4IDHA

Crystal structure of the large terminase subunit gp2 of bacterial virus sf6
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
463
structure length
451
Chain Sequence
SINPIFEPFIEAHRYKVAKGGRGSGKSWAIARLLVEAARRQPVRILCARELQNSISDSVIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGIDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTKVEMKQKLGIPSPNLADALMMCMHCPALVREETEIYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gene 2 protein
publication title Structures of the phage Sf6 large terminase provide new insights into DNA translocation and cleavage.
pubmed doi rcsb
source organism Shigella phage sf6
molecule tags Viral protein
total genus 166
structure length 451
sequence length 463
ec nomenclature
pdb deposition date 2012-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04466 Terminase_3 Phage terminase large subunit
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4idhA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4idhA01
2Q3FA 2R8RA 4MRSA 1HE8B 5G53C 4Q1CA 4TLDA 1SULA 1G8YA 2JIZA 4GNKA 2KBEA 4PPNA 4DSOA 1W44A 4QKQA 4RFSB 2GAAA 2D4HA 5L8VA 4M4SA 2W6JD 3P26A 1R0ZA 2GETA 1UEJA 2XOKD 3KUCA 3TLXA 3AVXA 4X8OA 1KDPA 4QJ4A 1R5NA 3K1JA 2VH5R 2VP4A 4A0HA 5FPKA 1OKKA 5JWRA 2IUSA 4I1OA 1SZPA 4XOIA 4L4UA 2JLQA 1XTIA 1GUAA 2HT1A 3D6TB 5EP1A 3B60A 5JSZB 3GLIE 4PZYA 1WMSA 2NTYC 3AKEA 4NYMR 1LV7A 2A5JA 2ZVPX 2W6ID 2QRNA 1OH5A 1W2GA 2OFXA 1RC8A 2ZIAA 3FKSD 1NNEA 2PZGA 1NLFA 4MITA 4I1VA 3F8TA 3KXIA 1OFHA 4YMUA 3BE4A 3C7KA 5LPNA 3OIYA 1ELOA 2IF2A 2XB4A 2ASEA 4QGFA 3CR8A 4W9MC 1GFIA 1R0YA 4TN1A 1XZPA 2ODNA 3PEWA 2QMUA 3REGA 2CCKA 4A2PA 2W2XA 4OK5A 4Q21A 5GJCA 4L15A 1GL9B 3CWZA 2PMDA 2QA5A 1G4UR 2FZLA 2ZJOA 4NH0A 4NCIA 5FBQB 4BECA 5CYPA 3THXA 2NIPA 1TU4A 2GJAA 3LAWA 4D26A 1Q1ZA 4JLOA 2IYRA 3WBJA 3KJGA 3MRSA 1Z0AA 2JCSA 4IEEA 3RSLA 2YOFA 2PCJA 3V9PA 4DBLC 4M1KA 2J7PA 2NPFA 1X6VA 3I5YA 2V55B 3HPQA 4GOXA 4M2LA 4CYMA 2R6AA 2IX3A 4CGZA 4KBGA 4YC7A 2A30A 1M1YE 3MGCA 1DG1G 4HB4A 1G8PA 2QPTA 1MV5A 4B6FA 3AEZA 2ZR7A 2O0HA 3QQ5A 1J70A 2J0UA 1E79A 1AKEA 1W4BA 2R9VA 1AQYA 3PENA 3LW8A 5EE5B 4C7OB 3B1XA 4O0MA 3EZ6A 1S0UA 4XD7A 3KB2A 1D6JA 4HLCA 3WMGA 1SKYB 2DR3A 1HH4A 2O8DA 3CX7A 1IY0A 4R71A 4A0RA 3SZRA 3SBDA 1Q0UA 5M04A 3EXAA 2H5EA 3QKTA 3A6PC 2B92A 1Q12A 2RGAA 2I3BA 5EE3A 2HDNB 1XDBA 4XH9B 5IRCD 4B76A 1S1MA 4M1MA 1NSFA 1IAQA 1KY3A 4RZ3A 2YWFA 3QVUA 2REXB 3CRRA 3K9LA 4V0KA 4YXWD 2ZM5A 2DFTA 3BOSA 4HB0A 2QPOA 2N46A 2YYZA 2ZI6A 4Q4AA 5SZIA 3GFTA 3BS4A 2PEYA 2V4ZA 3DPUA 1YZTA 1D5CA 4G1UC 3LWNA 4KBFA 4K8OA 3TR0A 4DLTA 4GL2A 2CJWA 1HQYE 3CW2A 1QHSA 3CRMA 2XXAA 2WWGA 1SKYE 2FNAA 4IXMA 4ZDIA 2QUZA 1DELA 1U2RA 1WP9A 5G40A 4DCUA 1NF3A 2AWNA 4JL8A 4OHYA 4M9QA 2CCGA 2GCNA 4ZI3A 5KUTA 4B3XA 3KQUA 4FCTA 4WW0A 4JL5A 1IBRA 2ZS7A 4O2RA 2J45A 5DI9A 1VTKA 4TT3D 2GZAA 3NG1A 1KDTA 5JRZA 5JJKA 2JLZA 2AN9A 1U0LA 2OEPA 3VKHA 2J46A 4Q7MB 1LW7A 4DSNA 2BCJQ 4P0TA 1IQPA 2ZJAA 5KTYA 2GZHA 2QP4A 1UKEA 1KTVA 1YR6A 3IILA 3V00A 5J5CA 1LY1A 1DAKA 4BFWA 3ZQJA 4LJ5A 3BB3A 2ZRGA 1XJ0A 2WPDD 1G7CA 3FFBA 2OM2A 4LDJA 2QQ0A 2GVDC 4GPTA 1ZIOA 3WP0A 1P3JA 3KQLA 3VR5A 4M9XA 1R5OA 1AS2A 1XMJA 4BEJA 3TW8B 5BN4A 4C30A 2HYIC 1CIPA 4NTZA 2D62A 2V1UA 3QXJA 5KSZA 4TYWA 3L8YA 4HAWA 1XTKA 4KYUA 3GLHA 2RMKA 1SVIA 3LV8A 3THXB 3AGQA 2J0SA 5D3QA 1ZM4A 5CK4A 1NVUQ 4FXPA 5FOSA 2ONJA 4GT1A 1I2MA 1SVLA 4PO9A 3L0PA 4Z8XA 3HP1A 4LYFA 4QNRA 1FMLA 1G17A 2BBOA 3D3QA 1W48A 3IIJA 4EDHA 2DWPA 3FDIA 1V43A 3R8FA 2YOGA 1G9XA 2C2HA 4Q02A 2YINC 1NL3A 3ZJYA 5E7IA 2ZJYA 1RW4A 1QVRA 1AS3A 1SXJA 1N6IA 4EPWA 2QROA 1PLLA 3RVBA 2H8KA 4BWYA 2IYSA 2I1QA 3K0EA 3SEAA 3W5IA 2P5TB 2FE4A 1KKLA 1HY3A 2J0UB 4LJ4A 5EZ6B 4J0QA 3T06B 4B2IA 3LVRE 1SXJC 4B2LA 4R2IA 1Q1BA 1N5IA 3IQWA 3WHLA 1HUQA 3VU9A 3HYRA 3U3KA 3UATA 3A58B 1E4YA 3EPKA 4IDPA 2UKDA 2HLDD 4LBYA 2BBTA 4TLAA 4AG5A 2A78A 4ZV4A 4D4MA 3KKMA 1Z08A 1G7SA 1OYYA 2EU8A 2ZRPA 2ZETA 2FX3A 3NBXX 4A8JA 1TL7C 5AJWA 2AL7A 4KFRA 1AQUA 4JJKA 2XGJA 3KL4A 4AI6A 3U7HB 4HYYA 2J41A 2OFWA 2RGBA 4HAXA 1SHZA 3CR7A 2JEOA 1Z8FA 3Q5DA 1J90A 4G0NA 2VP2A 1P7CA 5JCPA 1WCV1 4Q9KA 4DUGD 2BMDA 1VCMA 4Q4AB 1JR3A 5HTKA 4ZKDA 1W1WA 3OESA 1EWRA 1R8QA 3IEVA 1LB1B 4ACAA 3HPRA 4TSFD 4GRAA 1T8TA 2CJWB 3UG6A 2RAPA 1UBEA 4I1SA 4A15A 2XXAB 3LA6A 3I62A 5BYJA 5ANRB 1NIPA 4DVGA 5JWHA 2IEYA 4KFSA 4MRNA 3ZDQA 5F2EA 3WYFA 3QXXA 2D2FA 4XWKA 4PSVA 2QP3A 2WKQA 1DADA 1HT2E 3TW4A 4D4KA 5FTJA 2A3RA 1YZLA 1KSGA 3QG5A 3D31A 4Z54A 2WJHA 4POAA 3X1DA 5FR2A 3LBHA 2FEMA 2GF9A 2JAQA 3UXMA 3QY0A 5DSZA 3RRMA 1VG1A 3ADCA 2ZVQX 6Q21A 2OE2A 5JLJA 5EP2A 2VSOA 1IN4A 2G3YA 2QM7A 1W49A 1E0JA 2ORVA 2RKOA 3Q85A 3W9YA 4DRZA 4DZZA 1E2EA 3GJ0A 4PC3A 5EE1A 3SYKA 2X19A 2QGZA 4LOAA 1DEKA 4C0AC 4M53A 5FTKA 1M6NA 4EJSA 4OI2A 1FP6A 1G19A 1W47A 4Q4JA 4TLBA 2C8VA 3L43A 2XSZD 1YR7A 4HDQB 1II8A 4KFUA 1IN7A 3ZVLA 2AXNA 2J7KA 3KFVA 1QDEA 3TUIC 1E32A 1P9WA 1QHGA 2QMOA 2FGKA 1Z2AA 2G77B 2TMKA 3TSWA 1GNRA 2GJKA 4JS0A 3GLHB 2C95A 1W5TA 2CK3A 3IKJA 1S2MA 3GEIA 3X1YA 4B34A 4BGDA 1ZUIA 3OF5A 5E7MA 5M1KA 3DO6A 3VNVA 1WE2A 4TWZA 2OG2A 3VKWA 1P4SA 2JDID 4OBEA 5GVSA 1UM8A 1DAGA 4PZLA 4DHEA 1BKDR 2XJ9A 3GJ6A 