  1WGH A;  1HA5 A;  2RDH A;  1E90 A;  3S2A A;  3R3M A;  2IO2 B;  2KTR A;  1KLU D;  3EC8 A;  4BZA A;  4FJZ A;  4HPM B;  5C23 A;  5E6J A;  4JE3 B;  2WXF A;  2BPS A;  4MEL A;  3OLM D;  1HZ6 A;  3Q8A A;  2KMM A;  3BII D;  4LDT B;  1QF6 A;  2WWZ A;  3H1U A;  4WJP A;  3MC0 B;  2LGS A;  3ABV B;  1ZDX A;  1C77 A;  4BVU C;  3UQB A;  1SJH D;  3FC4 A;  4YSX B;  4O1N A;  2MWS B;  2M4N A;  5LNK 1;  2DAF A;  2JUO A;  3NS1 A;  2WHI A;  3L13 A;  2JRH A;  1V81 A;  2J0J A;  3VRA B;  1I35 A;  3BVG A;  4P1C C;  4HKQ A;  1GJZ A;  1SGH A;  1UF0 A;  2K5P A;  3ZRC A;  1FCC C;  3SR6 A;  4NQL B;  3NZU A;  2EKE C;  3K9P B;  5G5H A;  1FNV A;  2L05 A;  3PZ7 A;  4GDL A;  2G1E A;  2Z0D B;  2CHZ A;  2V4I B;  3LXF A;  4DDG D;  4LLG M;  1JWM D;  4US9 A;  3DOW A;  3A33 B;  3L54 A;  1TKG A;  2G4D B;  4ZRP A;  2DAJ A;  1G6J A;  1P1A A;  3QQ8 B;  1D5M C;  3DPD A;  2BWF A;  4C4V B;  5AEK B;  4XWT A;  3L4P A;  1BML C;  4G11 A;  2C7H A;  2BKR B;  3A9J B;  2IGG A;  2WU2 B;  3X0W A;  1TS4 A;  2KWV B;  4KDL B;  4G50 A;  3EUB 2;  3RYT A;  3ZIM A;  1J7A A;  2N7E A;  4MH8 A;  4HRO A;  4P1B C;  1TTN A;  3RPF C;  3AM9 A;  1P7E A;  4H2A A;  3PT2 B;  4A90 A;  1WXA A;  3IG3 A;  3N1Y C;  2C9W B;  4A20 A;  3M3J A;  2MA9 B;  1PGX A;  1J0G A;  1TIF A;  1E7V A;  4WJO A;  1XCQ L;  1YQ4 B;  2V1Y A;  2NPT B;  3ML9 A;  5AZF A;  1GC6 A;  2WXL A;  3MC9 A;  4D2K A;  3WA0 A;  3AMZ A;  3X23 A;  1C4A A;  3TEW A;  3UIO B;  4RM8 A;  2J53 A;  4KIK A;  3QIJ A;  2JRI B;  1WR1 A;  2GBK A;  4B0M A;  3B08 A;  2D10 A;  3JVZ X;  4JGH B;  2M56 B;  2K22 A;  4DWF A;  1K53 A;  2V4L A;  3DWM A;  4C00 A;  1ISN A;  3AH7 A;  3QK0 A;  3Q3M C;  4BOZ B;  1ZPS A;  2TSS A;  2IY0 B;  2YLM A;  2MP2 A;  3U4E G;  1PQS A;  1C78 A;  4IW0 A;  2KWU B;  3TEY A;  1ZXH A;  3QA8 A;  1S1Q B;  4S17 A;  5DPS A;  2BS2 B;  5G2N A;  2NMQ A;  5GMV A;  4FLH A;  5BYS A;  2WXM A;  3FIL A;  1C79 A;  2DNF A;  1I4R A;  2RSU A;  2GBM A;  1NYR A;  3PGE A;  1F0Z A;  3KH0 A;  2WXJ A;  3Q8F A;  2FID A;  5JHB A;  3VTU A;  4WJQ A;  3R7Q A;  2RPV A;  3ZNG C;  4TQ0 A;  4ICV A;  1HTO A;  4NJ6 A;  2NTS A;  4K3C A;  1TY0 A;  1V1P