4ID4A

Crystal structure of chimeric beta-lactamase ctem-17m
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
263
structure length
263
Chain Sequence
b'HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTDFLRQIGDKETRLDRIEPDLNEGKLGDLRDTTTPKAIASTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM, Beta-lactamase PSE-4
publication title Maintenance of Native-like Protein Dynamics May Not Be Required for Engineering Functional Proteins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 94
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4id4A00
5E2HA 2HP5A 4KQQA 2Y2JA 1TEMA 3N7WA 3OCNA 5AQBA 3V50A 1EROA 3G2YA 5HW3A 1CEGA 1U60A 2XH9A 2EXAA 4X68A 5FI7A 1BLCA 1YMSA 3HL9A 1RP5A 1ERQA 3O86A 1ES5A 1W79A 2DRWA 4L0LA 2EX8A 5FA7A 4F94A 1E25A 5HX9A 4OPRA 2ZQDA 4N1HA 3AGDA 3C4PA 3QNCA 4MNRA 1O07A 2WGIA 4Y0OA 4Y0TA 1MWTA 2XD1A 4KZ8A 3O88A 1YLPA 4OQHA 2V20A 3IHAA 2WK0A 4U0XA 1C3BA 2WZZA 1MWRA 5EVID 1KE4A 3IWIA 5CGWA 3BEBA 1MWSA 4OLDA 1CI8A 1KGGA 1L0EA 3WS4A 1K56A 1SHVA 3W4OA 4GDBA 2WAEA 4K91A 3WS0A 2WZXA 2X01A 2WAFA 4OQGA 1DJAA 1VM1A 1YLWA 5EOEA 5HL1A 4X6TA 1S0WA 3LY3A 4MBHA 1FOFA 1SDNA 5GHXA 1M40A 4C3QA 1SDEA 2ZD8A 4WMCD 3ZVTA 1WE4A 4S2KA 2OLVA 3P09A 1ONHA 2H10A 1YQSA 4DE2A 5F83A 1YM1A 3OPLA 4KQRA 4E3NA 4P87A 3CZDA 1MKIA 2R9XA 4OPYA 1G68A 4S2JA 5FSRA 5EOOA 3W8KA 3WWXA 4GD6A 3A3IA 4GZBA 4UA7A 3VFFA 5E2GA 3VP4A 3FV7A 4EV4A 5TR7A 1Y54A 4QY6A 4R0QA 5FAOA 4DRTA 2G2UA 4M3KA 2IWCA 4KQOA 4GB7A 1Q2QA 5CRFA 3BYDA 3HBRA 3MXRA 3DW0A 3GRJA 4OQIA 4H8RA 1N4OA 3E2LA 3GVBA 4JXVA 4X53A 4ZAMA 3VP2A 1RCJA 3Q7VB 4E3IA 4RX3A 1JWPA 1BTLA 3EQUA 4LV2A 4R3JA 4QY5A 2HP6A 3BM6A 1KE3A 3G30A 2JE5A 3CG5A 3G4PA 4GD8A 1XKZA 4JF4A 5E2EA 3GTCA 4BD0A 5FI6A 3Q7ZA 1PI5A 5CHUA 2OSUA 5F82A 1GHMA 4FH2A 5EPHA 1LL9A 1I5QA 3FWLA 5M1AA 4KZAA 1NY0A 5D3OA 5FAQA 2V2FF 3IF6B 1XPBA 3VFHA 4GDNA 1FR6A 3HLWA 3RXWA 2ZC7A 3UDXA 3V3RA 2Y55A 3PBNA 3N4IA 1HD8A 4EBLA 2HDRA 3BLMA 3HVFA 2Y91A 4N92A 3IF6C 2Y2PA 4Y7PA 5L2FA 4NETA 3OCLA 1FCNA 4E3LA 3ISGA 4WYYA 1IYSA 2RCXA 3MFDA 1GA0A 2X71A 4WELA 1K54A 4WBGA 4OOMA 2ZC3B 1DJCA 3OC2A 2Y2GA 3SOIA 1YLJA 5DF7A 3BLSA 4P0MA 5FASA 5GHZA 4QU3A 3Q7VA 4ZJ2A 4HEFA 5CHMA 4RVAA 1FR1A 2B5RA 3C7VA 3OPPA 1G6AA 4B4ZA 1VQQA 3C5AA 4LENA 3A3JA 4IEDA 1NZUA 3D4FA 2XGNA 5EUAA 2ZQ7A 3HLDA 1NJ4A 3MZFA 4WZ4A 4ZJ1A 3UPPA 3BFDA 4E3MA 5FQJA 4DF6A 4U0TA 1K38A 2XK1A 3IF6A 3A3DA 2JCHA 1MY8A 4DXCA 1K6RA 4O7DA 2IWDA 1ZKJA 3WS5A 3ZCZA 5HAPA 3NI9A 4MEZA 4EBPA 1MBLA 2X02A 5EVIB 1KDWA 2JC7A 1FCMA 1BLHA 1ES3A 2Y2NA 3NIAA 4OPZA 4KZ7A 3SH7A 3IH9A 1KE0A 3V39A 3FKVA 1LL5A 3HUOA 3BRMA 1ONGA 1YLYA 5CTNA 2ZM8A 4PM7A 4EBNA 4JF6A 4WEKA 4C75A 1MPLA 1TDGA 2Z2LB 5TFQA 4MBKA 2PU4A 5EVIC 2QMIA 2J8YA 5DF9A 5A91A 3UNWA 3G32A 1SCWA 2DCFA 1XP4A 4QJGA 4LCLA 3GSGA 4PM5A 3N8RA 2H5SA 3UDFA 2WGVA 3IXHA 3ZDJA 2WKIA 4KZ6A 4WZ5A 1L2SA 3BFGA 4S2IA 3RXXA 1K4EA 1RGZA 1ZG6A 4DE1A 3TOIA 5DVAA 3W4PA 3O3VA 4PM6A 3TSGA 2Y2OA 4OKPA 2E8IA 3DTMA 4NK3A 1K25A 4FH4A 4S2LA 4XXRA 5M18A 3MBZA 3WS2A 1JTDA 3UPOA 3ZHHA 3ZG7B 3FZCA 1ERMA 2QZ6A 4X56A 1MWUA 3WRTA 5EVIA 2BLSA 1MXOA 4S2MA 1CEFA 4JBFA 1TDLA 3WRZA 4R1GA 3PBSA 5GL9A 4Q8IA 1NYYA 1ZC2A 3GQZA 4KZBA 5FQIA 3BECA 4JPMA 4OLGA 5DF8A 2FFYA 4XUZA 1Z6FA 1JWVA 4RYEA 1PI4A 5DTKA 2WGWB 3ZG0A 4BQMA 4WMCA 4S2OA 1NZOA 4BLMA 5KMWA 3AGFA 3C7UA 2HDSA 1KDSA 4DDYA 3HLEA 4KZ5A 3NCKA 3UN7A 2ZQ9A 4RX2A 1K4FA 2ZC6B 4QB8A 5EVLA 2XFSA 1KVLA 4IVIA 3ZG8B 1M6KA 4C6YA 5CGXA 1HVBA 4E6WA 4E3KA 3V5MA 1Q2PA 5M19A 1WYBA 4GOGA 1BLPA 1XGJA 2EX9A 3PBOA 4E6XA 1O7EA 1YT4A 4OVDA 2GDNA 4ZTKA 1FSYA 3V3SA 3MKFA 3PAGA 4JXGA 1S6RA 3O87A 4OQ0A 4BL3A 3EQVA 4N1XA 2J7VA 5A90A 5TGFA 4QD4A 1LI9A 4IBXA 3S1YA 2G2WA 4JLFA 1I2WA 4LV1A 3G35A 3NY4A 5EE8A 1W5DA 1AXBA 1LHYA 5HAIA 2QPNA 4P6BA 1HZOA 3S4XA 3UE3A 2DNSA 1PWCA 4FSFA 3Q81A 4EUZA 1QMEA 4D2OA 1IEMA 3ZNYA 4RA7A 5A92A 3DWZA 3IHBA 3JYIA 3VMAA 1H8YA 2WGWA 1FQGA 4ZBEA 1BT5A 1DY6A 1IYPA 3MZEA 3PBTA 5EECA 3ZG5A 1ZG4A 3AGEA 4EQIA 2I72A 5HFOA 5DTSA 4KZ9A 2J9PA 1DJBA 1HTZA 3IH8A 4KENB 4N9KA 3VOYA 3ZNTA 4DE0A 3ITBA 4CPKA 2EXBA 4CJNA 3UE0A 4E3OA 3ITAA 4PPRA 3M2JA 4OP8A 4MBFA 4YFMA 5AQ9A 5CHJA 3Q07A 3UPNA 4A5RA 2OLUA 4K0WA 5JYOA 2PBYA 3G31A 4ZJ3A 3UO9A 3TG9A 1NXYA 2FFFB 4JXSA 4QHCA 5AQ7A 3VSLA 5CEBA 3OPRA 4GNUA 1KGEA 2ZJ9A 4P85A 1PWDA 3BFFA 2Q9MA 3G34A 2C6WB 4OONA 4FD8A 2Y2IA 3MZDA 5GLAA 3IWOA 1J9MA 4GKUA 2ZC4B 3FYZA 4GN2A 3PAEA 3CJMA 3DWKA 4JF5A 2P9VB 1E4DA 1K56D 5FAPA 4UAAA 5AQAA 3W4QA 3LO7A 2Y4AA 4B4XA 1E3UD 4WM9A 2ZM2A 3HUMA 5CGSA 4U3TA 1BSGA 5I94A 3S22A 1QMFA 1XA1A 3PBQA 5IHVA 5GHYA 4HBUA 4OPQA 4FCFA 1EI5A 5FATA 2XR0A 4PM9A 2Q9NA 1IKIA 1KGFA 4DXBA 5A93A 2XLNA 4BENA 2WADA 4N9LA 1W8YA 4OP5A 3IF5A 1WYCA 5FI2A 4IBRA 4OOYA 2ZLYA 3IT9A 3IXGA 3N6IA 4R4SA 3OZHA 2JBFA 2Y2KA 3HLBA 1EWZA 1PIOA 4PM8A 2RL3A 3VP3A 3QNBA 3M6BA 1BZAA 4DKIA 1W8QA 5BOHA 2HDQA 2ZM0A 2EFXA 4X69A 4S2NC 5F1GA 5G18A 2XF3A 5U47A 1IYOA 1ESUA 5KSCA 1XA7A 3IXBA 1KVMA 1K57C 1L0FA 1PZOA 3GV9A 5FQMA 1E3UA 5GLBA 2ZQCA 4LCMA 3VOZA 2Y2HA 1GHPA 3UY6A 5KSHA 1XX2A 2VGKA 1BLSA 2V1ZA 2HPBA 3GMWA 1BULA 2H0TA 3BFCA 4WEJA 4ZDXA 3A3FA 3SS3A 3IWQA 2CC1A 3LCEA 1FCOA 3G2ZA 4ID4A 5FDHA 1GA9A 5JYPA 1H8ZA 3BFEA 1IKGA 2P9VA 2WKHA 3N8LA 1JVJA 2UWXA 3Q1FA 3E2KA 5HAQA 1TVFA 3A3EA 3C4OA 3HLGA 3I7JA 1GCEA 4YINA 5DTTA 2OV5A 4BL2A 4KG6A 1SKFA 1RGYA 3CMZA 3MXSA 1LI0A 4EWFA 2H0YA 3IXDA 1XXMA 3PTEA 1PZPA 4LV0A 3MKEA 4DE3A 4HBTA 5CTMA 4S2NA 2HDUA 2A3UA 3LY4A 3QHYA 4B88A 1IYQA 1K54C 4K0XA 1K57A 3HLCA 1JWZA 1NRFA 1CI9A 3HUNA 3SH9A 4UHUA 3ZG9B 1PYYA 3ZFZA 1XGIA 2VGJA 2ZC5B 1FSWA 1ES4A 4JKTA 2WKEA 5FQQA 2WYXA 5KZHA 2A49A 3Q82A 3P98A 2Y2MA 2ZMAA 3B3XA 5FQ9A 3SH8A 4Y0UA 2PU2A 2EX2A 1PW8A 3SS4A 2EX6A 3UDIA 4OOLA 3VP1A 3PBRA 5E2FA 3WS1A 5J8XA 3HREA 5GLDA 4E3JA 3VP0A 3NDGA 1YLTA 1JTGA 1N9BA 1W7FA 3IQAA 4LV3A 4UA9A 4Z9QA 4X55A 1K55C 3FKWA 4DDSA 2XD5A 3NC8A 2XDMA 3N8SA 1L0GA 3VSKA 2XFTA 2XEPA 2WUQA 1IELA 2ZQ8A 3GR2A 4IVKA 3RJUA 1K6SA 2BG1A 2Y2LA 2Y2QA 4KZ4A 2R9WA 4OH0A 1CK3A 3NBLA 1PWGA 5CERA 4KG5A 4HESA 1PW1A 4BD1A 4KG2A 4XUXA 2IWBA 5HARA 1ALQA 2Z2MB 4UA6A 3ZGAB 3LEZA 5E43A 2C5WB 5FQKA 2ZQAA 3NDEA 3M6HA 5CXWA 1BUEA 1GHIA 1YLZA 1I2SA 1L0DA 4BJPA 2Y59A 1OMEA 4JXWA 1LLBA 5CEDA 5GLCA 1ESIA 3ZVWA 5CECA 5F1FA 1H5XA 3SS5A 1ES2A 2J9OA 1YMXA 3UE1A 4KZ3A 3HLFA 4PMAA 4WZ5C 3M2KA 2XQZA 2P74A 2EFUA 4S2PA 2HP9A 3OPHA 4MLLA 4R4RA 1NYMA 4R23A 4R3BA 1K55A
chains in the Genus database with same CATH superfamily