3UG7A 1SXJB 4BE7B 2ZRBA 4UKDA 1GILA 2ZUBA 4BFTA 3PUXA 1Z22A 3QG1A 5K8IA 2FZ4A 4C0HA 1B0UA 1GNPA 3K9HA 2ZITA 4BZXA 4JLPA 3RHFA 4NYJQ 1ZMXA 1G291 1ETUA 3OAAD 1ZM2A 3QKSA 4HAZA 3SC3A 4DSTA 1CR4A 1OB5A 2Z0MA 1D2EA 3GLHE 1Z06A 1KDRA 2GCOA 3K70D 3VU9B 1G3QA 1OXTA 2PCLA 2QRZA 2OCAA 1F6BA 2D7CA 2YZ2A 3MWYW 2AD1A 2WOOA 3O47A 4TTQA 3B5JA 3WMEA 2ERXA 5DYIA 1KJWA 2CL6X 2FSIA 3THYA 4XVQA 3GJ7A 2WHXA 4JBXA 1XMIA 3U7FB 1U94A 521PA 3OHMA 1KO1A 1QHNA 1R8SA 1YR9A 1T0HB 2QMEA 3FE2A 4CIDA 1SXJE 4EPXA 2WV9A 4TL9A 4LJ8A 3KJIA 4WZBE 4NP6A 1G7TA 2JASA 4LBWA 3VR2A 1R0XA 3VHXA 2F9MA 1NRJB 3AF0A 3GFOA 1JI0A 1KI6B 1P61B 4D0LB 2VHJA 1E2GA 1H8ED 3ZS8A 1BIFA 4NCJA 4IOMA 1JAIA 5CIQA 4IJMA 2WBLC 3HWSA 4CT4B 5EZ5A 5CJ2A 1NLZA 4L9SA 3LLMA 2Z4RA 1E2MA 1GP2A 2MSEB 4US0R 1A7JA 1RZ3A 2JJ2D 3FGNA 3SHFA 4GP6A 1G3MA 5EXPA 2EFHB 3GJXC 2A5DA 4JL6A 3S1AA 3WY9A 1F5NA 3MWKA 3VKGA 4EFMA 3HDTA 1Z0DA 4QM7A 1VKJA 2CL0X 1G4AE 2VYFA 3I8XA 2PT5A 2XSZA 1VDZA 4F91B 4LWZA 5FUVA 2ZRMA 1QHXA 2D2EA 3CPJB 2J87A 3KDSE 1JBKA 1GG2A 1XCPA 2QN6A 1JR6A 5JS8A 1BO6A 2DFKB 4PC1A 1SQ5A 3C16C 4AYXA 3BH0A 2WAYA 1JR3E 1N0UA 4US2R 2X2FA 5FL3A 1N3BA 5CB6A 4PPGA 4H9GA 4RKFA 2OT3B 1WXQA 3E2IA 4RSGA 3ZGXA 3EG5A 4ZDWA 3W8RA 5F9FA 4TMZA 1C4OA 1P2TA 1Y3AA 3ICEA 4Q4HA 3ZZUA 1TU3A 2CVHA 1ZIPA 4TZ6A 4UNRA 2GXAA 4Z1MD 2OV2A 3QPVA 5KHOC 4TTPA 2C9OA 4LJ6A 3M0EA 4MYCA 2P6RA 3NC1C 4D4JA 4MGYR 4RFVA 5CM8B 2H7VA 4M1OA 3AM1A 2WICA 5FBWB 4C9BA 2OBLA 4ZCLA 1Q3TA 2CLDX 2GNOA 4Q5IA 1RVDA 4JVLA 1ZNWA 3QIAA 3FOZA 4X8MA 4IW3B 2ZAOA 1YR8A 2AR7A 2B8WA 1OH8A 1OE0A 2DWQA 3BFKA 1NMXA 4CZ2A 4XIGS 1NG9A 2EFGA 1RPZA 4AYWA 3B1YA 3I8SA 2VO1A 2XNDD 1R5BA 4EPYA 1A2KC 1ESNA 3B6EA 3JVVA 4GDFA 2G1KA 5TV2A 4FWIB 4DDUA 4Q9HA 1TF2A 1E9DA 2AD5A 2VF8A 2ZRFA 4IVQA 4RFSA 4IXNA 3SJAA 3B2EA 2IW3A 1N0WA 2D74A 4M0LA 3QKSB 3BH7A 4RCYA 1E6CA 4DDTA 3U4QA 3VX4A 1DAMA 1JXMA 1OIVA 2AFIE 4M9ZA 2V7QA 1EG7A 2GCOB 3W3ZB 4IVRA 2JLUA 3CRQA 2WJVA 1DAFA 2JLSA 1E1QA 2FJUA 4A6PA 1R6BX 2FPKA 2QPAA 2DFLA 3NWJA 3THYB 3FWYA 4G5RA 4HDOB 3QPUA 4LV5B 4UNNA 2BIFA 2JIZD 4AIIA 5KPDA 1ZNZA 1NG1A 4UNQA 4E22A 4ZDKA 4XTCS 2KWIA 4M1TA 5LDDC 4NCKA 1QRAA 2YWEA 1W0JD 2V6IA 1J7KA 1U98A 4HSEA 1OKKD 4QHSA 3BBPA 3G82C 1Z63A 2ZR0A 2ODBA 5E3HA 1T5LA 3ZVMA 4TYPA 4D80A 1GRRA 4EPVA 1E2NA 3CO5A 4PHTA 2BCGY 1NSTA 1JQJC 5GJVC 1Z07A 3A1WA 4P4TA 4IDHA 5DE3A 1S3SA 2FSFA 5BQ5A 3B85A 3S1AB 1N25A 2F43B 1A2BA 4KLZA 4PAMA 1XPOA 3W3AA 4G5OA 4P32A 1KKMA 1NVWQ 2EYQA 5AUNB 4A92A 4GSYA 4PHHA 1P72A 2ZR9A 3NHBA 3DOFA 2ERYA 3EPLA 3CLVA 1KI3A 3QBTA 2Q21A 1M7BA 3CNLA 4Q4LA 4MRPA 3GCGA 4HAUA 2IYXA 4LJ9A 2CBZA 3C6HA 5AR1A 4XWAA 4PXAA 4RD6A 4F4CA 1FUKA 4URWR 4QXAA 2Q0HA 1IXSB 4BEBA 4Q4HB 1ZJ6A 3PG5A 5UKDA 3T34A 5JECA 2HJVA 3AKYA 4PSKA 3AV0B 2ORWA 1V5WA 2ZE5A 4NU0A 3ZQ6A 3EASA 2IYWA 3I1FA 1IONA 4B6EA 3R9WA 1XD8A 2V54A 4NYIR 3LQRA 1KK1A 4YLGA 4QG7A 2JLYA 4GZMA 1F2UA 2RGNA 1FX0B 3AF3A 1MRNA 3LD9A 4NYMQ 2W58A 4D4LA 2ZYUX 3H1TA 4A6XA 1XD2B 4PZZA 5HKKA 4B3GA 3TSZA 1LS6A 3MMPA 4HLUA 1H8HA 2ZREA 1E79D 3FYHA 2GESA 3BGWA 3MWJA 1YJ5A 1QZXA 2FG5A 2GAOA 2VP0A 2RCNA 3BB1A 3NKVA 2RGNC 3DHWC 2YC2C 4XD7D 1ZUNB 1LFDB 3M1IA 5AK0A 1Q44A 2MSCB 3SE0A 1OT3A 3FKQA 2WMOB 1Z3IX 1GAJA 2OCBA 3PR1A 4HLUC 5FOVA 4BZQA 3F5FA 5GJWC 1K5DA 5CYOA 4B75A 1G41A 4KV9A 3T61A 2HT6A 1GKUB 2AWOA 3EZ2A 4ZO4A 5CDFA 4MKIA 3PEYA 4ZIRA 1CULC 3K9NA 4DWJA 5GJBA 1AS0A 1M74A 2LWIA 3BFXA 1GRNA 3U4QB 2CEAA 4UNSA 1W0JA 3TK1A 2C5LA 4LYJA 2F3RA 1DOAA 2XEXA 3A37A 4JJZA 5H68A 2HCJB 4MKFA 2ZPTX 2XTZA 2OLJA 1AZTA 2ZUCA 2IS6A 3U3RA 3NH6A 2C78A 5SZJA 2DHRA 2CMKA 3IBGA 2WAXA 4JLVA 2NPIA 4EPRA 5TARA 2XNSA 3VNUA 1JECA 1Q20A 4MA4A 4ZPXA 2BOVA 4GOKA 2FFHA 1HV8A 1VECA 4K81B 3RS5A 4BLPA 4NCNA 3KQKA 1N6LA 1JAHA 1CKEA 4RJLA 3LVQE 3SNHA 4L9WA 1YZNA 2FU5C 3TQCA 1YZGA 3U3OA 1Y63A 4KFTA 5E7JA 4A2WA 1EX7A 3LNCA 4AY2A 4YMTA 4OHVA 2A2ZA 5B2ZA 1QF9A 2OAP1 1OB2A 4LRWA 3THOA 1E1RA 2N42A 3T1QA 2ZRCA 3CF6R 4PHGA 1DTSA 4R2HA 3C5HA 1CTQA 1ZINA 5KNBA 4URXR 4DEXA 2BEJA 3OEHA 3WYAA 1LS1A 1E2HA 3AQ4A 2BMFA 4OKSA 2BKUA 2O5VA 1R4AA 4D6PA 1GL6A 1JALA 1AM4D 3VR3A 4BRUA 4DJTA 2GVZC 3ONWA 2REOA 3F3YA 4PSAA 3UPUA 2EFCB 3KQNA 1G18A 4E03A 5CM9C 2YVUA 2IXGA 2B6HA 2XX3A 3AUYA 4D0GA 4QGHA 4E07A 1KAOA 5L3RA 4QBFA 2F6RA 2B7BA 3MJRA 5LB2A 3SJCA 2ZYVX 1P62B 5EUMA 1W4AA 4ZKEA 2HCBA 5M1QA 2R2AA 4IDQA 2VSFA 1D9ZA 3T1OA 2OESA 5GADl 1F48A 1AN0A 2HEIA 4JVNA 1KK3A 2F3TA 1SXJD 4Q19A 2MSDB 5C4GB 4F92B 1NN5A 2DWOA 5TXGA 4M1YA 4EPTA 4V02A 4LPSA 1F2UB 4HLDA 3NBYC 4OK3A 4HB2A 5A5GA 2NO6A 2X2EA 1XBTA 3FVQA 3V4RA 2QEQA 2NQ2C 1UJ2A 4NDZA 1OXSC 4BLOA 3U60B 1UEIA 5DYGA 3H2YA 1Q1QA 2ZI5A 3RANA 4II7A 1VG0B 3ZVRA 3P4XA 5EQTA 1N6PA 3RC3A 3FTQA 1IXZA 3SU8A 4D81A 1J8YF 1DAHA 2AKYA 3Q7QA 3AP2A 2WTUA 3QVVA 2H18A 4YMWA 4URUR 1TTTA 4D0NA 3WNCA 3LRPA 2HXSA 4LV8B 2IHYA 1RRPA 1CJKC 2JLVA 1P2VA 1TF7A 4ZIRB 4ESVA 3ASYA 4YDHB 2VP9A 3I3SR 4OI0A 1XD9A 4UJ5A 1L4UA 3SS8A 2WKPA 4F38A 1MABA 5JBQA 2ZYWX 3FB4A 3PUWA 2Q9CA 4JLDA 1QG4A 5FOWA 3PFIA 2ZTSA 1JR3D 4GMDA 3WRXC 1TPZA 1JEEA 2ZS8A 4NPHA 3SFZA 4C4PA 1COWA 5CLQA 4HAYA 4ARZB 2GKSA 2QP9X 4WXPA 2WSMA 5LD2C 5CB8A 2FEOA 4NL4H 2WJGA 1TNDA 3TRFA 3ZH9B 1YVDA 2FPLA 