A;  5H92 C;  4ZRQ A;  1XD3 B;  1I4H A;  1Q10 A;  3PRZ A;  3JW0 X;  3N1X C;  1D4B A;  3DQV A;  2N4F A;  4FHJ A;  1MHH E;  5LXH A;  1J19 A;  4W9C A;  2GBJ A;  4L23 A;  1FRR A;  1C76 A;  3PRP B;  3V62 A;  1WH3 A;  5JHA A;  4DXA B;  3DDC B;  1WJN A;  1WE7 A;  2KO3 A;  4WJN A;  4YL8 A;  4K1R B;  2J0K A;  4HLE A;  1MJD A;  2O2V A;  3QWZ B;  3WAM A;  2MQJ A;  2ZZP B;  4GN1 A;  4EOY A;  1YN3 A;  2BYF A;  4HPL B;  3W9C B;  1WI0 A;  2SAK A;  1NI2 A;  2L7R A;  2BTE A;  4ZHO A;  3PPA A;  3L17 A;  2JWU A;  4NQK E;  3AED B;  2RGF A;  3NOB A;  4WAA A;  1V97 A;  2M0A A;  4K7S A;  5CHF A;  4ZRJ A;  2IBI B;  2WGS A;  2KMA A;  4J3O D;  3IAS 1;  3EGR A;  4C80 A;  2CKH B;  3ZVV A;  3AE8 B;  4WIP A;  2WNM A;  3ZNI D;  1IYF A;  2AL3 A;  4EZJ A;  3Q69 A;  2W9N A;  2JZP A;  1NBF C;  2KC1 A;  2HJ1 A;  4WAF A;  1QKZ A;  2O6V A;  5DPT A;  1FNW A;  1JWS D;  2N1V A;  3A1Q B;  4GIV A;  1QOG A;  1N62 A;  3NVW A;  3B1L X;  4IUM B;  1SF0 A;  2AEH A;  3SD5 A;  1TGZ B;  1VCB A;  1Y56 A;  1VR9 A;  2OED A;  2LJI A;  1QLB B;  1YJI A;  4KGR A;  1DGJ A;  3AN1 A;  5BO4 B;  2PIA A;  4JWU C;  4AJW A;  4OZC A;  3VUW A;  4W9K A;  2KDE B;  4N9F 4;  1E8W A;  1GG3 A;  1L4D B;  4NZL B;  2EEL A;  2L0T A;  3BZD B;  1KTK A;  2L0F A;  4ZDV A;  1XCT L;  5DPW A;  1JWA D;  1CK1 A;  2CU1 A;  2NR2 A;  4IC7 B;  3KLS X;  2D2Q A;  3DHH C;  2LMC A;  2FAZ A;  1YJJ A;  3NZS A;  5AUK A;  1K52 A;  1WGD A;  1WSP A;  3W5V B;  1VZ6 A;  2DYB A;  2LVQ A;  5IOI A;  4EEW A;  3JSV A;  4NY0 A;  4X57 B;  1TJE A;  2OHF A;  3PS6 A;  1C3T A;  1KH0 A;  1WJU A;  3GP7 A;  4K3B A;  1TT5 B;  4PT5 A;  4HDO A;  1XLQ A;  3A9K B;  2D3B A;  1RFA A;  3AEF B;  4HKZ E;  1WX8 A;  1RFK A;  3KWV A;  3TSS A;  1U4A A;  1X1M A;  4W9E A;  1C1Y B;  1OQR A;  2O6V D;  4B9K A;  1PGB A;  2DWQ A;  4LJO B;  3W2D A;  1WE6 A;  3AE2 B;  1A70 A;  3BY4 B;  4W9J A;  3ZJT A;  1TY2 A;  2BT6 A;  1MI0 A;  2LGD A;  4NAM A;  3QC8 B;  3BIN A;  2REX A;  5HHD G;  2EKI A;  3N32 A;  3TEX A;  2KQ7 A;  3DCG A;  1RM6 C;  3VUX A;  4RMA A;  4LK0 M;  3I63 C;  4BKS A;  1QOB A;  2ICI A;  3DBL B;  5TR5 A;  1V86 A;  1EWC A;  1WR6 E;  