1DRMA 1VB6A 3EEAA 5AQBA 3OCNA 3V50A 2JKTI 3MS6A 3O86A 4QWOA 1ES5A 3DBAA 1E25A 3BJNA 3AGDA 4I3IA 3A0SA 1MWTA 2XD1A 1YLPA 3OBFA 1C3BA 5IS1A 1KE4A 1V9ZA 1D7EA 1MWSA 3WS4A 1CI8A 1KGGA 1K56A 3LR0A 3W4OA 4K91A 3WS0A 2WZXA 1DJAA 5HL1A 3FC7A 4X6TA 3LY3A 4MBHA 1SDEA 4G3VA 1WE4A 3G6OA 5G4YA 2OLVA 3O5YA 3P09A 1K0KA 1GSWA 4PKYG 1YM1A 4E3NA 1G68A 2GZAA 4S2JA 5EOOA 4I38A 3VFFA 3VP4A 4PAUA 2M7UA 3FG8A 5FAOA 4RQ9A 4M3KA 5CRFA 3HBRA 3B42A 4OQIA 4X53A 1N4OA 3GVBA 3F1OA 3OLOA 1JWPA 2Y8HA 3B47A 4R3JA 2HP6A 2ZMVA 1KE3A 4GD8A 2JE5A 1OPXA 2ZL1A 1MZUA 1PI5A 5CHUA 1PNEA 1OJ5A 4FH2A 1I5QA 4P6ZM 1IFQA 2A24B 2V2FF 1XPBA 4GDNA 3NULA 3UDXA 1HD8A 3OOVA 4EBLA 4EESA 3BLMA 3S7OA 2JKRI 2Y91A 4N92A 3IF6C 4Y7PA 3OCLA 4WN5A 4WYYA 1N9OA 3RH8B 4WBGA 4OOMA 4WF0A 3OC2A 3SOIA 2KDKA 4K08A 4QU3A 3BW6A 3KSFA 5DJTA 4B4ZA 3D4FA 3CUEC 5HWTA 2QJ5A 5FQJA 4MDZA 2JCHA 3IBRA 4DXCA 4O7DA 4M4XA 3KSGA 3T4KA 1EW0A 5EVIB 3IH9A 4BMWA 3FKVA 3BQ8A 2ZM8A 4EERA 4EBNA 4JF6A 1PRQA 3B33A 4CLCA 1TDGA 4NXEA 1Y28A 2WGVA 4KZ6A 3BWLA 4I3AA 4PM6A 4NK3A 1W63M 3H7WB 1D1JA 4D60A 3MBZA 4LLOB 2NUTC 1ERMA 4WLAA 1CEFA 1AWIA 4R1GA 1ZC2A 3EGDC 1F98A 1SZVA 5DFYA 3ZYTA 1Z6FA 1JWVA 1PI4A 1HLUP 2K7SA 5DTKA 5KIZA 4S2OA 2HDSA 1KDSA 4LFUA 1G28A 2B02A 1K4FA 1YSPA 4E6WA 3T4SA 2Z6CA 4GOGA 1XGJA 3PBOA 1YT4A 3PAGA 4OQ0A 4QD4A 3E4QA 4JLFA 1I2WA 4HJ3A 2QHKA 1W5DA 1AXBA 5HSQA 1HZOA 2DNSA 1Y4OA 3Q81A 3DTKA 2OOLA 1NLYA 5A92A 3IHBA 1H8YA 2WGWA 1FQGA 2J3WA 1BT5A 4HQAA 2W3HA 1IYPA 5EECA 5HD3A 5HFOA 2A24A 4DE0A 3ZNTA 4CPKA 2Q0OA 5FEFA 4PPRA 4OP8A 3EGXC 2OLUA 3LIBA 2PBYA 4JXSA 2FFFB 3OPRA 4HH3A 3RTYA 1KGEA 3BFFA 3G34A 2C6WB 5CX7A 2HZ5A 2JN7A 4GN2A 1ODVA 3DWKA 4Y15A 4Q0JA 2P08A 5FAPA 4UAAA 4PHTA 4WM9A 1BSGA 1QMFA 3T1RA 3QP2A 3UB5P 4FCFA 1CJFA 2XLNA 4OP5A 3IF5A 2ZLYA 2JBFA 1BYWA 2RL3A 3CPTA 3QNBA 5BOHA 1BZAA 2ZM0A 3JVUA 5G18A 4S2NC 2XF3A 5U47A 1KVMA 1K57C 1L0FA 2ZQCA 3LIDA 5KSHA 4EQ1A 2P7JA 3K3DA 3BFCA 3UMDA 3A3FA 5MC7A 3N8LA 1H8ZA 3BFEA 4EU0A 3LI8A 2VZWA 2UWXA 2OAQ1 3A3EA 5DTTA 3I7JA 4YOFA 2OV5A 3MR0A 2KX6A 3DTIA 3KO6A 4F3LA 1XXMA 4LV0A 3UB7A 3QHYA 4B88A 1NRFA 3SH9A 4EUVA 3ZG9B 2VGJA 5HPIA 1ES4A 2XA7M 3Q82A 2ZMAA 2EX2A 4HOIA 1PW8A 4HNBA 1LSVA 5DJUA 3UDIA 3VP1A 5EFWA 5EV0A 2ZMFA 3NDGA 1YLTA 3BY9A 4LV3A 4UA9A 4CLCE 4GS9A 2XEPA 1IELA 1K6SA 1P9RA 2Y2LA 3K2NA 1PW1A 4BD1A 4XUXA 2PD8A 2Z2MB 4UA6A 1WA9A 3T12B 4MCWA 3S7NA 3M6HA 1YLZA 2M1CA 1I2SA 1L0DA 1OMEA 2HF6A 4H6JA 5F1FA 1H5XA 2J9OA 1YMXA 4JGOA 3UE1A 4KZ3A 2XQZA 4NXFA 4S2PA 4MLLA 4GJ4A 1TEMA 2QKPA 2GX5A 3V67A 1U60A 2XH9A 2EXAA 1YSQA 5FI7A 4LRYC 1RP5A 2QYBA 4GLQA 4HY8A 3F1OB 2J80A 2ZQDA 4MNRA 4Y0TA 2ZL1B 4OQHA 2V20A 2WK0A 5HDSA 3MSHA 3BEBA 4OLDA 4P6ZS 3K3CA 3T4LA 1OTDA 3LR3A 2X01A 3LYXA 2WAFA 3C8CA 1FOFA 4WMCD 3JPUA 1YQSA 4L9EA 3OPLA 4P87A 2ZOIA 5LBRA 3WWXA 4UA7A 4EV4A 4QPRA 1MC0A 2JHEA 2K31A 4B93A 3MXRA 3G30A 4LRXC 3D72A 1T1AA 1S67L 5F82A 3MQQA 4NEED 5EPHA 4GCZA 5D3OA 1NY0A 2W0NA 1PFLA 3PR6A 5L10A 3S7PA 1TD5A 5F6AA 3VFHA 2ZC7A 4Q0HA 4X1LA 2Y55A 3PBNA 2INWA 4HH2A 3E4PA 1VETB 2HDRA 1XJ3A 3HVFA 4KUKA 5L2FA 4E3LA 2O0YA 3ISGA 4CLCB 4O0PA 1GA0A 1J3WA 2Y2GA 2HJ9C 4P0MA 5GHZA 4ZJ2A 3EEHA 3H82A 5CHMA 4RVAA 2B5RA 5C5KA 4CQHA 4HP9A 3A3JA 2XGNA 2W1TA 2ZQ7A 1NJ4A 2J3TD 4ZJ1A 5DFXA 3LICA 4DF6A 1K38A 3A3DA 1MY8A 3NOPC 4GHIA 2IWDA 1ZKJA 5HAPA 2JKFA 1KDWA 1FCMA 3LIEA 3NIAA 4OPZA 4O01A 3LGOA 3SH7A 1KE0A 1S1YA 2W3FA 3HUOA 4BBTA 5TFQA 4MBKA 2PU4A 5EVIC 5A91A 3UNWA 3LI9A 3F1NA 4PM5A 3N8RA 4L9GA 1N9LA 1L2SA 2B95A 3RXXA 1XJ6A 1ZG6A 4G3KA 3O3VA 3TSGA 5HPFA 4PKYA 5A8BA 1K25A 1NLZA 4S2LA 5EM0A 1JTDA 2OAP1 3ZHHA 2O99A 2BLSA 1XJ2A 4JBFA 1S1ZA 3PBSA 1VEUA 2PT7A 4KZBA 2VK3A 3BECA 2FFYA 1N9NA 2WGWB 3ZG0A 2WKPA 2V8FA 5KMWA 3NCKA 3L7HA 2ZQ9A 4RX2A 4BBVA 2ZC6B 3P7NA 3PXPA 4MN7A 1GSVA 4IVIA 3ZG8B 1M6KA 5M19A 1TS8A 1O7EA 3V3SA 2GDNA 4ZTKA 3QP5A 4JXGA 4LRZE 2J7VA 5TGFA 4LV1A 5FDSA 3G35A 3NY4A 1OJGA 1YPRA 1LHYA 2VGLS 2WKRA 2QPNA 3UE3A 1PWCA 1QMEA 3NJAA 3ZNYA 3VMAA 1S66L 1DY6A 2ZBBA 3FPWA 5AVFA 4KZ9A 4NKPA 2J9PA 4ZRRA 1DJBA 1HTZA 4KENB 4N9KA 3ITBA 4CJNA 4E3OA 3M2JA 3MF0A 3CPTB 5CHJA 3Q07A 5AQ9A 3UPNA 4A5RA 4K0WA 5JYOA 3G31A 3NHQA 1VETA 4ZJ3A 3TG9A 5CEBA 4QHCA 3VSLA 2D02A 2VLGA 2Q9MA 4YNRA 4FD8A 4EW7A 2V0UA 3IWOA 1J9MA 3CJMA 3KYQA 1S4SA 2PRFA 4JF5A 3IX4A 3LO7A 2Y4AA 2QJ7A 2ZM2A 4U3TA 3F1PA 4ME4A 3LIAA 4F3LB 4OPQA 1EI5A 1IKIA 5A93A 3VE3A 4N9LA 5FI2A 1WYCA 1H8MA 1W8QA 2XA7S 2EFXA 2W3EA 1IYOA 3IXBA 3GV9A 5FQMA 4II7A 2Y2HA 1GHPA 3UY6A 2VGKA 2HPBA 3IWQA 2Y79A 5JYPA 2WKQA 2WKHA 1JVJA 3HCYA 4O8GA 4GS9B 1GCEA 4I5SA 3W2ZA 1SKFA 1LI0A 3IXDA 2W1RA 5J4EA 5CTMA 2HDUA 2A3UA 4ETXA 4Y5FA 1PYYA 3ZFZA 1FIKA 4H6JB 5IT5A 4ESPA 2WYXA 1SKOA 4HJ6A 2PR5A 2A49A 5KZHA 3P98A 5FQ9A 3LUQA 2PU2A 2EX6A 2Z6DA 2JKGA 4Y13A 4UQIM 3U2AA 3PBRA 5E2FA 5J8XA 1NWZA 5GLDA 3NECA 1XJ4A 2L1MA 4JGRA 1T18A 4DDSA 3CITA 3BY8A 2XDMA 4KQDA 3KX0X 4Q0IA 4R70A 4IVKA 3RJUA 2Y2QA 3UMEA 2R9WA 1CK3A 4GW9A 4KG5A 4HESA 4KG2A 1ALQA 3LEZA 5E43A 5FQKA 5HL6A 1GHIA 2I9VA 3T50A 4JXWA 1LLBA 5GLCA 3ZVWA 3R4KA 1OTIA 2EFUA 3UB8A 2HP9A 3OPHA 4R4RA 4ID4A 1NYMA 4R23A 4R3BA 1K55A 3T4JA 5E2HA 4EETB 5HW3A 1EROA 3G2YA 4DN0A 2JKTM 1BLCA 3HJIA 1YMSA 3HL9A 5IU1A 1ERQA 1W79A 2DRWA 4L0LA 5L09A 1TS0A 4OPRA 1ZHHB 3UE6A 3O88A 3IHAA 2G7UA 3QP1A 1MWRA 5EVID 1H0MA 3IWIA 1TS6A 5CGWA 1L0EA 5DKKA 1SHVA 2HJEA 3S7QA 4R6LA 1VM1A 1YLWA 3CWFA 1SDNA 5GHXA 4S2KA 1ONHA 2H10A 4DE2A 4KQRA 4OPYA 3A3IA 4GZBA 5E2GA 5TR7A 1Y54A 4R0QA 1H3QA 2G2UA 4KQOA 1Q2QA 3BYDA 3DW0A 3GRJA 4H8RA 2VA0A 4E3IA 4RX3A 4X1MA 1BTLA 1T1BA 4QY5A 3H82B 3CG5A 1P0ZA 3H9WA 4JF4A 5E2EA 3GTCA 2P04A 2VX8A 3QP4A 5FI6A 2FH5A 2W1TB 3TRCA 1GHMA 2YKFA 3MXQA 1LL9A 3FWLA 2LB9A 4GHIB 4MN6A 2XROA 5EM1A 3UB9A 1OTAA 4DJ2A 2Y2PA 1FCNA 2H28A 2ZOHA 4YWZA 2RCXA 3MFDA 4WELA 3PYPA 1DJCA 5FASA 3F1NB 3Q7VA 4CLCC 1FR1A 3C7VA 1VQQA 3LR4A 4HP4A 3MZFA 1JNUA 2PBDP 3UPPA 1DP6A 3IF6A 2VV8A 1K6RA 1T1CA 5F69A 3T1XA 4MEZA 4EBPA 2X02A 2JC7A 1ES3A 4KZ7A 1VEUB 3V39A 1YLYA 2QWSA 2PD7A 4WL9A 2EWWA 1MPLA 2Z2LB 4MN5A 2QMIA 3MJQA 3G32A 1SCWA 4LCLA 1UWPX 3GSGA 2H5SA 3UDFA 3IXHA 3ZDJA 2WKIA 3UB6A 3BFGA 3IX3A 4Y3IA 2NUPC 4DE1A 4ETZA 3TOIA 1OT6A 4XT2B 3W4PA 4OKPA 2E8IA 1S4RA 4FH4A 4NXBA 4HIAA 3U4LP 3ZG7B 3FZCA 2QZ6A 4X56A 1MWUA 3WRTA 1TDLA 1OTEA 4Q8IA 3GQZA 5FQIA 2V1BA 4JPMA 5DF8A 4FOFA 4XUZA 1KOUA 4RYEA 4WMCA 3CLOA 1NZOA 2D01A 3HLEA 4KZ5A 4QB8A 4FTXA 1KVLA 4C6YA 2V9AA 4E3KA 3V5MA 4E6XA 1FSYA 3MKFA 5DKLA 2K2NA 3O87A 3EQVA 4N1XA 5A90A 1LI9A 4IBXA 3S1YA 2G2WA 2HV1A 4JGQA 2OWJA 5HAIA 4P6BA 4FSFA 3MQ0A 4EUZA 2V0WA 4I3JA 4IUKA 3BQAA 1V9YA 3F1PB 3E4OA 3MZEA 3PBTA 5AJGA 3AGEA 4EQIA 5DTSA 4UEYA 5HWVA 2EXBA 4YFMA 1STZA 3KSIA 2ZJ9A 1PWDA 4BBUA 3MZDA 4GKUA 3FYZA 2XRNA 3MQOA 5FEGA 1K56D 3TE8A 5AQAA 3W4QA 3PBQA 5IHVA 3TJZC 5GHYA 4EEUA 4HBUA 2L4RA 4IUHA 1KGFA 2PDRA 2WADA 4OOYA 4E04A 3IXGA 4R4SA 2Y2KA 4HJ4A 1EWZA 1PIOA 4PM8A 3VP3A 5AVEA 3M6BA 2CMNA 1SKOB 4X69A 1XA7A 1T19A 2R78A 5GLBA 4LCMA 3E0YA 5L8MA 3QP8A 2V1ZA 3GMWA 4UQIS 1F9IA 1BULA 4WEJA 4BWIA 4ZDXA 2CC1A 3G2ZA 4NG2A 3SW1A 1TS7A 1GA9A 2BASA 2P9VA 1F5MA 3E2KA 5HAQA 4BL2A 3C2WA 3L9KA 4KG6A 3CMZA 1UWNX 4KUOA 2H0YA 3PTEA 1PZPA 1F2KA 4XT2A 3MKEA 4DE3A 4S2NA 3LY4A 5J3WA 4K0XA 1K57A 3HLCA 2MJ6A 4UHUA 4Y17A 1FSWA 4JKTA 2WKEA 5TBMA 3CI6A 3C30A 3SH8A 3SS4A 4LGWA 2LB5A 4OOLA 2W3GA 3WS1A 3HREA 4E3JA 3LR5A 1JTGA 1N9BA 