1CF4A 2QAJA 3QF4A 3QPWA 1R10A 5C15A 4B2PA 3A36A 3PITA 2WWYA 1ZRHA 1XEWX 2X8AA 3WBKA 3I5XA 5JJIA 5IF9A 2A9KA 3QKRA 1WF3A 4DCSA 5CITA 2BV3A 3W90A 1KI7A 2KSQA 5CDFE 2XB2A 1NJFA 2N1BA 3PXGA 4DIDA 4XWOA 3N2EA 1GL7A 4LHZA 4G5SA 1GKYA 5EXSA 4RD0A 1DAEA 4FCVA 3NBZC 2BEKA 4H1VA 1KMHA 4YMVA 2QT0A 4PHFA 1F60A 2CE2X 1EX6A 1K5GA 2BDTA 1I4LD 3DEFA 4QBHA 4A0GA 4JKIA 5KNDA 5DIFA 2RGCA 4XVRA 1N6KA 5C46F 2R44A 4MQBA 3SI7A 5AUPB 3THWA 4X8LA 4HUQB 2XJ4A 1VCIA 4Q1BA 4A36A 1CR2A 4N1AA 1CJTC 1CRQA 2MMGA 5K8TA 4C2TA 4W5WA 3OZXA 1ZM9A 1W36C 2GILA 3I4LA 2J0VA 1KI8A 3CPEA 4ILEA 2F55A 2IYZA 3L2OB 1YQTA 2FOLA 2W83A 3NXSA 2QENA 2ZSAA 2GXUA 2ZUDA 4LCBA 2V6JA 4BPBA 1TMKA 2J5XA 1XEWY 1P5ZB 2CK3D 4PANA 3OEEA 4B32A 4OHWA 2ZE8A 1FNMA 4JLBA 2K5UA 3VMFA 2AXPA 3CPHA 4KLNA 1E99A 1YZUA 2RGDA 5J4HA 2WSSA 1IXRC 1RRCA 4TLCA 2IA5A 4Q7JB 5K8UA 2BMJA 2ZI9A 4KSCA 2HYDA 5TB5A 2C77A 1T8UA 2ANBA 1BOFA 3DMDA 2ZE7A 4AK9A 2VLIA 4QM6A 1Q21A 1XCGB 3QEJA 1G64A 3U3MA 3VHLB 2AX4A 2Q9BA 3OE7D 5KSOA 4FINA 2ZI3A 5JZVA 1FOEB 5HR5A 1M7HA 3KTAA 1E0AA 4KCGA 3ZVNA 4A0FA 5C2FA 3IIKA 1SVKA 1WBBA 1MR3F 2AKAB 4W5JA 4LY6A 4Q1DA 3GLFA 1KI6A 2OCPA 2WWXA 3D8BA 2YKGA 1GKIA 2BKEA 1K8RA 3L0OA 2QI9C 1RJ9A 3A4MA 3KKQA 4IOKA 4S35A 1DO2A 4UXHA 4H1UA 5EE9A 3RLFA 3WXMA 3EPJA 3U44A 4MRRA 3AF1A 4TMWA 1AK2A 1T3HA 4JBWA 4OHZA 5JFGA 4JLJA 3M4YA 5LD2B 4U5XA 5E95A 4LHYA 3IIMA 2W0MA 5BW8A 3AVOA 2IWHA 2JATA 5FL7A 4DLWA 1MABB 1MO6A 1Z6AA 2VHTA 3TVTA 3U7EB 2Z43A 4FN5A 3T1TA 1RE0A 1GIAA 2WWHA 1ODFA 5EP3A 5JEDA 4B43A 5HZHA 3AKDA 1XXHA 4TYYA 1G3IA 4G3XA 4R98A 4IDNA 2ZI4A 5FBLB 3CRVA 2I4IA 3SDZA 4DIEA 2WJJA 3QF4B 2PEZA 2B8TA 5SZHB 3QKUA 3QKRB 1N0VC 2O8EA 1S9DA 1WRBA 4LBZA 2WMNB 2CHQA 1N5LA 4IFEA 2VF7A 5FUWA 3MUFA 1I4TD 3LDAA 5FTNA 4ZCIA 4DLYA 4BLQA 1KMHB 2QG6A 3C15C 3GEHA 3A1UA 3CZPA 1W36B 4FW9A 1KO7A 1X8KA 3MAAC 1NMYA 2IYUA 1T4GA 2PL3A 3B1ZA 1HQCA 4PAOA 1GVNB 2HXYA 5DHAA 2X1VA 1WQ1R 5L3SA 1I2DA 2HUPA 2VRWA 5B64A 1VHTA 4A9AA 2R65A 3THWB 1U99A 1HT1E 1A1VA 1SVOA 2OO7A 3JZMA 1XU4A 4QGGA 1CEEA 1DBSA 2VL7A 4MYUA 2A5YB 1D2MA 2VTKA 4FMCB 3UMRA 3HR7A 3KJEA 4DDVA 2FGJA 1G1MA 3MD0A 1MRSA 1XPUA 2FSGA 1W0KA 3AF2A 4AD8A 5CLLA 1X1RA 3OE7A 3QUSA 3P32A 4JLMA 4LI0A 4F7WA 3Q7PA 4RZ2A 1T5IA 1VHLA 4HLQB 5J40A 1UKVY 4LHWA 3T15A 4GP7A 4CW7A 2CL7X 2FF7A 2CXXA 1CJVC 1P73A 3N70A 5C1BA 4JKYA 1XX6A 2WKRA 3U6KA 5G3YA 1TADA 5K8LA 3AVTA 4DCTA 4TL6A 3AVUA 3DM5A 3I92A 1N6NA 5KYKA 2CHGA 2ZJ2A 5HE9A 3GD7A 1Q57A 3WNDA 1NP6A 2ZRNA 2XITA 3DM9B 3FMIA 3PVSA 1EGAA 3B8HA 3EIEA 3WRYC 3LW7A 5BYKA 3W6OA 1B23P 3B9QA 1M8PA 2YOHA 4PC7A 1L7VC 1MO5A 3KTAB 1W46A 1VYUA 4NCHA 2NZ8A 3WHKA 2V7QD 2GEUA 2CHVA 1L8QA 2QSYA 2FDCA 2KE5A 2OZEA 3GLFB 3UWKA 1QG2A 3P1JA 2L0XA 2QTFA 1E1QD 2IYLD 2ZSEA 5KDDA 3IPXA 4WVFA 2HV8A 4WOPA 4IDOA 1F3OA 3ND8A 3TE6A 2XTNA 1RJ9B 4MUBA 3PUYA 4M1SA 4TYNA 3U44B 4ON9A 3EW9A 2E87A 5LB4A 3JZAA 3T35A 5JI3E 3CB4A 3A1SA 5FOXA 5FH9A 3AVWA 1AJEA 1VYTA 2F43A 1YZQA 2W2VA 5FOTA 3X1WA 3K09A 4RD2A 3RRZA 3V4FA 2G83A 3QNUA 2B21A 5J4YA 2D7DA 1U8YA 821PA 5JEEA 1C1YA 2F1RA 4HAVA 3B82A 3TAHA 1FPMA 1XXHB 4DDWA 4XSGA 3K09C 1R2QA 5P21A 3GLFE 4LYAA 2OCYC 4O2LA 4PQRA 1IM2A 1KSFX 5H1YA 2FFQA 3CKLA 1EESA 2O8EB 1ZC3A 1Z6GA 1WB9A 4B33A 1OPXA 1A82A 3MLEA 4XSHA 4LGMA 3SR0A 1OHHA 5KNCA 1X3SA 3QXSA 1Z83A 1NN0A 2PLFA 1HEIA 2BBSA 3W6NA 4JVMA 4F4IA 3WP1B 1FX0A 3CZQA 3HR8A 1A4RA 1FW6A 1GSIA 3LH5A 1KO5A 3RAPR 3QENA 5EJEA 1XD2A 4LK2A 4CT5A 5BN3A 4RD3A 5KDLA 1DARA 3MG9A 1H65A 2V1XA 1KI2A 1EFCA 3QXHA 1XXHE 3EARA 4JSTA 5L3SB 2WWIA 3ZYCA 4GOJA 3AP3A 4JIMA 3RABA 2W00A 3LFUA 1P75A 1E0SA 2ZSBA 4CEIB 2IXFA 3C5CA 4P4SB 2PX0A 2IBMA 4IHQA 3RS7A 4BASA 4C0KA 5JMTA 1E2LA 1ZU5A 2W0SA 2D3WA 2G6BA 2UZ3A 5IHPA 1F2TA 2G88A 2PJZA 4G01B 2HF9A 4CEJA 3ND9A 4Q1FA 2JJ1A 2FN4A 4DEYA 1P2UA 4Q1AA 4YDSA 1UBCA 2Q3MA 2QMHA 3RS3A 1W4RA 1NJGA 3EWAA 5HKKD 1KI9A 3N2IA 1H8HD 3SJZA 4DB2A 1KO8A 1NKSA 3NTUA 4WIAA 3A1VA 2P65A 4MKHA 4Z51A 3K0CA 1NVVR 1ZU4A 4DT1A 2IS1A 3HJNA 1NY6A 1RYFA 1IJEA 3CF0A 1Q1EA 1IY1A 2GHIA 1ZNYA 3H4MA 1JJ7A 1JJVA 3NEJA 4DLSA 3BK7A 4F93B 4RZUA 1II9A 2E1RA 1XMVA 3LXXA 1PUJA 2BVNA 4XVUA 2ZS9A 3ZD7A 1E0KA 2Q9AA 3K0CC 5KPJA 1ZNXA 2NMVA 2CNWA 2FSHA 3O8BA 4B44A 3T1VA 3C6AA 4I81A 4B71A 3B9PA 3CONA 5DHFA 2HF8A 4KSBA 5CJPA 3ZZTA 4M21A 2WJIA 4IKEA 1IN8A 1ZM7A 2P3SA 5M1PA 3ADBA 3P20A 4EFLA 1EFRA 2BWJA 2QQEA 3NEYA 4WZ6A 1OF1A 2YWHA 5M1FA 4E09A 4TQUS 4KHZA 3TKLA 4NYIQ 1UDWA 2RGEA 1ZD9A 3EAQA 1UFQA 2W2TA 2AFHE 3GJ5A 4Q00A 1G5RA 4WAUA 4LJ7A 4BFUA 4HZUB 5C18A 1G8GA 5J4LA 2LKCA 4FWTA 1OW3B 4A82A 4ERNA 4JMPA 2RB4A 1T91A 1YU9A 1FTSA 3FMFA 4YONB 1G5TA 2HJGA 3FHOA 4UNPA 4DKXA 1KDOA 1AGRA 1E1RD 1XTJA 2PZFA 1JPJA 1MO3A 3AP1A 4KI0A 4WXRA 3RWOA 3UK6A 2GEVA 2IUUA 4C2UA 2IXEA 4AKEA 1FFHA 4LBVA 1HURA 4D2IA 1S9HA 221PA 1E9CA 3CBQA 3NIBA 3OEHD 2IYTA 4QNMA 3VR6A 2YC4C 2DFNA 2QSZA 2Q3HA 2VQSA 3IQXA 4LHXA 4LPKA 4QC2A 3R9IA 3SJBA 2OXRA 1X86B 2IC5A 3BJIC 1JEDA 3NVAA 1LVGA 4BFYA 1G5PA 2WIBA 1QHIA 3ZD6A 4AKHA 1T6NA 4BRWA 1KZ7B 1U0JA 3W34A 4HI0E 1T9HA 4RZXA 2OUKA 4FMCF 1E2KA 2ZAMA 3PUZA 4EIWA 1CBUA 2ZRKA 3KXKA 2LKDA 4PQFA 3EIHA 1TF5A 4HB3A 1EFUA 3HYTA 4Q66C 2O8BA 3FMPB 3MFYA 4ITRC 3R7WB 4U02A 