1ZP0 B;  2CHX A;  4IWQ A;  3KUD B;  2CS4 A;  1YN5 A;  4LNF A;  3T8M A;  3NG0 A;  1FXA A;  3APC A;  1OTR B;  3P63 A;  4FA6 A;  1FNU A;  2BYE A;  4DK5 A;  3QJZ A;  4JLC A;  2LHE A;  3IBE A;  1JWU D;  1P7F A;  3DBS A;  4QAY A;  4JPS A;  1V8C A;  4ARC A;  4C4V A;  2IY1 B;  1T0Q C;  2YEP B;  3KWL A;  4I6L B;  3ZXR A;  3M95 A;  2LUE A;  4W9D A;  2WYQ A;  1CZP A;  2VH1 A;  1NEK B;  1YQ3 B;  2JWZ A;  3O13 A;  4TUU A;  1SSN A;  3DVN U;  4WWO A;  2H89 B;  1K50 A;  1F2R C;  2JX5 A;  1F1H A;  3RUI B;  3OAW A;  2NBV B;  4BBN F;  1I4G A;  2ZVN A;  4AJY B;  2X8X X;  1CMX B;  3VTV A;  1BXT A;  3KVF B;  4RGT A;  4LDT D;  3PRE A;  2CJO A;  2WXQ A;  2WXP A;  2Y5P A;  2GLS A;  5J18 A;  2PEA A;  2JZZ A;  2BKF A;  4AOF A;  2NPT A;  1TZ1 A;  1GUA B;  4BKS D;  2DX5 B;  1WGY A;  2JYE A;  3OWE B;  2RPQ A;  1DOY A;  1SE9 A;  1I4Q A;  3IAM 1;  3GZN B;  2KK8 A;  1PFD A;  3I57 A;  2HTH A;  4MGZ E;  1VRA B;  3AI5 A;  3PHX B;  2K8C A;  5DPR A;  5D7G A;  4PS7 A;  1ZUD 2;  1CQV A;  1SEB D;  3ZLZ A;  2PTL A;  2HE7 A;  2KX3 A;  3HVZ A;  1IBX B;  1V2Y A;  2KMC A;  3MJ5 A;  2KXJ A;  2JZ3 B;  4MGK E;  4GLS C;  1GPX A;  2BB6 A;  3T3N A;  3U8Z A;  3NJT A;  1WRI A;  4AWJ A;  3KUZ A;  2ZW1 A;  1GB4 A;  3IHP C;  4XC2 A;  3MHZ A;  1BUI C;  4KGT A;  1SJE D;  4L1B A;  4P6V F;  3VQI A;  4RGO S;  3WAO A;  2XNA C;  2JQR B;  5EE9 A;  3K9O B;  1QOA A;  1TS3 A;  1HQR D;  3RZF A;  3BYY B;  1JAL A;  2J52 A;  4NAW B;  4M8M A;  2M0X A;  1GB1 A;  1TBE A;  3OJ3 A;  1FIQ A;  1KLG D;  1Q0W B;  1YIW A;  4JWS C;  2KWC A;  4M00 A;  3IT4 B;  1TZO A;  1F2R I;  3C8Y A;  4YTN B;  2KVR A;  5FKA C;  4CYE A;  1KM7 A;  5L83 A;  1H4R A;  4A6Q A;  2INP E;  3P1M A;  3AU5 A;  4AP4 C;  3DVG Y;  2XBB C;  1WXS A;  2KJR A;  4USA A;  4IM0 A;  3VVW B;  5D3I B;  2M8S A;  4ZOH C;  2HD5 B;  3Q3N C;  4XZ4 A;  1H8C A;  4WWN A;  3HVD A;  1WF9 A;  3P4Q B;  3QAQ A;  1WY8 A;  2PPH A;  5C3J B;  1NYQ A;  3KYC D;  1YN4 A;  3TUO A;  2QIE B;  2XEW A;  2ZW0 A;  2KFJ A; 
#chains in the Genus database with same CATH homology