3DAVA 4X55A 2XD5A 3N8SA 3VSKA 2ACGA 2XFTA 2ZQ8A 3GR2A 2BG1A 1A0KA 4OH0A 3NBLA 1PWGA 4IHQA 3EOIA 5G4ZA 2IWBA 3T4OA 2C5WB 2ZQAA 3NDEA 5CXWA 1BUEA 1IOUA 4CLCD 4BJPA 1ESIA 2VKSA 3HLFA 3M2KA 1VHMA 4JGPA 1NRJA 2HP5A 2M7VA 4KQQA 2Y2JA 3N7WA 1ACFA 1CEGA 4X68A 3R7WA 2VJWA 2EX8A 5FA7A 4F94A 5HX9A 2XSSA 4N1HA 3C4PA 3P01A 3QNCA 5TJJA 1O07A 2WGIA 4Y0OA 4KZ8A 1Z09A 3JVVA 3T1QB 4U0XA 2WZZA 2UV0E 4GDBA 2WAEA 4OQGA 5EOEA 1S0WA 2O9AA 4C3QA 1M40A 2ZD8A 3ZVTA 3TW8A 3C38A 2YKHA 3CZDA 1MKIA 2R9XA 5HDDA 2PYRA 5FSRA 3W8KA 4GD6A 2VV6A 3FV7A 4QY6A 4DRTA 3LEQA 2V8CA 2IWCA 4GB7A 3E2LA 4JXVA 4X25A 4ZAMA 3VP2A 1RCJA 3Q7VB 3EQUA 4LV2A 3BM6A 3G4PA 2PAVP 1XKZA 4BD0A 3Q7ZA 2OSUA 4G3WA 1UGUA 1MKMA 5M1AA 4KZAA 5FAQA 1DP8A 3IF6B 1FR6A 3HLWA 3RXWA 3V3RA 3N4IA 5EVEA 5FL3A 2O9CA 3IX8A 3D9YA 4NETA 4R3AA 2EWVA 1IYSA 3IS2B 2E8JA 4EXOA 1P97A 2X71A 1K54A 2ZC3B 1YLJA 5DF7A 3BLSA 3NOTC 1LSWA 4HEFA 3NOUC 2J3TC 1G6AA 3CHWP 3OPPA 3C5AA 4LENA 2O9BA 4IEDA 1NZUA 5EUAA 4L9FA 3HLDA 4WZ4A 1FILA 3T4TA 3BFDA 4E3MA 4U0TA 5HD5A 2XK1A 3KYZA 5I5LA 3WS5A 4HHDA 3ZCZA 3NI9A 5J7EA 1MBLA 1BLHA 2Y2NA 2W3DA 4HI4A 1LL5A 3BRMA 1ONGA 1G5UA 5CTNA 4PM7A 3ICYA 4WEKA 4C75A 3VOLA 4ARZB 2VGLM 5DF9A 2J8YA 2DCFA 1XP4A 4QJGA 4DJ3A 4FUWA 4WUJA 4WZ5A 2V1AA 3HJKA 4IJGA 1ZTUA 4S2IA 1K4EA 1RGZA 5DVAA 2Y2OA 3DTMA 4I39A 4XXRA 5M18A 3WS2A 2B18A 4AFIA 3UPOA 1YKDA 3KYEA 3FPVA 5EVIA 1MXOA 4S2MA 5HWWA 3WRZA 5GL9A 1NYYA 4OLGA 4Z1WA 4BQMA 4BLMA 3AGFA 3C7UA 4EEPA 4DDYA 5K5BA 5HDCA 5EVLA 2XFSA 1CQAA 5CGXA 1HVBA 4DMZA 2AVXA 1Q2PA 1WYBA 4Y2FA 1BLPA 2EX9A 1W63Q 4OVDA 3H7WA 2JKRM 1S6RA 4BL3A 1XFNA 2A2LA 4R38A 2HGVA 5EE8A 2VV7A 3S4XA 4D2OA 1IEMA 4RA7A 3DWZA 1GSXA 3JYIA 4ZBEA 1DP9A 3ZG5A 1ZG4A 3VE4A 2I72A 2VEAA 3IH8A 3VOYA 3SZTA 3UE0A 3ITAA 4MBFA 5F68A 3UO9A 1CF0A 1NXYA 5AQ7A 4GNUA 4P85A 4OONA 2Y2IA 3IS2A 2EA9A 3LIFA 2PR6A 5GLAA 2ZC4B 3PHYA 2GJ3A 3PAEA 2BTFP 3DTEA 3KSHA 2FZ0A 3VV4A 2L0WA 3CUEA 2P9VB 1E4DA 4B4XA 1E3UD 3HUMA 2DMWA 5CGSA 3MMHA 5I94A 3S22A 1XA1A 5FATA 2XR0A 4PM9A 3ULFA 2Q9NA 4DXBA 1X0OA 3ZQ5A 4BENA 1W8YA 4IBRA 3N6IA 3IT9A 4LPZA 3OZHA 3HLBA 1LSXA 4DKIA 2HDQA 5TBMB 5F1GA 1ESUA 5KSCA 1PZOA 1D06A 1E3UA 3VOZA 1XX2A 1BLSA 1YAXA 2H0TA 3GDIA 4ARZA 2PYPA 3SS3A 3LCEA 1FCOA 5FDHA 1IKGA 4B9OA 3Q1FA 1TVFA 3C4OA 3CAXA 3HLGA 3A0VA 4YINA 2KOIA 1LL8A 3MXSA 1RGYA 4EWFA 3IBJA 3RFBA 2IA2A 4HBTA 1IYQA 1K54C 3HUNA 1JWZA 1CI9A 3T4QA 3A0RA 1XGIA 3T1SA 2ZC5B 1LT0A 5FQQA 2Y2MA 3B3XA 1OT9A 5HZHA 4Y0UA 4MMNA 1TF1A 3EWKA 1P9WA 1OTBA 1G6OA 3R7WB 5F5YA 3VP0A 1W7FA 3IQAA 3E98A 4Z9QA 1K55C 3FKWA 3NC8A 1L0GA 3D3OA 2WUQA 1XFQA 4KZ4A 3MFXA 2OWHA 5CERA 4NXGA 3LFVA 5L07A 5HARA 2GNXA 3ZGAB 2W27A 1L3LA 2Y59A 5CEDA 5CECA 3SS5A 1ES2A 2PHYA 4PMAA 4WZ5C 2P74A 2KLIA 3GECA 5F83A 3UN7A 3QP6A
chains in the Genus database with same CATH topology
5E2HA 2HP5A 4KQQA 2Y2JA 1TEMA 3N7WA 3OCNA 5AQBA 3V50A 1EROA 3G2YA 5HW3A 1CEGA 1U60A 2XH9A 2EXAA 4X68A 5FI7A 1BLCA 1YMSA 3HL9A 1RP5A 1ERQA 3O86A 1ES5A 1W79A 2DRWA 4L0LA 2EX8A 5FA7A 4F94A 1E25A 5HX9A 4OPRA 2ZQDA 4N1HA 3AGDA 3C4PA 3QNCA 4MNRA 1O07A 2WGIA 4Y0OA 4Y0TA 1MWTA 2XD1A 4KZ8A 3O88A 1YLPA 4OQHA 2V20A 3IHAA 2WK0A 4U0XA 1C3BA 2WZZA 1MWRA 5EVID 1KE4A 3IWIA 5CGWA 3BEBA 1MWSA 4OLDA 1CI8A 1KGGA 1L0EA 3WS4A 1K56A 1SHVA 3W4OA 4GDBA 2WAEA 4K91A 3WS0A 2WZXA 2X01A 2WAFA 4OQGA 1DJAA 1VM1A 1YLWA 5EOEA 5HL1A 4X6TA 1S0WA 3LY3A 4MBHA 1FOFA 1SDNA 5GHXA 1M40A 4C3QA 1SDEA 2ZD8A 4WMCD 3ZVTA 1WE4A 4S2KA 2OLVA 3P09A 1ONHA 2H10A 1YQSA 4DE2A 5F83A 1YM1A 3OPLA 4KQRA 4E3NA 4P87A 3CZDA 1MKIA 2R9XA 4OPYA 1G68A 4S2JA 5FSRA 5EOOA 3W8KA 3WWXA 4GD6A 3A3IA 4GZBA 4UA7A 3VFFA 5E2GA 3VP4A 3FV7A 4EV4A 5TR7A 1Y54A 4QY6A 4R0QA 5FAOA 4DRTA 2G2UA 4M3KA 2IWCA 4KQOA 4GB7A 1Q2QA 5CRFA 3BYDA 3HBRA 3MXRA 3DW0A 3GRJA 4OQIA 4H8RA 1N4OA 3E2LA 3GVBA 4JXVA 4X53A 4ZAMA 3VP2A 1RCJA 3Q7VB 4E3IA 4RX3A 1JWPA 1BTLA 3EQUA 4LV2A 4R3JA 4QY5A 2HP6A 3BM6A 1KE3A 3G30A 2JE5A 3CG5A 3G4PA 4GD8A 1XKZA 4JF4A 5E2EA 3GTCA 4BD0A 5FI6A 3Q7ZA 1PI5A 5CHUA 2OSUA 5F82A 1GHMA 4FH2A 5EPHA 1LL9A 1I5QA 3FWLA 5M1AA 4KZAA 1NY0A 5D3OA 5FAQA 2V2FF 3IF6B 1XPBA 3VFHA 4GDNA 1FR6A 3HLWA 3RXWA 2ZC7A 3UDXA 3V3RA 2Y55A 3PBNA 3N4IA 1HD8A 4EBLA 2HDRA 3BLMA 3HVFA 2Y91A 4N92A 3IF6C 2Y2PA 4Y7PA 5L2FA 4NETA 3OCLA 1FCNA 4E3LA 3ISGA 4WYYA 1IYSA 2RCXA 3MFDA 1GA0A 2X71A 4WELA 1K54A 4WBGA 4OOMA 2ZC3B 1DJCA 3OC2A 2Y2GA 3SOIA 1YLJA 5DF7A 3BLSA 4P0MA 5FASA 5GHZA 4QU3A 3Q7VA 4ZJ2A 4HEFA 5CHMA 4RVAA 1FR1A 2B5RA 3C7VA 3OPPA 1G6AA 4B4ZA 1VQQA 3C5AA 4LENA 3A3JA 4IEDA 1NZUA 3D4FA 2XGNA 5EUAA 2ZQ7A 3HLDA 1NJ4A 3MZFA 4WZ4A 4ZJ1A 3UPPA 3BFDA 4E3MA 5FQJA 4DF6A 4U0TA 1K38A 2XK1A 3IF6A 3A3DA 2JCHA 1MY8A 4DXCA 1K6RA 4O7DA 2IWDA 1ZKJA 3WS5A 3ZCZA 5HAPA 3NI9A 4MEZA 4EBPA 1MBLA 2X02A 5EVIB 1KDWA 2JC7A 1FCMA 1BLHA 1ES3A 2Y2NA 3NIAA 4OPZA 4KZ7A 3SH7A 3IH9A 1KE0A 3V39A 3FKVA 1LL5A 3HUOA 3BRMA 1ONGA 1YLYA 5CTNA 2ZM8A 4PM7A 4EBNA 4JF6A 4WEKA 4C75A 1MPLA 1TDGA 2Z2LB 5TFQA 4MBKA 2PU4A 5EVIC 2QMIA 2J8YA 5DF9A 5A91A 3UNWA 3G32A 1SCWA 2DCFA 1XP4A 4QJGA 4LCLA 3GSGA 4PM5A 3N8RA 2H5SA 3UDFA 2WGVA 3IXHA 3ZDJA 2WKIA 4KZ6A 4WZ5A 1L2SA 3BFGA 4S2IA 3RXXA 1K4EA 1RGZA 1ZG6A 4DE1A 3TOIA 5DVAA 3W4PA 3O3VA 4PM6A 3TSGA 2Y2OA 4OKPA 2E8IA 3DTMA 4NK3A 1K25A 4FH4A 4S2LA 4XXRA 5M18A 3MBZA 3WS2A 1JTDA 3UPOA 3ZHHA 3ZG7B 3FZCA 1ERMA 2QZ6A 4X56A 1MWUA 3WRTA 5EVIA 2BLSA 1MXOA 4S2MA 1CEFA 4JBFA 1TDLA 3WRZA 4R1GA 3PBSA 5GL9A 4Q8IA 1NYYA 1ZC2A 3GQZA 4KZBA 5FQIA 3BECA 4JPMA 4OLGA 5DF8A 2FFYA 4XUZA 1Z6FA 1JWVA 4RYEA 1PI4A 5DTKA 2WGWB 3ZG0A 4BQMA 4WMCA 4S2OA 1NZOA 4BLMA 5KMWA 3AGFA 3C7UA 2HDSA 1KDSA 4DDYA 3HLEA 4KZ5A 3NCKA 3UN7A 2ZQ9A 4RX2A 1K4FA 2ZC6B 4QB8A 5EVLA 2XFSA 1KVLA 4IVIA 3ZG8B 1M6KA 4C6YA 5CGXA 1HVBA 4E6WA 4E3KA 3V5MA 1Q2PA 5M19A 1WYBA 4GOGA 1BLPA 1XGJA 2EX9A 3PBOA 4E6XA 1O7EA 1YT4A 4OVDA 2GDNA 4ZTKA 1FSYA 3V3SA 3MKFA 3PAGA 4JXGA 1S6RA 3O87A 4OQ0A 4BL3A 3EQVA 4N1XA 2J7VA 5A90A 5TGFA 4QD4A 1LI9A 4IBXA 3S1YA 2G2WA 4JLFA 1I2WA 4LV1A 3G35A 3NY4A 5EE8A 1W5DA 1AXBA 1LHYA 5HAIA 2QPNA 4P6BA 1HZOA 3S4XA 3UE3A 2DNSA 1PWCA 4FSFA 3Q81A 4EUZA 1QMEA 4D2OA 1IEMA 3ZNYA 4RA7A 5A92A 3DWZA 3IHBA 3JYIA 3VMAA 1H8YA 2WGWA 1FQGA 4ZBEA 1BT5A 1DY6A 1IYPA 3MZEA 3PBTA 5EECA 3ZG5A 1ZG4A 3AGEA 4EQIA 2I72A 5HFOA 5DTSA 4KZ9A 2J9PA 1DJBA 1HTZA 3IH8A 4KENB 4N9KA 3VOYA 3ZNTA 4DE0A 3ITBA 4CPKA 2EXBA 4CJNA 3UE0A 4E3OA 3ITAA 4PPRA 3M2JA 4OP8A 4MBFA 4YFMA 5AQ9A 5CHJA 3Q07A 3UPNA 4A5RA 2OLUA 4K0WA 5JYOA 2PBYA 3G31A 4ZJ3A 3UO9A 3TG9A 1NXYA 2FFFB 4JXSA 4QHCA 5AQ7A 3VSLA 5CEBA 3OPRA 4GNUA 1KGEA 2ZJ9A 4P85A 1PWDA 3BFFA 2Q9MA 3G34A 2C6WB 4OONA 4FD8A 2Y2IA 3MZDA 5GLAA 3IWOA 1J9MA 4GKUA 2ZC4B 3FYZA 4GN2A 3PAEA 3CJMA 3DWKA 4JF5A 2P9VB 1E4DA 1K56D 5FAPA 4UAAA 5AQAA 3W4QA 3LO7A 2Y4AA 4B4XA 1E3UD 4WM9A 2ZM2A 3HUMA 5CGSA 4U3TA 1BSGA 5I94A 3S22A 1QMFA 1XA1A 3PBQA 5IHVA 5GHYA 4HBUA 4OPQA 4FCFA 1EI5A 5FATA 2XR0A 4PM9A 2Q9NA 1IKIA 1KGFA 4DXBA 5A93A 2XLNA 4BENA 