4ID4A

Crystal structure of chimeric beta-lactamase ctem-17m
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTDFLRQIGDKETRLDRIEPDLNEGKLGDLRDTTTPKAIASTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM, Beta-lactamase PSE-4
publication title Maintenance of Native-like Protein Dynamics May Not Be Required for Engineering Functional Proteins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 94
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4id4A00
4XUZA 4JXVA 3ZG9B 3HVFA 4GN2A 4DE3A 3OCNA 4MEZA 5AQ9A 4JKTA 4Y0OA 1W79A 4Y0UA 3MKFA 2A49A 3GSGA 1HVBA 5GLCA 4FSFA 3CZDA 1H5XA 4EQIA 3ZVWA 3MBZA 1OMEA 2P74A 3VP1A 2Y2MA 1K54A 2RL3A 5A90A 3AGDA 3NC8A 4NETA 3V39A 4ZDXA 2ZC3B 1ZKJA 5HW3A 3V5MA 2IWDA 1CI9A 1IELA 3SH8A 3C5AA 5DF8A 2VGJA 4YINA 2DCFA 3N7WA 1O7EA 4S2KA 5TR7A 1W8YA 4RYEA 3IH9A 1KDWA 4K91A 3FYZA 3EQUA 4ZJ1A 3IWQA 1BLCA 4EBPA 3OPHA 2H10A 2WK0A 3GMWA 5HX9A 1I2WA 3BM6A 1L0EA 3UPNA 4B4XA 2X02A 2WGWB 4WZ5C 1ERQA 1JTDA 3IXBA 2DRWA 3FKWA 1ALQA 2Y2KA 4PM6A 5E2FA 1HTZA 2WYXA 4GZBA 3ZNTA 3C7UA 4FH2A 2ZQ7A 3Q7ZA 1ONHA 5KZHA 1KGFA 1K4EA 4OP5A 2HP9A 1K38A 1CI8A 1FR6A 5AQ7A 1K55C 1ONGA 5JYOA 3MXRA 4R3BA 4DE2A 1IYOA 1RGZA 4MLLA 3CJMA 3OCLA 1IYPA 3BLSA 5EVIC 1DJBA 2Y4AA 3M2JA 4S2PA 1CEGA 3UN7A 3OPPA 4S2MA 1YLWA 2EXBA 4OVDA 3IF6C 4OP8A 1W7FA 2V2FF 1S0WA 3IXHA 1K56A 5EVIB 4S2IA 3UPOA 2XK1A 4JF6A 4MBKA 4K0WA 1YLZA 4P6BA 4QB8A 3UDXA 1MKIA 2Y55A 1MBLA 3NDGA 2WGIA 3DTMA 3MKEA 4WZ5A 2ZQCA 5FQ9A 1ES4A 2HP6A 4LCLA 5DTTA 3S22A 2EX8A 3BFFA 1ESIA 4KZAA 5DTKA 5FQMA 3OC2A 1DJCA 5D3OA 4EUZA 4RX3A 4EBNA 3P09A 4UAAA 3WS5A 4LV3A 4QHCA 2HDUA 1PZOA 3SS4A 3G2YA 4HESA 4KZ6A 1JWZA 2Z2MB 1FQGA 1ES3A 3DWKA 1LI0A 4ID4A 2WZZA 3FV7A 5GL9A 1BUEA 3WS2A 1TVFA 4GD8A 1LL9A 1GHIA 3PBSA 5HAPA 4LV2A 1QMFA 2QPNA 1DJAA 3VMAA 3HREA 1BT5A 3IF6A 1CK3A 1XKZA 2XH9A 4EBLA 1PI5A 4FCFA 1PWCA 5FQKA 2Y91A 5CGSA 4FD8A 3IXGA 3HLGA 1PZPA 4E3LA 1MWUA 4OPQA 4E3JA 2ZC4B 4ZJ3A 1NZUA 1IKGA 1LL5A 2P9VA 3G4PA 4GDBA 3LO7A 1E3UD 1E4DA 1PYYA 3IWIA 2QZ6A 3NY4A 2ZM2A 4KZ3A 1VM1A 1WYBA 3HLCA 3TSGA 3ZDJA 5CEDA 4HBTA 1BSGA 3BRMA 4OH0A 3A3EA 4JXWA 4IVKA 2EXAA 3PBTA 5FSRA 3PBRA 3A3DA 3SS5A 4M3KA 4YFMA 3VP3A 3WS4A 4E3NA 1BLSA 1ESUA 4N9KA 3E2LA 2WAEA 2PU2A 4JF5A 1MWTA 2RCXA 3G32A 4X69A 1M40A 1XPBA 5GLBA 2ZJ9A 4OPRA 5CRFA 2Y2GA 2R9XA 3BFDA 4MBFA 1NXYA 4IVIA 4N1HA 5EE8A 3ZGAB 4DE0A 4WMCA 2IWBA 3IF5A 2JE5A 3JYIA 3PTEA 4KZ7A 2XFTA 2XEPA 1CEFA 4KG5A 1W8QA 4DRTA 3S1YA 4DDYA 4MNRA 3N8SA 3VFFA 5E43A 3GR2A 5EECA 3DWZA 2X01A 1JVJA 1LI9A 4R1GA 3UDIA 3C4OA 3FKVA 5CXWA 3ISGA 1K25A 4ZTKA 1FCOA 4KQRA 2R9WA 5AQAA 5TFQA 5FI6A 1SDNA 4PMAA 5A91A 3WWXA 4XUXA 3PBOA 2ZQ9A 1O07A 4Y7PA 3V3SA 3WS0A 1FCNA 2VGKA 4C6YA 1I5QA 3HUMA 2BG1A 1ES5A 5A93A 3NDEA 4L0LA 1KGEA 1L0FA 4P87A 5CHUA 5AQBA 4WEKA 3Q7VB 5BOHA 1IYSA 4DXBA 4LV1A 4JBFA 4PM7A 3UE0A 2Y59A 4ZBEA 2HP5A 4GKUA 5FQJA 4OLGA 4UA9A 4KQOA 5L2FA 4Z9QA 5DTSA 5GHYA 1MXOA 5M18A 1JTGA 3AGEA 1YLPA 1G6AA 3MZEA 4QD4A 2XGNA 4X56A 1ZG6A 4WM9A 1U60A 3O3VA 1PWGA 2WKEA 1PI4A 1G68A 1GHMA 4QU3A 2ZQDA 4KG2A 4N92A 1JWPA 4R4RA 3PBNA 3G31A 1XP4A 5M1AA 4LCMA 4QJGA 3PAGA 2XD1A 2OLUA 2WGWA 3GRJA 1FOFA 1FSWA 2GDNA 3RXXA 3QHYA 4GD6A 1RGYA 2EX2A 5KMWA 3UE3A 3GQZA 5FASA 5GHXA 3ZHHA 2B5RA 3Q81A 4C3QA 4DF6A 3NBLA 4XXRA 1MY8A 2H0TA 3W4PA 3ZCZA 5KSCA 3Q82A 4OOYA 4QY5A 1SHVA 3MZFA 5J8XA 4S2NC 4R23A 3M6HA 3DW0A 5IHVA 4N1XA 2Y2PA 3OZHA 1RCJA 2XR0A 5CHJA 5HL1A 4BL2A 3BFGA 3M2KA 4KZBA 1NJ4A 1WYCA 3GVBA 2PBYA 5EVLA 4C75A 5A92A 4KZ8A 1ZC2A 3ZG7B 3A3FA 4H8RA 1K55A 5HARA 4BLMA 5FATA 2BLSA 2IWCA 5CGXA 5EVIA 1SCWA 4EV4A 3IH8A 3P98A 3W4OA 2OLVA 4S2JA 4E6WA 3WRZA 4UA7A 3VFHA 4KZ4A 4PM8A 5E2EA 5FAQA 1IKIA 1DY6A 3QNCA 1M6KA 3SH7A 2XLNA 1MWSA 3MFDA 3BECA 3UPPA 4GNUA 4E6XA 2ZLYA 3M6BA 3LY3A 1LLBA 4P85A 3Q07A 5CHMA 4B88A 3V3RA 5EOEA 3HLWA 2C5WB 1MWRA 3ZVTA 4X68A 1KVLA 2EFUA 1Y54A 4E3IA 4JF4A 4R4SA 5GLAA 4D2OA 4BENA 3I7JA 4Q8IA 5F1FA 1PW1A 2PU4A 2XFSA 5F83A 1YT4A 3VSKA 1Q2QA 5CERA 4DKIA 1GA9A 4KENB 4S2OA 3MXSA 3LCEA 5EUAA 3VP0A 4S2LA 5DF9A 3BYDA 3A3JA 4X6TA 5G18A 1H8ZA 2WKIA 1BULA 2XF3A 4KZ9A 2CC1A 4E3MA 3NIAA 1YLTA 3BLMA 2WKHA 2ZC6B 5HFOA 3PAEA 2Y2IA 3VP2A 4OKPA 3O88A 5CTMA 1IEMA 4ZJ2A 1XXMA 1RP5A 2Y2JA 2X71A 1YM1A 3LEZA 3SH9A 4DDSA 1ERMA 1W5DA 4KZ5A 1WE4A 3QNBA 4BD1A 1E25A 3IQAA 1PWDA 1SKFA 4LENA 1N9BA 3OPRA 2XDMA 2E8IA 5FA7A 2UWXA 4WZ4A 3G34A 1ZG4A 4OQGA 3BEBA 3C4PA 3ZG0A 4X55A 4BQMA 1HZOA 3RJUA 1IYQA 4CJNA 5JYPA 1L0DA 3UNWA 4WYYA 1XX2A 4R0QA 5F82A 4N9LA 1MPLA 4GB7A 5FQQA 4P0MA 3WRTA 4IBXA 3TOIA 3VP4A 2JCHA 3ITAA 4EWFA 4RX2A 3VOZA 1FR1A 2Y2HA 2XQZA 4OPZA 5CGWA 4GOGA 4U3TA 3ZG8B 2WAFA 4KQQA 1YMSA 5GLDA 4GDNA 5CECA 2ZD8A 3UDFA 1K4FA 3V50A 5EPHA 1K57C 2V1ZA 5U47A 1YMXA 1K6RA 3CG5A 5DVAA 2WUQA 5FDHA 1EWZA 3IXDA 1KVMA 1YQSA 2ZC5B 5HAIA 4CPKA 5HAQA 5TGFA 4HEFA 1GA0A 5FI7A 4WBGA 4QY6A 1KE4A 1TDLA 3BFEA 3C7VA 3IHAA 5CEBA 3UY6A 4UA6A 2HPBA 1EROA 2Q9NA 4IEDA 3PBQA 1K56D 4Y0TA 4OQHA 2V20A 3Q7VA 5FAPA 4PM9A 2EX9A 1S6RA 3GV9A 5KSHA 1XGIA 5FAOA 1J9MA 3A3IA 1HD8A 4IBRA 1KE0A 3ZNYA 2G2WA 2H0YA 1TDGA 1H8YA 3E2KA 3ZG5A 3HBRA 4BD0A 3HLDA 3NCKA 2DNSA 2WADA 2JBFA 4U0XA 4WELA 5I94A 2I72A 3Q1FA 1YLJA 4LV0A 4PPRA 2Y2LA 4E3KA 1K6SA 5E2GA 4F94A 3HUOA 1C3BA 1PW8A 4DE1A 1K57A 4X53A 3ZFZA 2OV5A 4A5RA 4B4ZA 3HUNA 4O7DA 4K0XA 4JPMA 5EVID 5GHZA 1SDEA 2J7VA 4OONA 3IT9A 2ZM0A 3HL9A 1YLYA 1KDSA 2EX6A 3FZCA 3BFCA 3MZDA 3W4QA 1FSYA 4WEJA 1L0GA 3IF6B 1Q2PA 1FCMA 1Z6FA 2Y2NA 3VSLA 4PM5A 4OQ0A 1L2SA 5E2HA 5CTNA 5EOOA 3LY4A 2OSUA 1BZAA 3N4IA 4RA7A 5DF7A 2QMIA 3OPLA 1XA7A 2ZC7A 1VQQA 2P9VB 2ZMAA 4FH4A 2J9OA 3ITBA 1KE3A 1NYMA 2HDRA 2HDQA 2EFXA 4JXSA 2H5SA 3G2ZA 5FQIA 2FFFB 1BLPA 2FFYA 1XA1A 4S2NA 2J8YA 1AXBA 2XD5A 2Z2LB 1BLHA 3WS1A 2ZQ8A 4OLDA 3O87A 4R3JA 2ZM8A 3G30A 1QMEA 3HLEA 3HLFA 1LHYA 1PIOA 3HLBA 2Y2OA 4MBHA 4ZAMA 3N8LA 4OOLA 3D4FA 1NRFA 3IHBA 1NY0A 1EI5A 1BTLA 3NI9A 3O86A 3UE1A 4DXCA 1NZOA 4UHUA 5FI2A 1TEMA 2HDSA 2ZQAA 4OPYA 2A3UA 5M19A 4RVAA 3GTCA 3IWOA 1NYYA 4WMCD 1K54C 3SOIA 2JC7A 4KG6A 1N4OA 4U0TA 3TG9A 5F1GA 3S4XA 4JLFA 4OQIA 2C6WB 4E3OA 1KGGA 1E3UA 2G2UA 3CMZA 4BL3A 4OOMA 3AGFA 3SS3A 2Q9MA 3G35A 4JXGA 4NK3A 2WGVA 1ES2A 1GCEA 1GHPA 2WZXA 3RXWA 2J9PA 3UO9A 1JWVA 3W8KA 1XGJA 3FWLA 3EQVA 3VOYA 3N6IA 2Y2QA 1I2SA 3B3XA 4HBUA 3N8RA 4BJPA
chains in the Genus database with same CATH superfamily