 3PRP B;  2MBE A;  3V62 A;  1WH3 A;  4ASW C;  4J6I A;  1WM3 A;  4BFR A;  5JHA A;  3KW5 B;  4IWP A;  4DXA B;  1Z5S B;  2ASQ A;  1EF5 A;  1OQY A;  3DDC B;  1WYW B;  1WJN A;  1WE7 A;  2KO3 A;  2MLB A;  4IM2 A;  4WJN A;  4FBJ B;  4YL8 A;  4K7W A;  1P0R A;  2N7D A;  4K1R B;  1ZKH A;  5LLI A;  2J0K A;  4ANU A;  3KUC B;  3WAL A;  2IZV B;  4HLE A;  5LXI B;  2KNB A;  3W1Y A;  2OOB B;  3PZD A;  2O2V A;  3QWZ B;  3PSE B;  5JH5 C;  1EO6 A;  4HCP B;  3W1S C;  1E7U A;  2C7N B;  2GBR A;  3WAM A;  2D3G A;  2MQJ A;  2ZZP B;  4CO7 A;  3VDZ A;  4GN1 A;  1WGR A;  4EOY A;  2BYF A;  2EMS A;  4HPL B;  1LQB A;  1LM8 B;  2LRW A;  4TQ1 A;  4B6W A;  4MDK E;  4F8C B;  1WX7 A;  1WI0 A;  4ZRK A;  3EEC A;  3MJW A;  2OJR A;  2ZJD A;  1NI2 A;  4NNJ B;  4EZK A;  5D6J B;  2L7R A;  2ZVO A;  2KOX A;  3ML8 A;  3VTW A;  3PPA A;  3L17 A;  4FJY A;  4LCD E;  4NQK E;  4WQO B;  5C1Z A;  2RGF A;  3H7P A;  4PYU A;  2JY6 A;  2KAN A;  2XK5 A;  3DBL I;  3NOB A;  2GMI C;  3VAW A;  4II2 B;  4WAA A;  1F9J A;  3MHS D;  3TL5 A;  4HCN B;  4K7S A;  3A4R A;  4OVU A;  2M1M A;  3ENE A;  5CHF A;  3Q3J A;  4ZRJ A;  4EZL A;  2IBI B;  3U7D A;  3ZDT A;  2KMA A;  4ANV A;  1WRD B;  2Y5B B;  1MG8 A;  3MTN B;  3UIP B;  1UGM A;  1WZ0 A;  2UWQ A;  2CKH B;  2O2V B;  4MJS B;  3ZVV A;  3UIN B;  4KVG B;  2AL6 A;  1E8X A;  4WWP A;  5E6N A;  3D32 A;  3VHT C;  3ZNI D;  1IYF A;  1P9D U;  2LXC A;  4GMV A;  4EKU A;  3RD2 A;  3SHQ A;  2AL3 A;  4EZJ A;  2W9N A;  2MBO A;  1NBF C;  2KZR A;  3SU8 X;  3VH3 B;  5EDS A;  2KC1 A;  5CHW A;  5HKH A;  1WX9 A;  2O6V A;  3QX1 A;  5DPT A;  4ZRI A;  1WJ4 A;  2QHO A;  2IO1 B;  2N1V A;  3A1Q B;  4GIV A;  1YQB A;  3H7P B;  3CMM B;  3B1L X;  2XK5 B;  4IUM B;  3WIM A;  2AEH A;  2B3A A;  2K1F A;  3SD5 A;  1LFD A;  1TGZ B;  1VCB A;  2R2Q A;  1M94 A;  4TKN A;  2KHW B;  1LXD A;  2GBN A;  3ZW3 A;  1L2N A;  3ALB A;  3HHM A;  4A3P A;  3C0R B;  2PE6 B;  2G45 B;  2MX2 A;  3LDZ E;  2KN5 A;  3ZNH B;  2K8B A;  3V6E B;  1NDD A;  3AXC A;  2C60 A;  3CSF A;  3L08 A;  5BO4 B;  2FCS A;  2LVO A;  2NBW B;  3WAP A;  2KTR B;  1EUV B;  4AUQ C;  4AJW A;  3QAR A;  1ZGU B;  3VUW A;  4ANW A;  4BKT A;  3ZUN A;  3PLV A;  4KZC A;  2NCN A;  2KDE B;  4FJV B;  4W9K