2WADA 4N9LA 1W8YA 4OP5A 3IF5A 1WYCA 5FI2A 4IBRA 4OOYA 2ZLYA 3IT9A 3IXGA 3N6IA 4R4SA 3OZHA 2JBFA 2Y2KA 3HLBA 1EWZA 1PIOA 4PM8A 2RL3A 3VP3A 3QNBA 3M6BA 1BZAA 4DKIA 1W8QA 5BOHA 2HDQA 2ZM0A 2EFXA 4X69A 4S2NC 5F1GA 5G18A 2XF3A 5U47A 1IYOA 1ESUA 5KSCA 1XA7A 3IXBA 1KVMA 1K57C 1L0FA 1PZOA 3GV9A 5FQMA 1E3UA 5GLBA 2ZQCA 4LCMA 3VOZA 2Y2HA 1GHPA 3UY6A 5KSHA 1XX2A 2VGKA 1BLSA 2V1ZA 2HPBA 3GMWA 1BULA 2H0TA 3BFCA 4WEJA 4ZDXA 3A3FA 3SS3A 3IWQA 2CC1A 3LCEA 1FCOA 3G2ZA 4ID4A 5FDHA 1GA9A 5JYPA 1H8ZA 3BFEA 1IKGA 2P9VA 2WKHA 3N8LA 1JVJA 2UWXA 3Q1FA 3E2KA 5HAQA 1TVFA 3A3EA 3C4OA 3HLGA 3I7JA 1GCEA 4YINA 5DTTA 2OV5A 4BL2A 4KG6A 1SKFA 1RGYA 3CMZA 3MXSA 1LI0A 4EWFA 2H0YA 3IXDA 1XXMA 3PTEA 1PZPA 4LV0A 3MKEA 4DE3A 4HBTA 5CTMA 4S2NA 2HDUA 2A3UA 3LY4A 3QHYA 4B88A 1IYQA 1K54C 4K0XA 1K57A 3HLCA 1JWZA 1NRFA 1CI9A 3HUNA 3SH9A 4UHUA 3ZG9B 1PYYA 3ZFZA 1XGIA 2VGJA 2ZC5B 1FSWA 1ES4A 4JKTA 2WKEA 5FQQA 2WYXA 5KZHA 2A49A 3Q82A 3P98A 2Y2MA 2ZMAA 3B3XA 5FQ9A 3SH8A 4Y0UA 2PU2A 2EX2A 1PW8A 3SS4A 2EX6A 3UDIA 4OOLA 3VP1A 3PBRA 5E2FA 3WS1A 5J8XA 3HREA 5GLDA 4E3JA 3VP0A 3NDGA 1YLTA 1JTGA 1N9BA 1W7FA 3IQAA 4LV3A 4UA9A 4Z9QA 4X55A 1K55C 3FKWA 4DDSA 2XD5A 3NC8A 2XDMA 3N8SA 1L0GA 3VSKA 2XFTA 2XEPA 2WUQA 1IELA 2ZQ8A 3GR2A 4IVKA 3RJUA 1K6SA 2BG1A 2Y2LA 2Y2QA 4KZ4A 2R9WA 4OH0A 1CK3A 3NBLA 1PWGA 5CERA 4KG5A 4HESA 1PW1A 4BD1A 4KG2A 4XUXA 2IWBA 5HARA 1ALQA 2Z2MB 4UA6A 3ZGAB 3LEZA 5E43A 2C5WB 5FQKA 2ZQAA 3NDEA 3M6HA 5CXWA 1BUEA 1GHIA 1YLZA 1I2SA 1L0DA 4BJPA 2Y59A 1OMEA 4JXWA 1LLBA 5CEDA 5GLCA 1ESIA 3ZVWA 5CECA 5F1FA 1H5XA 3SS5A 1ES2A 2J9OA 1YMXA 3UE1A 4KZ3A 3HLFA 4PMAA 4WZ5C 3M2KA 2XQZA 2P74A 2EFUA 4S2PA 2HP9A 3OPHA 4MLLA 4R4RA 1NYMA 4R23A 4R3BA 1K55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E2H A;  2HP5 A;  4KQQ A;  2Y2J A;  1TEM A;  3N7W A;  3OCN A;  5AQB A;  3V50 A;  1ERO A;  3G2Y A;  5HW3 A;  1CEG A;  1U60 A;  2XH9 A;  2EXA A;  4X68 A;  5FI7 A;  1BLC A;  1YMS A;  3HL9 A;  1RP5 A;  1ERQ A;  3O86 A;  1ES5 A;  1W79 A;  2DRW A;  4L0L A;  2EX8 A;  5FA7 A;  4F94 A;  1E25 A;  5HX9 A;  4OPR A;  2ZQD A;  4N1H A;  3AGD A;  3C4P A;  3QNC A;  4MNR A;  1O07 A;  2WGI A;  4Y0O A;  4Y0T A;  1MWT A;  2XD1 A;  4KZ8 A;  3O88 A;  1YLP A;  4OQH A;  2V20 A;  3IHA A;  2WK0 A;  4U0X A;  1C3B A;  2WZZ A;  1MWR A;  5EVI D;  1KE4 A;  3IWI A;  5CGW A;  3BEB A;  1MWS A;  4OLD A;  1CI8 A;  1KGG A;  1L0E A;  3WS4 A;  1K56 A;  1SHV A;  3W4O A;  4GDB A;  2WAE A;  4K91 A;  3WS0 A;  2WZX A;  2X01 A;  2WAF A;  4OQG A;  1DJA A;  1VM1 A;  1YLW A;  5EOE A;  5HL1 A;  4X6T A;  1S0W A;  3LY3 A;  4MBH A;  1FOF A;  1SDN A;  5GHX A;  1M40 A;  4C3Q A;  1SDE A;  2ZD8 A;  4WMC D;  3ZVT A;  1WE4 A;  4S2K A;  2OLV A;  3P09 A;  1ONH A;  2H10 A;  1YQS A;  4DE2 A;  5F83 A;  1YM1 A;  3OPL A;  4KQR A;  4E3N A;  4P87 A;  3CZD A;  1MKI A;  2R9X A;  4OPY A;  1G68 A;  4S2J A;  5FSR A;  5EOO A;  3W8K A;  3WWX A;  4GD6 A;  3A3I A;  4GZB A;  4UA7 A;  3VFF A;  5E2G A;  3VP4 A;  3FV7 A;  4EV4 A;  5TR7 A;  1Y54 A;  4QY6 A;  4R0Q A;  5FAO A;  4DRT A;  2G2U A;  4M3K A;  2IWC A;  4KQO A;  4GB7 A;  1Q2Q A;  5CRF A;  3BYD A;  3HBR A;  3MXR A;  3DW0 A;  3GRJ A;  4OQI A;  4H8R A;  1N4O A;  3E2L A;  3GVB A;  4JXV A;  4X53 A;  4ZAM A;  3VP2 A;  1RCJ A;  3Q7V B;  4E3I A;  4RX3 A;  1JWP A;  1BTL A;  3EQU A;  4LV2 A;  4R3J A;  4QY5 A;  2HP6 A;  3BM6 A;  1KE3 A;  3G30 A;  2JE5 A;  3CG5 A;  3G4P A;  4GD8 A;  1XKZ A;  4JF4 A;  5E2E A;  3GTC A;  4BD0 A;  5FI6 A;  3Q7Z A;  1PI5 A;  5CHU A;  2OSU A;  5F82 A;  1GHM A;  4FH2 A;  5EPH A;  1LL9 A;  1I5Q A;  3FWL A;  5M1A A;  4KZA A;  1NY0 A;  5D3O A;  5FAQ A;  2V2F F;  3IF6 B;  1XPB A;  3VFH A;  4GDN A;  1FR6 A;  3HLW A;  3RXW A;  2ZC7 A;  3UDX A;  3V3R A;  2Y55 A;  3PBN A;  3N4I A;  1HD8 A;  4EBL A;  2HDR A;  3BLM A;  3HVF A;  2Y91 A;  4N92 A;  3IF6 C;  2Y2P A;  4Y7P A;  5L2F A;  4NET A;  3OCL A;  1FCN A;  4E3L A;  3ISG A;  4WYY A;  1IYS A;  2RCX A;  3MFD A;  1GA0 A;  2X71 A;  4WEL A;  1K54 A;  4WBG A;  4OOM A;  2ZC3 B;  1DJC A;  3OC2 A;  2Y2G A;  3SOI A;  1YLJ A;  5DF7 A;  3BLS A;  4P0M A;  5FAS A;  5GHZ A;  4QU3 A;  3Q7V A;  4ZJ2 A;  4HEF A;  5CHM A;  4RVA A;  1FR1 A;  2B5R A;  3C7V A;  3OPP A;  1G6A A;  4B4Z A;  1VQQ A;  3C5A A;  4LEN A;  3A3J A;  4IED A;  1NZU A;  3D4F A;  2XGN A;  5EUA A;  2ZQ7 A;  3HLD A;  1NJ4 A;  3MZF A;  4WZ4 A;  4ZJ1 A;  3UPP A;  3BFD A;  4E3M A;  5FQJ A;  4DF6 A;  4U0T A;  1K38 A;  2XK1 A;  3IF6 A;  3A3D A;  2JCH A;  1MY8 A;  4DXC A;  1K6R A;  4O7D A;  2IWD A;  1ZKJ A;  3WS5 A;  3ZCZ A;  5HAP A;  3NI9 A;  4MEZ A;  4EBP A;  1MBL A;  2X02 A;  5EVI B;  1KDW A;  2JC7 A;  1FCM A;  1BLH A;  1ES3 A;  2Y2N A;  3NIA A;  4OPZ A;  4KZ7 A;  3SH7 A;  3IH9 A;  1KE0 A;  3V39 A;  3FKV A;  1LL5 A;  3HUO A;  3BRM A;  1ONG A;  1YLY A;  5CTN A;  2ZM8 A;  4PM7 A;  4EBN A;  4JF6 A;  4WEK A;  4C75 A;  1MPL A;  1TDG A;  2Z2L B;  5TFQ A;  4MBK A;  2PU4 A;  5EVI C;  2QMI A;  2J8Y A;  5DF9 A;  5A91 A;  3UNW A;  3G32 A;  1SCW A;  2DCF A;  1XP4 A;  4QJG A;  4LCL A;  3GSG A;  4PM5 A;  3N8R A;  2H5S A;  3UDF A;  2WGV A;  3IXH A;  3ZDJ A;  2WKI A;  4KZ6 A;  4WZ5 A;  1L2S A;  3BFG A;  4S2I A;  3RXX A;  1K4E A;  1RGZ A;  1ZG6 A;  4DE1 A;  3TOI A;  5DVA A;  3W4P A;  3O3V A;  4PM6 A;  3TSG A;  2Y2O A;  4OKP A;  2E8I A;  3DTM A;  4NK3 A;  1K25 A;  4FH4 A;  4S2L A;  4XXR A;  5M18 A;  3MBZ A;  3WS2 A;  1JTD A;  3UPO A;  3ZHH A;  3ZG7 B;  3FZC A;  1ERM A;  2QZ6 A;  4X56 A;  1MWU A;  3WRT A;  5EVI A;  2BLS A;  1MXO A;  4S2M A;  1CEF A;  4JBF A;  1TDL A;  3WRZ A;  4R1G A;  3PBS A;  5GL9 A;  4Q8I A;  1NYY A;  1ZC2 A;  3GQZ A;  4KZB A;  5FQI A;  3BEC A;  4JPM A;  4OLG A;  5DF8 A;  2FFY A;  4XUZ A;  1Z6F A;  1JWV A;  4RYE A;  1PI4 A;  5DTK A;  2WGW B;  3ZG0 A;  4BQM A;  4WMC A;  4S2O A;  1NZO A;  4BLM A;  5KMW A;  3AGF A;  3C7U A;  2HDS A;  1KDS A;  4DDY A;  3HLE A;  4KZ5 A;  3NCK A;  3UN7 A;  2ZQ9 A;  4RX2 A;  1K4F A;  2ZC6 B;  4QB8 A;  5EVL A;  2XFS A;  1KVL A;  4IVI A;  3ZG8 B;  1M6K A;  4C6Y A;  5CGX A;  1HVB A;  4E6W A;  4E3K A;  3V5M A;  1Q2P A;  5M19 A;  1WYB A;  4GOG A;  1BLP A;  1XGJ A;  2EX9 A;  3PBO A;  4E6X A;  1O7E A;  1YT4 A;  4OVD A;  2GDN A;  4ZTK A;  1FSY A;  3V3S A;  3MKF A;  3PAG A;  4JXG A;  1S6R A;  3O87 A;  4OQ0 A;  4BL3 A;  3EQV A;  4N1X A;  2J7V A;  5A90 A;  5TGF A;  4QD4 A;  1LI9 A;  4IBX A;  3S1Y A;  2G2W A;  4JLF A;  1I2W A;  4LV1 A;  3G35 A;  3NY4 A;  5EE8 A;  1W5D A;  1AXB A;  1LHY A;  5HAI A;  2QPN A;  4P6B A;  1HZO A;  3S4X A;  3UE3 A;  2DNS A;  1PWC A;  4FSF A;  3Q81 A;  4EUZ A;  1QME A;  4D2O A;  1IEM A;  3ZNY A;  4RA7 A;  5A92 A;  3DWZ A;  3IHB A;  3JYI A;  3VMA A;  1H8Y A;  2WGW A;  1FQG A;  4ZBE A;  1BT5 A;  1DY6 A;  1IYP A;  3MZE A;  3PBT A;  5EEC A;  3ZG5 A;  1ZG4 A;  3AGE A;  4EQI A;  2I72 A;  5HFO A;  5DTS A;  4KZ9 A;  2J9P A;  