4O8GA 1G28A 3LI8A 3HJKA 1PNEA 3OCNA 3O5YA 2VGLS 4GHIA 5GLCA 4FSFA 2VA0A 1H5XA 4EQIA 3ZVWA 2RL3A 4HI4A 5HW3A 1S4RA 3LYXA 5DF8A 4YNRA 2NUTC 2Q0OA 1KDWA 2A24B 2XRNA 3OPHA 3GMWA 3BM6A 1L0EA 2GZAA 4B4XA 3IXBA 3FKWA 1HTZA 4GZBA 2Y8HA 2ZQ7A 1ONHA 2HP9A 2M1CA 1K38A 3RH8B 4DE2A 4K08A 3BLSA 4MN5A 4IUHA 2GJ3A 1DJBA 3F1OB 3M2JA 2NUPC 3K3CA 3PR6A 4OVDA 2JKRI 2V2FF 1K56A 3UPOA 2XK1A 4JF6A 3UB8A 1VHMA 1MKIA 2Y55A 2WGIA 1D1JA 2HP6A 3MSHA 4HJ4A 2EX8A 3TJZC 3NJAA 3OC2A 5D3OA 3P09A 1WA9A 3U2AA 4ID4A 3FV7A 5GL9A 1BUEA 4NXEA 2P04A 3KO6A 3PBSA 4LV2A 2QPNA 3VMAA 3LGOA 1CK3A 1XKZA 2XH9A 4HHDA 2K2NA 5CGSA 1PZPA 4E3JA 1NZUA 1TS8A 1E4DA 3QP8A 4KZ3A 2QZ6A 1VM1A 3TW8A 4HBTA 4OH0A 1S66L 2W3FA 4IVKA 1P97A 4M3KA 3VP3A 3D3OA 4N9KA 3E2LA 2RCXA 3NOTC 3IX4A 5GLBA 4OPRA 4EUVA 5DKKA 2JKRM 3EWKA 4CLCB 2IWBA 2XFTA 2XEPA 1W8QA 4DRTA 2I9VA 2VV6A 2W3GA 5EFWA 5A91A 4O01A 3WWXA 5TBMB 5HDCA 1FCNA 3HUMA 5A93A 1OTDA 5F69A 4ARZB 4WEKA 3B33A 4DXBA 4PM7A 5FQJA 5HWTA 5GHYA 1MXOA 3BQAA 4NEED 4ME4A 3LR4A 4WLAA 2WKEA 1G68A 4KG2A 4N92A 4NXFA 3T1QB 1JWPA 3PBNA 4Y5FA 4LCMA 4GCZA 3PAGA 2OLUA 2WGWA 2GDNA 3PYPA 5F5YA 2V0WA 4GS9B 3GQZA 3NHQA 2UV0E 5KSCA 3Q82A 1SHVA 3M6HA 5IHVA 2XR0A 4MN6A 2OAQ1 4Q0IA 2EA9A 1NLYA 5J4EA 5EVLA 4C75A 4H8RA 1K55A 3BQ8A 5CGXA 2E8JA 1GSWA 3F1NB 1T19A 5E2EA 3QNCA 1M6KA 3DTEA 3EEHA 3MFDA 3BECA 4GNUA 4XT2A 4E6XA 2ZLYA 3M6BA 4O0PA 5CHMA 3V3RA 3E4QA 2M7UA 3ZVTA 1KVLA 2EFUA 1Y54A 2XFSA 5F83A 1YT4A 4KUKA 4L9GA 3BYDA 3A3JA 5G18A 3R7WB 2JKTI 2GX5A 1YLTA 3BLMA 1NWZA 1RP5A 1ERMA 2ZL1A 2PYRA 1SKFA 1N9BA 2ZMFA 3OPRA 2XDMA 5FA7A 3LIEA 2UWXA 1ZG4A 3C4PA 3OLOA 4X55A 3RJUA 4CJNA 5JYPA 3UNWA 3C38A 5F82A 1MPLA 4GB7A 4P0MA 3WRTA 3TOIA 4GOGA 2D02A 3GDIA 1NRJA 3CG5A 4CPKA 2WUQA 2XROA 5HAIA 1YSQA 5EM0A 4WBGA 4X1MA 5CEBA 2Q9NA 1N9OA 2V20A 3Q7VA 5FAPA 2JKTM 1TS0A 1J9MA 3MFXA 4IBRA 4L9EA 1TDGA 3HBRA 4BD0A 2DNSA 3UB9A 2JBFA 5CX7A 4EQ1A 1YLJA 3NOUC 4PPRA 1PW8A 2Y79A 3NOPC 4X53A 3ZFZA 2OV5A 3HUNA 3MS6A 4K0XA 4JPMA 5EVID 5GHZA 4H6JB 1YLYA 1KDSA 4HH3A 1VB6A 4OQ0A 5E2HA 1XA7A 1VQQA 2P9VB 2J9OA 3LI9A 4BBVA 1G6OA 1BLPA 4S2NA 1AXBA 1BLHA 1VETB 4R3JA 3HLBA 4ZAMA 3RFBA 3O86A 4DXCA 1BTLA 3NI9A 1H0MA 1OJGA 4I3JA 2JN7A 4JGPA 5FI2A 3V67A 1KOUA 2ZQAA 4RVAA 3GTCA 1NYYA 3S7OA 4WMCD 3T4TA 3S4XA 4OQIA 4LLOB 1KGGA 1E3UA 1ODVA 3AGFA 4KUOA 1ES2A 1UGUA 3JVVA 2J9PA 3FWLA 3N6IA 2J3TD 1OJ5A 3H7WB 2XSSA 1XJ4A 4EEPA 2W1TA 2A2LA 4XUZA 3HVFA 2WKPA 4PKYG 5AQ9A 4G3KA 1W79A 3CZDA 1OMEA 3VV4A 1DP9A 4WL9A 3AGDA 3NC8A 4ZDXA 4R38A 5HL6A 4B93A 2VGJA 2DCFA 1O7EA 4S2KA 4M4XA 5FL3A 3K2NA 3IWQA 1BLCA 4LRYC 4L9FA 3LFVA 2VV8A 2JHEA 4MCWA 4WZ5C 2QYBA 2W3EA 2DRWA 1ALQA 3K3DA 2WYXA 3T12B 5KZHA 1CI8A 5JYOA 3MXRA 1IYOA 3OPPA 4S2MA 2EXBA 5EVIB 3HJIA 2DMWA 4I38A 1P9RA 4K0WA 1YLZA 4Y2FA 4WZ5A 3S22A 4KZAA 3OBFA 5DTKA 2HF6A 1Y28A 4RX3A 1STZA 2HDUA 3C8CA 1PZOA 3SS4A 3G2YA 3MJQA 1JWZA 3DWKA 3A0VA 1X0OA 4G3WA 4GD8A 1LL8A 1QMFA 1DJAA 5FQKA 4FD8A 3T4QA 4OPQA 1P9WA 2ZC4B 4Z1WA 5MC7A 3IWIA 3NY4A 3TSGA 2ZM2A 1WYBA 3D72A 3HLCA 3ZDJA 5CEDA 3A3EA 4JXWA 1F2KA 2H28A 3PBTA 3PBRA 3PHYA 3SS5A 4LRZE 3WS4A 3IS2A 3CPTB 2PU2A 4JF5A 3G32A 2KX6A 1XPBA 4EEUA 1NLZA 3BFDA 4IVIA 4N1HA 3ZGAB 4CLCD 1S4SA 3IF5A 3PTEA 4KZ7A 1VEUB 3S1YA 3DWZA 2X01A 4R1GA 3UDIA 3C4OA 5TFQA 5FI6A 1SDNA 3KYEA 2KLIA 1OTBA 3PBOA 2ZQ9A 3H82A 3V3SA 4C6YA 2VGKA 1I5QA 1ES5A 3KSGA 2VX8A 3NDEA 3IBJA 1ZTUA 1D06A 3JPUA 1W63M 4LV1A 4JBFA 2Y59A 2EWVA 1S1ZA 4OLGA 4KQOA 1Y4OA 3MQQA 4Z9QA 2HJEA 5M18A 5HPIA 5FDSA 2PD7A 3T1RA 1U60A 3O3VA 1PWGA 3PXPA 4QU3A 1DP6A 2GNXA 3G31A 1XP4A 3T4SA 4QJGA 1F5MA 1FSWA 3RXXA 4GD6A 5KMWA 2EX2A 3UE3A 4C3QA 3T1XA 1OTIA 2B95A 4XXRA 3BW6A 1MY8A 1FILA 3QP5A 3W4PA 3ZCZA 3UB7A 3LR0A 3OZHA 3BFGA 5IT5A 3M2KA 4KZBA 5TJJA 1WYCA 3GVBA 5A92A 3A3FA 5HARA 5FATA 2IWCA 2BASA 3IH8A 2OLVA 3CHWP 4S2JA 4E6WA 3S7QA 3C30A 4BWIA 3L9KA 4P85A 3E4OA 3HLWA 4GJ4A 1MWRA 4X68A 5EM1A 4E3IA 5GLAA 4Q8IA 5F1FA 5HZHA 1N9LA 1PW1A 2HJ9C 1GA9A 3MXSA 4KQDA 4DJ3A 1EW0A 4X6TA 3FPVA 4KZ9A 4E3MA 3LR5A 5HFOA 2WKQA 4GHIB 4ZJ2A 1XXMA 1YM1A 4NKPA 4DDSA 4KZ5A 2BTFP 1E25A 1PWDA 2OWJA 2E8IA 4Q0JA 1BYWA 3ULFA 1OTAA 1CJFA 2QHKA 2P7JA 4WZ4A 1OTEA 5FQQA 3DBAA 3ITAA 3VOZA 2Y2HA 3F1PA 2EWWA 3G6OA 4GDNA 4JGQA 2ZD8A 3UDFA 1K4FA 1K57C 2V1ZA 5U47A 1K6RA 1YMXA 3IXDA 1YQSA 5TGFA 5FI7A 5DJUA 1KE4A 1TDLA 3C7VA 3UY6A 4Y0TA 4PM9A 2PR6A 2EX9A 5KSHA 2HV1A 3P7NA 1IFQA 3T4KA 1KE0A 3ZNYA 3E2KA 3ZG5A 4NXGA 4WELA 2I72A 4E3KA 5E2GA 4F94A 1J3WA 2W3DA 3HUOA 1SKOA 4BMWA 4DE1A 1K57A 4A5RA 4O7DA 1LT0A 4HH2A 1SDEA 4EXOA 4OONA 4Y13A 2ZM0A 3HL9A 3BFCA 3MZDA 1L0GA 1FCMA 3VSLA 1PFLA 2YKHA 5EOOA 3N4IA 5HD3A 2QMIA 4FH4A 2HDRA 2H5SA 2FFFB 2FFYA 3WS1A 4WF0A 4OLDA 2ZM8A 4HIAA 3HLEA 1LHYA 1PIOA 4MBHA 4YWZA 2G7UA 2V9AA 1AWIA 1Z09A 4UQIM 4OPYA 2A3UA 3C2WA 1K54C 4X25A 2JC7A 4ZRRA 4JLFA 4MN7A 4E3OA 2K31A 3CMZA 4BL3A 2PDRA 2AVXA 3SW1A 4MMNA 3E0YA 5AJGA 1GCEA 1GHPA 3RXWA 2PBDP 3W8KA 5AVFA 3EQVA 3VOYA 2V8FA 4LFUA 4WUJA 4JXVA 3ZG9B 1UWNX 4BBUA 4GN2A 4DE3A 2V0UA 4MEZA 5J7EA 4LRXC 4HY8A 4Y0OA 3MKFA 2O9BA 2P74A 2FH5A 3VP1A 1SZVA 1K54A 5A90A 3TRCA 2ZC3B 1ZKJA 5HWVA 2IWDA 3C5AA 4YINA 3DAVA 3B42A 2IA2A 4RYEA 3IH9A 3T4JA 3LR3A 3FYZA 3UE6A 4ZJ1A 3P01A 4EBPA 3E4PA 2H10A 2WK0A 5HX9A 2WGWB 2QWSA 2P08A 4F3LA 3Q7ZA 1ONGA 4R3BA 1RGZA 4MLLA 2J80A 3CJMA 3OCLA 5EVIC 1ZHHB 1CQAA 2Y4AA 4S2PA 3UN7A 1CEGA 1L3LA 2FZ0A 1D7EA 1YLWA 2L0WA 3BY9A 3IF6C 3KSHA 4OP8A 2QJ5A 4MBKA 4P6BA 1MBLA 3MKEA 2ZQCA 1ES4A 1OT9A 2ZBBA 3KYZA 1N9NA 3E98A 3BFFA 4GW9A 4EW7A 3CI6A 5FQMA 4XT2B 5HWWA 2CMNA 3WS5A 3MXQA 4LV3A 4YOFA 4KZ6A 4ETXA 4PAUA 1LI0A 1MKMA 3WS2A 1TVFA 4P6ZS 1GHIA 1V9YA 3HREA 3IF6A 2V1BA 1PI5A 4FCFA 1PWCA 3HCYA 3IXGA 3MQ0A 1MWUA 4E3LA 2ZOIA 2W0NA 4ZJ3A 1IKGA 5IS1A 3G4PA 4GDBA 1E3UD 3KYQA 3BRMA 2ZL1B 2J3TC 4P6ZM 1YSPA 1BLSA 1XJ2A 1MWTA 5HD5A 1M40A 5G4YA 5CRFA 2Y2GA 4DMZA 1NXYA 2PT7A 4WMCA 2JE5A 3JYIA 1JNUA 1CEFA 4MNRA 3N8SA 5E43A 1H8MA 2L1MA 1LI9A 5CXWA 4DN0A 1FCOA 4KQRA 4XUXA 5A8BA 1O07A 4Y7PA 3WS0A 2JKFA 2BG1A 4L0LA 1KGEA 1HLUP 4P87A 3Q7VB 5BOHA 1IYSA 1ACFA 3LUQA 4FOFA 4UA9A 3IBRA 1JTGA 3MZEA 2XGNA 1ZG6A 4WM9A 1PI4A 1GHMA 2A24A 3VE3A 3QHYA 1RGYA 5L09A 3Q81A 1YPRA 4DF6A 2H0TA 2INWA 5HDSA 4QY5A 3MZFA 3VOLA 5J8XA 3CITA 3DW0A 3KSFA 4CLCE 5HL1A 4N1XA 2Y2PA 4R6LA 1NJ4A 3F1OA 3LIFA 3ZG7B 2BLSA 1SCWA 4BBTA 5EV0A 2MJ6A 2L4RA 3P98A 5L8MA 5HPFA 3WRZA 4UA7A 4II7A 2VEAA 4KZ4A 4PM8A 4ETZA 3UMEA 1DY6A 3UPPA 1W63Q 1LLBA 4B88A 2PR5A 1H3QA 2B18A 2K7SA 3LIBA 5DJTA 4R4SA 2PU4A 4DKIA 4IJGA 4S2OA 1F98A 3LCEA 5EUAA 2VJWA 4S2LA 4CLCC 1H8ZA 2W1TB 1BULA 2XF3A 4HOIA 2ZC6B 2KDKA 3JVUA 3VP2A 3PAEA 4OKPA 1F9IA 5CTMA 5IU1A 1IEMA 2V8CA 4HP9A 2Y2JA 2X71A 3LEZA 1WE4A 3QNBA 4BD1A 3T50A 1PRQA 2VLGA 3S7NA 1G5UA 1OPXA 1HZOA 3EEAA 1IYQA 4CLCA 3A0RA 4IBXA 4OPZA 4U3TA 3ZG8B 2WAFA 2OOLA 4KQQA 1YMSA 5GLDA 5L10A 3V50A 2V1AA 1T1CA 3LEQA 4BQMA 1V9ZA 1KVMA 2ZC5B 1T1BA 4HEFA 3MR0A 1GA0A 5TBMA 2VGLM 4QY6A 3BFEA 3IHAA 2HPBA 1EROA 1MC0A 1K56D 1XJ3A 1P0ZA 2O9CA 4ARZA 1XFQA 3GV9A 1S6RA 1DRMA 1FIKA 1XGIA 5FAOA 3T4OA 3A0SA 1HD8A 2H0YA 1H8YA 4RQ9A 3HLDA 4JGOA 4U0XA 4HJ3A 3Q1FA 4LV0A 2Y2LA 1C3BA 4EERA 1MZUA 4EU0A 2J7VA 3IT9A 3T1SA 2OAP1 3OOVA 2EX6A 3FZCA 4IUKA 3W4QA 4GS9A 2Y2NA 1Z6FA 4PM5A 5G4ZA 4I39A 4HJ6A 5CTNA 2OSUA 1BZAA 4RA7A 3BWLA 1CF0A 3T4LA 2HDQA 5FQIA 1XA1A 2Z2LB 2ZQ8A 3ZYTA 1QMEA 3D9YA 3HLFA 3IS2B 2ZMVA 3IHBA 3UE1A 1NY0A 1NZOA 2OWHA 3F1NA 4UHUA 1TEMA 5M19A 3IWOA 2Z6CA 