A;  1RRB A;  3M63 B;  2DZK A;  2DHZ A;  4N9F 4;  1E8W A;  1GG3 A;  1WJ6 A;  1YX5 B;  4G3X B;  2FCN A;  5KHQ A;  2L00 B;  2LRU A;  1FXT B;  2I1K A;  2O6V B;  3UF8 A;  4ANX A;  2I1J A;  2L0T A;  2ZPY A;  5E6P A;  4BKG A;  4KDI C;  4JIO U;  2JPH A;  2V3S A;  5CTR C;  2L0F A;  4ZDV A;  2LD9 A;  3A9K A;  5DPW A;  2LZ6 A;  3V61 A;  5D94 A;  3IFW B;  1V6E A;  3VH4 B;  4OVV A;  3IVF A;  2D11 A;  2CU1 A;  2NR2 A;  4IC7 B;  2G4S A;  2D2Q A;  4PS3 A;  1P3Q U;  5AZH A;  5E6O A;  3DVG X;  4E71 A;  2FAZ A;  3N3K B;  3NZS A;  2ZNV C;  1WGD A;  1KJT A;  4FAD A;  2MSE D;  2JXX A;  1IP9 A;  1BT0 A;  4GOC A;  4F7Z A;  3GZN I;  1EF1 A;  2MBB B;  3ZNZ B;  2DYB A;  4FUL A;  3HK0 A;  2J7Q B;  1E8Y A;  2LVQ A;  3AUL A;  4EEW A;  2FNJ B;  2LAS A;  3JSV A;  2LXA A;  2WX0 A;  4HWI B;  4NY0 A;  2NS5 A;  3CF6 E;  4X57 B;  4EUT A;  3ZDM C;  1I42 A;  3CST A;  3R66 C;  1GC7 A;  4KZ0 A;  3PS6 A;  1C3T A;  1UD7 A;  4GDL B;  3PV1 A;  2BGF A;  1WJU A;  2L8J A;  3P2B A;  2CR5 A;  4MJS A;  3ECI A;  4HDO A;  2C5L C;  3A9K B;  1RFA A;  2N9X A;  2MCN B;  2LWP A;  3JYU A;  3TIX A;  1WX8 A;  2ZCB A;  3PRM B;  2LJ5 A;  2FCM A;  2KQS A;  1U4A A;  1X1M A;  1YJ1 A;  4W9E A;  1C1Y B;  4MM3 A;  2O6V D;  4B9K A;  3EFU A;  3A4S C;  4KSL C;  1Q1O A;  4M8N A;  4LJP B;  4W9H A;  4LJO B;  2DEN B;  3A1Q A;  3PTF C;  3L0W B;  3H7S A;  1WE6 A;  3N30 A;  1RAX A;  2ZPN A;  3BY4 B;  4W9J A;  2LI5 A;  4G0N B;  2KC2 A;  2N9E B;  2BWE S;  2ZEQ A;  3JSV B;  2LGD A;  2K6D B;  1WZ3 A;  4K81 A;  4TV3 A;  1WGG A;  1V5O A;  3QC8 B;  1WGH A;  3BIN A;  2D07 B;  4HJK A;  3TBL D;  2REX A;  1E90 A;  2BYV E;  2KLC A;  4W9L A;  3DVN V;  3N32 A;  3NS8 A;  2KQ7 A;  2KLG A;  2PJH A;  3DCG A;  3H9D A;  3R3M A;  3S2A A;  3VUX A;  3B0A A;  3U30 A;  3ZRF A;  1HE8 A;  4RMA A;  2IO2 B;  2KTR A;  4PS8 A;  4BKS A;  2WX1 A;  3EC8 A;  4FJZ A;  4DBG A;  2A4Z A;  2LVP A;  4HPM B;  5C23 A;  3RUL A;  3HM3 A;  1XQQ A;  2L76 A;  5TR5 A;  1V86 A;  5CX3 A;  1WR6 E;  2CHX A;  2BPS A;  4IWQ A;  3OLM D;  4MEL A;  1OEY A;  2FIF A;  1OGW A;  3KUD B;  3L16 A;  3T9L A;  2CS4 A;  4ZYN A;  5D2M B;  3DBR I;  