5EXTA 1TEVA 1QVAA 4IFBA 2GJ9A 2BC9A 1VG9B 2BHRA 3DMNA 3PEVA 4KXFB 3H86A 3N5CA 1X1SA 2AK2A 2R6CA 2SHKA 1XJQA 3K8YA 4JLKA 1AA9A 2GJSA 3PEUA 1M34E 1O3YA 4GI7A 1BYIA 1E9AA 1DAIA 4UXJA 1FP7A 4R7ZA 3U61B 3RNLA 3P27A 1NN3A 1KO4A 3UIEA 4R9UC 2E9SA 1JXOA 3QI2A 1F2TB 4I4LA 2P2LA 4M1WA 4CEJB 2RHDA 3UKDA 1NBMA 2ATVA 3WYGA 3LLUA 2GXSA 3BB4A 3O8DA 2OSBA 2NOAA 2VPPA 3FFAA 1HTWA 4DLUA 1QHHA 1SVMA 5FPHA 3RS2A 3REFA 1WBDA 3RYTC 5F98A 3IO5A 5DGXA 4AKGA 3G5UA 3J81k 1J8MF 1N6OA 5KU1A 4MGIR 2JGNA 1OFTA 1M7GA 4M9SA 2ONKA 1E69A 2FFAA 4OI4A 3OFNA 5G41A 4F4JA 2GTPA 4DT1B 2J0QA 3BFVA 5AJYA 1ZBDA 4ARZA 1X8JA 2RH5A 1XNJA 4OQMA 3OIWA 2NZJA 3VQTA 1Z0FA 4NZYA 3AVVA 4Y0VA 1Z28A 3NDPA 1U9IA 3KQHA 2F1IA 2VP6A 1D8TA 4WZAE 2R6GA 4MDFA 1IHUA 4AKIA 2PT7A 3L0IB 4LZZA 5TDHA 2ZEJA 4PTLA 5FUXA 4OQNA 2OXCA 1ZCBA 1GZSA 1CJUC 5KOYA 4Q01A 4DCVA 3AVPA 1U9IC 1Z0KA 3EZ7A 1RIFA 2RHMA 5J4VA 2VIIA 5IT5A 4KO8A 1JPNA 1SGWA 1COWD 2WIAA 2OILA 1E2IA 1SVSA 2PX3A 2EWWA 421PA 4HATA 2V8OA 4TMVA 4GBMA 3DKPA 3TR5A 1OSNA 4NKRA 1ZP6A 1XZQA 3KKPA 1GTVA 3KB1A 4HUQA 5JJLA 4ABYA 1XTQA 4MDEA 4EKDA 4QHTA 1E3MA 4G5QA 1YZKA 2FA9A 4M8NE 4JBYA 4LSGA 1KMQA 1KZGB 2CVFA 1G16A 2F1HA 3K9GA 4ASUD 5DI3B 1CR0A 3UMFA 2J9RA 4TTRA 1WDTA 4OQFA 5AWFC 2OFOA 1PLKA 5FPYA 3FMOB 5J4KA 4OQLA 1E98A 4CRWB 1RYHA 5GVRA 1KGDA 3CX6A 3RDPA 1IY2A 1W36D 4JT2A 1G20E 3QEOA 2FWRA 2ZROA 2ORIA 3SQXA 4QGAA 4WA7A 2XZLA 1U90A 1E96A 2C9CA 5AUQA 3IPYA 2WJYA 3C4JA 3CF2A 3ZIAA 5LBIA 3I73A 2CE7A 2PJRA 3ZZ0A 1S8FA 1NLYA 1RRFA 4MYHA 2P0EA 2IL1A 4FD2A 2V3CC 2G1JA 3W6PA 1KSHA 2DY1A 1VG8A 1KSJA 4E5UA 3GPLA 3W8NA 4CVNA 1G6HA 4OL0A 4FMBB 4AC9A 1IOZA 1KIMA 3DVLA 2OHFA 2XAUA 2O8BB 5L3VA 2C98A 5IDVA 4DB4A 1XMSA 3B1WA 3BWDD 4GFDA 4ESHA 1XF9A 3EC1A 3OEED 4XTRA 1BMFA 3GLGA 1KJZA 3RRNA 2ZRHA 3T5DA 1FL9A 1KI4A 2WSSD 1VCOA 4LV6A 4BLRA 3EX7C 3L82B 2ZU0C 1MH1A 4KYIB 3SHWA 4PQYA 2KB0A 5L3QA 1CXZA 2OAQ1 3E70C 3TBKA 4BZPA 1CS4C 2IS2A 3OIVA 3LBNA 4DLZA 1HE1C 1AZSC 1XJCA 4Q7KA 4LHVA 5FBRB 2ZRJA 1UPTA 1JQLB 4TLEA 4QJ5A 2IF0A 1UKZA 4D82A 4BLSA 1Z6YA 2FFBA 3K0FA 3DKVA 4BUJA 4TYQA 2W6JA 4DCNA 1QHHB 4KJZA 2ZJBA 4IEIA 2XOKA 4OQXA 2DYKA 4FCWA 2YHSA 3ZLJA 3H84A 2BM1A 2WOJA 3KX2A 4V0NA 1XRJA 1P2SA 2VHQA 3E5HA 5J47A 1UAAA 2J59A 4UQOA 1GNQA 3BH6A 1MKYA 3QF7A 4G5GA 4TMKA 4PO1A 1OV4A 1Q3HA 4NHOA 3MSXA 4HUTA 4FMDB 3LXRA 1E9BA 5DNYB 1AKYA 2GRJA 2W6IA 4HZIA 1P60A 1UKYA 5B58C 2P5SA 4PFSA 3FKSA 3H0KA 1NMZA 1OH7A 621PA 1FTNA 3RS4A 2VHCA 5FTLA 1SKQA 1DE0A 1KHTA 1KAGA 5C12A 1GM5A 1T3SA 1VMAA 1P9NA 4LC1A 2ECKA 1IN6A 1NBME 4Q1EA 5AJVB 2KBFA 1OXXK 3I61A 2ZJZA 2ZYTX 4ASUA 5FL7D 2ZRDA 3KKOA 2QBYA 3SQWA 3IDQA 4C0SA 1OJLA 1R7RA 3KUDA 4OYHA 3MJHA 4M22A 2A5GA 1TQ6A 4OI1A 1XTSA 2RGXA 2EFDB 4I1UA 4V0MA 1ZVQA 1QHYA 1N2CE 3UANA 1GITA 4TMXA 2O0JA 5TVKA 1W5SA 2GCPA 4IRUB 2C99A 3DZ8A 2VBCA 3TMKA 2XZPA 2VHUA 4HDCA 3EA5A 4QBIA 3G0HA 2GZDA 4DLRA 2O8CA 3A4NA 2CLCX 2B7CA 1U8ZA 3RRYA 4EQ6A 1FMJA 4AYTA 1G21E 2BM0A 3CH4B 1U81A 4GMXA 2J1LA 1U8AA 2LCFA 4US1R 4QHYA 4TL7A 2EVWX 3DZDA 2Z83A 4DC9A 1XFAA 3ICQB 1YRBA 5DO9A 2NG1A 4OK6A 3CM0A 5EXXA 2QT1A 3SOPA 1II0A 1BH2A 2P6NA 5F9HA 4QFMA 1YRAA 4L5BA 4BFZA 4ZDJA 4C0BA 8OHMA 3EPHA 3VAAA 1MOZA 2PBRA 2R62A 3AF4A 1OIWA 1NIJA 1W2HA 3TIFA 3EIQA 3IHLA 4V0OA 5DH9A 4Q7LA 5KSPA 1Z5ZA 1NN1A 2PH1A 5HZKA 1TQ4A 2ZJ8A 5E4FA 1PVOA 3PQCA 2EFEB 4MRVA 121PA 1W0KD 2GEDA 2QY9A 3LX8A 2JLRA 5TMPA 1T0JB 1HYQA 4K46A 1KI1A 5M1NA 3K0AA 5BN5A 3TUJC 1FNNA 4YXWA 3W5JA 1ZYUA 3GLGB 3FHCB 3BAFA 3GJ4A 2BBWA 1Z6XA 5HCNA 2FMXA 1KYIA 2UZIR 2O8DB 3LQQA 4LYHA 3SYNA 3CUEF 3MWLA 1GRQA 1ESMA 4RY2A 5JWOA 5L3QB 3ZS9A 2O8FA 4OJKA 5EUQB 2CLSA 3SYLA 2EYUA 2A7QA 2WM9B 1CJMA 3K0FB 2QORA 1DS6A 4NONA 1RKBA 2G0TA 2ZQ5A 4B3BA 2BMEA 1NVXQ 2FV8A 4B74A 3LY5A 5HCIA 2AHOA 4A8JC 1Z0JA 2IYYA 4TT3A 4YMSA 1N6RA 4KITB 2C03A 4KODA 4PPFA 5FI0B 2FPMA 3GEEA 1AGPA 4N0EA 4PAQA 5FFMA 2XZOA 3GLGE 3ASZA 4B3DA 3HU2A 4L8GA 4CDGA 3ETLA 5FUYA 1NKTA 2H17A 4B47A 4IOLA 721PA 2NO7A 2NO1A 4DXAA 5SZKB 2IEZA 2WPDA 2Z6VA 3BC1A 4MGKR 2GK6A 3BD9A 1US8A 2F9LA 3BXZA 2OLKA 3QE0A 1ONBA 4KVGA 4MKGA 1S3GA 3RS0A 2UVQA 3EZ9A 4TZ0A 2NO0A 4NMMA 3VFDA 3T5GA 2AK3A 5HPYB 1EFTA 2ANCA 3Q72A 1GWNA 2QBYB 2QE7D 3IBYA 1KNXA 1E2QA 4JT4A 1CRPA 1TEXA 1LNZA 3X1ZA 2QM8A 1ZCAA 2YWGA 1P6XA 4QRHA 4EFNA 3EWSA 1FQKA 4Y0AA 1XB2A 2QNRA 3K53A 1P9RA 1JB1A 3CIOA 4C0JA 3NH9A 4FI3C 4ZI2A 4X8HA 4QL3A 2O0KA 5JCZA 1G3RA 2ZJ5A 2IHBA 3JVUA 2YJTD 2O8CB 4CEIA 1E9RA 1DG3A 4P4SA 2FH5B 1OHHD 4EQ6B 1KOFA 3TH5A 2Q6TA 5B57C 3KKNA 1XTRA 1PJRA 4EJSC 1Z2CA 1XEXA 4CEHA 5JI2E 5H8WA 1NI3A 3Q3JB 4LUCA 2F1JA 2DBYA 3FPAA 1YE8A 4UXIA 3UMSA 1G8HA 2MMCA 5ELXA 3AGPA 2JA1A 2WZQA 2CDNA 5KDOA 1EWQA 3L8ZA 1E94E 4V0ME 3LBIA 3NBFA 5F3WB 1U0HC 2GDJA 2HLDA 2G9NA 1XEFA 5C10A 3QJYA 1E2JA 2H57A 1XCMA 1OFUX 3RSOA 5JRJA 1VCNA 5C2DA 1OXUA 1L2TA 2GK7A 2R6FA 2WVJA 1ZC4A 3TQFA 2JJ1D 2CCJA 3KFXA 5AUOB 1DO0A 4OHXA 1KJYA 5KO2A 3KZ1E 5DLQC 4LX0A 1BYUA 4L16A 3B13B 2ODEA 1L4YA 3K0AB 2P6UA 2RGGA 1KNQA 4V0LA 1ZD1A 1VIYA 2OBMA 2C96A 4RKEA 2GA8A 4DUGA 3AB3A 3GP8A 2O52A 1ZW6A 1E2PA 2KJQA 5FR1A 1TUEA 3BRWD 4QBGB 1Z6TA 4BFXA 4BLTA 4FMDF 2C9YA 2QTVB 3X2SA 4TSFA 4A1FA 3E1SA 4TMTA 2VA8A 3R8CA 