4IDHA

Crystal structure of the large terminase subunit gp2 of bacterial virus sf6
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
463
structure length
451
Chain Sequence
b'SINPIFEPFIEAHRYKVAKGGRGSGKSWAIARLLVEAARRQPVRILCARELQNSISDSVIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGIDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTKVEMKQKLGIPSPNLADALMMCMHCPALVREETEIYVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gene 2 protein
publication title Structures of the phage Sf6 large terminase provide new insights into DNA translocation and cleavage.
pubmed doi rcsb
source organism Shigella phage sf6
molecule tags Viral protein
total genus 166
structure length 451
sequence length 463
ec nomenclature
pdb deposition date 2012-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04466 Terminase_3 Phage terminase large subunit
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4idhA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4idhA01
4YMVA 2ZJBA 3X1DA 4JJZA 4AKGA 4JLOA 1AQYA 1N6NA 4B2IA 3P4YA 4LJYA 3WNCA 2NOAA 3L0IB 2OESA 4QJ4A 2GJSA 3NEJA 1NRJB 2MSDB 2PJRA 4WAUA 2AWOA 3IPXA 1UEIA 2BJVA 3K0AA 3AV0B 2QAGB 5DO9A 1LS1A 3QUSA 2ZM5A 4JSYA 2D2EA 2GXQA 1QHXA 2WJGA 1XXHE 3EPJA 1KK2A 2PH1A 2QGZA 4KVAA 4YLGA 1OH8A 4ZCMA 3GLIB 4UNPA 1OKKD 3SEAA 5CLLA 1Q57A 1UKYA 2P67A 1I2DA 5CB8A 2OILA 3TIFA 3LBHA 4LPSA 2ODNA 4MDEA 1VDZA 2GESA 3GJ6A 1WE2A 3OIYA 4FD2A 2WJJA 4F38A 2PLRA 5BYKA 3PVSA 2F1RA 1OFHA 2QA5A 3B82A 1YZUA 4JLBA 1WXQA 5HR5A 3WP1B 3LFUA 3FKQA 1E79A 1DELA 4IDPA 4Q21A 5AWFC 3TSWA 3CZQA 2ZE6A 1ELOA 2OV2A 4GNKA 2GBLC 2ZRHA 3ZVNA 1F2TA 1ZUHA 4HLUA 1E2GA 2H57A 3GJ5A 2FDCA 4IDQA 2ODEA 2C98A 1VECA 3WBKA 3GLIE 2AXPA 2QMUA 5EZ6B 3RWMB 4MRSA 2O8CA 2Q9CA 1KO8A 3NXSA 3PQCA 4PHHA 3RABA 3LVRE 3CIOA 3CF2A 4LBZA 4Y0AA 1JJVA 4CEHA 1P9NA 4MYTA 1V43A 1TQ2A 1L2TA 2ZRIA 4AY2A 4JMPA 2WWFA 1W1WA 2HEIA 4XWOA 4BEJA 3NBYC 2DFTA 1CRPA 1LNZA 1Z5ZA 1FX0A 2GKSA 1XTKA 1LV7A 1OFTA 1T5IA 2PBRA 2ONKA 1IN7A 2ZYVX 4ITRC 5D3MA 2JLUA 3EPHA 3AP1A 4O3MA 2IF2A 1OYWA 4FINA 1IN5A 3W9YA 4CEJA 4GP6A 5KNBA 4O25A 2O8BA 4JLDA 4QGHA 2ZUDA 2B7BA 4QOSA 1G20E 1YR6A 2FZ4A 2GNOA 1XEWX 2GK6A 1KI6A 4QHSA 1F2TB 2IYYA 1A4RA 5JI2E 421PA 4JBYA 2ODWA 4W5WA 4HAWA 1R7RA 3LO5A 2O8CB 4PC7A 3D7MA 3N2EA 2CXXA 2G9NA 2XGJA 3BBPA 2BKEA 3RRYA 5M1FA 1KZ7B 3DDCA 5JS8A 5EE0A 2YYZA 5G40A 4B34A 2WJVA 1CBUA 2ZUBA 5BN4A 2F3TA 1ZM4A 4URXR 2ZRKA 3ZQJA 1AA9A 5JI3E 2ANBA 1ZCBA 3QXHA 4NDZA 2YWHA 5KTYA 2ZE7A 5KYKA 4HLCA 5HCIA 4BUJA 1FX0B 4DSOA 4H1VA 1JR3D 4DLSA 1P2UA 4UKDA 3WYGA 1UPTA 4KBFA 3U3KA 1DO0A 4PHFA 4PO8A 5CIWA 1G7RA 2RB4A 2O8BB 2CL0X 4D4KA 3FHTA 2RKOA 4AWXA 1TNDA 2DYKA 2YWFA 1AGPA 5C12A 1GVNB 1R0XA 5DSZA 1ZBDA 4DLZA 1KI6B 3UIEA 1NJFA 1KGDA 