1DJB A;  1HTZ A;  3IH8 A;  4KEN B;  4N9K A;  3VOY A;  3ZNT A;  4DE0 A;  3ITB A;  4CPK A;  2EXB A;  4CJN A;  3UE0 A;  4E3O A;  3ITA A;  4PPR A;  3M2J A;  4OP8 A;  4MBF A;  4YFM A;  5AQ9 A;  5CHJ A;  3Q07 A;  3UPN A;  4A5R A;  2OLU A;  4K0W A;  5JYO A;  2PBY A;  3G31 A;  4ZJ3 A;  3UO9 A;  3TG9 A;  1NXY A;  2FFF B;  4JXS A;  4QHC A;  5AQ7 A;  3VSL A;  5CEB A;  3OPR A;  4GNU A;  1KGE A;  2ZJ9 A;  4P85 A;  1PWD A;  3BFF A;  2Q9M A;  3G34 A;  2C6W B;  4OON A;  4FD8 A;  2Y2I A;  3MZD A;  5GLA A;  3IWO A;  1J9M A;  4GKU A;  2ZC4 B;  3FYZ A;  4GN2 A;  3PAE A;  3CJM A;  3DWK A;  4JF5 A;  2P9V B;  1E4D A;  1K56 D;  5FAP A;  4UAA A;  5AQA A;  3W4Q A;  3LO7 A;  2Y4A A;  4B4X A;  1E3U D;  4WM9 A;  2ZM2 A;  3HUM A;  5CGS A;  4U3T A;  1BSG A;  5I94 A;  3S22 A;  1QMF A;  1XA1 A;  3PBQ A;  5IHV A;  5GHY A;  4HBU A;  4OPQ A;  4FCF A;  1EI5 A;  5FAT A;  2XR0 A;  4PM9 A;  2Q9N A;  1IKI A;  1KGF A;  4DXB A;  5A93 A;  2XLN A;  4BEN A;  2WAD A;  4N9L A;  1W8Y A;  4OP5 A;  3IF5 A;  1WYC A;  5FI2 A;  4IBR A;  4OOY A;  2ZLY A;  3IT9 A;  3IXG A;  3N6I A;  4R4S A;  3OZH A;  2JBF A;  2Y2K A;  3HLB A;  1EWZ A;  1PIO A;  4PM8 A;  2RL3 A;  3VP3 A;  3QNB A;  3M6B A;  1BZA A;  4DKI A;  1W8Q A;  5BOH A;  2HDQ A;  2ZM0 A;  2EFX A;  4X69 A;  4S2N C;  5F1G A;  5G18 A;  2XF3 A;  5U47 A;  1IYO A;  1ESU A;  5KSC A;  1XA7 A;  3IXB A;  1KVM A;  1K57 C;  1L0F A;  1PZO A;  3GV9 A;  5FQM A;  1E3U A;  5GLB A;  2ZQC A;  4LCM A;  3VOZ A;  2Y2H A;  1GHP A;  3UY6 A;  5KSH A;  1XX2 A;  2VGK A;  1BLS A;  2V1Z A;  2HPB A;  3GMW A;  1BUL A;  2H0T A;  3BFC A;  4WEJ A;  4ZDX A;  3A3F A;  3SS3 A;  3IWQ A;  2CC1 A;  3LCE A;  1FCO A;  3G2Z A;  4ID4 A;  5FDH A;  1GA9 A;  5JYP A;  1H8Z A;  3BFE A;  1IKG A;  2P9V A;  2WKH A;  3N8L A;  1JVJ A;  2UWX A;  3Q1F A;  3E2K A;  5HAQ A;  1TVF A;  3A3E A;  3C4O A;  3HLG A;  3I7J A;  1GCE A;  4YIN A;  5DTT A;  2OV5 A;  4BL2 A;  4KG6 A;  1SKF A;  1RGY A;  3CMZ A;  3MXS A;  1LI0 A;  4EWF A;  2H0Y A;  3IXD A;  1XXM A;  3PTE A;  1PZP A;  4LV0 A;  3MKE A;  4DE3 A;  4HBT A;  5CTM A;  4S2N A;  2HDU A;  2A3U A;  3LY4 A;  3QHY A;  4B88 A;  1IYQ A;  1K54 C;  4K0X A;  1K57 A;  3HLC A;  1JWZ A;  1NRF A;  1CI9 A;  3HUN A;  3SH9 A;  4UHU A;  3ZG9 B;  1PYY A;  3ZFZ A;  1XGI A;  2VGJ A;  2ZC5 B;  1FSW A;  1ES4 A;  4JKT A;  2WKE A;  5FQQ A;  2WYX A;  5KZH A;  2A49 A;  3Q82 A;  3P98 A;  2Y2M A;  2ZMA A;  3B3X A;  5FQ9 A;  3SH8 A;  4Y0U A;  2PU2 A;  2EX2 A;  1PW8 A;  3SS4 A;  2EX6 A;  3UDI A;  4OOL A;  3VP1 A;  3PBR A;  5E2F A;  3WS1 A;  5J8X A;  3HRE A;  5GLD A;  4E3J A;  3VP0 A;  3NDG A;  1YLT A;  1JTG A;  1N9B A;  1W7F A;  3IQA A;  4LV3 A;  4UA9 A;  4Z9Q A;  4X55 A;  1K55 C;  3FKW A;  4DDS A;  2XD5 A;  3NC8 A;  2XDM A;  3N8S A;  1L0G A;  3VSK A;  2XFT A;  2XEP A;  2WUQ A;  1IEL A;  2ZQ8 A;  3GR2 A;  4IVK A;  3RJU A;  1K6S A;  2BG1 A;  2Y2L A;  2Y2Q A;  4KZ4 A;  2R9W A;  4OH0 A;  1CK3 A;  3NBL A;  1PWG A;  5CER A;  4KG5 A;  4HES A;  1PW1 A;  4BD1 A;  4KG2 A;  4XUX A;  2IWB A;  5HAR A;  1ALQ A;  2Z2M B;  4UA6 A;  3ZGA B;  3LEZ A;  5E43 A;  2C5W B;  5FQK A;  2ZQA A;  3NDE A;  3M6H A;  5CXW A;  1BUE A;  1GHI A;  1YLZ A;  1I2S A;  1L0D A;  4BJP A;  2Y59 A;  1OME A;  4JXW A;  1LLB A;  5CED A;  5GLC A;  1ESI A;  3ZVW A;  5CEC A;  5F1F A;  1H5X A;  3SS5 A;  1ES2 A;  2J9O A;  1YMX A;  3UE1 A;  4KZ3 A;  3HLF A;  4PMA A;  4WZ5 C;  3M2K A;  2XQZ A;  2P74 A;  2EFU A;  4S2P A;  2HP9 A;  3OPH A;  4MLL A;  4R4R A;  1NYM A;  4R23 A;  4R3B A;  1K55 A; 
#chains in the Genus database with same CATH topology
 1DRM A;  1VB6 A;  3EEA A;  5AQB A;  3OCN A;  3V50 A;  2JKT I;  3MS6 A;  3O86 A;  4QWO A;  1ES5 A;  3DBA A;  1E25 A;  3BJN A;  3AGD A;  4I3I A;  3A0S A;  1MWT A;  2XD1 A;  1YLP A;  3OBF A;  1C3B A;  5IS1 A;  1KE4 A;  1V9Z A;  1D7E A;  1MWS A;  3WS4 A;  1CI8 A;  1KGG A;  1K56 A;  3LR0 A;  3W4O A;  4K91 A;  3WS0 A;  2WZX A;  1DJA A;  5HL1 A;  3FC7 A;  4X6T A;  3LY3 A;  4MBH A;  1SDE A;  4G3V A;  1WE4 A;  3G6O A;  5G4Y A;  2OLV A;  3O5Y A;  3P09 A;  1K0K A;  1GSW A;  4PKY G;  1YM1 A;  4E3N A;  1G68 A;  2GZA A;  4S2J A;  5EOO A;  4I38 A;  3VFF A;  3VP4 A;  4PAU A;  2M7U A;  3FG8 A;  5FAO A;  4RQ9 A;  4M3K A;  5CRF A;  3HBR A;  3B42 A;  4OQI A;  4X53 A;  1N4O A;  3GVB A;  3F1O A;  3OLO A;  1JWP A;  2Y8H A;  3B47 A;  4R3J A;  2HP6 A;  2ZMV A;  1KE3 A;  4GD8 A;  2JE5 A;  1OPX A;  2ZL1 A;  1MZU A;  1PI5 A;  5CHU A;  1PNE A;  1OJ5 A;  4FH2 A;  1I5Q A;  4P6Z M;  1IFQ A;  2A24 B;  2V2F F;  1XPB A;  4GDN A;  3NUL A;  3UDX A;  1HD8 A;  3OOV A;  4EBL A;  4EES A;  3BLM A;  3S7O A;  2JKR I;  2Y91 A;  4N92 A;  3IF6 C;  4Y7P A;  3OCL A;  4WN5 A;  4WYY A;  1N9O A;  3RH8 B;  4WBG A;  4OOM A;  4WF0 A;  3OC2 A;  3SOI A;  2KDK A;  4K08 A;  4QU3 A;  3BW6 A;  3KSF A;  5DJT A;  4B4Z A;  3D4F A;  3CUE C;  5HWT A;  2QJ5 A;  5FQJ A;  4MDZ A;  2JCH A;  3IBR A;  4DXC A;  4O7D A;  4M4X A;  3KSG A;  3T4K A;  1EW0 A;  5EVI B;  3IH9 A;  4BMW A;  3FKV A;  3BQ8 A;  2ZM8 A;  4EER A;  4EBN A;  4JF6 A;  1PRQ A;  3B33 A;  4CLC A;  1TDG A;  4NXE A;  1Y28 A;  2WGV A;  4KZ6 A;  3BWL A;  4I3A A;  4PM6 A;  4NK3 A;  1W63 M;  3H7W B;  1D1J A;  4D60 A;  3MBZ A;  4LLO B;  2NUT C;  1ERM A;  4WLA A;  1CEF A;  1AWI A;  4R1G A;  1ZC2 A;  3EGD C;  1F98 A;  1SZV A;  5DFY A;  3ZYT A;  1Z6F A;  1JWV A;  1PI4 A;  1HLU P;  2K7S A;  5DTK A;  5KIZ A;  4S2O A;  2HDS A;  1KDS A;  4LFU A;  1G28 A;  2B02 A;  1K4F A;  1YSP A;  4E6W A;  3T4S A;  2Z6C A;  4GOG A;  1XGJ A;  3PBO A;  1YT4 A;  3PAG A;  4OQ0 A;  4QD4 A;  3E4Q A;  4JLF A;  1I2W A;  4HJ3 A;  2QHK A;  1W5D A;  1AXB A;  5HSQ A;  1HZO A;  2DNS A;  1Y4O A;  3Q81 A;  3DTK A;  2OOL A;  1NLY A;  5A92 A;  3IHB A;  1H8Y A;  2WGW A;  1FQG A;  2J3W A;  1BT5 A;  4HQA A;  2W3H A;  1IYP A;  5EEC A;  5HD3 A;  5HFO A;  2A24 A;  4DE0 A;  3ZNT A;  4CPK A;  2Q0O A;  5FEF A;  4PPR A;  4OP8 A;  3EGX C;  2OLU A;  3LIB A;  2PBY A;  4JXS A;  2FFF B;  3OPR A;  4HH3 A;  3RTY A;  1KGE A;  3BFF A;  3G34 A;  2C6W B;  5CX7 A;  2HZ5 A;  2JN7 A;  4GN2 A;  1ODV A;  3DWK A;  4Y15 A;  4Q0J A;  2P08 A;  5FAP A;  4UAA A;  4PHT A;  4WM9 A;  1BSG A;  1QMF A;  3T1R A;  3QP2 A;  3UB5 P;  4FCF A;  1CJF A;  2XLN A;  4OP5 A;  3IF5 A;  2ZLY A;  2JBF A;  1BYW A;  2RL3 A;  3CPT A;  3QNB A;  5BOH A;  1BZA A;  2ZM0 A;  3JVU A;  5G18 A;  4S2N C;  2XF3 A;  5U47 A;  1KVM A;  1K57 C;  1L0F A;  2ZQC A;  3LID A;  5KSH A;  4EQ1 A;  2P7J A;  3K3D A;  3BFC A;  3UMD A;  3A3F A;  5MC7 A;  3N8L A;  1H8Z A;  3BFE A;  4EU0 A;  3LI8 A;  2VZW A;  2UWX A;  2OAQ 1;  3A3E A;  5DTT A;  3I7J A;  4YOF A;  2OV5 A;  3MR0 A;  2KX6 A;  3DTI A;  3KO6 A;  4F3L A;  1XXM A;  4LV0 A;  3UB7 A;  3QHY A;  4B88 A;  1NRF A;  3SH9 A;  4EUV A;  3ZG9 B;  2VGJ A;  5HPI A;  1ES4 A;  2XA7 M;  3Q82 A;  2ZMA A;  2EX2 A;  