2VK3A 3TG9A 4B9OA 2G2UA 3EGXC 4OOMA 3SS3A 3R4KA 2VKSA 4NK3A 1LSVA 2WGVA 2WZXA 2O0YA 1JWVA 3FG8A 2W3HA 1I2SA 3B3XA 4HBUA 3N8RA 2PAVP 1S1YA 3R7WA 3H82B 4EESA 1GSXA 4Y3IA 4JKTA 4Y0UA 2A49A 3GSGA 5KIZA 2ACGA 1HVBA 3H9WA 3MBZA 3MQOA 1LSWA 2LB9A 2Y2MA 4NETA 3V39A 3V5MA 1CI9A 1IELA 3SH8A 4HP4A 3N7WA 5TR7A 1W8YA 4PHTA 3UMDA 4K91A 3EQUA 1XFNA 2KOIA 1I2WA 3UPNA 4NG2A 2X02A 4G3VA 1ERQA 1JTDA 2Y2KA 4PM6A 5E2FA 1YAXA 3ZNTA 3C7UA 4FH2A 1KGFA 1K4EA 4OP5A 1FR6A 5AQ7A 2VV7A 1K55C 1IYPA 2HZ5A 5FEGA 3ZQ5A 5HSQA 3IX8A 1W7FA 1S0WA 3IXHA 4S2IA 2WKRA 4LPZA 1A0KA 3DTIA 4QB8A 3UDXA 3NDGA 3DTMA 5FQ9A 1LSXA 5K5BA 4LCLA 5DTTA 1ESIA 1DJCA 4EUZA 1YKDA 4EBNA 4UAAA 4UQIS 4QHCA 4HESA 3KSIA 2Z2MB 1FQGA 1ES3A 2WZZA 4Y15A 4H6JA 1LL9A 2VZWA 4E04A 3QP6A 3MMHA 1BT5A 3FC7A 4EBLA 5C5KA 1T18A 2Y91A 3CAXA 3DTKA 3HLGA 1LL5A 2P9VA 3LO7A 1PYYA 1BSGA 2PRFA 2EXAA 5FSRA 4FUWA 3A3DA 1VETA 4YFMA 4E3NA 1ESUA 3VE4A 2O9AA 2WAEA 4X69A 2W1RA 2W27A 3QP4A 4I5SA 5DFXA 2ZJ9A 2R9XA 4MBFA 5EE8A 5FEFA 4DE0A 3KX0X 3EOIA 4KG5A 4DDYA 3VFFA 2PHYA 3GR2A 5EECA 1JVJA 3F1PB 3FKVA 3ISGA 1K25A 4ZTKA 1T1AA 2R9WA 5AQAA 5LBRA 4PMAA 3H7WA 2PYPA 2D01A 4HQAA 1L0FA 5CHUA 5F6AA 5AQBA 3FPWA 3UE0A 4ZBEA 2HP5A 4GKUA 3NECA 5L2FA 5DTSA 3AGEA 1YLPA 1G6AA 4QD4A 4X56A 4WN5A 2ZQDA 4JGRA 1SKOB 4R4RA 5M1AA 2XD1A 3GRJA 1FOFA 3NULA 1TF1A 1TS7A 5FASA 5GHXA 3IX3A 3ZHHA 2B5RA 5J3WA 3NBLA 4OOYA 4S2NC 4R23A 1RCJA 5CHJA 4BL2A 3L7HA 2PBYA 4KZ8A 1ZC2A 5I5LA 3UB6A 4BLMA 5EVIA 4EV4A 1UWPX 3W4OA 3LIAA 3S7PA 2PD8A 2LB5A 3VFHA 3BJNA 5FAQA 1IKIA 3SH7A 2XLNA 4GLQA 1MWSA 3CUEC 4NXBA 4DJ2A 3LY3A 3Q07A 4UEYA 5EOEA 2C5WB 4JF4A 4D2OA 4BENA 3I7JA 1DP8A 3VSKA 1Q2QA 5CERA 4ESPA 4KENB 1TD5A 3VP0A 3UB5P 5DF9A 4LGWA 2JKGA 2WKIA 2CC1A 3CWFA 3NIAA 2QKPA 1IOUA 3SZTA 2WKHA 5DFYA 2Y2IA 3O88A 3GECA 3SH9A 3CUEA 2R78A 1W5DA 3ICYA 3IQAA 4Q0HA 1GSVA 4LENA 5DKLA 3CPTA 3G34A 4OQGA 3BEBA 3ZG0A 1L0DA 4WYYA 1XX2A 4R0QA 4N9LA 1VEUA 4R70A 3VP4A 2JCHA 4EWFA 4RX2A 1FR1A 2XQZA 5CGWA 3MF0A 4F3LB 4PKYA 5CECA 4R3AA 5EPHA 5DVAA 5FDHA 5HAPA 1EWZA 5HAQA 3LIDA 3U4LP 4MDZA 5F68A 4UA6A 4IEDA 3PBQA 1XJ6A 3CLOA 1K0KA 4OQHA 3EGDC 3A3IA 4X1LA 5AVEA 2G2WA 5HDDA 3NCKA 2WADA 4EETB 4QPRA 3LICA 5I94A 2ZOHA 1K6SA 4B4ZA 4I3IA 2HGVA 3TE8A 1FSYA 4WEJA 3IF6B 1Q2PA 2XA7S 1L2SA 2O99A 3LY4A 2M7VA 5EVEA 5DF7A 4AFIA 3OPLA 4IHQA 2ZC7A 2ZMAA 3ITBA 1KE3A 1NYMA 2YKFA 2EFXA 4JXSA 3G2ZA 2Z6DA 2QJ7A 2J8YA 2XD5A 3O87A 3G30A 2B02A 2Y2OA 2XA7M 3N8LA 4OOLA 1TS6A 3W2ZA 3D4FA 1NRFA 1EI5A 3QP1A 3QP2A 2HDSA 4QWOA 4CQHA 3BY8A 3SOIA 4I3AA 4U0TA 4KG6A 1N4OA 3RTYA 1S67L 4HNBA 5F1GA 4FTXA 2C6WB 4Y17A 2Q9MA 3G35A 4JXGA 5L07A 1OT6A 3UO9A 3B47A 1XGJA 2J3WA 4D60A 2Y2QA 4BJPA
chains in the Genus database with same CATH topology
4XUZA 4JXVA 3ZG9B 3HVFA 4GN2A 4DE3A 3OCNA 4MEZA 5AQ9A 4JKTA 4Y0OA 1W79A 4Y0UA 3MKFA 2A49A 3GSGA 1HVBA 5GLCA 4FSFA 3CZDA 1H5XA 4EQIA 3ZVWA 3MBZA 1OMEA 2P74A 3VP1A 2Y2MA 1K54A 2RL3A 5A90A 3AGDA 3NC8A 4NETA 3V39A 4ZDXA 2ZC3B 1ZKJA 5HW3A 3V5MA 2IWDA 1CI9A 1IELA 3SH8A 3C5AA 5DF8A 2VGJA 4YINA 2DCFA 3N7WA 1O7EA 4S2KA 5TR7A 1W8YA 4RYEA 3IH9A 1KDWA 4K91A 3FYZA 3EQUA 4ZJ1A 3IWQA 1BLCA 4EBPA 3OPHA 2H10A 2WK0A 3GMWA 5HX9A 1I2WA 3BM6A 1L0EA 3UPNA 4B4XA 2X02A 2WGWB 4WZ5C 1ERQA 1JTDA 3IXBA 2DRWA 3FKWA 1ALQA 2Y2KA 4PM6A 5E2FA 1HTZA 2WYXA 4GZBA 3ZNTA 3C7UA 4FH2A 2ZQ7A 3Q7ZA 1ONHA 5KZHA 1KGFA 1K4EA 4OP5A 2HP9A 1K38A 1CI8A 1FR6A 5AQ7A 1K55C 1ONGA 5JYOA 3MXRA 4R3BA 4DE2A 1IYOA 1RGZA 4MLLA 3CJMA 3OCLA 1IYPA 3BLSA 5EVIC 1DJBA 2Y4AA 3M2JA 4S2PA 1CEGA 3UN7A 3OPPA 4S2MA 1YLWA 2EXBA 4OVDA 3IF6C 4OP8A 1W7FA 2V2FF 1S0WA 3IXHA 1K56A 5EVIB 4S2IA 3UPOA 2XK1A 4JF6A 4MBKA 4K0WA 1YLZA 4P6BA 4QB8A 3UDXA 1MKIA 2Y55A 1MBLA 3NDGA 2WGIA 3DTMA 3MKEA 4WZ5A 2ZQCA 5FQ9A 1ES4A 2HP6A 4LCLA 5DTTA 3S22A 2EX8A 3BFFA 1ESIA 4KZAA 5DTKA 5FQMA 3OC2A 1DJCA 5D3OA 4EUZA 4RX3A 4EBNA 3P09A 4UAAA 3WS5A 4LV3A 4QHCA 2HDUA 1PZOA 3SS4A 3G2YA 4HESA 4KZ6A 1JWZA 2Z2MB 1FQGA 1ES3A 3DWKA 1LI0A 4ID4A 2WZZA 3FV7A 5GL9A 1BUEA 3WS2A 1TVFA 4GD8A 1LL9A 1GHIA 3PBSA 5HAPA 4LV2A 1QMFA 2QPNA 1DJAA 3VMAA 3HREA 1BT5A 3IF6A 1CK3A 1XKZA 2XH9A 4EBLA 1PI5A 4FCFA 1PWCA 5FQKA 2Y91A 5CGSA 4FD8A 3IXGA 3HLGA 1PZPA 4E3LA 1MWUA 4OPQA 4E3JA 2ZC4B 4ZJ3A 1NZUA 1IKGA 1LL5A 2P9VA 3G4PA 4GDBA 3LO7A 1E3UD 1E4DA 1PYYA 3IWIA 2QZ6A 3NY4A 2ZM2A 4KZ3A 1VM1A 1WYBA 3HLCA 3TSGA 3ZDJA 5CEDA 4HBTA 1BSGA 3BRMA 4OH0A 3A3EA 4JXWA 4IVKA 2EXAA 3PBTA 5FSRA 3PBRA 3A3DA 3SS5A 4M3KA 4YFMA 3VP3A 3WS4A 4E3NA 1BLSA 1ESUA 4N9KA 3E2LA 2WAEA 2PU2A 4JF5A 1MWTA 2RCXA 3G32A 4X69A 1M40A 1XPBA 5GLBA 2ZJ9A 4OPRA 5CRFA 2Y2GA 2R9XA 3BFDA 4MBFA 1NXYA 4IVIA 4N1HA 5EE8A 3ZGAB 4DE0A 4WMCA 2IWBA 3IF5A 2JE5A 3JYIA 3PTEA 4KZ7A 2XFTA 2XEPA 1CEFA 4KG5A 1W8QA 4DRTA 3S1YA 4DDYA 4MNRA 3N8SA 3VFFA 5E43A 3GR2A 5EECA 3DWZA 2X01A 1JVJA 1LI9A 4R1GA 3UDIA 3C4OA 3FKVA 5CXWA 3ISGA 1K25A 4ZTKA 1FCOA 4KQRA 2R9WA 5AQAA 5TFQA 5FI6A 1SDNA 4PMAA 5A91A 3WWXA 4XUXA 3PBOA 2ZQ9A 1O07A 4Y7PA 3V3SA 3WS0A 1FCNA 2VGKA 4C6YA 1I5QA 3HUMA 2BG1A 1ES5A 5A93A 3NDEA 4L0LA 1KGEA 1L0FA 4P87A 5CHUA 5AQBA 4WEKA 3Q7VB 5BOHA 1IYSA 4DXBA 4LV1A 4JBFA 4PM7A 3UE0A 2Y59A 4ZBEA 2HP5A 4GKUA 5FQJA 4OLGA 4UA9A 4KQOA 5L2FA 4Z9QA 5DTSA 5GHYA 1MXOA 5M18A 1JTGA 3AGEA 1YLPA 1G6AA 3MZEA 4QD4A 2XGNA 4X56A 1ZG6A 4WM9A 1U60A 3O3VA 1PWGA 2WKEA 1PI4A 1G68A 1GHMA 4QU3A 2ZQDA 4KG2A 4N92A 1JWPA 4R4RA 3PBNA 3G31A 1XP4A 5M1AA 4LCMA 4QJGA 3PAGA 2XD1A 2OLUA 2WGWA 3GRJA 1FOFA 1FSWA 2GDNA 3RXXA 3QHYA 4GD6A 1RGYA 2EX2A 5KMWA 3UE3A 3GQZA 5FASA 5GHXA 3ZHHA 2B5RA 3Q81A 4C3QA 4DF6A 3NBLA 4XXRA 1MY8A 2H0TA 3W4PA 3ZCZA 5KSCA 3Q82A 4OOYA 4QY5A 1SHVA 3MZFA 5J8XA 4S2NC 4R23A 3M6HA 3DW0A 5IHVA 4N1XA 2Y2PA 3OZHA 1RCJA 2XR0A 5CHJA 5HL1A 4BL2A 3BFGA 3M2KA 4KZBA 1NJ4A 1WYCA 3GVBA 2PBYA 5EVLA 4C75A 5A92A 4KZ8A 1ZC2A 3ZG7B 3A3FA 4H8RA 1K55A 5HARA 4BLMA 5FATA 2BLSA 2IWCA 5CGXA 5EVIA 1SCWA 4EV4A 3IH8A 3P98A 3W4OA 2OLVA 4S2JA 4E6WA 3WRZA 4UA7A 3VFHA 4KZ4A 4PM8A 5E2EA 5FAQA 1IKIA 1DY6A 3QNCA 1M6KA 3SH7A 2XLNA 1MWSA 3MFDA 3BECA 3UPPA 4GNUA 4E6XA 2ZLYA 3M6BA 3LY3A 1LLBA 4P85A 3Q07A 5CHMA 4B88A 3V3RA 5EOEA 3HLWA 2C5WB 1MWRA 3ZVTA 4X68A 1KVLA 2EFUA 1Y54A 4E3IA 4JF4A 4R4SA 5GLAA 4D2OA 4BENA 3I7JA 4Q8IA 5F1FA 1PW1A 2PU4A 2XFSA 5F83A 1YT4A 3VSKA 1Q2QA 5CERA 4DKIA 1GA9A 4KENB 4S2OA 3MXSA 3LCEA 5EUAA 3VP0A 4S2LA 5DF9A 3BYDA 3A3JA 4X6TA 5G18A 1H8ZA 2WKIA 1BULA 2XF3A 4KZ9A 2CC1A 4E3MA 3NIAA 1YLTA 3BLMA 2WKHA 2ZC6B 5HFOA 3PAEA 2Y2IA 3VP2A 4OKPA 3O88A 5CTMA 1IEMA 4ZJ2A 1XXMA 1RP5A 2Y2JA 2X71A 1YM1A 3LEZA 3SH9A 4DDSA 1ERMA 1W5DA 4KZ5A 1WE4A 3QNBA 4BD1A 1E25A 3IQAA 1PWDA 1SKFA 4LENA 1N9BA 3OPRA 2XDMA 2E8IA 5FA7A 2UWXA 4WZ4A 3G34A 1ZG4A 4OQGA 3BEBA 3C4PA 3ZG0A 4X55A 4BQMA 1HZOA 3RJUA 1IYQA 4CJNA 5JYPA 1L0DA 3UNWA 4WYYA 1XX2A 4R0QA 5F82A 4N9LA 1MPLA 4GB7A 5FQQA 4P0MA 3WRTA 4IBXA 3TOIA 3VP4A 2JCHA 3ITAA 4EWFA 4RX2A 3VOZA 1FR1A 2Y2HA 2XQZA 4OPZA 5CGWA 4GOGA 4U3TA 