3QBVA 2O8FB 1VPLA 1BS1A 3KXLA 3VR1A 4A8JB 3B78A 1VIAA 4ACBA 3CNOA 2VEDA 3A4LA 4B73A 5DN6D 1TX4B 5B30A 3VR4A 3RWMB 1D2NA 1DPFA 5JS7A 1EXMA 2EQBA 4HZUA 2CNWD 4JLAA 1E9EA 1CU1A 4B3FX 4Q9LA 1G6OA 1CR1A 2IYQA 2JJ8A 2Z5FA 3UWOA 4UJ3A 3Q8XB 2QE7A 3U5ZB 1GDDA 1Z0IA 4QJ3A 2IYVA 1FQJA 2XTMA 1S96A 1EFRD 3AH8A 4BFSA 1Q22A 4I99A 5JHGB 3O8RA 1T3LA 3C8UA 1E9FA 4NYJR 4JLNA 1W4CA 3GQBA 3DL0A 2ATXA 4C0QC 4EAQA 3OIUA 4URVR 1SHKA 2IT1A 1US8B 4P4UA 3O8CA 2I1VB 3L0SA 5AJXA 4O25A 3IEUA 1TQDA 1IJFA 4LC0A 1OLOA 4S2EA 4Q9JA 5DISB 3DDCA 4DSUA 2X77A 1RFLA 3PCRB 5C4MA 3AKCA 5D3MA 2GBLA 1EFHA 5CK5A 1OH6A 1MO4A 2V9PA 4U7DA 4TQ9A 1OXVA 2IUTA 1N5JA 1NVVQ 1O87A 5HE8A 1ZUHA 5A4JA 1PUIA 4PR0A 2WWFA 5TY0A 1D9XA 1E2FA 3U6BA 2D06A 3QSYA 1FZQA 2Y8EA 2ZI7A 3R7WA 3PIRA 1LF0A 5A0FA 4RVCA 5FPTA 2GBLC 4PPQA 2H1LA 2REBA 2G0NA 4MYTA 4DLXA 1LTQA 4TL8A 4EJSB 2JLWA 3IHWA 4Q4JB 5FOUA 3QXCA 2ZXUA 1K6MA 2YV5A 2JDIA 2ZRLA 1I4DD 3A8TA 2Z4SA 4KVAA 1II8B 1YHNA 5EP4A 4Q03A 3GFPA 2QAGA 2IK8A 1G3UA 1FUUA 1YKSA 3LO5A 3EZFA 1TAGA 1XEXB 3GJ8A 4MGZR 4CEHB 2NGRA 2ZE6A 3KJHA 1ANKA 3ADKA 5G3ZA 1UF9A 3OAAA 4WBSA 2ZU6A 3K0SA 2WWWA 2H16A 5EE0A 2QAGC 4IOJA 3GLIA 2DB3A 3NDBB 1VYVA 2ZSDA 5IK2D 4KU4A 2H92A 1S4QA 4P33A 1C9KA 5M1OA 4QOSA 3TVDA 4JVSB 1LF5A 1X8LA 1UADA 3BORA 3B7GA 4GZLA 4NBSA 1WA5A 4PO8A 3TAUA 1N5KA 5KSYA 2VSXA 4O3MA 3I32A 1G8FA 4IVPA 1R0WA 2R6DA 3K70C 5DN6A 1W7AA 1M2OB 1ZAKA 3DOEA 1NBMD 3CH5A 4DLVA 1EK0A 3SBEA 3PJRA 4HEJA 3CX8A 4URZR 5FTMA 3B1VA 5FBVB 4RD1A 1QBKC 1KK0A 4RCZA 4B35A 1DVRA 4KAXA 4MH0R 3GMTA 4Q18A 4V03A 4CF7A 3LX5A 3TUZC 1H8EA 2KI5A 5JSZA 1OYWA 3OFND 4JYCA 3U7GA 1PZNA 1E2DA 2OBNA 3U2QA 2NO9A 3M6AA 4YQFA 1KK2A 3IUYA 3TNFA 1PV4A 4A2QA 1HA3A 3IGFA 4N0DA 4Q48A 3U3JA 2JJ2A 3GJ3A 3TSOA 2ZRIA 1UBFA 4C3ZA 3ADDA 4LJAA 4AWXA 2IS4A 4XJXA 2PLRA 1XP8A 2QL6A 3C14C 1AIPA 1N6HA 3NHAA 2IWRA 2BJVA 3SN6A 5H70A 3CNNA 3F0TA 1CLUA 3R9XA 4N3NA 5AJZA 3VX3A 1TUIA 1OIXA 5DI3A 1Z47A 3CWQA 2GWHA 4Q9IA 4B3CA 4AG6A 4PC6A 3BERA 4D25A 1E9SA 4W7SA 2A5FA 4URYR 4BQSA 1XPRA 1GOTA 1OFIA 3VTKA 1ZM3A 3TJZA 3QOFA 2GJ8A 1Z29A 1J99A 5JHHB 3TGPA 3ECCA 3D7MA 4Z1MA 3R20A 4C0LA 1IN5A 2ZSFA 3X1XA 3WNBA 5D3MB 1RRGA 2DCUA 2F7SA 2ZANA 3AVQA 5BXQC 1E4VA 3A1TA 3PUVA 3PV0A 4MUAA 4Q47A 3BIFA 1NY5A 3SFVA 2PZEA 2J3EA 4A4DA 1CP2A 1ZD8A 2VP5A 2QU8A 4LJYA 3WMFA 4EUNA 4B48A 3T12A 3HU1A 3CRW1 2EWVA 4JYBA 5BWMA 2C04A 4PC2A 4C7OA 1G7RA 2DPXA 3HU3A 5IK2A 3Q9LA 1TQ2A 3Q5EA 3ZIAD 3MCAA 3AUXA 2J7PD 1JNYA 3C41J 3P4YA 5CIWA 2EW1A 5FPSA 4RD4A 2XNDA 2ZRAA 3FHTA 2QAGB 1XWIA 1A5TA 4ZCMA 3IO3A 4BFVA 4Z8YA 2ODWA 3EA0A 5C2JB 1J2JA 3AVYA 4FIDA 4P31A 4U00A 2GF0A 1KY2A 1UDXA 4JZKA 1UBGA 3EC2A 2QGNA 4JSYA 2YNMA 4P3YA 4OJQA 4PX9A 4W5HA 5FI1B 3GLIB 4AURA 3NC0C 4NE2A 3K70B 1BMFD 1PLJA 2BJWA 2P67A 2QZ4A 2QTHA 2JLXA 3I72A 2GXQA 1MT0A 3RC8A 4TQAA 1S1CA 2PMKA 1SVWA
chains in the Genus database with same CATH superfamily
2Q41A 3JQBC 3G0BA 1TMYA 4BRDA 2GAAA 3P26A 4BCCA 1NM5C 5BR8K 2VH5R 4I1OA 1ZVVA 3FTNA 1RLOA 3WFIA 3L0QA 2WC1A 2ZVPX 3OPXA 2PZGA 3B36A 1PVVA 4EVQA 1ZFNA 2HMAA 4DTXA 3GEDA 1ZH2A 5AI6A 3IJRA 1XVVA 3UK0A 2GJAA 1M2GA 3LAWA 3DZIA 1Q1ZA 2Q8QA 5K4AA 1FFDA 4IEEA 3RSLA 4M1KA 2J7PA 4LDPA 2YYYA 4EO7A 3U7QA 3JXEA 4NARA 1N2OA 4NMHA 4HB4A 1G8PA 3KM0A 3AVGA 1DGQA 4X61A 4HMPA 4XCQA 4EHJA 3QQ5A 3PENA 3RVSA 4OFXA 3B1XA 4DHYA 3EIUA 1RT1A 4G26A 4BRSA 3VF2A 1ACJA 3DBHA 4R2WA 3IQGX 4CKYA 1Q8IA 4R1LA 1NJ5A 2EKPA 4M1MA 1W4LA 2GASA 3ZN2A 1DU4A 3RRFA 2Z3VA 4F06A 5SZIA 1P7ZA 3BS4A 3SIPA 5KZMB 3S28A 3EN0A 2WZBA 3DPUA 1D5CA 4M89A 4K8OA 3TR0A 2DQ4A 1QHSA 4JKOA 4IXMA 4LF9B 1TMOA 5G40A 4J0CA 2A58A 4WN9B 5C0OE 4B3XA 3FLCO 2BGUA 4O2RA 5JO0A 5DI9A 2C61A 1O6GA 1JUDA 2AN9A 4OJRA 2GYWA 3A6LA 4IDCA 4J16C 2C59A 2WPDD 1SURA 2D1RA 1YGYA 1VBFA 4NTZA 3QINA 4OHCA 3L8YA 1ACMA 3WYCA 1UXKA 2BSAA 1RAFA 5CK4A 3OX4A 1IPHA 5KQDA 4FXPA 4JX8A 4QNRA 2HV9A 3H7AA 3BMOA 4C8MA 1SBCA 4U8HA 5FT9A 4Q02A 1NL3A 4RZQA 3DJFA 1KE1A 2P9GA 2X8JB 4MROA 4TV9A 4RZHA 5EJFA 4IFVA 2AN3A 4FGWA 4PPYA 3LVRE 4LNUA 1MQSA 5KC8A 3VU9A 1T1GA 3KU1A 3K5IA 2UKDA 4ZU3A 2A8YA 3BGVA 2WT4A 5FOQA 3ZDYB 1ADGA 5BNTA 2VP2A 1QYRA 2NU6A 4Q4AB 2GPSA 2ZPUA 2CNKA 4DFMA 3IEVA 5KINB 3I62A 2I4LA 2BDUA 1NIPA 1YACA 4OHMA 4BE9A 5IWAK 2SICE 2JK1A 1QQCA 4CMIB 3ESZA 3QG5A 4V38A 5FR2A 5AM4A 3ADCA 4R79A 1JBEA 5E1MA 4Z99A 2VG6A 2JH3A 4YAFA 2QGZA 3AXSA 4LOAA 1DEKA 3L7IA 3V1MA 3GELA 1Q1GA 3H7IA 3MINB 4HWRA 1G5FA 3L43A 2PGNA 4KFUA 1RBQA 4QLAA 1YQWA 3KFVA 3P9NA 3PXBA 2XHZA 2J9GA 2VXCA 4B34A 4TT8A 4A5OA 4H4DA 3OJLA 4WX2B 4YY3K 3TSAA 4C04A 4KHPB 3MWFA 3UG7A 1UOEA 1Z22A 3K9HA 2IRWA 3V1QA 1ETUA 1UKCA 3MM4A 1O57A 4ER6A 4HQLA 1CNMA 4FXDA 1B1AA 1GZ5A 3ZD8A 4EUKA 2XHBA 3D6VA 2R2GA 2ADOA 1LDMA 8LDHA 3S6JA 2I55A 3FE2A 4Z49A 2JFNA 3PWZA 2C5BA 3LA8A 3UYLA 5KQMA 1V3VA 1BIFA 4W8GA 4JC4A 3V2GA 3JRWA 2J4DA 1D1SA 3LLMA 3EVEA 1ZRNA 2IHVA 4AN4A 1V4BA 2BFWA 3F3SA 2PQ6A 4K6FA 3HDJA 3SHFA 3VKGA 2QTDA 1SJ9A 3W04A 3Q7EA 1K2WA 2IJGX 3CPJB 1GG2A 1H1TA 3QU2A 3Q7IA 4PC1A 1X3MA 1RHQA 5CB6A 4PPGA 4ZAZA 1ZLXA 4FQ5A 5H59A 3A05A 3R0IA 3JS6A 4IUBS 4FLEA 5E3IA 2HHCA 2A1RA 1RQNA 1S9GA 5IYZA 1YBMA 2HNKA 4UREA 4PX5A 2VZ9A 1IKXA 1D1TA 2YZNA 1S2LA 