4HOI A;  1PW8 A;  4HNB A;  1LSV A;  5DJU A;  3UDI A;  3VP1 A;  5EFW A;  5EV0 A;  2ZMF A;  3NDG A;  1YLT A;  3BY9 A;  4LV3 A;  4UA9 A;  4CLC E;  4GS9 A;  2XEP A;  1IEL A;  1K6S A;  1P9R A;  2Y2L A;  3K2N A;  1PW1 A;  4BD1 A;  4XUX A;  2PD8 A;  2Z2M B;  4UA6 A;  1WA9 A;  3T12 B;  4MCW A;  3S7N A;  3M6H A;  1YLZ A;  2M1C A;  1I2S A;  1L0D A;  1OME A;  2HF6 A;  4H6J A;  5F1F A;  1H5X A;  2J9O A;  1YMX A;  4JGO A;  3UE1 A;  4KZ3 A;  2XQZ A;  4NXF A;  4S2P A;  4MLL A;  4GJ4 A;  1TEM A;  2QKP A;  2GX5 A;  3V67 A;  1U60 A;  2XH9 A;  2EXA A;  1YSQ A;  5FI7 A;  4LRY C;  1RP5 A;  2QYB A;  4GLQ A;  4HY8 A;  3F1O B;  2J80 A;  2ZQD A;  4MNR A;  4Y0T A;  2ZL1 B;  4OQH A;  2V20 A;  2WK0 A;  5HDS A;  3MSH A;  3BEB A;  4OLD A;  4P6Z S;  3K3C A;  3T4L A;  1OTD A;  3LR3 A;  2X01 A;  3LYX A;  2WAF A;  3C8C A;  1FOF A;  4WMC D;  3JPU A;  1YQS A;  4L9E A;  3OPL A;  4P87 A;  2ZOI A;  5LBR A;  3WWX A;  4UA7 A;  4EV4 A;  4QPR A;  1MC0 A;  2JHE A;  2K31 A;  4B93 A;  3MXR A;  3G30 A;  4LRX C;  3D72 A;  1T1A A;  1S67 L;  5F82 A;  3MQQ A;  4NEE D;  5EPH A;  4GCZ A;  5D3O A;  1NY0 A;  2W0N A;  1PFL A;  3PR6 A;  5L10 A;  3S7P A;  1TD5 A;  5F6A A;  3VFH A;  2ZC7 A;  4Q0H A;  4X1L A;  2Y55 A;  3PBN A;  2INW A;  4HH2 A;  3E4P A;  1VET B;  2HDR A;  1XJ3 A;  3HVF A;  4KUK A;  5L2F A;  4E3L A;  2O0Y A;  3ISG A;  4CLC B;  4O0P A;  1GA0 A;  1J3W A;  2Y2G A;  2HJ9 C;  4P0M A;  5GHZ A;  4ZJ2 A;  3EEH A;  3H82 A;  5CHM A;  4RVA A;  2B5R A;  5C5K A;  4CQH A;  4HP9 A;  3A3J A;  2XGN A;  2W1T A;  2ZQ7 A;  1NJ4 A;  2J3T D;  4ZJ1 A;  5DFX A;  3LIC A;  4DF6 A;  1K38 A;  3A3D A;  1MY8 A;  3NOP C;  4GHI A;  2IWD A;  1ZKJ A;  5HAP A;  2JKF A;  1KDW A;  1FCM A;  3LIE A;  3NIA A;  4OPZ A;  4O01 A;  3LGO A;  3SH7 A;  1KE0 A;  1S1Y A;  2W3F A;  3HUO A;  4BBT A;  5TFQ A;  4MBK A;  2PU4 A;  5EVI C;  5A91 A;  3UNW A;  3LI9 A;  3F1N A;  4PM5 A;  3N8R A;  4L9G A;  1N9L A;  1L2S A;  2B95 A;  3RXX A;  1XJ6 A;  1ZG6 A;  4G3K A;  3O3V A;  3TSG A;  5HPF A;  4PKY A;  5A8B A;  1K25 A;  1NLZ A;  4S2L A;  5EM0 A;  1JTD A;  2OAP 1;  3ZHH A;  2O99 A;  2BLS A;  1XJ2 A;  4JBF A;  1S1Z A;  3PBS A;  1VEU A;  2PT7 A;  4KZB A;  2VK3 A;  3BEC A;  2FFY A;  1N9N A;  2WGW B;  3ZG0 A;  2WKP A;  2V8F A;  5KMW A;  3NCK A;  3L7H A;  2ZQ9 A;  4RX2 A;  4BBV A;  2ZC6 B;  3P7N A;  3PXP A;  4MN7 A;  1GSV A;  4IVI A;  3ZG8 B;  1M6K A;  5M19 A;  1TS8 A;  1O7E A;  3V3S A;  2GDN A;  4ZTK A;  3QP5 A;  4JXG A;  4LRZ E;  2J7V A;  5TGF A;  4LV1 A;  5FDS A;  3G35 A;  3NY4 A;  1OJG A;  1YPR A;  1LHY A;  2VGL S;  2WKR A;  2QPN A;  3UE3 A;  1PWC A;  1QME A;  3NJA A;  3ZNY A;  3VMA A;  1S66 L;  1DY6 A;  2ZBB A;  3FPW A;  5AVF A;  4KZ9 A;  4NKP A;  2J9P A;  4ZRR A;  1DJB A;  1HTZ A;  4KEN B;  4N9K A;  3ITB A;  4CJN A;  4E3O A;  3M2J A;  3MF0 A;  3CPT B;  5CHJ A;  3Q07 A;  5AQ9 A;  3UPN A;  4A5R A;  4K0W A;  5JYO A;  3G31 A;  3NHQ A;  1VET A;  4ZJ3 A;  3TG9 A;  5CEB A;  4QHC A;  3VSL A;  2D02 A;  2VLG A;  2Q9M A;  4YNR A;  4FD8 A;  4EW7 A;  2V0U A;  3IWO A;  1J9M A;  3CJM A;  3KYQ A;  1S4S A;  2PRF A;  4JF5 A;  3IX4 A;  3LO7 A;  2Y4A A;  2QJ7 A;  2ZM2 A;  4U3T A;  3F1P A;  4ME4 A;  3LIA A;  4F3L B;  4OPQ A;  1EI5 A;  1IKI A;  5A93 A;  3VE3 A;  4N9L A;  5FI2 A;  1WYC A;  1H8M A;  1W8Q A;  2XA7 S;  2EFX A;  2W3E A;  1IYO A;  3IXB A;  3GV9 A;  5FQM A;  4II7 A;  2Y2H A;  1GHP A;  3UY6 A;  2VGK A;  2HPB A;  3IWQ A;  2Y79 A;  5JYP A;  2WKQ A;  2WKH A;  1JVJ A;  3HCY A;  4O8G A;  4GS9 B;  1GCE A;  4I5S A;  3W2Z A;  1SKF A;  1LI0 A;  3IXD A;  2W1R A;  5J4E A;  5CTM A;  2HDU A;  2A3U A;  4ETX A;  4Y5F A;  1PYY A;  3ZFZ A;  1FIK A;  4H6J B;  5IT5 A;  4ESP A;  2WYX A;  1SKO A;  4HJ6 A;  2PR5 A;  2A49 A;  5KZH A;  3P98 A;  5FQ9 A;  3LUQ A;  2PU2 A;  2EX6 A;  2Z6D A;  2JKG A;  4Y13 A;  4UQI M;  3U2A A;  3PBR A;  5E2F A;  5J8X A;  1NWZ A;  5GLD A;  3NEC A;  1XJ4 A;  2L1M A;  4JGR A;  1T18 A;  4DDS A;  3CIT A;  3BY8 A;  2XDM A;  4KQD A;  3KX0 X;  4Q0I A;  4R70 A;  4IVK A;  3RJU A;  2Y2Q A;  3UME A;  2R9W A;  1CK3 A;  4GW9 A;  4KG5 A;  4HES A;  4KG2 A;  1ALQ A;  3LEZ A;  5E43 A;  5FQK A;  5HL6 A;  1GHI A;  2I9V A;  3T50 A;  4JXW A;  1LLB A;  5GLC A;  3ZVW A;  3R4K A;  1OTI A;  2EFU A;  3UB8 A;  2HP9 A;  3OPH A;  4R4R A;  4ID4 A;  1NYM A;  4R23 A;  4R3B A;  1K55 A;  3T4J A;  5E2H A;  4EET B;  5HW3 A;  1ERO A;  3G2Y A;  4DN0 A;  2JKT M;  1BLC A;  3HJI A;  1YMS A;  3HL9 A;  5IU1 A;  1ERQ A;  1W79 A;  2DRW A;  4L0L A;  5L09 A;  1TS0 A;  4OPR A;  1ZHH B;  3UE6 A;  3O88 A;  3IHA A;  2G7U A;  3QP1 A;  1MWR A;  5EVI D;  1H0M A;  3IWI A;  1TS6 A;  5CGW A;  1L0E A;  5DKK A;  1SHV A;  2HJE A;  3S7Q A;  4R6L A;  1VM1 A;  1YLW A;  3CWF A;  1SDN A;  5GHX A;  4S2K A;  1ONH A;  2H10 A;  4DE2 A;  4KQR A;  4OPY A;  3A3I A;  4GZB A;  5E2G A;  5TR7 A;  1Y54 A;  4R0Q A;  1H3Q A;  2G2U A;  4KQO A;  1Q2Q A;  3BYD A;  3DW0 A;  3GRJ A;  4H8R A;  2VA0 A;  4E3I A;  4RX3 A;  4X1M A;  1BTL A;  1T1B A;  4QY5 A;  3H82 B;  3CG5 A;  1P0Z A;  3H9W A;  4JF4 A;  5E2E A;  3GTC A;  2P04 A;  2VX8 A;  3QP4 A;  5FI6 A;  2FH5 A;  2W1T B;  3TRC A;  1GHM A;  2YKF A;  3MXQ A;  1LL9 A;  3FWL A;  2LB9 A;  4GHI B;  4MN6 A;  2XRO A;  5EM1 A;  3UB9 A;  1OTA A;  4DJ2 A;  2Y2P A;  1FCN A;  2H28 A;  2ZOH A;  4YWZ A;  2RCX A;  3MFD A;  4WEL A;  3PYP A;  1DJC A;  5FAS A;  3F1N B;  3Q7V A;  4CLC C;  1FR1 A;  3C7V A;  1VQQ A;  3LR4 A;  4HP4 A;  3MZF A;  1JNU A;  2PBD P;  3UPP A;  1DP6 A;  3IF6 A;  2VV8 A;  1K6R A;  1T1C A;  5F69 A;  3T1X A;  4MEZ A;  4EBP A;  2X02 A;  2JC7 A;  1ES3 A;  4KZ7 A;  1VEU B;  3V39 A;  1YLY A;  2QWS A;  2PD7 A;  4WL9 A;  2EWW A;  1MPL A;  2Z2L B;  4MN5 A;  2QMI A;  3MJQ A;  3G32 A;  1SCW A;  4LCL A;  1UWP X;  3GSG A;  2H5S A;  3UDF A;  3IXH A;  3ZDJ A;  2WKI A;  3UB6 A;  3BFG A;  3IX3 A;  4Y3I A;  2NUP C;  4DE1 A;  4ETZ A;  3TOI A;  1OT6 A;  4XT2 B;  3W4P A;  4OKP A;  2E8I A;  1S4R A;  4FH4 A;  4NXB A;  4HIA A;  3U4L P;  3ZG7 B;  3FZC A;  2QZ6 A;  4X56 A;  1MWU A;  3WRT A;  1TDL A;  1OTE A;  4Q8I A;  3GQZ A;  5FQI A;  2V1B A;  4JPM A;  5DF8 A;  4FOF A;  4XUZ A;  1KOU A;  4RYE A;  4WMC A;  3CLO A;  1NZO A;  2D01 A;  3HLE A;  4KZ5 A;  4QB8 A;  4FTX A;  1KVL A;  4C6Y A;  2V9A A;  4E3K A;  3V5M A;  4E6X A;  1FSY A;  3MKF A;  5DKL A;  2K2N A;  3O87 A;  3EQV A;  4N1X A;  5A90 A;  1LI9 A;  4IBX A;  3S1Y A;  2G2W A;  2HV1 A;  4JGQ A;  2OWJ A;  5HAI A;  4P6B A;  4FSF A;  3MQ0 A;  4EUZ A;  2V0W A;  4I3J A;  4IUK A;  3BQA A;  1V9Y A;  3F1P B;  3E4O A;  3MZE A;  3PBT A;  5AJG A;  3AGE A;  4EQI A;  5DTS A;  4UEY A;  5HWV A;  2EXB A;  4YFM A;  1STZ A;  3KSI A;  2ZJ9 A;  1PWD A;  4BBU A;  3MZD A;  4GKU A;  3FYZ A;  2XRN A;  3MQO A;  5FEG A;  1K56 D;  3TE8 A;  5AQA A;  3W4Q A;  3PBQ A;  5IHV A;  3TJZ C;  5GHY A;  4EEU A;  4HBU A;  2L4R