3ZG8B 2WAFA 4KQQA 1YMSA 5GLDA 4GDNA 5CECA 2ZD8A 3UDFA 1K4FA 3V50A 5EPHA 1K57C 2V1ZA 5U47A 1YMXA 1K6RA 3CG5A 5DVAA 2WUQA 5FDHA 1EWZA 3IXDA 1KVMA 1YQSA 2ZC5B 5HAIA 4CPKA 5HAQA 5TGFA 4HEFA 1GA0A 5FI7A 4WBGA 4QY6A 1KE4A 1TDLA 3BFEA 3C7VA 3IHAA 5CEBA 3UY6A 4UA6A 2HPBA 1EROA 2Q9NA 4IEDA 3PBQA 1K56D 4Y0TA 4OQHA 2V20A 3Q7VA 5FAPA 4PM9A 2EX9A 1S6RA 3GV9A 5KSHA 1XGIA 5FAOA 1J9MA 3A3IA 1HD8A 4IBRA 1KE0A 3ZNYA 2G2WA 2H0YA 1TDGA 1H8YA 3E2KA 3ZG5A 3HBRA 4BD0A 3HLDA 3NCKA 2DNSA 2WADA 2JBFA 4U0XA 4WELA 5I94A 2I72A 3Q1FA 1YLJA 4LV0A 4PPRA 2Y2LA 4E3KA 1K6SA 5E2GA 4F94A 3HUOA 1C3BA 1PW8A 4DE1A 1K57A 4X53A 3ZFZA 2OV5A 4A5RA 4B4ZA 3HUNA 4O7DA 4K0XA 4JPMA 5EVID 5GHZA 1SDEA 2J7VA 4OONA 3IT9A 2ZM0A 3HL9A 1YLYA 1KDSA 2EX6A 3FZCA 3BFCA 3MZDA 3W4QA 1FSYA 4WEJA 1L0GA 3IF6B 1Q2PA 1FCMA 1Z6FA 2Y2NA 3VSLA 4PM5A 4OQ0A 1L2SA 5E2HA 5CTNA 5EOOA 3LY4A 2OSUA 1BZAA 3N4IA 4RA7A 5DF7A 2QMIA 3OPLA 1XA7A 2ZC7A 1VQQA 2P9VB 2ZMAA 4FH4A 2J9OA 3ITBA 1KE3A 1NYMA 2HDRA 2HDQA 2EFXA 4JXSA 2H5SA 3G2ZA 5FQIA 2FFFB 1BLPA 2FFYA 1XA1A 4S2NA 2J8YA 1AXBA 2XD5A 2Z2LB 1BLHA 3WS1A 2ZQ8A 4OLDA 3O87A 4R3JA 2ZM8A 3G30A 1QMEA 3HLEA 3HLFA 1LHYA 1PIOA 3HLBA 2Y2OA 4MBHA 4ZAMA 3N8LA 4OOLA 3D4FA 1NRFA 3IHBA 1NY0A 1EI5A 1BTLA 3NI9A 3O86A 3UE1A 4DXCA 1NZOA 4UHUA 5FI2A 1TEMA 2HDSA 2ZQAA 4OPYA 2A3UA 5M19A 4RVAA 3GTCA 3IWOA 1NYYA 4WMCD 1K54C 3SOIA 2JC7A 4KG6A 1N4OA 4U0TA 3TG9A 5F1GA 3S4XA 4JLFA 4OQIA 2C6WB 4E3OA 1KGGA 1E3UA 2G2UA 3CMZA 4BL3A 4OOMA 3AGFA 3SS3A 2Q9MA 3G35A 4JXGA 4NK3A 2WGVA 1ES2A 1GCEA 1GHPA 2WZXA 3RXWA 2J9PA 3UO9A 1JWVA 3W8KA 1XGJA 3FWLA 3EQVA 3VOYA 3N6IA 2Y2QA 1I2SA 3B3XA 4HBUA 3N8RA 4BJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XUZ A;  4JXV A;  3ZG9 B;  3HVF A;  4GN2 A;  4DE3 A;  3OCN A;  4MEZ A;  5AQ9 A;  4JKT A;  4Y0O A;  1W79 A;  4Y0U A;  3MKF A;  2A49 A;  3GSG A;  1HVB A;  5GLC A;  4FSF A;  3CZD A;  1H5X A;  4EQI A;  3ZVW A;  3MBZ A;  1OME A;  2P74 A;  3VP1 A;  2Y2M A;  1K54 A;  2RL3 A;  5A90 A;  3AGD A;  3NC8 A;  4NET A;  3V39 A;  4ZDX A;  2ZC3 B;  1ZKJ A;  5HW3 A;  3V5M A;  2IWD A;  1CI9 A;  1IEL A;  3SH8 A;  3C5A A;  5DF8 A;  2VGJ A;  4YIN A;  2DCF A;  3N7W A;  1O7E A;  4S2K A;  5TR7 A;  1W8Y A;  4RYE A;  3IH9 A;  1KDW A;  4K91 A;  3FYZ A;  3EQU A;  4ZJ1 A;  3IWQ A;  1BLC A;  4EBP A;  3OPH A;  2H10 A;  2WK0 A;  3GMW A;  5HX9 A;  1I2W A;  3BM6 A;  1L0E A;  3UPN A;  4B4X A;  2X02 A;  2WGW B;  4WZ5 C;  1ERQ A;  1JTD A;  3IXB A;  2DRW A;  3FKW A;  1ALQ A;  2Y2K A;  4PM6 A;  5E2F A;  1HTZ A;  2WYX A;  4GZB A;  3ZNT A;  3C7U A;  4FH2 A;  2ZQ7 A;  3Q7Z A;  1ONH A;  5KZH A;  1KGF A;  1K4E A;  4OP5 A;  2HP9 A;  1K38 A;  1CI8 A;  1FR6 A;  5AQ7 A;  1K55 C;  1ONG A;  5JYO A;  3MXR A;  4R3B A;  4DE2 A;  1IYO A;  1RGZ A;  4MLL A;  3CJM A;  3OCL A;  1IYP A;  3BLS A;  5EVI C;  1DJB A;  2Y4A A;  3M2J A;  4S2P A;  1CEG A;  3UN7 A;  3OPP A;  4S2M A;  1YLW A;  2EXB A;  4OVD A;  3IF6 C;  4OP8 A;  1W7F A;  2V2F F;  1S0W A;  3IXH A;  1K56 A;  5EVI B;  4S2I A;  3UPO A;  2XK1 A;  4JF6 A;  4MBK A;  4K0W A;  1YLZ A;  4P6B A;  4QB8 A;  3UDX A;  1MKI A;  2Y55 A;  1MBL A;  3NDG A;  2WGI A;  3DTM A;  3MKE A;  4WZ5 A;  2ZQC A;  5FQ9 A;  1ES4 A;  2HP6 A;  4LCL A;  5DTT A;  3S22 A;  2EX8 A;  3BFF A;  1ESI A;  4KZA A;  5DTK A;  5FQM A;  3OC2 A;  1DJC A;  5D3O A;  4EUZ A;  4RX3 A;  4EBN A;  3P09 A;  4UAA A;  3WS5 A;  4LV3 A;  4QHC A;  2HDU A;  1PZO A;  3SS4 A;  3G2Y A;  4HES A;  4KZ6 A;  1JWZ A;  2Z2M B;  1FQG A;  1ES3 A;  3DWK A;  1LI0 A;  4ID4 A;  2WZZ A;  3FV7 A;  5GL9 A;  1BUE A;  3WS2 A;  1TVF A;  4GD8 A;  1LL9 A;  1GHI A;  3PBS A;  5HAP A;  4LV2 A;  1QMF A;  2QPN A;  1DJA A;  3VMA A;  3HRE A;  1BT5 A;  3IF6 A;  1CK3 A;  1XKZ A;  2XH9 A;  4EBL A;  1PI5 A;  4FCF A;  1PWC A;  5FQK A;  2Y91 A;  5CGS A;  4FD8 A;  3IXG A;  3HLG A;  1PZP A;  4E3L A;  1MWU A;  4OPQ A;  4E3J A;  2ZC4 B;  4ZJ3 A;  1NZU A;  1IKG A;  1LL5 A;  2P9V A;  3G4P A;  4GDB A;  3LO7 A;  1E3U D;  1E4D A;  1PYY A;  3IWI A;  2QZ6 A;  3NY4 A;  2ZM2 A;  4KZ3 A;  1VM1 A;  1WYB A;  3HLC A;  3TSG A;  3ZDJ A;  5CED A;  4HBT A;  1BSG A;  3BRM A;  4OH0 A;  3A3E A;  4JXW A;  4IVK A;  2EXA A;  3PBT A;  5FSR A;  3PBR A;  3A3D A;  3SS5 A;  4M3K A;  4YFM A;  3VP3 A;  3WS4 A;  4E3N A;  1BLS A;  1ESU A;  4N9K A;  3E2L A;  2WAE A;  2PU2 A;  4JF5 A;  1MWT A;  2RCX A;  3G32 A;  4X69 A;  1M40 A;  1XPB A;  5GLB A;  2ZJ9 A;  4OPR A;  5CRF A;  2Y2G A;  2R9X A;  3BFD A;  4MBF A;  1NXY A;  4IVI A;  4N1H A;  5EE8 A;  3ZGA B;  4DE0 A;  4WMC A;  2IWB A;  3IF5 A;  2JE5 A;  3JYI A;  3PTE A;  4KZ7 A;  2XFT A;  2XEP A;  1CEF A;  4KG5 A;  1W8Q A;  4DRT A;  3S1Y A;  4DDY A;  4MNR A;  3N8S A;  3VFF A;  5E43 A;  3GR2 A;  5EEC A;  3DWZ A;  2X01 A;  1JVJ A;  1LI9 A;  4R1G A;  3UDI A;  3C4O A;  3FKV A;  5CXW A;  3ISG A;  1K25 A;  4ZTK A;  1FCO A;  4KQR A;  2R9W A;  5AQA A;  5TFQ A;  5FI6 A;  1SDN A;  4PMA A;  5A91 A;  3WWX A;  4XUX A;  3PBO A;  2ZQ9 A;  1O07 A;  4Y7P A;  3V3S A;  3WS0 A;  1FCN A;  2VGK A;  4C6Y A;  1I5Q A;  3HUM A;  2BG1 A;  1ES5 A;  5A93 A;  3NDE A;  4L0L A;  1KGE A;  1L0F A;  4P87 A;  5CHU A;  5AQB A;  4WEK A;  3Q7V B;  5BOH A;  1IYS A;  4DXB A;  4LV1 A;  4JBF A;  4PM7 A;  3UE0 A;  2Y59 A;  4ZBE A;  2HP5 A;  4GKU A;  5FQJ A;  4OLG A;  4UA9 A;  4KQO A;  5L2F A;  4Z9Q A;  5DTS A;  5GHY A;  1MXO A;  5M18 A;  1JTG A;  3AGE A;  1YLP A;  1G6A A;  3MZE A;  4QD4 A;  2XGN A;  4X56 A;  1ZG6 A;  4WM9 A;  1U60 A;  3O3V A;  1PWG A;  2WKE A;  1PI4 A;  1G68 A;  1GHM A;  4QU3 A;  2ZQD A;  4KG2 A;  4N92 A;  1JWP A;  4R4R A;  3PBN A;  3G31 A;  1XP4 A;  5M1A A;  4LCM A;  4QJG A;  3PAG A;  2XD1 A;  2OLU A;  2WGW A;  3GRJ A;  1FOF A;  1FSW A;  2GDN A;  3RXX A;  3QHY A;  4GD6 A;  1RGY A;  2EX2 A;  5KMW A;  3UE3 A;  3GQZ A;  5FAS A;  5GHX A;  3ZHH A;  2B5R A;  3Q81 A;  4C3Q A;  4DF6 A;  3NBL A;  4XXR A;  1MY8 A;  2H0T A;  3W4P A;  3ZCZ A;  5KSC A;  3Q82 A;  4OOY A;  4QY5 A;  1SHV A;  3MZF A;  5J8X A;  4S2N C;  4R23 A;  3M6H A;  3DW0 A;  5IHV A;  4N1X A;  2Y2P A;  3OZH A;  1RCJ A;  2XR0 A;  5CHJ A;  5HL1 A;  4BL2 A;  3BFG A;  3M2K A;  4KZB A;  1NJ4 A;  1WYC A;  3GVB A;  2PBY A;  5EVL A;  4C75 A;  5A92 A;  4KZ8 A;  1ZC2 A;  3ZG7 B;  3A3F A;  4H8R A;  1K55 A;  5HAR A;  4BLM A;  5FAT A;  2BLS A;  2IWC A;  5CGX A;  5EVI A;  1SCW A;  4EV4 A;  3IH8 A;  3P98 A;  3W4O A;  2OLV A;  4S2J A;  4E6W A;  3WRZ A;  4UA7 A;  3VFH A;  4KZ4 A;  4PM8 A;  5E2E A;  5FAQ A;  1IKI A;  1DY6 A;  3QNC A;  1M6K A;  3SH7 A;  2XLN A;  1MWS A;  3MFD A;  3BEC A;  3UPP A;  4GNU A;  4E6X A;  2ZLY A;  3M6B A;  3LY3 A;  1LLB A;  4P85 A;  3Q07 A;  5CHM A;  4B88 A;  3V3R A;  5EOE A;  3HLW A;  2C5W B;  1MWR A;  3ZVT A;  4X68 A;  1KVL A;  2EFU A;  1Y54 A;  4E3I A;  4JF4 A;  4R4S A;  5GLA A;  4D2O A;  4BEN A;  3I7J A;  4Q8I A;  5F1F A;  1PW1 A;  2PU4 