4N40A 1Y8QB 4N5SA 5E26A 1ULAA 1RPZA 4AYWA 3VDQA 1P1HA 4LTDA 1R5BA 5TNXA 3JVVA 4GDFA 1TF2A 1NBWB 3N2NA 3VX4A 3ER9A 2XMSA 4G8JA 4A26A 3P5JA 5F5LA 2AI3A 3A1CA 1NUPA 3IS9A 4ZGGA 3GH3A 4E22A 5ILOA 3EDQA 4XTCS 5FHQA 5BMOA 4K26A 1MBZA 4BTEA 3AG5A 2ECQA 4JENA 2HU5A 3RBXA 3M5CA 1TM3E 2EKZA 3H2IA 4DPKA 2XB6A 4ONEA 3WGLA 1K8AO 5BQ5A 3Q87B 1K9VF 2KLBA 2PXHA 4A92A 1CDEA 4PHHA 4RWTA 1QKKA 2HWKA 2CY0A 1IIRA 3QBTA 1QGUA 4MPTA 4X1IB 4Z3OA 4KV7A 1MEOA 5HQTA 2YVQA 2I91A 1DJOA 3BXGA 5G1NA 2XMGA 3L1KA 1STOA 3LKDA 2VXYA 3G9QA 1PUXA 2V54A 3IELA 3TD6A 2WABA 1EI9A 2Z1MA 2LCIA 1AY0A 3LD9A 4B0PA 1NSYA 1H94A 4M42A 1LS6A 2C82A 4OB7A 2M1ZA 3NKVA 3ZLUA 1RDWX 5AK0A 3NRJA 1AMNA 4UTNA 2MSCB 3GDGA 1OT3A 3LZ6A 2Q3CA 4G2NA 1VRVA 5CD9A 4L5AA 5JDCA 3ZCSA 4K9RA 3C8HA 2UZ1B 1ATSA 3WLNA 4WJKB 2QY6A 5I9MA 2A9FA 2CMKA 3O3NB 1FMCA 1W35A 1ZZGA 1T9GS 4AJJA 2B5WA 3KQKA 2X5JO 3T9EA 1B6SA 4BJ3A 2GD2A 2D1QA 1RJGA 3I2GA 3OOSA 2XGGA 2BCEA 4A2WA 2GARA 3SXUB 7MHTA 3AVHA 4EYKA 4WDRA 3SKYA 4HX5A 1DTSA 1ZSNA 5DM4A 1N75A 5JPIA 3Q7TA 4BNLA 4KQ9A 1TB4A 4CK3A 1GL6A 3V1UA 3AEUA 5CX4A 3GC6A 1UT6A 4YAUA 4TN5A 4IDDA 4QDUA 1SXIA 4XIUA 3GBSA 3S55A 4Q3AA 2GELA 1SCAA 1P62B 5FRDA 5FHRA 4ZKEA 1A9QA 2VXOA 1D9ZA 5FJJA 2PLNA 1H3NA 1F48A 2QLNA 1NVEA 5E8RA 2XQJA 4CECA 4Q19A 4HX9A 2K87A 4EPTA 1KMCA 1HTTA 3NHSA 5FDFA 2Q0RA 3LZIA 3BQ9A 1HF3A 2PAFA 1ADFA 1AHPA 1YSCA 1D09A 1UOPA 3GLVA 2IU4A 1X9MA 1NONA 4KQKA 2HY7A 3UT5B 3AKZA 4G5HA 3RVDA 3ITKA 2NQ8A 1LWEA 1KE2A 5KWEA 5ELLA 1V8OA 2FP4A 4OP3A 1HG0A 4XIYA 4YI3A 5LD2C 4NPAA 4NL4H 4IJKA 3EUAA 3FLMA 2RDMA 4E31A 3A0UA 1ZRHA 5JJIA 4YCSA 1YMUA 4H0YB 1F1BA 4DCSA 1ZA1A 3BEOA 1KI7A 3GFRA 3NHFA 3NHYA 4DIDA 5L7TA 3T3PB 1PNOA 5A71A 2KFZA 1MDBA 4CTNA 3WLJA 4C88A 3C7DB 4IX1A 2X23A 2QT0A 4V19S 5KYYB 1I4LD 1LW2A 1QS0A 4KPGA 1O8CA 3K6JA 1J49A 4O55A 2GILA 3AM4A 1KI8A 4ISBA 3VZPA 2UUBK 1FIUA 1QIJA 2YQZA 5BVGA 1W8DA 1QCYA 1S1UA 4C21A 1BG6A 3FMGA 3OZCA 4CF9A 1JLRA 2Q1UA 4IHJA 1OVMA 4L8YA 4G4JA 2VLIA 4OX9K 1XCGB 3UXEA 5F7ZA 2R5FA 3H46O 2DT8A 3V6DA 1PBNA 1NYQA 4H6PA 3NM6B 3MECA 3SBXA 2IDOA 3MCZA 1A69A 2P68A 2VWJA 4HD8A 3WO1A 3DOOA 3TTYA 3EZXA 3PUIA 4JLJA 1D1QA 4BQIA 2G71A 2IEBA 4M63C 5BW8A 3V9XA 2I4MA 5CFOA 3WWZA 2EKLA 5FYQA 2RJ3A 3AI7A 3S4YA 3AEXA 4DIEA 4MI1A 4PBSA 2B8TA 3VSDA 2BFBA 1CDZA 1Q0HA 4YDQA 3ZZNA 4C8LA 2DJIA 1PR3A 4MP8A 2BRUC 1KMHB 4R1NA 4TSKA 2JI4A 2IPAB 2FE1A 1X8KA 2IYUA 1XNQK 1HQCA 3RC1A 1U02A 3ROGA 4G85A 1ZXXA 3LL3A 1M6WA 5GIOE 5CYGA 4EUFA 2ZAGA 2FSGA 3NVMB 3AF2A 2IZZA 5JVHL 1VSUA 4FW8A 2I4RA 1U5BB 5J40A 4AMZA 2IE8A 3VMFB 1FQOA 4LQ4A 4LY3A 3TGWA 2J33A 1TADA 3IR5A 4P5DA 4DCTA 1GTSA 2D8AA 1JILA 2ZOSA 4L07A 2CHGA 4DQUA 3DR3A 1RT6A 4WOJA 1NWCA 1MO5A 4JJEA 4A57A 3MOGA 4F3RA 4NI5A 5H3LA 4O4IB 5LWQA 2E87A 5JI3E 5K3BA 3WXIA 5AVUA 3EXG2 1AMUA 3AY9A 2OCYC 4PQRA 3GNLA 3K5PA 5BT9A 5JXGA 5LXTF 2PPVA 1UQRA 3QXSA 4LF8K 2PLFA 1BRTA 3W6NA 2CYCA 4PYLA 2I66A 3RRHA 2E4WA 1TM2A 3RAPR 1XD2A 2Q0UA 3IAHA 3QXHA 1XXHE 3IQEA 3AEKA 1H85A 5EQJB 1CY6A 2MT9A 3C5CA 3OHRA 4U63A 1KAEA 3DE3X 4IIBA 3RS7A 1OLXA 2IXTA 2D3WA 2LNDA 4BGBA 3EULA 1Z6PA 3DBLB 1RQXA 3KQWA 1UXIA 3FN4A 3E9CA 3NTUA 3N4PA 1L7DA 1CSEE 2ZW9A 2DH6A 4M0CA 4MKHA 4DT1A 4KN5A 1JF8A 2Y1FA 3F5TA 2IVZA 1IY1A 3NIWA 2Q4BA 2EZ8A 1ZNYA 2CL5A 2YXLA 1GQRA 3LXXA 3S3MA 1U4BA 3WEEB 4BRZA 2FSHA 4NOMA 3LM8A 3PO5A 2ZB8A 3NMUA 1QZ3A 3CONA 4KSBA 1X94A 4IKEA 3JQ7B 4BO5A 3L6DA 5EVZA 1EFRA 1M1ZA 5H9VA 3STUA 5EXWA 2VWKA 2QK4A 2CBGA 4JP2A 5E9WA 5J4LA 5K2OA 1TYAE 4H1HA 3RTDA 3O38A 5L6MB 4FZYA 1G5TA 2HJGA 1MO3A 4MW6A 4AKEA 5EJIA 4G81A 5HIKA 2YC4C 3OJFA 2Q3HA 2VQSA 3R9IA 1JAZA 3NNDA 4CF2A 2NO4A 4GWGA 1KXJA 2OUKA 4QPNA 1J8FA 2BKAA 3CN9A 4NG5A 2FXIA 2O2XA 3C3YA 2FEPA 4J76A 3M8SA 5HJ7A 2VJMA 3PEUA 1M34E 1VBKA 4EB6A 4CIAA 2G08A 3IO5A 1CUGA 3PL5A 2ONKA 3KYDB 5IMBA 3AVAA 1GSHA 1N2CA 2RH5A 3VU0A 4CIGA 1UC5B 2VOEA 2JIPA 4CL3A 2R48A 1YDEA 4AKIA 4GPIB 4K9SA 5IDWA 4LZZA 2OXCA 3HWWA 2UUCK 1JEAA 1JLCA 1E2IA 2EWWA 2L82A 3DKPA 5F21A 1OSNA 2DR2A 2PGOA 3QHQA 2GSDA 1W96A 4HDKA 4JBYA 4PFJA 2MIIA 3NGIA 1E3QA 5EIHA 2BMVA 2EG5A 1E7MA 4WA7A 1U90A 5AUQA 3RUEA 4EW3A 2PJRA 3TLGB 1KD1O 3D02A 1SV5A 1V1RB 2QM3A 2P9TA 4WXEA 4AC9A 3D6NB 1T6DA 3I9OA 2OHFA 2MSKA 2XAUA 2C98A 2XNHA 1XF9A 1WY5A 2H0QA 1GU0A 4NABA 1V9LA 4MKRA 3PVCA 3PY8A 1Z7YA 2OAQ1 3E70C 2QDXA 3OIVA 3L6UA 3AB7A 4TLEA 1YZVA 3EFOB 4D82A 3R9PA 3DKVA 5HXAA 3ZLJA 2XMBA 3M5RA 2WP8J 5KGXA 1KDZA 4MLZA 3VGJA 3H42B 1XA4A 5DNYB 2W6IA 1URPA 2V7VA 4JA2A 1HNZK 4RTQA 3N5KA 4KQCA 3I39X 4PQEA 5J1TB 1QGDA 2PFKA 3C4QA 1I7SB 3RR8A 1NNSA 4ZAWA 1R7RA 3KUDA 4CLEA 3AUFA 2WDZA 4DA7A 2YJEA 4IRUB 2NUPA 4HDCA 2YV4A 2J31A 1ZBQA 3G0HA 3P0EA 3R40A 2BM0A 2X4IA 2EVWX 4DC9A 3BK1A 1NMDA 2L69A 2DWUA 2B4AA 3GX1A 3C3KA 4FEYA 4KEAA 3SOPA 2ACWA 2Z2KA 1RCHA 4Q7EA 2VQFB 1Z5ZA 2OBXA 2ZCVA 3B7PA 3QYPA 4EHHA 3ZD9A 1JDNA 3Q7RA 3PL1A 1Z6XA 5BUSA 2UZIR 1JIQA 1ESMA 5L3QB 4C29A 3JQ9C 4OM7A 5JPCA 4N03A 1ZY2A 1X3LA 2PM8A 4KUHA 4KODA 3QWAA 2AC2A 1AGPA 1GNVA 1UDAA 4AMYA 4ENVA 16PKA 1GLGA 3ETLA 4B47A 3IAXA 1ZMBA 3A25A 3LPTA 2QRGA 2BFNA 3RS9A 4LH4A 4QQFA 2QBYB 3KYCB 4MQ5A 2OFFA 1TJYA 4YNBA 2NVBA 3PCTA 9GPBA 4JLHA 3VQ5A 5GZ6A 1IBSA 4K1LA 