A;  4IUH A;  1KGF A;  2PDR A;  2WAD A;  4OOY A;  4E04 A;  3IXG A;  4R4S A;  2Y2K A;  4HJ4 A;  1EWZ A;  1PIO A;  4PM8 A;  3VP3 A;  5AVE A;  3M6B A;  2CMN A;  1SKO B;  4X69 A;  1XA7 A;  1T19 A;  2R78 A;  5GLB A;  4LCM A;  3E0Y A;  5L8M A;  3QP8 A;  2V1Z A;  3GMW A;  4UQI S;  1F9I A;  1BUL A;  4WEJ A;  4BWI A;  4ZDX A;  2CC1 A;  3G2Z A;  4NG2 A;  3SW1 A;  1TS7 A;  1GA9 A;  2BAS A;  2P9V A;  1F5M A;  3E2K A;  5HAQ A;  4BL2 A;  3C2W A;  3L9K A;  4KG6 A;  3CMZ A;  1UWN X;  4KUO A;  2H0Y A;  3PTE A;  1PZP A;  1F2K A;  4XT2 A;  3MKE A;  4DE3 A;  4S2N A;  3LY4 A;  5J3W A;  4K0X A;  1K57 A;  3HLC A;  2MJ6 A;  4UHU A;  4Y17 A;  1FSW A;  4JKT A;  2WKE A;  5TBM A;  3CI6 A;  3C30 A;  3SH8 A;  3SS4 A;  4LGW A;  2LB5 A;  4OOL A;  2W3G A;  3WS1 A;  3HRE A;  4E3J A;  3LR5 A;  1JTG A;  1N9B A;  3DAV A;  4X55 A;  2XD5 A;  3N8S A;  3VSK A;  2ACG A;  2XFT A;  2ZQ8 A;  3GR2 A;  2BG1 A;  1A0K A;  4OH0 A;  3NBL A;  1PWG A;  4IHQ A;  3EOI A;  5G4Z A;  2IWB A;  3T4O A;  2C5W B;  2ZQA A;  3NDE A;  5CXW A;  1BUE A;  1IOU A;  4CLC D;  4BJP A;  1ESI A;  2VKS A;  3HLF A;  3M2K A;  1VHM A;  4JGP A;  1NRJ A;  2HP5 A;  2M7V A;  4KQQ A;  2Y2J A;  3N7W A;  1ACF A;  1CEG A;  4X68 A;  3R7W A;  2VJW A;  2EX8 A;  5FA7 A;  4F94 A;  5HX9 A;  2XSS A;  4N1H A;  3C4P A;  3P01 A;  3QNC A;  5TJJ A;  1O07 A;  2WGI A;  4Y0O A;  4KZ8 A;  1Z09 A;  3JVV A;  3T1Q B;  4U0X A;  2WZZ A;  2UV0 E;  4GDB A;  2WAE A;  4OQG A;  5EOE A;  1S0W A;  2O9A A;  4C3Q A;  1M40 A;  2ZD8 A;  3ZVT A;  3TW8 A;  3C38 A;  2YKH A;  3CZD A;  1MKI A;  2R9X A;  5HDD A;  2PYR A;  5FSR A;  3W8K A;  4GD6 A;  2VV6 A;  3FV7 A;  4QY6 A;  4DRT A;  3LEQ A;  2V8C A;  2IWC A;  4GB7 A;  3E2L A;  4JXV A;  4X25 A;  4ZAM A;  3VP2 A;  1RCJ A;  3Q7V B;  3EQU A;  4LV2 A;  3BM6 A;  3G4P A;  2PAV P;  1XKZ A;  4BD0 A;  3Q7Z A;  2OSU A;  4G3W A;  1UGU A;  1MKM A;  5M1A A;  4KZA A;  5FAQ A;  1DP8 A;  3IF6 B;  1FR6 A;  3HLW A;  3RXW A;  3V3R A;  3N4I A;  5EVE A;  5FL3 A;  2O9C A;  3IX8 A;  3D9Y A;  4NET A;  4R3A A;  2EWV A;  1IYS A;  3IS2 B;  2E8J A;  4EXO A;  1P97 A;  2X71 A;  1K54 A;  2ZC3 B;  1YLJ A;  5DF7 A;  3BLS A;  3NOT C;  1LSW A;  4HEF A;  3NOU C;  2J3T C;  1G6A A;  3CHW P;  3OPP A;  3C5A A;  4LEN A;  2O9B A;  4IED A;  1NZU A;  5EUA A;  4L9F A;  3HLD A;  4WZ4 A;  1FIL A;  3T4T A;  3BFD A;  4E3M A;  4U0T A;  5HD5 A;  2XK1 A;  3KYZ A;  5I5L A;  3WS5 A;  4HHD A;  3ZCZ A;  3NI9 A;  5J7E A;  1MBL A;  1BLH A;  2Y2N A;  2W3D A;  4HI4 A;  1LL5 A;  3BRM A;  1ONG A;  1G5U A;  5CTN A;  4PM7 A;  3ICY A;  4WEK A;  4C75 A;  3VOL A;  4ARZ B;  2VGL M;  5DF9 A;  2J8Y A;  2DCF A;  1XP4 A;  4QJG A;  4DJ3 A;  4FUW A;  4WUJ A;  4WZ5 A;  2V1A A;  3HJK A;  4IJG A;  1ZTU A;  4S2I A;  1K4E A;  1RGZ A;  5DVA A;  2Y2O A;  3DTM A;  4I39 A;  4XXR A;  5M18 A;  3WS2 A;  2B18 A;  4AFI A;  3UPO A;  1YKD A;  3KYE A;  3FPV A;  5EVI A;  1MXO A;  4S2M A;  5HWW A;  3WRZ A;  5GL9 A;  1NYY A;  4OLG A;  4Z1W A;  4BQM A;  4BLM A;  3AGF A;  3C7U A;  4EEP A;  4DDY A;  5K5B A;  5HDC A;  5EVL A;  2XFS A;  1CQA A;  5CGX A;  1HVB A;  4DMZ A;  2AVX A;  1Q2P A;  1WYB A;  4Y2F A;  1BLP A;  2EX9 A;  1W63 Q;  4OVD A;  3H7W A;  2JKR M;  1S6R A;  4BL3 A;  1XFN A;  2A2L A;  4R38 A;  2HGV A;  5EE8 A;  2VV7 A;  3S4X A;  4D2O A;  1IEM A;  4RA7 A;  3DWZ A;  1GSX A;  3JYI A;  4ZBE A;  1DP9 A;  3ZG5 A;  1ZG4 A;  3VE4 A;  2I72 A;  2VEA A;  3IH8 A;  3VOY A;  3SZT A;  3UE0 A;  3ITA A;  4MBF A;  5F68 A;  3UO9 A;  1CF0 A;  1NXY A;  5AQ7 A;  4GNU A;  4P85 A;  4OON A;  2Y2I A;  3IS2 A;  2EA9 A;  3LIF A;  2PR6 A;  5GLA A;  2ZC4 B;  3PHY A;  2GJ3 A;  3PAE A;  2BTF P;  3DTE A;  3KSH A;  2FZ0 A;  3VV4 A;  2L0W A;  3CUE A;  2P9V B;  1E4D A;  4B4X A;  1E3U D;  3HUM A;  2DMW A;  5CGS A;  3MMH A;  5I94 A;  3S22 A;  1XA1 A;  5FAT A;  2XR0 A;  4PM9 A;  3ULF A;  2Q9N A;  4DXB A;  1X0O A;  3ZQ5 A;  4BEN A;  1W8Y A;  4IBR A;  3N6I A;  3IT9 A;  4LPZ A;  3OZH A;  3HLB A;  1LSX A;  4DKI A;  2HDQ A;  5TBM B;  5F1G A;  1ESU A;  5KSC A;  1PZO A;  1D06 A;  1E3U A;  3VOZ A;  1XX2 A;  1BLS A;  1YAX A;  2H0T A;  3GDI A;  4ARZ A;  2PYP A;  3SS3 A;  3LCE A;  1FCO A;  5FDH A;  1IKG A;  4B9O A;  3Q1F A;  1TVF A;  3C4O A;  3CAX A;  3HLG A;  3A0V A;  4YIN A;  2KOI A;  1LL8 A;  3MXS A;  1RGY A;  4EWF A;  3IBJ A;  3RFB A;  2IA2 A;  4HBT A;  1IYQ A;  1K54 C;  3HUN A;  1JWZ A;  1CI9 A;  3T4Q A;  3A0R A;  1XGI A;  3T1S A;  2ZC5 B;  1LT0 A;  5FQQ A;  2Y2M A;  3B3X A;  1OT9 A;  5HZH A;  4Y0U A;  4MMN A;  1TF1 A;  3EWK A;  1P9W A;  1OTB A;  1G6O A;  3R7W B;  5F5Y A;  3VP0 A;  1W7F A;  3IQA A;  3E98 A;  4Z9Q A;  1K55 C;  3FKW A;  3NC8 A;  1L0G A;  3D3O A;  2WUQ A;  1XFQ A;  4KZ4 A;  3MFX A;  2OWH A;  5CER A;  4NXG A;  3LFV A;  5L07 A;  5HAR A;  2GNX A;  3ZGA B;  2W27 A;  1L3L A;  2Y59 A;  5CED A;  5CEC A;  3SS5 A;  1ES2 A;  2PHY A;  4PMA A;  4WZ5 C;  2P74 A;  2KLI A;  3GEC A;  5F83 A;  3UN7 A;  3QP6 A; 
#chains in the Genus database with same CATH homology
 5E2H A;  2HP5 A;  4KQQ A;  2Y2J A;  1TEM A;  3N7W A;  3OCN A;  5AQB A;  3V50 A;  1ERO A;  3G2Y A;  5HW3 A;  1CEG A;  1U60 A;  2XH9 A;  2EXA A;  4X68 A;  5FI7 A;  1BLC A;  1YMS A;  3HL9 A;  1RP5 A;  1ERQ A;  3O86 A;  1ES5 A;  1W79 A;  2DRW A;  4L0L A;  2EX8 A;  5FA7 A;  4F94 A;  1E25 A;  5HX9 A;  4OPR A;  2ZQD A;  4N1H A;  3AGD A;  3C4P A;  3QNC A;  4MNR A;  1O07 A;  2WGI A;  4Y0O A;  4Y0T A;  1MWT A;  2XD1 A;  4KZ8 A;  3O88 A;  1YLP A;  4OQH A;  2V20 A;  3IHA A;  2WK0 A;  4U0X A;  1C3B A;  2WZZ A;  1MWR A;  5EVI D;  1KE4 A;  3IWI A;  5CGW A;  3BEB A;  1MWS A;  4OLD A;  1CI8 A;  1KGG A;  1L0E A;  3WS4 A;  1K56 A;  1SHV A;  3W4O A;  4GDB A;  2WAE A;  4K91 A;  3WS0 A;  2WZX A;  2X01 A;  2WAF A;  4OQG A;  1DJA A;  1VM1 A;  1YLW A;  5EOE A;  5HL1 A;  4X6T A;  1S0W A;  3LY3 A;  4MBH A;  1FOF A;  1SDN A;  5GHX A;  1M40 A;  4C3Q A;  1SDE A;  2ZD8 A;  4WMC D;  3ZVT A;  1WE4 A;  4S2K A;  2OLV A;  3P09 A;  1ONH A;  2H10 A;  1YQS A;  4DE2 A;  5F83 A;  1YM1 A;  3OPL A;  4KQR A;  4E3N A;  4P87 A;  3CZD A;  1MKI A;  2R9X A;  4OPY A;  1G68 A;  4S2J A;  5FSR A;  5EOO A;  3W8K A;  3WWX A;  4GD6 A;  3A3I A;  4GZB A;  4UA7 A;  3VFF A;  5E2G A;  3VP4 A;  3FV7 A;  4EV4 A;  5TR7 A;  1Y54 A;  4QY6 A;  4R0Q A;  5FAO A;  4DRT A;  2G2U A;  4M3K A;  2IWC A;  4KQO A;  4GB7 A;  1Q2Q A;  5CRF A;  3BYD A;  3HBR A;  3MXR A;  3DW0 A;  3GRJ A;  4OQI A;  4H8R A;  1N4O A;  3E2L A;  3GVB A;  4JXV A;  4X53 A;  4ZAM A;  3VP2 A;  1RCJ A;  3Q7V B;  4E3I A;  4RX3 A;  1JWP A;  1BTL A;  3EQU A;  4LV2 A;  4R3J A;  4QY5 A;  2HP6 A;  3BM6 A;  1KE3 A;  3G30 A;  2JE5 A;  3CG5 A;  3G4P A;  4GD8 A;  1XKZ A;  4JF4 A;  5E2E A;  3GTC A;  4BD0 A;  5FI6 A;  3Q7Z A;  1PI5 A;  5CHU A;  2OSU A;  5F82 A;  1GHM A;  4FH2 A;  5EPH A;  1LL9 A;  1I5Q A;  3FWL A;  5M1A A;  4KZA