3APD A;  4PYZ A;  4GDK A;  2MBH A;  4LDT B;  3TJP A;  1WXV A;  2WWZ A;  3H1U A;  4WJP A;  3T8M A;  3APC A;  4FHK A;  1ZW7 A;  1OTR B;  3AU4 A;  1UBI A;  4BVU C;  1YD8 U;  2JF5 A;  3UQB A;  4FA6 A;  5L95 C;  1R4N I;  1WMH A;  2BYE A;  1GNU A;  4DK5 A;  3QJZ A;  2MWS B;  2M4N A;  4JLC A;  3IBE A;  2DAF A;  2JUO A;  3DBS A;  1UZX B;  3RCZ A;  2VRR B;  4GGQ A;  2IY1 B;  1YX6 B;  1QZE A;  2JRH A;  3L13 A;  5G55 A;  5J17 A;  1V81 A;  2J0J A;  1KOT A;  1I35 A;  4I6L B;  1VD2 A;  1GJZ A;  1SGH A;  3M95 A;  2KTF A;  3ZRC A;  2LUE A;  1AAR A;  4W9D A;  4NQL B;  3NZU A;  1WM2 A;  2EKE C;  3K9P B;  2L05 A;  2WYQ A;  3L10 B;  2KJ6 A;  3RZW C;  1K8R B;  4GDL A;  2Z0D B;  2JWZ A;  4TUU A;  1V49 A;  4GDK B;  2CHZ A;  2CHW A;  2WDT B;  4DDG D;  4DDI D;  2KDI A;  1V9J A;  3DVN U;  3EHV A;  3DOW A;  4WWO A;  3A33 B;  3L54 A;  2G4D B;  1UBQ A;  3QCA A;  2DAJ A;  2MRP A;  3RUI B;  3OAW A;  2NBV B;  4BBN F;  1G6J A;  3W1S A;  1P1A A;  2ZVN A;  4AJY B;  1WMH B;  3LJ3 A;  3QQ8 B;  3Q3F A;  1CMX B;  3VTV A;  2RD0 A;  4BBN C;  2L3Z A;  2R2O A;  2MP2 B;  2IYD B;  2ZCC A;  3KVF B;  4IM3 A;  1Z2M A;  2N1W A;  4GXB A;  4LDT D;  4MSM B;  4XX5 A;  3DPD A;  3O65 B;  1WXM A;  1SIF A;  2NBU A;  3PRE A;  2BWF A;  4EFO A;  2FUH B;  5AEK B;  1D3Z A;  1R4M I;  3ZKJ C;  4G11 A;  2DZM A;  4HVB A;  4II3 B;  4M0W B;  5J18 A;  2C7H A;  1KLV A;  2BKR B;  2PEA A;  3A9J B;  2JZZ A;  4JL9 A;  3X0W A;  2BKF A;  3UQA A;  4AOF A;  2KWV B;  4E74 A;  4KDL B;  2NPT A;  3GOE A;  4G50 A;  1TZ1 A;  1GUA B;  3RYT A;  3ZIM A;  2PE9 A;  3NHE B;  5FR6 A;  4CHK A;  4GU2 A;  2N7E A;  2KD0 A;  4BKS D;  2DX5 B;  1WGY A;  1V80 A;  5AZG A;  2RPQ A;  4JQW C;  1SE9 A;  1TTN A;  3HM6 X;  2KFK A;  2YVC A;  3VXW A;  3PT2 B;  1Q5W B;  2KK8 A;  1WXA A;  3IG3 A;  2HTH A;  4MGZ E;  5DCN A;  3AI5 A;  3HIZ A;  3PHX B;  4NJ7 A;  1T0Y A;  4NPN A;  1OEY J;  2C9W B;  4A20 A;  3UGB B;  3M3J A;  2K8C A;  2JT4 B;  2MA9 B;  1V5T A;  2BF8 B;  3ZTC A;  3APF A;  5DPR A;  5D7G A;  4PS7 A;  4DHZ B;  1J0G A;  4HXD A;  2C7M B;  5JZE B;  1WFY A;  2IO3 B;  3DBH I;  4GSW A;  3ZLZ A;  2KDF B;  2HE7 A;  