4H0XB 4GAEA 5BN4B 3N2GB 4HDNB 2AH5A 2I65A 3V42A 1LD3A 1EFVB 5KTTA 4XUCA 2H5IA 2DBYA 2HVIA 3H0EA 4H3HB 1U28A 4CFCA 3WZ2A 2EARA 2QN2A 1A4IA 1B00A 3NANA 1SCNE 5BQFA 2A0XA 3CXCM 1ZWLA 3B13B 2NXCA 4RKEA 2E6UX 1N6QA 4DR6K 3C3XA 3DOKA 2W9XA 2O8FB 3VYVA 2DU8A 4WY2A 1M1XB 3JQRA 3QI7A 5JS7A 2XBUA 3UB5A 5AP9A 4Q9LA 2IYQA 2QX4A 2CT8A 5AM1A 2VDLB 1J5XA 1Z0IA 1CY4A 5CFZA 1S96A 2WB4A 3PTLA 2VDOB 4C0QC 4YGYA 2Q5CA 1RCUA 1Q0LA 4LC0A 1HFWA 1OH6A 3FTPA 2OTLN 4RPKA 1ZUHA 4UHEA 3OQIA 3G0DA 5AVYA 5FPTA 4YP7A 4PCAA 5IC4A 4MW1A 3K9JA 1M2WA 2ZFUA 3ANYB 4WXMA 3K8ZA 4XIJA 1SU8A 2X14A 2IDJA 5CFPA 1TAGA 1XEXB 3TOXA 2AFIB 1ADBA 4C89A 1NK0A 2QAGC 2DB3A 1OROA 4P33A 4RK5A 4QOSA 3WXJA 3EODA 1UADA 3CQXA 4GPBA 4IFYA 3BJRA 5GINE 2AS0A 3PU6A 2VSXA 4O3MA 4GZ3A 4MZXA 3VU8A 2IH2A 4PL8A 2HKIA 2R97A 4N49A 3ZWYA 4RD1A 4V2IA 5J2TF 4LZPA 2P9ZA 4B6JA 2IELA 5G1OA 2HNAA 1T4CB 2EEZA 2V6FA 4PF1A 2X7HA 1RBTA 3NOQA 3SN6A 1N6HA 3ROKA 4S1NA 2XA1A 4BMVA 4X7MA 2BFEA 2I33A 5IJ0B 1R4NA 4NZPA 5AXBA 1RPNA 4EGAA 3TJZA 4CIEA 3DWLA 2C0CA 1QRUA 4AMBA 1U2VA 3O9SA 4GLOA 4Y2VA 1CQPA 4UHHA 4MR8A 3G8CA 3T12A 2AUNA 5CHIA 1SU7A 4XR9A 3QUQA 1PFQA 2FSKA 5CBPA 4L8VA 2WJ4A 4PCVA 1JNYA 3I30X 4L57A 2YASA 1XWIA 4OQ4A 1C8LA 4BFVA 3ITNA 1J2JA 1T1RA 4JP5A 1GNTA 1VHWA 3TCNA 5ALHA 4JKCA 3SZGA 4TQAA 2Q3FA 5CDTA 1O0CA 1QRRA 1PG5A 4MQFB 4GNKA 3LUKA 4C7BA 2YJGA 2QRKA 2Z04A 1GZVA 2WAMA 1C0GA 1U3UA 2Z5GA 1N2SA 3ORSA 2QWOA 4GM1A 2Q4RA 4WASA 3L01A 3U19A 3C7KA 1G0OA 1OD6A 1Y5LA 3A3KA 2J3HA 3FYTA 3R9XB 1GL9B 1TIBA 2FZLA 1C30B 4CR8A 2UUAB 4CEZA 2O3RA 2XRZA 1QH8A 1RM3A 2P2SA 4XQGA 5I7OA 2NPFA 3I5YA 3MWEA 4ZARA 2A30A 3G1WA 3U4CA 2IFTA 5BOVA 1S0UA 4XD7A 2DR3A 2GEMA 1I3KA 2AW3A 3QBXA 1SCDA 4B9AA 3SZRA 1MRZA 2IKQA 1UBMS 1RNHA 4PKHA 2CHUA 3GL1A 1GCIA 3DLPX 1UMDB 1KY3A 5AVXA 4V0KA 1VKOA 1XP5A 5AVZA 1C1AA 1VLZA 2I2CA 4ZQFA 1EGHA 3HPGA 4QXOA 5KTPA 2V4ZA 4Y1DA 4G1UC 2F9TA 5BQ3A 2CXPA 2IP2A 3PNBA 4FGSA 4OHYA 1XHLA 3CA8A 2QLFA 1AKNA 4DMMA 5JY6A 4F1WA 4TT3D 2Y99A 5JJKA 2OHIA 2UUOA 3O9MA 1IHOA 1TYQA 2HRRA 1IQPA 3JSMA 3T0FA 1YA4A 3VDMA 3ZQJA 1FYVA 2BSQA 4HWIA 2CW5A 3TW8B 1KFDA 2R751 3VZCA 3H1AA 3CVYA 4KYUA 3TEFA 1A7AA 5CRIA 1XZAA 1JHMA 2NRTA 1LTHR 5EZYA 5FOSA 1E3SA 1RI2A 3FDIA 3R8FA 3I9LA 1AB5A 1UANA 3NV9A 3F7NA 3ZJYA 4INPA 3ZCVA 1WXFA 2C2ZA 1PLLA 1KDVA 1NR7A 2GV9A 2P5TB 4R31A 1SXJC 3IQZA 1TJ4A 3E9ZA 1UA0A 3UXYA 3E9DA 2F3PA 3A58B 4MOWA 1CQIB 4IMPA 5DYNA 4AG5A 5FRNA 3HCBA 4EAAA 3NDKA 3TDMA 3MAJA 1G8KA 2JLAA 1OYYA 4QUIA 1N78A 2WK1A 4Y1EA 4KFRA 4HAXA 1F12A 5JCPA 4YJ2B 2FY8A 1SCIA 2FUNB 2CJWB 4FLUA 3WLMA 5DCUA 3RMBA 3LA6A 5C8DA 5A9RA 4UM5A 4F4KA 4FYDA 4ZMSA 3IR7A 3DXMA 4BBAA 1U0RA 1DTWA 3HA3A 2ATIA 5JLJA 4BOYA 4MV4A 2CDBA 4AJNA 1UFKA 3WDSA 3SX2A 5TPZA 3IURA 1G19A 2VDQB 4KNWA 5LP6A 2EIXA 1O9BA 3I5UA 4MYDA 5CDSA 2TMKA 4QUGA 3D45A 3ZX5A 4BGDA 2H0RA 3UICA 1JWLA 1HE2A 2WNHA 3VKWA 4DQXA 4JHLA 2AEEA 4RIHA 3GJ6A 1ST3A 4NS4A 5K45A 4WT7A 1Z62A 4I9UA 2H4XA 4KB0A 4MARA 4EFKA 2XKKA 4UCXA 1B0UA 1GNPA 4BZXA 3OCXA 4QFBA 3T7ZA 5EGSA 3W2IA 1KJ8A 4PO3X 3QWFA 2CL6X 3Q3VA 3T3FA 2NRXA 1LGYA 521PA 4RG8A 2JJMA 1ZAYA 4L6IA 2WHRA 1L5UA 1K6YA 4KGDA 1C1DA 1WN7A 3BL8A 2CNOA 4IJMA 5JAUA 4US0R 1V7ZA 1RZ3A 4R5HA 5HBRA 2Y05A 2JLBA 3ENQA 3CJ1A 3HDTA 3TB6A 5FWNA 4CMEC 1JKJB 3D2LA 5IXJA 4NU5A 4N9WA 1XCPA 5AQHA 2EDCA 3SCZA 4TKUB 1GYQA 1YJ8A 3BTSA 3BH0A 4BNKA 3ILSA 4I1YA 4P7BA 4P7FA 3B5EA 4B7UA 1NUQA 1TT7A 1QQ7A 4PWZA 4CUKA 3MCWA 4B46A 1ZRMA 5KHAA 4S0XA 2NSLA 1Y3CE 5CM8B 3GRFA 1NVAA 3NGYA 1ZOOA 3KZBA 2N0SA 2WFMA 2OVFA 1Q6YA 2FLWA 2MR6A 5JCJA 2V52B 2VO1A 4H6WA 4W4TA 5LQSA 1DHTA 4GQBA 1KYQA 3J8AA 1JP7A 2VF8A 4LHSA 5I7UA 3PHLA 4MS3A 4M0LA 2D74A 3BH7A 3R6MA 1P4RA 4CPDA 2G04A 3NWEA 1KR2A 4IO8A 1E1QA 2F90A 1R6BX 1SRRA 5IDYA 4M1TA 4R2JA 1KVAA 1CVLA 1U98A 3OZAA 4QYIB 4QHSA 2BL4A 2QD2A 2XYRA 3PQ4A 1YI2N 4Y2JA 1E2NA 5HUHA 1OUMA 3PXDA 4MHSA 3A1WA 4P4TA 3PVZA 3MT0A 4F2SA 4PAMA 1YB7A 3ZXUB 4OGCA 4PLCA 4B9UA 4UNIA 3UAWA 1AO0A 3WLAA 1IV0A 1UC8A 3CN7A 2G8WA 1O94C 3SLKA 4EA8A 5JH7A 3T1YB 1KETA 1P9LA 4QXAA 2QDKA 2PK3A 5JECA 1XQ1A 1JJIA 2ORWA 1ILYA 1JWAB 1XZGA 4B6EA 3I1FA 1H69A 1N34B 2VBFA 3DWFA 1MRNA 4UFOA 3VPZA 4Q7QA 1MHTA 4HLUA 3MWJA 1YJ5A 3G0CA 1TQ8A 1GV0A 1DKPA 1LFDB 2Z9CA 2RK4A 2AKEA 3T7KA 4G36A 2Z8XA 1G41A 3QMPA 2GN1A 4MKIA 3IL2A 3L8MA 4O2AB 3G9XA 1GRVA 4QYTA 2P9YA 1VSDA 3ZWMA 3ZLBA 4Q9NA 1SKSA 4ZEMA 2BOVA 4Y0WA 3CRNA 5ESWA 3OPYI 2VTDA 2V7YA 5LYJB 3HZHA 4GBED 5DDIP 4DSIA 4NU8X 3AHIA 3P96A 3T1QA 4TUYB 4QUJA 4Y1RA 5KNBA 1K89A 1IBLB 2WYVA 2O5VA 3JYOA 1JALA 1NNUA 3NBUA 5KJ1A 3E4CA 2REOA 2XMQA 4E03A 1JMVA 3PSIA 4RVNA 1Z5UA 4D0GA 4QBFA 4QD3A 3IAAA 3D7EO 3GGJA 4IKFA 2ILVA 3L93A 2HO4A 4M3UA 4BR5A 1UC4B 1LPBB 5ADHA 1U0TA 4HXFB 1I94K 3IFSA 4HB2A 3ITHA 1RM4A 5AVOA 2DBZA 4DNXA 2OZMA 5CFRA 1LDYA 4QOJA 4FTWA 4EP4A 3S3TA 1VJDA 2ZCUA 2H2WA 1EUCA 3L0YA 3FNFA 2Q4TA 3R41A 3BXPA 4ZAXA 1HPLA 4UJ5A 4HQOA 5AOVA 2YHBA 1PEKE 1QG4A 4JUFA 4CQMA 1JR3D 4NPHA 2R68A 4N54A 1OLUB 2WSMA 4K8RB 5EHZA 2V58A 2WHPB 3EE6A 4GNRA 1BKSB 4HC4A 4Z0TA 1NATA 1V8BA 2DQSA 3TQQA 3NT2A 3QKRA 1G2OA 5GIOA 1WF3A 2B8JA 5CDFE 3HB7A 4MVJE 3N2EA 2XRIA 1DAEA 3AI1A 1G6KA 5ETJA 1EX6A 5DIFA 1Z2OX 3EF3A 