A;  2XFS A;  5F83 A;  1YT4 A;  3VSK A;  1Q2Q A;  5CER A;  4DKI A;  1GA9 A;  4KEN B;  4S2O A;  3MXS A;  3LCE A;  5EUA A;  3VP0 A;  4S2L A;  5DF9 A;  3BYD A;  3A3J A;  4X6T A;  5G18 A;  1H8Z A;  2WKI A;  1BUL A;  2XF3 A;  4KZ9 A;  2CC1 A;  4E3M A;  3NIA A;  1YLT A;  3BLM A;  2WKH A;  2ZC6 B;  5HFO A;  3PAE A;  2Y2I A;  3VP2 A;  4OKP A;  3O88 A;  5CTM A;  1IEM A;  4ZJ2 A;  1XXM A;  1RP5 A;  2Y2J A;  2X71 A;  1YM1 A;  3LEZ A;  3SH9 A;  4DDS A;  1ERM A;  1W5D A;  4KZ5 A;  1WE4 A;  3QNB A;  4BD1 A;  1E25 A;  3IQA A;  1PWD A;  1SKF A;  4LEN A;  1N9B A;  3OPR A;  2XDM A;  2E8I A;  5FA7 A;  2UWX A;  4WZ4 A;  3G34 A;  1ZG4 A;  4OQG A;  3BEB A;  3C4P A;  3ZG0 A;  4X55 A;  4BQM A;  1HZO A;  3RJU A;  1IYQ A;  4CJN A;  5JYP A;  1L0D A;  3UNW A;  4WYY A;  1XX2 A;  4R0Q A;  5F82 A;  4N9L A;  1MPL A;  4GB7 A;  5FQQ A;  4P0M A;  3WRT A;  4IBX A;  3TOI A;  3VP4 A;  2JCH A;  3ITA A;  4EWF A;  4RX2 A;  3VOZ A;  1FR1 A;  2Y2H A;  2XQZ A;  4OPZ A;  5CGW A;  4GOG A;  4U3T A;  3ZG8 B;  2WAF A;  4KQQ A;  1YMS A;  5GLD A;  4GDN A;  5CEC A;  2ZD8 A;  3UDF A;  1K4F A;  3V50 A;  5EPH A;  1K57 C;  2V1Z A;  5U47 A;  1YMX A;  1K6R A;  3CG5 A;  5DVA A;  2WUQ A;  5FDH A;  1EWZ A;  3IXD A;  1KVM A;  1YQS A;  2ZC5 B;  5HAI A;  4CPK A;  5HAQ A;  5TGF A;  4HEF A;  1GA0 A;  5FI7 A;  4WBG A;  4QY6 A;  1KE4 A;  1TDL A;  3BFE A;  3C7V A;  3IHA A;  5CEB A;  3UY6 A;  4UA6 A;  2HPB A;  1ERO A;  2Q9N A;  4IED A;  3PBQ A;  1K56 D;  4Y0T A;  4OQH A;  2V20 A;  3Q7V A;  5FAP A;  4PM9 A;  2EX9 A;  1S6R A;  3GV9 A;  5KSH A;  1XGI A;  5FAO A;  1J9M A;  3A3I A;  1HD8 A;  4IBR A;  1KE0 A;  3ZNY A;  2G2W A;  2H0Y A;  1TDG A;  1H8Y A;  3E2K A;  3ZG5 A;  3HBR A;  4BD0 A;  3HLD A;  3NCK A;  2DNS A;  2WAD A;  2JBF A;  4U0X A;  4WEL A;  5I94 A;  2I72 A;  3Q1F A;  1YLJ A;  4LV0 A;  4PPR A;  2Y2L A;  4E3K A;  1K6S A;  5E2G A;  4F94 A;  3HUO A;  1C3B A;  1PW8 A;  4DE1 A;  1K57 A;  4X53 A;  3ZFZ A;  2OV5 A;  4A5R A;  4B4Z A;  3HUN A;  4O7D A;  4K0X A;  4JPM A;  5EVI D;  5GHZ A;  1SDE A;  2J7V A;  4OON A;  3IT9 A;  2ZM0 A;  3HL9 A;  1YLY A;  1KDS A;  2EX6 A;  3FZC A;  3BFC A;  3MZD A;  3W4Q A;  1FSY A;  4WEJ A;  1L0G A;  3IF6 B;  1Q2P A;  1FCM A;  1Z6F A;  2Y2N A;  3VSL A;  4PM5 A;  4OQ0 A;  1L2S A;  5E2H A;  5CTN A;  5EOO A;  3LY4 A;  2OSU A;  1BZA A;  3N4I A;  4RA7 A;  5DF7 A;  2QMI A;  3OPL A;  1XA7 A;  2ZC7 A;  1VQQ A;  2P9V B;  2ZMA A;  4FH4 A;  2J9O A;  3ITB A;  1KE3 A;  1NYM A;  2HDR A;  2HDQ A;  2EFX A;  4JXS A;  2H5S A;  3G2Z A;  5FQI A;  2FFF B;  1BLP A;  2FFY A;  1XA1 A;  4S2N A;  2J8Y A;  1AXB A;  2XD5 A;  2Z2L B;  1BLH A;  3WS1 A;  2ZQ8 A;  4OLD A;  3O87 A;  4R3J A;  2ZM8 A;  3G30 A;  1QME A;  3HLE A;  3HLF A;  1LHY A;  1PIO A;  3HLB A;  2Y2O A;  4MBH A;  4ZAM A;  3N8L A;  4OOL A;  3D4F A;  1NRF A;  3IHB A;  1NY0 A;  1EI5 A;  1BTL A;  3NI9 A;  3O86 A;  3UE1 A;  4DXC A;  1NZO A;  4UHU A;  5FI2 A;  1TEM A;  2HDS A;  2ZQA A;  4OPY A;  2A3U A;  5M19 A;  4RVA A;  3GTC A;  3IWO A;  1NYY A;  4WMC D;  1K54 C;  3SOI A;  2JC7 A;  4KG6 A;  1N4O A;  4U0T A;  3TG9 A;  5F1G A;  3S4X A;  4JLF A;  4OQI A;  2C6W B;  4E3O A;  1KGG A;  1E3U A;  2G2U A;  3CMZ A;  4BL3 A;  4OOM A;  3AGF A;  3SS3 A;  2Q9M A;  3G35 A;  4JXG A;  4NK3 A;  2WGV A;  1ES2 A;  1GCE A;  1GHP A;  2WZX A;  3RXW A;  2J9P A;  3UO9 A;  1JWV A;  3W8K A;  1XGJ A;  3FWL A;  3EQV A;  3VOY A;  3N6I A;  2Y2Q A;  1I2S A;  3B3X A;  4HBU A;  3N8R A;  4BJP A; 
#chains in the Genus database with same CATH topology
 4O8G A;  1G28 A;  3LI8 A;  3HJK A;  1PNE A;  3OCN A;  3O5Y A;  2VGL S;  4GHI A;  5GLC A;  4FSF A;  2VA0 A;  1H5X A;  4EQI A;  3ZVW A;  2RL3 A;  4HI4 A;  5HW3 A;  1S4R A;  3LYX A;  5DF8 A;  4YNR A;  2NUT C;  2Q0O A;  1KDW A;  2A24 B;  2XRN A;  3OPH A;  3GMW A;  3BM6 A;  1L0E A;  2GZA A;  4B4X A;  3IXB A;  3FKW A;  1HTZ A;  4GZB A;  2Y8H A;  2ZQ7 A;  1ONH A;  2HP9 A;  2M1C A;  1K38 A;  3RH8 B;  4DE2 A;  4K08 A;  3BLS A;  4MN5 A;  4IUH A;  2GJ3 A;  1DJB A;  3F1O B;  3M2J A;  2NUP C;  3K3C A;  3PR6 A;  4OVD A;  2JKR I;  2V2F F;  1K56 A;  3UPO A;  2XK1 A;  4JF6 A;  3UB8 A;  1VHM A;  1MKI A;  2Y55 A;  2WGI A;  1D1J A;  2HP6 A;  3MSH A;  4HJ4 A;  2EX8 A;  3TJZ C;  3NJA A;  3OC2 A;  5D3O A;  3P09 A;  1WA9 A;  3U2A A;  4ID4 A;  3FV7 A;  5GL9 A;  1BUE A;  4NXE A;  2P04 A;  3KO6 A;  3PBS A;  4LV2 A;  2QPN A;  3VMA A;  3LGO A;  1CK3 A;  1XKZ A;  2XH9 A;  4HHD A;  2K2N A;  5CGS A;  1PZP A;  4E3J A;  1NZU A;  1TS8 A;  1E4D A;  3QP8 A;  4KZ3 A;  2QZ6 A;  1VM1 A;  3TW8 A;  4HBT A;  4OH0 A;  1S66 L;  2W3F A;  4IVK A;  1P97 A;  4M3K A;  3VP3 A;  3D3O A;  4N9K A;  3E2L A;  2RCX A;  3NOT C;  3IX4 A;  5GLB A;  4OPR A;  4EUV A;  5DKK A;  2JKR M;  3EWK A;  4CLC B;  2IWB A;  2XFT A;  2XEP A;  1W8Q A;  4DRT A;  2I9V A;  2VV6 A;  2W3G A;  5EFW A;  5A91 A;  4O01 A;  3WWX A;  5TBM B;  5HDC A;  1FCN A;  3HUM A;  5A93 A;  1OTD A;  5F69 A;  4ARZ B;  4WEK A;  3B33 A;  4DXB A;  4PM7 A;  5FQJ A;  5HWT A;  5GHY A;  1MXO A;  3BQA A;  4NEE D;  4ME4 A;  3LR4 A;  4WLA A;  2WKE A;  1G68 A;  4KG2 A;  4N92 A;  4NXF A;  3T1Q B;  1JWP A;  3PBN A;  4Y5F A;  4LCM A;  4GCZ A;  3PAG A;  2OLU A;  2WGW A;  2GDN A;  3PYP A;  5F5Y A;  2V0W A;  4GS9 B;  3GQZ A;  3NHQ A;  2UV0 E;  5KSC A;  3Q82 A;  1SHV A;  3M6H A;  5IHV A;  2XR0 A;  4MN6 A;  2OAQ 1;  4Q0I A;  2EA9 A;  1NLY A;  5J4E A;  5EVL A;  4C75 A;  4H8R A;  1K55 A;  3BQ8 A;  5CGX A;  2E8J A;  1GSW A;  3F1N B;  1T19 A;  5E2E A;  3QNC A;  1M6K A;  3DTE A;  3EEH A;  3MFD A;  3BEC A;  4GNU A;  4XT2 A;  4E6X A;  2ZLY A;  3M6B A;  4O0P A;  5CHM A;  3V3R A;  3E4Q A;  2M7U A;  3ZVT A;  1KVL A;  2EFU A;  1Y54 A;  2XFS A;  5F83 A;  1YT4 A;  4KUK A;  4L9G A;  3BYD A;  3A3J A;  5G18 A;  3R7W B;  2JKT I;  2GX5 A;  1YLT A;  3BLM A;  1NWZ A;  1RP5 A;  1ERM A;  2ZL1 A;  2PYR A;  1SKF A;  1N9B A;  2ZMF A;  3OPR A;  2XDM A;  5FA7 A;  3LIE A;  2UWX A;  1ZG4 A;  3C4P A;  3OLO A;  4X55 A;  3RJU A;  4CJN A;  5JYP A;  3UNW A;  3C38 A;  5F82 A;  1MPL A;  4GB7 A;  4P0M A;  3WRT A;  3TOI A;  4GOG A;  2D02 A;  3GDI A;  1NRJ A;  3CG5 A;  4CPK A;  2WUQ A;  2XRO A;  5HAI A;  1YSQ A;  5EM0 A;  4WBG A;  4X1M A;  5CEB A;  2Q9N A;  1N9O A;  2V20 A;  3Q7V A;  5FAP A;  2JKT M;  1TS0 A;  1J9M A;  3MFX A;  4IBR A;  4L9E A;  1TDG A;  3HBR A;  4BD0 A;  2DNS A;  3UB9 A;  2JBF A;  5CX7 A;  4EQ1 A;  1YLJ A;  3NOU C;  4PPR A;  1PW8 A;  2Y79 A;  3NOP C;  4X53 A;  3ZFZ A;  2OV5 A;  3HUN A;  3MS6 A;  4K0X A;  4JPM A;  5EVI D;  5GHZ A;  4H6J B;  1YLY A;  1KDS A;  4HH3 A;  1VB6 A;  4OQ0 A;  5E2H A;  1XA7 A;  1VQQ A;  2P9V B;  2J9O A;  3LI9 A;  4BBV A;  1G6O A;  1BLP A;  4S2N A;  1AXB A;  1BLH A;  1VET B;  4R3J A;  3HLB A;  4ZAM A;  3RFB A;  3O86 A;  4DXC A;  1BTL A;  3NI9 A;  1H0M A;  1OJG A;  4I3J A;  