A;  1NY0 A;  5D3O A;  5FAQ A;  2V2F F;  3IF6 B;  1XPB A;  3VFH A;  4GDN A;  1FR6 A;  3HLW A;  3RXW A;  2ZC7 A;  3UDX A;  3V3R A;  2Y55 A;  3PBN A;  3N4I A;  1HD8 A;  4EBL A;  2HDR A;  3BLM A;  3HVF A;  2Y91 A;  4N92 A;  3IF6 C;  2Y2P A;  4Y7P A;  5L2F A;  4NET A;  3OCL A;  1FCN A;  4E3L A;  3ISG A;  4WYY A;  1IYS A;  2RCX A;  3MFD A;  1GA0 A;  2X71 A;  4WEL A;  1K54 A;  4WBG A;  4OOM A;  2ZC3 B;  1DJC A;  3OC2 A;  2Y2G A;  3SOI A;  1YLJ A;  5DF7 A;  3BLS A;  4P0M A;  5FAS A;  5GHZ A;  4QU3 A;  3Q7V A;  4ZJ2 A;  4HEF A;  5CHM A;  4RVA A;  1FR1 A;  2B5R A;  3C7V A;  3OPP A;  1G6A A;  4B4Z A;  1VQQ A;  3C5A A;  4LEN A;  3A3J A;  4IED A;  1NZU A;  3D4F A;  2XGN A;  5EUA A;  2ZQ7 A;  3HLD A;  1NJ4 A;  3MZF A;  4WZ4 A;  4ZJ1 A;  3UPP A;  3BFD A;  4E3M A;  5FQJ A;  4DF6 A;  4U0T A;  1K38 A;  2XK1 A;  3IF6 A;  3A3D A;  2JCH A;  1MY8 A;  4DXC A;  1K6R A;  4O7D A;  2IWD A;  1ZKJ A;  3WS5 A;  3ZCZ A;  5HAP A;  3NI9 A;  4MEZ A;  4EBP A;  1MBL A;  2X02 A;  5EVI B;  1KDW A;  2JC7 A;  1FCM A;  1BLH A;  1ES3 A;  2Y2N A;  3NIA A;  4OPZ A;  4KZ7 A;  3SH7 A;  3IH9 A;  1KE0 A;  3V39 A;  3FKV A;  1LL5 A;  3HUO A;  3BRM A;  1ONG A;  1YLY A;  5CTN A;  2ZM8 A;  4PM7 A;  4EBN A;  4JF6 A;  4WEK A;  4C75 A;  1MPL A;  1TDG A;  2Z2L B;  5TFQ A;  4MBK A;  2PU4 A;  5EVI C;  2QMI A;  2J8Y A;  5DF9 A;  5A91 A;  3UNW A;  3G32 A;  1SCW A;  2DCF A;  1XP4 A;  4QJG A;  4LCL A;  3GSG A;  4PM5 A;  3N8R A;  2H5S A;  3UDF A;  2WGV A;  3IXH A;  3ZDJ A;  2WKI A;  4KZ6 A;  4WZ5 A;  1L2S A;  3BFG A;  4S2I A;  3RXX A;  1K4E A;  1RGZ A;  1ZG6 A;  4DE1 A;  3TOI A;  5DVA A;  3W4P A;  3O3V A;  4PM6 A;  3TSG A;  2Y2O A;  4OKP A;  2E8I A;  3DTM A;  4NK3 A;  1K25 A;  4FH4 A;  4S2L A;  4XXR A;  5M18 A;  3MBZ A;  3WS2 A;  1JTD A;  3UPO A;  3ZHH A;  3ZG7 B;  3FZC A;  1ERM A;  2QZ6 A;  4X56 A;  1MWU A;  3WRT A;  5EVI A;  2BLS A;  1MXO A;  4S2M A;  1CEF A;  4JBF A;  1TDL A;  3WRZ A;  4R1G A;  3PBS A;  5GL9 A;  4Q8I A;  1NYY A;  1ZC2 A;  3GQZ A;  4KZB A;  5FQI A;  3BEC A;  4JPM A;  4OLG A;  5DF8 A;  2FFY A;  4XUZ A;  1Z6F A;  1JWV A;  4RYE A;  1PI4 A;  5DTK A;  2WGW B;  3ZG0 A;  4BQM A;  4WMC A;  4S2O A;  1NZO A;  4BLM A;  5KMW A;  3AGF A;  3C7U A;  2HDS A;  1KDS A;  4DDY A;  3HLE A;  4KZ5 A;  3NCK A;  3UN7 A;  2ZQ9 A;  4RX2 A;  1K4F A;  2ZC6 B;  4QB8 A;  5EVL A;  2XFS A;  1KVL A;  4IVI A;  3ZG8 B;  1M6K A;  4C6Y A;  5CGX A;  1HVB A;  4E6W A;  4E3K A;  3V5M A;  1Q2P A;  5M19 A;  1WYB A;  4GOG A;  1BLP A;  1XGJ A;  2EX9 A;  3PBO A;  4E6X A;  1O7E A;  1YT4 A;  4OVD A;  2GDN A;  4ZTK A;  1FSY A;  3V3S A;  3MKF A;  3PAG A;  4JXG A;  1S6R A;  3O87 A;  4OQ0 A;  4BL3 A;  3EQV A;  4N1X A;  2J7V A;  5A90 A;  5TGF A;  4QD4 A;  1LI9 A;  4IBX A;  3S1Y A;  2G2W A;  4JLF A;  1I2W A;  4LV1 A;  3G35 A;  3NY4 A;  5EE8 A;  1W5D A;  1AXB A;  1LHY A;  5HAI A;  2QPN A;  4P6B A;  1HZO A;  3S4X A;  3UE3 A;  2DNS A;  1PWC A;  4FSF A;  3Q81 A;  4EUZ A;  1QME A;  4D2O A;  1IEM A;  3ZNY A;  4RA7 A;  5A92 A;  3DWZ A;  3IHB A;  3JYI A;  3VMA A;  1H8Y A;  2WGW A;  1FQG A;  4ZBE A;  1BT5 A;  1DY6 A;  1IYP A;  3MZE A;  3PBT A;  5EEC A;  3ZG5 A;  1ZG4 A;  3AGE A;  4EQI A;  2I72 A;  5HFO A;  5DTS A;  4KZ9 A;  2J9P A;  1DJB A;  1HTZ A;  3IH8 A;  4KEN B;  4N9K A;  3VOY A;  3ZNT A;  4DE0 A;  3ITB A;  4CPK A;  2EXB A;  4CJN A;  3UE0 A;  4E3O A;  3ITA A;  4PPR A;  3M2J A;  4OP8 A;  4MBF A;  4YFM A;  5AQ9 A;  5CHJ A;  3Q07 A;  3UPN A;  4A5R A;  2OLU A;  4K0W A;  5JYO A;  2PBY A;  3G31 A;  4ZJ3 A;  3UO9 A;  3TG9 A;  1NXY A;  2FFF B;  4JXS A;  4QHC A;  5AQ7 A;  3VSL A;  5CEB A;  3OPR A;  4GNU A;  1KGE A;  2ZJ9 A;  4P85 A;  1PWD A;  3BFF A;  2Q9M A;  3G34 A;  2C6W B;  4OON A;  4FD8 A;  2Y2I A;  3MZD A;  5GLA A;  3IWO A;  1J9M A;  4GKU A;  2ZC4 B;  3FYZ A;  4GN2 A;  3PAE A;  3CJM A;  3DWK A;  4JF5 A;  2P9V B;  1E4D A;  1K56 D;  5FAP A;  4UAA A;  5AQA A;  3W4Q A;  3LO7 A;  2Y4A A;  4B4X A;  1E3U D;  4WM9 A;  2ZM2 A;  3HUM A;  5CGS A;  4U3T A;  1BSG A;  5I94 A;  3S22 A;  1QMF A;  1XA1 A;  3PBQ A;  5IHV A;  5GHY A;  4HBU A;  4OPQ A;  4FCF A;  1EI5 A;  5FAT A;  2XR0 A;  4PM9 A;  2Q9N A;  1IKI A;  1KGF A;  4DXB A;  5A93 A;  2XLN A;  4BEN A;  2WAD A;  4N9L A;  1W8Y A;  4OP5 A;  3IF5 A;  1WYC A;  5FI2 A;  4IBR A;  4OOY A;  2ZLY A;  3IT9 A;  3IXG A;  3N6I A;  4R4S A;  3OZH A;  2JBF A;  2Y2K A;  3HLB A;  1EWZ A;  1PIO A;  4PM8 A;  2RL3 A;  3VP3 A;  3QNB A;  3M6B A;  1BZA A;  4DKI A;  1W8Q A;  5BOH A;  2HDQ A;  2ZM0 A;  2EFX A;  4X69 A;  4S2N C;  5F1G A;  5G18 A;  2XF3 A;  5U47 A;  1IYO A;  1ESU A;  5KSC A;  1XA7 A;  3IXB A;  1KVM A;  1K57 C;  1L0F A;  1PZO A;  3GV9 A;  5FQM A;  1E3U A;  5GLB A;  2ZQC A;  4LCM A;  3VOZ A;  2Y2H A;  1GHP A;  3UY6 A;  5KSH A;  1XX2 A;  2VGK A;  1BLS A;  2V1Z A;  2HPB A;  3GMW A;  1BUL A;  2H0T A;  3BFC A;  4WEJ A;  4ZDX A;  3A3F A;  3SS3 A;  3IWQ A;  2CC1 A;  3LCE A;  1FCO A;  3G2Z A;  4ID4 A;  5FDH A;  1GA9 A;  5JYP A;  1H8Z A;  3BFE A;  1IKG A;  2P9V A;  2WKH A;  3N8L A;  1JVJ A;  2UWX A;  3Q1F A;  3E2K A;  5HAQ A;  1TVF A;  3A3E A;  3C4O A;  3HLG A;  3I7J A;  1GCE A;  4YIN A;  5DTT A;  2OV5 A;  4BL2 A;  4KG6 A;  1SKF A;  1RGY A;  3CMZ A;  3MXS A;  1LI0 A;  4EWF A;  2H0Y A;  3IXD A;  1XXM A;  3PTE A;  1PZP A;  4LV0 A;  3MKE A;  4DE3 A;  4HBT A;  5CTM A;  4S2N A;  2HDU A;  2A3U A;  3LY4 A;  3QHY A;  4B88 A;  1IYQ A;  1K54 C;  4K0X A;  1K57 A;  3HLC A;  1JWZ A;  1NRF A;  1CI9 A;  3HUN A;  3SH9 A;  4UHU A;  3ZG9 B;  1PYY A;  3ZFZ A;  1XGI A;  2VGJ A;  2ZC5 B;  1FSW A;  1ES4 A;  4JKT A;  2WKE A;  5FQQ A;  2WYX A;  5KZH A;  2A49 A;  3Q82 A;  3P98 A;  2Y2M A;  2ZMA A;  3B3X A;  5FQ9 A;  3SH8 A;  4Y0U A;  2PU2 A;  2EX2 A;  1PW8 A;  3SS4 A;  2EX6 A;  3UDI A;  4OOL A;  3VP1 A;  3PBR A;  5E2F A;  3WS1 A;  5J8X A;  3HRE A;  5GLD A;  4E3J A;  3VP0 A;  3NDG A;  1YLT A;  1JTG A;  1N9B A;  1W7F A;  3IQA A;  4LV3 A;  4UA9 A;  4Z9Q A;  4X55 A;  1K55 C;  3FKW A;  4DDS A;  2XD5 A;  3NC8 A;  2XDM A;  3N8S A;  1L0G A;  3VSK A;  2XFT A;  2XEP A;  2WUQ A;  1IEL A;  2ZQ8 A;  3GR2 A;  4IVK A;  3RJU A;  1K6S A;  2BG1 A;  2Y2L A;  2Y2Q A;  4KZ4 A;  2R9W A;  4OH0 A;  1CK3 A;  3NBL A;  1PWG A;  5CER A;  4KG5 A;  4HES A;  1PW1 A;  4BD1 A;  4KG2 A;  4XUX A;  2IWB A;  5HAR A;  1ALQ A;  2Z2M B;  4UA6 A;  3ZGA B;  3LEZ A;  5E43 A;  2C5W B;  5FQK A;  2ZQA A;  3NDE A;  3M6H A;  5CXW A;  1BUE A;  1GHI A;  1YLZ A;  1I2S A;  1L0D A;  4BJP A;  2Y59 A;  1OME A;  4JXW A;  1LLB A;  5CED A;  5GLC A;  1ESI A;  3ZVW A;  5CEC A;  5F1F A;  1H5X A;  3SS5 A;  1ES2 A;  2J9O A;  1YMX A;  3UE1 A;  4KZ3 A;  3HLF A;  4PMA A;  4WZ5 C;  3M2K A;  2XQZ A;  2P74 A;  2EFU A;  4S2P A;  2HP9 A;  3OPH A;  4MLL A;  4R4R A;  1NYM A;  4R23 A;  4R3B A;  1K55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...