2FPGA 1DMRA 1WO8A 3DP9A 4LXUA 3QTLA 1S5JA 1L1RA 4REMA 4LWQA 1XEWY 2QXYA 3KJVA 1M72A 4OQZA 4QGBA 4YAEA 1RRCA 2G36A 2IA5A 1R4MB 1W88A 5K01A 1RWBA 2ZE7A 4JI2K 2EX0A 4AK9A 5KQRA 2Z2JA 2QUAA 2FSVC 3OE7D 4FINA 1FOEB 3ZDRA 3ETEA 3NJ4A 3IV7A 4X3CA 3INNA 1WXXA 3D8BA 3DOLA 3WKCA 3Q5GA 1QFYA 3BMNA 1UFRA 3U62A 3O08A 4JI8B 4W9NA 3PE3A 1GGNA 3ZETA 1JG6A 1UKAA 4TV8F 3VM6A 4LHYA 4M46A 3JQFA 4CHYA 1ICEA 3U7EB 2O1XA 1KYZA 1BDHA 1TCVA 5FYDA 4FGKA 1YD7A 1XXHA 5K6RA 2HMSA 4B6PA 5F4ZA 2VPWA 2PYJA 1BQEA 1K8KA 1QOPB 2HSWA 3QFTA 3A0IX 3L7DA 5FTNA 1QQAA 1DZ3A 2I7NA 1BIZA 2Q50A 3SQ1A 4RS3A 2VBIA 1GVNB 4QNNA 1XNRB 4BDZA 4BC0A 5LP1A 5IU6A 2W6ZA 4F3YA 2FVYA 3ABOB 4DWIA 4LOKA 1RC1A 1QKIA 1JLKA 3CKKA 1UKVY 2CMGA 5CNKA 2FF7A 2CXXA 1CJVC 4JA0A 4FR0A 5C1BA 1T8EA 5KNLA 3MEDA 3KEOA 4EVSA 3E7DA 3OM0A 5NULA 4YRMA 3FZYA 1DIHA 4PM4A 1KVTA 1EGAA 2WIFA 5KTMA 3KJFA 1YVUA 1Y6ZA 2GEUA 5TQVA 3T38A 1X9WA 1L8QA 2H1WA 2FDCA 4NLCA 3ML1A 2L0XA 3PI7A 2D0IA 1T03A 2IOFA 3PUYA 4DR2B 3ZWKA 3O90A 2IUFA 5JPDA 3WGQA 3RRZA 2FK7A 5K4HA 1BXKA 3F46A 5I7SA 4D57A 1MA9B 1ODTC 1BCRA 3TAHA 4XSGA 2C0QA 1RJFA 4YPVA 4ADSG 1LV5A 1M34A 4MRMB 3NP7A 3OKAA 3NWOA 5EQFA 3G5TA 2V5VA 3MUOA 1O2DA 1MB3A 4DNOA 3TZHA 3DZJA 4HADA 4PIVA 4CK1A 4L9RA 4HUFA 2Q45A 1O13A 4QOHA 4EENA 1CETA 4F4IA 1YA8A 3WP1B 1FX0A 3VO8A 2GWKA 3QENA 4LK2A 3VKVA 5D7NA 3W3AH 1C8VB 4NAVA 2ZDQA 2NVUB 4P4SB 1C2YA 4BO1A 2W0SA 4N7JA 2P9JA 1ZITA 3G79A 3Q8MA 3EWAA 3HCWA 4CW7B 5H9WA 1CW2B 1NVVR 3OCVA 3VH4A 3LDPA 3MW8A 2AI2A 3OYNA 3H4MA 4DLSA 3BK7A 1QFXA 1P5FA 1K7YA 4JP8A 2CNWA 1N2IA 3FJYA 1QZ5A 3C6AA 4F4HA 3E1GA 3O6WA 2PA0A 1OKJA 4U0JA 2HL6A 1ZD9A 1ZQ9A 3H13A 3JS5A 3L1VA 1XO1A 4W82A 4LF4K 2JFZA 3AJEA 4YP1A 1J39A 1XRPA 4JMPA 2RB4A 4ZOQI 1LVUA 4AO8A 1JFFB 3U16A 4DKXA 3ULEB 4YAJA 2IXEA 4B3SK 4B87A 4P9NA 3GQBB 4WNAA 1S9HA 2DFNA 2ZWMA 3CU5A 2Q7DA 3P45A 4AKHA 1CY0A 4JI5B 4RZXA 3RH0A 3QUBA 3KQYA 4O5AA 4MIYA 1FYWA 3MFYA 4ITRC 2GAFA 4U02A 2V7TA 2CH6A 3AIIA 5A2QO 2BC9A 3H86A 1JXBA 4EHTA 4LRUA 4XRGA 3VVLA 2C3UA 3ZX4A 1FCJA 4FO0A 4BRNA 3L2RA 4CEJB 1O8BA 3A9VA 2ATVA 4PRYA 3LNTA 4HXGA 4UVGA 5DGXA 1IZ7A 1NXVA 1GCAA 2XY7A 1N6OA 4C2AA 5KU1A 2D0PA 1U6JA 3UMVA 1ENPA 1FRVA 3AJ9A 3PSFA 1IVNA 4DM7A 1BHLA 1GLJO 2OKGA 1JLGA 1NVDA 3ZX3A 2J32A 4YFUA 1VQMN 1L5LA 3G5MA 3WMWA 2Z30A 4QAQA 4WKGA 3DLGA 3FPSA 4GHWA 4QTZA 1UBNA 2RHMA 2VIIA 3D54D 5IT5A 3HP7A 3GPCA 4MO9A 4HUQA 4OJYA 3IH5A 3WYEA 3L4BC 3AXTA 3JRNA 2VZLA 2OFOA 4MUNA 3FMOB 2H29A 1KGDA 4QDZA 3ZWAA 1EE2A 4ZOLF 4DR1K 4G67A 3PUKA 1T9CA 4BO7A 4ELUA 1JDTA 2PS3A 4E5MA 1Y98A 5K0EA 2OSVA 3EEFA 2B37A 4O44A 3UQYS 4AUKA 4CBUA 4YX9A 3EX7C 1PTJC 3D64A 3LBNA 10MHA 3W8DA 5FBRB 1VRUA 3VN5A 4KXWA 2HREA 2COEA 3RU7A 1WSAA 1K3FA 5E4YA 2DY4A 1F1JA 1EETA 2BM8A 2FQ1A 5A3JA 1AKRA 3RTEA 1C0PA 2R25B 1TW3A 2WF6A 4ASUA 5BN1A 3B3AA 4X1OA 4YECA 2VC2B 1GCOA 3UANA 5TVKA 1QCZA 1WVIA 3A4NA 2LCFA 2HSDA 5T6MA 2GM9A 4YV7A 2WD9A 5DO9A 1T1IA 1B2RA 4PVDA 1N3YA 3C3AA 3FNGA 4LMPA 2R62A 1X1QA 2VQDA 3JYPA 2NYVA 2QNBA 3ASVA 2ZJ8A 2HSJA 4O2BA 2HQRA 1T15A 1QGYA 121PA 4HGZA 3ATVA 2Q0SA 2ZK7A 3TUJC 5EC8A 4YXWA 5TR9A 1MG0A 5HIJA 3H5LA 1V11B 2FMXA 4FM9A 1AT1A 5JWOA 2PKCA 1N36K 4P34A 1RQ7A 2WM9B 3DNMA 3PNPA 1N92A 3ER8A 2JIDA 5JVDA 5LQRA 3L4EA 5H83A 2FWNA 4GR5A 5EXEA 1B16A 4QX6A 1WKVA 2IYYA 2PO7A 3SG0A 3SPXA 3PHHA 3MS7A 4M1QA 4AWBA 2Q1WA 1N7IA 1YR2A 2IPXA 1VBMA 2PKWA 4Q4CA 4JJ7A 4INOA 4I6MA 3RJMA 3UH1A 1TO2E 1F7UA 3DFIA 2ALJA 3ZDBA 1KNXA 2BTQB 4ZQCB 3ZBQA 3RSQA 2YWGA 2GZ3A 1B6GA 1FQKA 4CMAA 1V5IA 5GINA 4F84A 2YJTD 4R1SA 1E9RA 3FCOA 2Q6TA 4REQA 1MC4A 2G5GX 2WU3A 1AC5A 1IBCA 1Z5PA 2G7ZA 4E3WA 2F1JA 1S72N 1RKXA 1D0SA 4UXIA 4LF6B 1IH7A 3AGPA 4FJNA 2DAPA 1EVLA 3DE5X 1FRZA 1WSBA 2Z1NA 2JK0A 5DBIA 1OXUA 4Z3DA 2RI6A 2RHCA 2GZRA 4K2HA 5G02A 3BWYA 5FUQA 3M2TA 1LAWA 2ZP1A 4COOA 1ZW6A 3T7SA 4KPUA 1Z6TA 4QTTB 3T5AA 3V7YA 3CG4A 3E61A 5AVTA 1BS1A 2J3JA 5DN6D 3VR4A 2WU1A 4RY0A 2ZWOA 1EXMA 3S3OA 1E9EA 1RBUA 4IWNA 4UJ3A 3Q8XB 3EZNA 4DV7K 3U3YA 3B6JA 5JHGB 3P83D 1QXSA 4XUEA 3R7NA 4G07A 4JBNA 2QV0A 2HBQA 1IZYA 4U7DA 3S2IA 3GG2A 4M0PA 4RHYA 3BF8A 4CKBA 4QU5A 1KJJA 4D56A 1WABA 3VR6D 5MF6A 2HMWA 2H08A 3AR5A 5IJWA 4E46A 4BC1A 2UV8A 3GJ8A 1BA2A 2ZE6A 1I24A 1DBQA 2NTVA 3OAAA 3LKVA 3SSNA 3Q7SA 4XGNA 2GM4A 4IIFA 4F5EA 3EWNA 3HACA 2R8YA 3NR2A 5DLYA 5FPPA 4KWCA 1D4ZA 2HF2A 1RWPA 4ETNA 1M2OB 1Z4OA 3HDGA 1NXTA 5AI8A 4JLUA 5KWIA 2R79A 4AP9A 3ZI4A 1E4OA 2FCRA 3R3YA 2UVPB 3DUFA 2JJ2A 3DDHA 3RTVA 4FOLA 4X0EA 2B4QA 3F2IA 1ZSVA 4XJXA 3NHAA 2FW6A 4C3OB 1E3DA 2AOTB 1BMTA 5EMHA 2WTXA 1NW7A 3KBBA 4PZEA 4URYR 2ZGVA 3QOFA 3H6GA 2GJ8A 1J99A 5KB3A 3ANTA 3DQQA 3D2FA 4OKIA 2Q5EA 5I4IA 5FWXA 1RBYA 2PZEA 2JFFA 4X62B 1HORA 2QIPA 5ITZA 2IPOA 3O80A 1DOZA 1YUBA 1A9RA 3QYAA 2IY7A 4DY6A 5CIWA 2G1PA 5BP7A 2A1SA 2XE7A 5FLKA 1QYIA 4Z8YA 5C2JB 2P62A 4J1NA 1TYZA 4I1PA 3EC2A 1PE0A 4OGWA 1W1UA 2BKXA 3K31A 1BMFD 3Q6IA 1Z8HA 2C83A 4CN9A 1J00A 3GLUA 3KAPA 3HA5A 1X1TA 3U81A 1OVYA 4DNFA 1TM4E 2IBSA 1UEJA 1R9MA 1OKKA 4F2PA 2JEZA 3MA0A 2ZUWA 1DEAA 3ILVA 4ELVA 2QRNA 3BTVA 4ILGB 3HHEA 3EVTA 3ITEA 3MN5A 2WTNA 2A0KA 3JQGA 4JJAA 3AYZB 2HWUA 3REGA 3GUHA 2RHKA 4D9MA 5FBQB 3THXA 5AQYA 2RC5A 2YY5A