2JN7 A;  4JGP A;  5FI2 A;  3V67 A;  1KOU A;  2ZQA A;  4RVA A;  3GTC A;  1NYY A;  3S7O A;  4WMC D;  3T4T A;  3S4X A;  4OQI A;  4LLO B;  1KGG A;  1E3U A;  1ODV A;  3AGF A;  4KUO A;  1ES2 A;  1UGU A;  3JVV A;  2J9P A;  3FWL A;  3N6I A;  2J3T D;  1OJ5 A;  3H7W B;  2XSS A;  1XJ4 A;  4EEP A;  2W1T A;  2A2L A;  4XUZ A;  3HVF A;  2WKP A;  4PKY G;  5AQ9 A;  4G3K A;  1W79 A;  3CZD A;  1OME A;  3VV4 A;  1DP9 A;  4WL9 A;  3AGD A;  3NC8 A;  4ZDX A;  4R38 A;  5HL6 A;  4B93 A;  2VGJ A;  2DCF A;  1O7E A;  4S2K A;  4M4X A;  5FL3 A;  3K2N A;  3IWQ A;  1BLC A;  4LRY C;  4L9F A;  3LFV A;  2VV8 A;  2JHE A;  4MCW A;  4WZ5 C;  2QYB A;  2W3E A;  2DRW A;  1ALQ A;  3K3D A;  2WYX A;  3T12 B;  5KZH A;  1CI8 A;  5JYO A;  3MXR A;  1IYO A;  3OPP A;  4S2M A;  2EXB A;  5EVI B;  3HJI A;  2DMW A;  4I38 A;  1P9R A;  4K0W A;  1YLZ A;  4Y2F A;  4WZ5 A;  3S22 A;  4KZA A;  3OBF A;  5DTK A;  2HF6 A;  1Y28 A;  4RX3 A;  1STZ A;  2HDU A;  3C8C A;  1PZO A;  3SS4 A;  3G2Y A;  3MJQ A;  1JWZ A;  3DWK A;  3A0V A;  1X0O A;  4G3W A;  4GD8 A;  1LL8 A;  1QMF A;  1DJA A;  5FQK A;  4FD8 A;  3T4Q A;  4OPQ A;  1P9W A;  2ZC4 B;  4Z1W A;  5MC7 A;  3IWI A;  3NY4 A;  3TSG A;  2ZM2 A;  1WYB A;  3D72 A;  3HLC A;  3ZDJ A;  5CED A;  3A3E A;  4JXW A;  1F2K A;  2H28 A;  3PBT A;  3PBR A;  3PHY A;  3SS5 A;  4LRZ E;  3WS4 A;  3IS2 A;  3CPT B;  2PU2 A;  4JF5 A;  3G32 A;  2KX6 A;  1XPB A;  4EEU A;  1NLZ A;  3BFD A;  4IVI A;  4N1H A;  3ZGA B;  4CLC D;  1S4S A;  3IF5 A;  3PTE A;  4KZ7 A;  1VEU B;  3S1Y A;  3DWZ A;  2X01 A;  4R1G A;  3UDI A;  3C4O A;  5TFQ A;  5FI6 A;  1SDN A;  3KYE A;  2KLI A;  1OTB A;  3PBO A;  2ZQ9 A;  3H82 A;  3V3S A;  4C6Y A;  2VGK A;  1I5Q A;  1ES5 A;  3KSG A;  2VX8 A;  3NDE A;  3IBJ A;  1ZTU A;  1D06 A;  3JPU A;  1W63 M;  4LV1 A;  4JBF A;  2Y59 A;  2EWV A;  1S1Z A;  4OLG A;  4KQO A;  1Y4O A;  3MQQ A;  4Z9Q A;  2HJE A;  5M18 A;  5HPI A;  5FDS A;  2PD7 A;  3T1R A;  1U60 A;  3O3V A;  1PWG A;  3PXP A;  4QU3 A;  1DP6 A;  2GNX A;  3G31 A;  1XP4 A;  3T4S A;  4QJG A;  1F5M A;  1FSW A;  3RXX A;  4GD6 A;  5KMW A;  2EX2 A;  3UE3 A;  4C3Q A;  3T1X A;  1OTI A;  2B95 A;  4XXR A;  3BW6 A;  1MY8 A;  1FIL A;  3QP5 A;  3W4P A;  3ZCZ A;  3UB7 A;  3LR0 A;  3OZH A;  3BFG A;  5IT5 A;  3M2K A;  4KZB A;  5TJJ A;  1WYC A;  3GVB A;  5A92 A;  3A3F A;  5HAR A;  5FAT A;  2IWC A;  2BAS A;  3IH8 A;  2OLV A;  3CHW P;  4S2J A;  4E6W A;  3S7Q A;  3C30 A;  4BWI A;  3L9K A;  4P85 A;  3E4O A;  3HLW A;  4GJ4 A;  1MWR A;  4X68 A;  5EM1 A;  4E3I A;  5GLA A;  4Q8I A;  5F1F A;  5HZH A;  1N9L A;  1PW1 A;  2HJ9 C;  1GA9 A;  3MXS A;  4KQD A;  4DJ3 A;  1EW0 A;  4X6T A;  3FPV A;  4KZ9 A;  4E3M A;  3LR5 A;  5HFO A;  2WKQ A;  4GHI B;  4ZJ2 A;  1XXM A;  1YM1 A;  4NKP A;  4DDS A;  4KZ5 A;  2BTF P;  1E25 A;  1PWD A;  2OWJ A;  2E8I A;  4Q0J A;  1BYW A;  3ULF A;  1OTA A;  1CJF A;  2QHK A;  2P7J A;  4WZ4 A;  1OTE A;  5FQQ A;  3DBA A;  3ITA A;  3VOZ A;  2Y2H A;  3F1P A;  2EWW A;  3G6O A;  4GDN A;  4JGQ A;  2ZD8 A;  3UDF A;  1K4F A;  1K57 C;  2V1Z A;  5U47 A;  1K6R A;  1YMX A;  3IXD A;  1YQS A;  5TGF A;  5FI7 A;  5DJU A;  1KE4 A;  1TDL A;  3C7V A;  3UY6 A;  4Y0T A;  4PM9 A;  2PR6 A;  2EX9 A;  5KSH A;  2HV1 A;  3P7N A;  1IFQ A;  3T4K A;  1KE0 A;  3ZNY A;  3E2K A;  3ZG5 A;  4NXG A;  4WEL A;  2I72 A;  4E3K A;  5E2G A;  4F94 A;  1J3W A;  2W3D A;  3HUO A;  1SKO A;  4BMW A;  4DE1 A;  1K57 A;  4A5R A;  4O7D A;  1LT0 A;  4HH2 A;  1SDE A;  4EXO A;  4OON A;  4Y13 A;  2ZM0 A;  3HL9 A;  3BFC A;  3MZD A;  1L0G A;  1FCM A;  3VSL A;  1PFL A;  2YKH A;  5EOO A;  3N4I A;  5HD3 A;  2QMI A;  4FH4 A;  2HDR A;  2H5S A;  2FFF B;  2FFY A;  3WS1 A;  4WF0 A;  4OLD A;  2ZM8 A;  4HIA A;  3HLE A;  1LHY A;  1PIO A;  4MBH A;  4YWZ A;  2G7U A;  2V9A A;  1AWI A;  1Z09 A;  4UQI M;  4OPY A;  2A3U A;  3C2W A;  1K54 C;  4X25 A;  2JC7 A;  4ZRR A;  4JLF A;  4MN7 A;  4E3O A;  2K31 A;  3CMZ A;  4BL3 A;  2PDR A;  2AVX A;  3SW1 A;  4MMN A;  3E0Y A;  5AJG A;  1GCE A;  1GHP A;  3RXW A;  2PBD P;  3W8K A;  5AVF A;  3EQV A;  3VOY A;  2V8F A;  4LFU A;  4WUJ A;  4JXV A;  3ZG9 B;  1UWN X;  4BBU A;  4GN2 A;  4DE3 A;  2V0U A;  4MEZ A;  5J7E A;  4LRX C;  4HY8 A;  4Y0O A;  3MKF A;  2O9B A;  2P74 A;  2FH5 A;  3VP1 A;  1SZV A;  1K54 A;  5A90 A;  3TRC A;  2ZC3 B;  1ZKJ A;  5HWV A;  2IWD A;  3C5A A;  4YIN A;  3DAV A;  3B42 A;  2IA2 A;  4RYE A;  3IH9 A;  3T4J A;  3LR3 A;  3FYZ A;  3UE6 A;  4ZJ1 A;  3P01 A;  4EBP A;  3E4P A;  2H10 A;  2WK0 A;  5HX9 A;  2WGW B;  2QWS A;  2P08 A;  4F3L A;  3Q7Z A;  1ONG A;  4R3B A;  1RGZ A;  4MLL A;  2J80 A;  3CJM A;  3OCL A;  5EVI C;  1ZHH B;  1CQA A;  2Y4A A;  4S2P A;  3UN7 A;  1CEG A;  1L3L A;  2FZ0 A;  1D7E A;  1YLW A;  2L0W A;  3BY9 A;  3IF6 C;  3KSH A;  4OP8 A;  2QJ5 A;  4MBK A;  4P6B A;  1MBL A;  3MKE A;  2ZQC A;  1ES4 A;  1OT9 A;  2ZBB A;  3KYZ A;  1N9N A;  3E98 A;  3BFF A;  4GW9 A;  4EW7 A;  3CI6 A;  5FQM A;  4XT2 B;  5HWW A;  2CMN A;  3WS5 A;  3MXQ A;  4LV3 A;  4YOF A;  4KZ6 A;  4ETX A;  4PAU A;  1LI0 A;  1MKM A;  3WS2 A;  1TVF A;  4P6Z S;  1GHI A;  1V9Y A;  3HRE A;  3IF6 A;  2V1B A;  1PI5 A;  4FCF A;  1PWC A;  3HCY A;  3IXG A;  3MQ0 A;  1MWU A;  4E3L A;  2ZOI A;  2W0N A;  4ZJ3 A;  1IKG A;  5IS1 A;  3G4P A;  4GDB A;  1E3U D;  3KYQ A;  3BRM A;  2ZL1 B;  2J3T C;  4P6Z M;  1YSP A;  1BLS A;  1XJ2 A;  1MWT A;  5HD5 A;  1M40 A;  5G4Y A;  5CRF A;  2Y2G A;  4DMZ A;  1NXY A;  2PT7 A;  4WMC A;  2JE5 A;  3JYI A;  1JNU A;  1CEF A;  4MNR A;  3N8S A;  5E43 A;  1H8M A;  2L1M A;  1LI9 A;  5CXW A;  4DN0 A;  1FCO A;  4KQR A;  4XUX A;  5A8B A;  1O07 A;  4Y7P A;  3WS0 A;  2JKF A;  2BG1 A;  4L0L A;  1KGE A;  1HLU P;  4P87 A;  3Q7V B;  5BOH A;  1IYS A;  1ACF A;  3LUQ A;  4FOF A;  4UA9 A;  3IBR A;  1JTG A;  3MZE A;  2XGN A;  1ZG6 A;  4WM9 A;  1PI4 A;  1GHM A;  2A24 A;  3VE3 A;  3QHY A;  1RGY A;  5L09 A;  3Q81 A;  1YPR A;  4DF6 A;  2H0T A;  2INW A;  5HDS A;  4QY5 A;  3MZF A;  3VOL A;  5J8X A;  3CIT A;  3DW0 A;  3KSF A;  4CLC E;  5HL1 A;  4N1X A;  2Y2P A;  4R6L A;  1NJ4 A;  3F1O A;  3LIF A;  3ZG7 B;  2BLS A;  1SCW A;  4BBT A;  5EV0 A;  2MJ6 A;  2L4R A;  3P98 A;  5L8M A;  5HPF A;  3WRZ A;  4UA7 A;  4II7 A;  2VEA A;  4KZ4 A;  4PM8 A;  4ETZ A;  3UME A;  1DY6 A;  3UPP A;  1W63 Q;  1LLB A;  4B88 A;  2PR5 A;  1H3Q A;  2B18 A;  2K7S A;  3LIB A;  5DJT A;  4R4S A;  2PU4 A;  4DKI A;  4IJG A;  4S2O A;  1F98 A;  3LCE A;  5EUA A;  2VJW A;  4S2L A;  4CLC C;  1H8Z A;  2W1T B;  1BUL A;  2XF3 A;  4HOI A;  2ZC6 B;  2KDK A;  3JVU A;  3VP2 A;  3PAE A;  4OKP A;  1F9I A;  5CTM A;  5IU1 A;  1IEM A;  2V8C A;  4HP9 A;  2Y2J A;  2X71 A;  3LEZ A;  1WE4 A;  3QNB A;  4BD1 A;  3T50 A;  1PRQ A;  2VLG A;  3S7N A;  1G5U A;  1OPX A;  1HZO A;  3EEA A;  1IYQ A;  4CLC A;  3A0R A;  4IBX A;  4OPZ A;  4U3T A;  3ZG8 B;  2WAF A;  2OOL A;  4KQQ A;  