2FCQ A;  1P98 A;  1E7V A;  2DYO A;  4WJO A;  2K6Q A;  2KX3 A;  2G3Q B;  2J0M A;  2V1Y A;  2NPT B;  1V2Y A;  2KKC A;  2KMC A;  4F1S A;  2RR9 A;  2KDB A;  1RLF A;  2KXJ A;  1JRU A;  3ML9 A;  3KYD D;  4NAW A;  4DHJ B;  5AZF A;  1UEL A;  1GC6 A;  2DZI A;  2JZ3 B;  1Y8R C;  2UYZ B;  4MGK E;  4MEM A;  3WAN A;  4I6N B;  3PLU A;  4DHZ E;  3WA0 A;  3X23 A;  4I6P A;  2KFK B;  3U8Z A;  2K8H A;  3UIO B;  4RM8 A;  4KIK A;  4ICU A;  3QIJ A;  4GB9 A;  4AWJ A;  2MW5 A;  1E8Z A;  3KUZ A;  3IHP C;  2JRI B;  4XC2 A;  1WR1 A;  2GBK A;  4IG7 B;  4IWO A;  3B08 A;  2D10 A;  1S3S G;  3JVZ X;  4JGH B;  3RT3 B;  1WIA A;  3WAO A;  3VQI A;  4DWF A;  4W9F A;  4MH0 E;  4A3O A;  2V4L A;  1ISN A;  2LGX A;  3K9O B;  5IAA C;  3V60 A;  3QK0 A;  4RM9 A;  4BOZ B;  3RZF A;  5IA7 A;  4MGY E;  2A5U A;  2IY0 B;  2K25 A;  2KJH B;  2YLM A;  4NAW B;  2MP2 A;  3TMP B;  1PQS A;  4P7I A;  4IW0 A;  4HK2 A;  2M0X A;  4M8M A;  1TBE A;  2KWU B;  3OJ3 A;  3H6N A;  4B95 A;  2DYM A;  2IO0 B;  2KX0 A;  3QHT A;  4HDQ A;  4K7U A;  3QA8 A;  1S1Q B;  1Q0W B;  1YIW A;  5DPS A;  5G2N A;  2AYO B;  2N9P C;  4KIK B;  2GOW A;  2KWC A;  2HJ8 A;  4BOS C;  3A9J A;  2NVU I;  4URK A;  2K39 A;  3M62 B;  5KHO A;  5GMV A;  1L7Y A;  4FLH A;  4DHJ D;  3PHW B;  2Z0E B;  2KVR A;  4CYE A;  1KM7 A;  5L83 A;  1H4R A;  3NY5 A;  2AWT A;  2Z59 B;  2RSU A;  2GBM A;  4KSK C;  3VFK A;  4FN2 A;  1UH6 A;  2LGY A;  3ZO5 B;  5J2R A;  3TCA A;  2M17 A;  2MBQ A;  1E5W A;  3AU5 A;  3PGE A;  3DVG Y;  2XBB C;  4AP4 C;  1WXS A;  3KH0 A;  2FID A;  2KJR A;  2EMT A;  5JHB A;  1A5R A;  3PVL A;  3VTU A;  4IM0 A;  2DZJ A;  3VVW B;  4WJQ A;  1J8C A;  2M8S A;  3R7Q A;  2HD5 B;  3ZNG C;  3V6C B;  4TQ0 A;  4XZ4 A;  3ONS A;  3I3T B;  4W9I A;  1XT9 B;  4WWN A;  1H8C A;  2JVC A;  4ICV A;  4MSQ B;  4NJ6 A;  3VUY A;  1WF9 A;  1IPG A;  3QAQ A;  4E3C A;  1WY8 A;  2PPH A;  2ZNV B;  3ZTD A;  4W9G A;  1XD3 B;  3SDL C;  3PRZ A;  3JW0 X;  4MGI E;  3KYC D;  3DQV A;  2N4F A;  4FHJ A;  5CHV C;  5LXH A;  1J19 A;  2XEW A;  4KV2 A;  4W9C A;  2GBJ A;  3OJ4 B;  2KFJ A;  3R7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...