1YMS A;  5GLD A;  5L10 A;  3V50 A;  2V1A A;  1T1C A;  3LEQ A;  4BQM A;  1V9Z A;  1KVM A;  2ZC5 B;  1T1B A;  4HEF A;  3MR0 A;  1GA0 A;  5TBM A;  2VGL M;  4QY6 A;  3BFE A;  3IHA A;  2HPB A;  1ERO A;  1MC0 A;  1K56 D;  1XJ3 A;  1P0Z A;  2O9C A;  4ARZ A;  1XFQ A;  3GV9 A;  1S6R A;  1DRM A;  1FIK A;  1XGI A;  5FAO A;  3T4O A;  3A0S A;  1HD8 A;  2H0Y A;  1H8Y A;  4RQ9 A;  3HLD A;  4JGO A;  4U0X A;  4HJ3 A;  3Q1F A;  4LV0 A;  2Y2L A;  1C3B A;  4EER A;  1MZU A;  4EU0 A;  2J7V A;  3IT9 A;  3T1S A;  2OAP 1;  3OOV A;  2EX6 A;  3FZC A;  4IUK A;  3W4Q A;  4GS9 A;  2Y2N A;  1Z6F A;  4PM5 A;  5G4Z A;  4I39 A;  4HJ6 A;  5CTN A;  2OSU A;  1BZA A;  4RA7 A;  3BWL A;  1CF0 A;  3T4L A;  2HDQ A;  5FQI A;  1XA1 A;  2Z2L B;  2ZQ8 A;  3ZYT A;  1QME A;  3D9Y A;  3HLF A;  3IS2 B;  2ZMV A;  3IHB A;  3UE1 A;  1NY0 A;  1NZO A;  2OWH A;  3F1N A;  4UHU A;  1TEM A;  5M19 A;  3IWO A;  2Z6C A;  2VK3 A;  3TG9 A;  4B9O A;  2G2U A;  3EGX C;  4OOM A;  3SS3 A;  3R4K A;  2VKS A;  4NK3 A;  1LSV A;  2WGV A;  2WZX A;  2O0Y A;  1JWV A;  3FG8 A;  2W3H A;  1I2S A;  3B3X A;  4HBU A;  3N8R A;  2PAV P;  1S1Y A;  3R7W A;  3H82 B;  4EES A;  1GSX A;  4Y3I A;  4JKT A;  4Y0U A;  2A49 A;  3GSG A;  5KIZ A;  2ACG A;  1HVB A;  3H9W A;  3MBZ A;  3MQO A;  1LSW A;  2LB9 A;  2Y2M A;  4NET A;  3V39 A;  3V5M A;  1CI9 A;  1IEL A;  3SH8 A;  4HP4 A;  3N7W A;  5TR7 A;  1W8Y A;  4PHT A;  3UMD A;  4K91 A;  3EQU A;  1XFN A;  2KOI A;  1I2W A;  3UPN A;  4NG2 A;  2X02 A;  4G3V A;  1ERQ A;  1JTD A;  2Y2K A;  4PM6 A;  5E2F A;  1YAX A;  3ZNT A;  3C7U A;  4FH2 A;  1KGF A;  1K4E A;  4OP5 A;  1FR6 A;  5AQ7 A;  2VV7 A;  1K55 C;  1IYP A;  2HZ5 A;  5FEG A;  3ZQ5 A;  5HSQ A;  3IX8 A;  1W7F A;  1S0W A;  3IXH A;  4S2I A;  2WKR A;  4LPZ A;  1A0K A;  3DTI A;  4QB8 A;  3UDX A;  3NDG A;  3DTM A;  5FQ9 A;  1LSX A;  5K5B A;  4LCL A;  5DTT A;  1ESI A;  1DJC A;  4EUZ A;  1YKD A;  4EBN A;  4UAA A;  4UQI S;  4QHC A;  4HES A;  3KSI A;  2Z2M B;  1FQG A;  1ES3 A;  2WZZ A;  4Y15 A;  4H6J A;  1LL9 A;  2VZW A;  4E04 A;  3QP6 A;  3MMH A;  1BT5 A;  3FC7 A;  4EBL A;  5C5K A;  1T18 A;  2Y91 A;  3CAX A;  3DTK A;  3HLG A;  1LL5 A;  2P9V A;  3LO7 A;  1PYY A;  1BSG A;  2PRF A;  2EXA A;  5FSR A;  4FUW A;  3A3D A;  1VET A;  4YFM A;  4E3N A;  1ESU A;  3VE4 A;  2O9A A;  2WAE A;  4X69 A;  2W1R A;  2W27 A;  3QP4 A;  4I5S A;  5DFX A;  2ZJ9 A;  2R9X A;  4MBF A;  5EE8 A;  5FEF A;  4DE0 A;  3KX0 X;  3EOI A;  4KG5 A;  4DDY A;  3VFF A;  2PHY A;  3GR2 A;  5EEC A;  1JVJ A;  3F1P B;  3FKV A;  3ISG A;  1K25 A;  4ZTK A;  1T1A A;  2R9W A;  5AQA A;  5LBR A;  4PMA A;  3H7W A;  2PYP A;  2D01 A;  4HQA A;  1L0F A;  5CHU A;  5F6A A;  5AQB A;  3FPW A;  3UE0 A;  4ZBE A;  2HP5 A;  4GKU A;  3NEC A;  5L2F A;  5DTS A;  3AGE A;  1YLP A;  1G6A A;  4QD4 A;  4X56 A;  4WN5 A;  2ZQD A;  4JGR A;  1SKO B;  4R4R A;  5M1A A;  2XD1 A;  3GRJ A;  1FOF A;  3NUL A;  1TF1 A;  1TS7 A;  5FAS A;  5GHX A;  3IX3 A;  3ZHH A;  2B5R A;  5J3W A;  3NBL A;  4OOY A;  4S2N C;  4R23 A;  1RCJ A;  5CHJ A;  4BL2 A;  3L7H A;  2PBY A;  4KZ8 A;  1ZC2 A;  5I5L A;  3UB6 A;  4BLM A;  5EVI A;  4EV4 A;  1UWP X;  3W4O A;  3LIA A;  3S7P A;  2PD8 A;  2LB5 A;  3VFH A;  3BJN A;  5FAQ A;  1IKI A;  3SH7 A;  2XLN A;  4GLQ A;  1MWS A;  3CUE C;  4NXB A;  4DJ2 A;  3LY3 A;  3Q07 A;  4UEY A;  5EOE A;  2C5W B;  4JF4 A;  4D2O A;  4BEN A;  3I7J A;  1DP8 A;  3VSK A;  1Q2Q A;  5CER A;  4ESP A;  4KEN B;  1TD5 A;  3VP0 A;  3UB5 P;  5DF9 A;  4LGW A;  2JKG A;  2WKI A;  2CC1 A;  3CWF A;  3NIA A;  2QKP A;  1IOU A;  3SZT A;  2WKH A;  5DFY A;  2Y2I A;  3O88 A;  3GEC A;  3SH9 A;  3CUE A;  2R78 A;  1W5D A;  3ICY A;  3IQA A;  4Q0H A;  1GSV A;  4LEN A;  5DKL A;  3CPT A;  3G34 A;  4OQG A;  3BEB A;  3ZG0 A;  1L0D A;  4WYY A;  1XX2 A;  4R0Q A;  4N9L A;  1VEU A;  4R70 A;  3VP4 A;  2JCH A;  4EWF A;  4RX2 A;  1FR1 A;  2XQZ A;  5CGW A;  3MF0 A;  4F3L B;  4PKY A;  5CEC A;  4R3A A;  5EPH A;  5DVA A;  5FDH A;  5HAP A;  1EWZ A;  5HAQ A;  3LID A;  3U4L P;  4MDZ A;  5F68 A;  4UA6 A;  4IED A;  3PBQ A;  1XJ6 A;  3CLO A;  1K0K A;  4OQH A;  3EGD C;  3A3I A;  4X1L A;  5AVE A;  2G2W A;  5HDD A;  3NCK A;  2WAD A;  4EET B;  4QPR A;  3LIC A;  5I94 A;  2ZOH A;  1K6S A;  4B4Z A;  4I3I A;  2HGV A;  3TE8 A;  1FSY A;  4WEJ A;  3IF6 B;  1Q2P A;  2XA7 S;  1L2S A;  2O99 A;  3LY4 A;  2M7V A;  5EVE A;  5DF7 A;  4AFI A;  3OPL A;  4IHQ A;  2ZC7 A;  2ZMA A;  3ITB A;  1KE3 A;  1NYM A;  2YKF A;  2EFX A;  4JXS A;  3G2Z A;  2Z6D A;  2QJ7 A;  2J8Y A;  2XD5 A;  3O87 A;  3G30 A;  2B02 A;  2Y2O A;  2XA7 M;  3N8L A;  4OOL A;  1TS6 A;  3W2Z A;  3D4F A;  1NRF A;  1EI5 A;  3QP1 A;  3QP2 A;  2HDS A;  4QWO A;  4CQH A;  3BY8 A;  3SOI A;  4I3A A;  4U0T A;  4KG6 A;  1N4O A;  3RTY A;  1S67 L;  4HNB A;  5F1G A;  4FTX A;  2C6W B;  4Y17 A;  2Q9M A;  3G35 A;  4JXG A;  5L07 A;  1OT6 A;  3UO9 A;  3B47 A;  1XGJ A;  2J3W A;  4D60 A;  2Y2Q A;  4BJP A; 
#chains in the Genus database with same CATH homology
 4XUZ A;  4JXV A;  3ZG9 B;  3HVF A;  4GN2 A;  4DE3 A;  3OCN A;  4MEZ A;  5AQ9 A;  4JKT A;  4Y0O A;  1W79 A;  4Y0U A;  3MKF A;  2A49 A;  3GSG A;  1HVB A;  5GLC A;  4FSF A;  3CZD A;  1H5X A;  4EQI A;  3ZVW A;  3MBZ A;  1OME A;  2P74 A;  3VP1 A;  2Y2M A;  1K54 A;  2RL3 A;  5A90 A;  3AGD A;  3NC8 A;  4NET A;  3V39 A;  4ZDX A;  2ZC3 B;  1ZKJ A;  5HW3 A;  3V5M A;  2IWD A;  1CI9 A;  1IEL A;  3SH8 A;  3C5A A;  5DF8 A;  2VGJ A;  4YIN A;  2DCF A;  3N7W A;  1O7E A;  4S2K A;  5TR7 A;  1W8Y A;  4RYE A;  3IH9 A;  1KDW A;  4K91 A;  3FYZ A;  3EQU A;  4ZJ1 A;  3IWQ A;  1BLC A;  4EBP A;  3OPH A;  2H10 A;  2WK0 A;  3GMW A;  5HX9 A;  1I2W A;  3BM6 A;  1L0E A;  3UPN A;  4B4X A;  2X02 A;  2WGW B;  4WZ5 C;  1ERQ A;  1JTD A;  3IXB A;  2DRW A;  3FKW A;  1ALQ A;  2Y2K A;  4PM6 A;  5E2F A;  1HTZ A;  2WYX A;  4GZB A;  3ZNT A;  3C7U A;  4FH2 A;  2ZQ7 A;  3Q7Z A;  1ONH A;  5KZH A;  1KGF A;  1K4E A;  4OP5 A;  2HP9 A;  1K38 A;  1CI8 A;  1FR6 A;  5AQ7 A;  1K55 C;  1ONG A;  5JYO A;  3MXR A;  4R3B A;  4DE2 A;  1IYO A;  1RGZ A;  4MLL A;  3CJM A;  3OCL A;  1IYP A;  3BLS A;  5EVI C;  1DJB A;  2Y4A A;  3M2J A;  4S2P A;  1CEG A;  3UN7 A;  3OPP A;  4S2M A;  1YLW A;  2EXB A;  4OVD A;  3IF6 C;  4OP8 A;  1W7F A;  2V2F F;  1S0W A;  3IXH A;  1K56 A;  5EVI B;  4S2I A;  3UPO A;  2XK1 A;  4JF6 A;  4MBK A;  4K0W A;  1YLZ A;  4P6B A;  4QB8 A;  3UDX A;  1MKI A;  2Y55 A;  1MBL A;  3NDG A;  2WGI A;  3DTM A;  3MKE A;  4WZ5 A;  2ZQC A;  5FQ9 A;  1ES4 A;  2HP6 A;  4LCL A;  5DTT A;  3S22 A;  2EX8 A;  3BFF A;  1ESI A;  4KZA A;  5DTK A;  5FQM A;  3OC2 A;  1DJC A;  5D3O A;  4EUZ A;  4RX3 A;  4EBN A;  3P09 A;  4UAA A;  3WS5 A;  4LV3 A;  4QHC A;  2HDU A;  1PZO A;  3SS4 A;  3G2Y A;  4HES A;  4KZ6 A;  1JWZ A;  2Z2M B;  1FQG A;  1ES3 A;  3DWK A;  1LI0 A;  4ID4 A;  2WZZ A;  3FV7 A;  5GL9 A;  1BUE A;  3WS2 A;  1TVF A;  4GD8 A;  1LL9 A;  1GHI A;  3PBS A;  5HAP A;  4LV2 A;  1QMF A;  2QPN A;  1DJA A;  3VMA A;  3HRE A;  1BT5 A;  3IF6 A;  1CK3 A;  1XKZ A;  2XH9 A;  4EBL A;  1PI5 A;  4FCF A;  1PWC A;  5FQK A;  2Y91 A;  5CGS A;  4FD8 A;  3IXG A;  3HLG A;  1PZP A;  4E3L A;  1MWU A;  4OPQ A;  4E3J A;  2ZC4 B;  4ZJ3 A;  1NZU A;  1IKG A;  1LL5 A;  2P9V A;  3G4P A;  4GDB A;  3LO7 A;  1E3U D;  1E4D A;  1PYY A;  3IWI A;  2QZ6 A;  3NY4 A;  2ZM2 A;  4KZ3 A;  1VM1 A;  1WYB A;  3HLC A;  3TSG A;  3ZDJ A;  5CED A;  4HBT A;  1BSG A;  3BRM A;  4OH0 A;  3A3E A;  4JXW A;  4IVK A;  2EXA A;  3PBT A;  5FSR A;  3PBR A;  3A3D A;  3SS5 A;  4M3K A;  4YFM A;  3VP3 A;  3WS4 A;  4E3N A;  1BLS A;  1ESU A;  4N9K A;  3E2L A;  2WAE A;  2PU2 A;  4JF5 A;  1MWT A;  2RCX A;  3G32 A;  4X69 A;  1M40 A;  1XPB A;  5GLB A;  2ZJ9 A;  4OPR A;  5CRF A;  2Y2G A;  2R9X A;  3BFD A;  4MBF A;  1NXY A;  4IVI A;  4N1H A;  5EE8 A;  3ZGA B;  4DE0 A;  4WMC A;  2IWB A;  3IF5 A;  2JE5 A;  3JYI A;  3PTE A;  4KZ7 A;  2XFT A;  2XEP A;  1CEF A;  4KG5 A;  1W8Q A;  4DRT A;  3S1Y A;  4DDY A;  4MNR A;  3N8S A;  3VFF A;  5E43 A;  3GR2 A;  5EEC A;  3DWZ A;  2X01 A;  1JVJ A;  1LI9 A;  4R1G A;  3UDI A;  3C4O A;  3FKV A;  5CXW A;  3ISG A;  1K25 A;  4ZTK A;  1FCO A;  4KQR A;  2R9W A;  5AQA A;  5TFQ A;  5FI6 A;  1SDN A;  4PMA A;  5A91 A;  3WWX A;  4XUX A;  3PBO A;  2ZQ9 A;  1O07 A;  4Y7P A;  3V3S A;  3WS0 A;  1FCN A;  2VGK A;  4C6Y A;  1I5Q A;  3HUM A;  2BG1 A;  1ES5 A;  5A93 A;  3NDE A;  4L0L A;  1KGE A;  1L0F A;  4P87 A;  5CHU A;  5AQB A;  4WEK A;  3Q7V B;  5BOH A;  1IYS A;  4DXB A;  4LV1 A;  4JBF A;  4PM7 A;  3UE0 A;  2Y59 A;  4ZBE A;  2HP5 A;  4GKU A;  5FQJ A;  4OLG A;  4UA9 A;  4KQO A;  5L2F A;  4Z9Q A;  5DTS A;  5GHY A;  1MXO A;  5M18 A;  1JTG A;  3AGE A;  1YLP A;  1G6A A;  3MZE A;  4QD4 A;  2XGN A;  4X56 A;  1ZG6 A;  4WM9 A;  1U60 A;  3O3V A;  1PWG A;  2WKE A;  1PI4 A;  1G68 A;  1GHM A;  4QU3 A;  2ZQD A;  4KG2 A;  4N92 A;  1JWP A;  4R4R A;  3PBN A;  3G31 A;  1XP4 A;  5M1A A;  4LCM A;  4QJG A;  3PAG A;  2XD1 A;  2OLU A;  2WGW A;  3GRJ A;  1FOF A;  1FSW A;  2GDN A;  3RXX A;  3QHY A;  4GD6 A;  1RGY A;  2EX2 A;  5KMW A;  3UE3 A;  3GQZ A;  5FAS A;  5GHX A;  3ZHH A;  2B5R A;  3Q81 A;  4C3Q A;  4DF6 A;  3NBL A;  4XXR A;  1MY8 A;  2H0T A;  3W4P A;  3ZCZ A;  5KSC A;  3Q82 A;  4OOY A;  4QY5 A;  1SHV A;  3MZF A;  5J8X A;  4S2N C;  4R23 A;  3M6H A;  3DW0 A;  5IHV A;  4N1X A;  2Y2P A;  3OZH A;  1RCJ A;  2XR0 A;  5CHJ A;  5HL1 A;  4BL2 A;  3BFG A;  3M2K A;  4KZB A;  1NJ4 A;  1WYC A;  3GVB A;  2PBY A;  5EVL A;  4C75 A;  5A92 A;  4KZ8 A;  1ZC2 A;  3ZG7 B;  3A3F A;  4H8R A;  1K55 A;  5HAR A;  4BLM A;  5FAT A;  2BLS A;  2IWC A;  5CGX A;  5EVI A;  1SCW A;  4EV4 A;  3IH8 A;  3P98 A;  3W4O A;  2OLV A;  4S2J A;  4E6W A;  3WRZ A;  4UA7 A;  3VFH A;  4KZ4 A;  4PM8 A;  5E2E A;  5FAQ A;  1IKI A;  1DY6 A;  3QNC A;  1M6K A;  3SH7 A;  2XLN A;  1MWS A;  3MFD A;  3BEC A;  3UPP A;  4GNU A;  4E6X A;  2ZLY A;  3M6B A;  3LY3 A;  1LLB A;  4P85 A;  3Q07 A;  5CHM A;  4B88 A;  3V3R A;  5EOE A;  3HLW A;  2C5W B;  1MWR A;  3ZVT A;  4X68 A;  1KVL A;  2EFU A;  1Y54 A;  4E3I A;  4JF4 A;  4R4S A;  5GLA A;  4D2O A;  4BEN A;  3I7J A;  4Q8I A;  5F1F A;  1PW1 A;  2PU4 A;  2XFS A;  5F83 A;  1YT4 A;  3VSK A;  1Q2Q A;  5CER A;  4DKI A;  1GA9 A;  4KEN B;  4S2O A;  3MXS A;  3LCE A;  5EUA A;  3VP0 A;  4S2L A;  5DF9 A;  3BYD A;  3A3J A;  4X6T A;  5G18 A;  1H8Z A;  2WKI A;  1BUL A;  2XF3 A;  4KZ9 A;  2CC1 A;  4E3M A;  3NIA A;  1YLT A;  3BLM A;  2WKH A;  2ZC6 B;  5HFO A;  3PAE A;  2Y2I A;  3VP2 A;  4OKP A;  3O88 A;  5CTM A;  1IEM A;  4ZJ2 A;  1XXM A;  1RP5 A;  2Y2J A;  2X71 A;  1YM1 A;  3LEZ A;  3SH9 A;  4DDS A;  1ERM A;  1W5D A;  4KZ5 A;  1WE4 A;  3QNB A;  4BD1 A;  1E25 A;  3IQA A;  1PWD A;  1SKF A;  4LEN A;  1N9B A;  3OPR A;  2XDM A;  2E8I A;  5FA7 A;  2UWX A;  4WZ4 A;  3G34 A;  1ZG4 A;  4OQG A;  3BEB A;  3C4P A;  3ZG0 A;  4X55 A;  4BQM A;  1HZO A;  3RJU A;  1IYQ A;  4CJN A;  5JYP A;  1L0D A;  3UNW A;  4WYY A;  1XX2 A;  4R0Q A;  5F82 A;  4N9L A;  1MPL A;  4GB7 A;  5FQQ A;  4P0M A;  3WRT A;  4IBX A;  3TOI A;  3VP4 A;  2JCH A;  3ITA A;  4EWF A;  4RX2 A;  3VOZ A;  1FR1 A;  2Y2H A;  2XQZ A;  4OPZ A;  5CGW A;  4GOG A;  4U3T A;  3ZG8 B;  2WAF A;  4KQQ A;  1YMS A;  5GLD A;  4GDN A;  5CEC A;  2ZD8 A;  3UDF A;  1K4F A;  3V50 A;  5EPH A;  1K57 C;  2V1Z A;  5U47 A;  1YMX A;  1K6R A;  3CG5 A;  5DVA A;  2WUQ A;  5FDH A;  1EWZ A;  3IXD A;  1KVM A;  1YQS A;  2ZC5 B;  5HAI A;  4CPK A;  5HAQ A;  5TGF A;  4HEF A;  1GA0 A;  5FI7 A;  4WBG A;  4QY6 A;  1KE4 A;  1TDL A;  3BFE A;  3C7V A;  3IHA A;  5CEB A;  3UY6 A;  4UA6 A;  2HPB A;  1ERO A;  2Q9N A;  4IED A;  3PBQ A;  1K56 D;  4Y0T A;  4OQH A;  2V20 A;  3Q7V A;  5FAP A;  4PM9 A;  2EX9 A;  1S6R A;  3GV9 A;  5KSH A;  1XGI A;  5FAO A;  1J9M A;  3A3I A;  1HD8 A;  4IBR A;  1KE0 A;  3ZNY A;  2G2W A;  2H0Y A;  1TDG A;  1H8Y A;  3E2K A;  3ZG5 A;  3HBR A;  4BD0 A;  3HLD A;  3NCK A;  2DNS A;  2WAD A;  2JBF A;  4U0X A;  4WEL A;  5I94 A;  2I72 A;  3Q1F A;  1YLJ A;  4LV0 A;  4PPR A;  2Y2L A;  4E3K A;  1K6S A;  5E2G A;  4F94 A;  3HUO A;  1C3B A;  1PW8 A;  4DE1 A;  1K57 A;  4X53 A;  3ZFZ A;  2OV5 A;  4A5R A;  4B4Z A;  3HUN A;  4O7D A;  4K0X A;  4JPM A;  5EVI D;  5GHZ A;  1SDE A;  2J7V A;  4OON A;  3IT9 A;  2ZM0 A;  3HL9 A;  1YLY A;  1KDS A;  2EX6 A;  3FZC A;  3BFC A;  3MZD A;  3W4Q A;  1FSY A;  4WEJ A;  1L0G A;  3IF6 B;  1Q2P A;  1FCM A;  1Z6F A;  2Y2N A;  3VSL A;  4PM5 A;  4OQ0 A;  1L2S A;  5E2H A;  5CTN A;  5EOO A;  3LY4 A;  2OSU A;  1BZA A;  3N4I A;  4RA7 A;  5DF7 A;  2QMI A;  3OPL A;  1XA7 A;  2ZC7 A;  1VQQ A;  2P9V B;  2ZMA A;  4FH4 A;  2J9O A;  3ITB A;  1KE3 A;  1NYM A;  2HDR A;  2HDQ A;  2EFX A;  4JXS A;  2H5S A;  3G2Z A;  5FQI A;  2FFF B;  1BLP A;  2FFY A;  1XA1 A;  4S2N A;  2J8Y A;  1AXB A;  2XD5 A;  2Z2L B;  1BLH A;  3WS1 A;  2ZQ8 A;  4OLD A;  3O87 A;  4R3J A;  2ZM8 A;  3G30 A;  1QME A;  3HLE A;  3HLF A;  1LHY A;  1PIO A;  3HLB A;  2Y2O A;  4MBH A;  4ZAM A;  3N8L A;  4OOL A;  3D4F A;  1NRF A;  3IHB A;  1NY0 A;  1EI5 A;  1BTL A;  3NI9 A;  3O86 A;  3UE1 A;  4DXC A;  1NZO A;  4UHU A;  5FI2 A;  1TEM A;  2HDS A;  2ZQA A;  4OPY A;  2A3U A;  5M19 A;  4RVA A;  3GTC A;  3IWO A;  1NYY A;  4WMC D;  1K54 C;  3SOI A;  2JC7 A;  4KG6 A;  1N4O A;  4U0T A;  3TG9 A;  5F1G A;  3S4X A;  4JLF A;  4OQI A;  2C6W B;  4E3O A;  1KGG A;  1E3U A;  2G2U A;  3CMZ A;  4BL3 A;  4OOM A;  3AGF A;  3SS3 A;  2Q9M A;  3G35 A;  4JXG A;  4NK3 A;  2WGV A;  1ES2 A;  1GCE A;  1GHP A;  2WZX A;  3RXW A;  2J9P A;  3UO9 A;  1JWV A;  3W8K A;  1XGJ A;  3FWL A;  3EQV A;  3VOY A;  3N6I A;  2Y2Q A;  1I2S A;  3B3X A;  4HBU A;  3N8R A;  4BJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...