5J4YA 2EQBA 4R2IA 4LJ5A 4AYWA 3U3OA 3ND8A 4KHZA 1FZQA 2XNDA 4D25A 4XVRA 4BECA 2ZYWX 3VR5A 1GOTA 1J8MF 2VSOA 1KMHA 2VF8A 4QGFA 2A2ZA 3AKCA 3DM5A 4LX0A 1MOZA 5SZJA 4PO9A 2ORIA 5K8UA 5ELXA 1TTTA 3VR6A 2IF0A 4A82A 3FFBA 4MGKR 2G0NA 3GEEA 2IW3A 1FPMA 2E1RA 4WIAA 5EXXA 2J0UA 1ZU4A 3GJXC 1CJVC 3H0KA 2ZSDA 2FFQA 4OK6A 2NTYC 4C4PA 1KI1A 1A1VA 1OKKA 3K09C 4DLVA 1XB2A 1ZCAA 4BASA 3RS0A 5C2FA 3C15C 5AJZA 3AF4A 2RGBA 3PUVA 3D3QA 4MITA 3ZQ6A 2NO1A 5CIQA 1TPZA 1KYIA 1Z63A 3B7GA 2ZRDA 2QBYB 4C0JA 1KSHA 1YR7A 2DCUA 4FWTA 2QM7A 3FGNA 4Q7KA 4NCIA 1P60A 4LV5B 3CWZA 3QPWA 2X2EA 1XCMA 3LBIA 5A0FA 2ZAOA 3F5FA 4FXPA 1AKYA 3WYFA 5CITA 1GIAA 1Z28A 4LGMA 1PZNA 1U8AA 5GJWC 3U5ZB 1G8YA 5JSZA 3BB3A 2O8FA 5CDFA 2GJ9A 1W4BA 2QP9X 3TJZA 1E2JA 3KTAA 4V03A 1ZNYA 1OIXA 2BJWA 3CNOA 1NJGA 3CX7A 1ZUNB 2CLSA 3BFKA 3LLUA 1ANKA 2VIIA 3DZDA 1VG0B 2K5UA 3T1QA 3ADCA 4RZ3A 4DDVA 5EXPA 1CR4A 1P3JA 2W2XA 4XIGS 3WP0A 4Q47A 3EPLA 3FWYA 4AKIA 2JJ1D 2OFOA 3T15A 1UBFA 3H86A 1N2CE 2FFAA 2OM2A 2XZPA 4QJ5A 1II8B 1KIMA 3QXSA 4OK5A 2DB3A 2QRZA 2JLRA 3AF1A 4XSHA 3LXRA 4HB4A 3GLGE 2JLVA 1E2IA 3RVBA 1PUJA 3W6OA 1TF2A 2IYRA 2P3SA 4FCWA 2IBMA 4NE2A 5KU1A 2XB4A 2ANCA 2XITA 4DWJA 4I1OA 4CIDA 5C10A 3OHMA 2F55A 1NSFA 2PL3A 1YZTA 3BRWD 5FBVB 4IDOA 1P73A 5JSZB 4TQ9A 4A0FA 4QL3A 3TUZC 1N6KA 1XPOA 3K53A 3KB1A 1JPNA 2J59A 4C3ZA 3M4YA 4M8NE 1LVGA 3VR4A 2YWGA 1HT1E 2FSFA 2VP0A 1JXOA 1F48A 2WJYA 4M21A 5JWOA 1RC8A 1G19A 3B1XA 2IS2A 4BQSA 1C9KA 2FPMA 4QJ3A 5SZKB 4TLAA 2R6GA 5J4HA 2E9SA 1Z47A 3LQQA 2O5VA 3S1AA 1JQJC 2PZFA 2H7VA 2V9PA 1W0KD 3A1SA 1AN0A 4XWKA 4S35A 1II9A 3CRVA 2FPLA 3PIRA 2ZI6A 4BFVA 5J4VA 4PC2A 1JR3A 3RSOA 1SXJB 4ZDWA 5DNYB 1E9SA 1G41A 1EFHA 2BBWA 2C04A 4OQXA 4OYHA 2V1UA 4UNRA 4EDHA 4LJ8A 4M1SA 1N5LA 2QT0A 5DI9A 2H18A 4LBYA 4LJAA 1NVXQ 4TLCA 4GI7A 1O3YA 2NO7A 2BOVA 3TH5A 3IIJA 5JWRA 2C9YA 1GKYA 3EC2A 1HURA 3PENA 3QQ5A 1W2HA 1N6IA 3K0EA 3SE0A 4CRWB 3CR8A 5JJIA 4BWYA 1NNEA 1TEVA 4LHWA 3CX6A 3RAPR 2HT1A 4JT4A 5L8VA 5KPJA 3BERA 3QY0A 5CJ2A 2ZS7A 4M1YA 4R71A 1KDOA 4QGAA 3H84A 3AVUA 3ZVLA 4EPRA 4RD2A 3HP1A 1IN8A 3SJBA 4GMDA 3TQFA 2D06A 1CR1A 1NI3A 1DADA 1ZMXA 2WSMA 3A8TA 4E07A 3S1AB 2YINC 3P1JA 1KSFX 1RFLA 4Q1EA 4XOIA 5B30A 3D8BA 2J0QA 1R6BX 2IYZA 1DAHA 3NH9A 4JVLA 2JLSA 3AVVA 4QBHA 2IHBA 2YOHA 1H8HD 4MYHA 2ORVA 2IS4A 1N3BA 2A9KA 2W58A 1N0VC 3IBYA 3IILA 4RY2A 2JA1A 3W8RA 2CCKA 3KKOA 3K9GA 3B5JA 4B43A 4D0LB 5FTLA 3LBNA 1OXTA 4ZI2A 4I81A 1R0YA 1DARA 4TMVA 2JLQA 5FTNA 2FU5C 4HLDA 4K8OA 4O2LA 5FOWA 5DI3B 1GTVA 1ESNA 4TTRA 1AM4D 3CH5A 5M1KA 4V0LA 4URWR 1KY3A 3TQCA 1EFCA 3BB1A 1XJQA 3CRQA 4AKEA 5L3SB 3GEHA 1QRAA 4WXPA 1R5BA 4JIMA 4BGDA 2XZOA 2GTPA 5LD2C 5F3WB 4M22A 2ZI5A 3EWSA 3LW8A 1W4CA 4JYBA 1JR3E 4XSGA 1E9CA 2J3EA 1CJUC 1SVOA 2L0XA 2F43B 1FTSA 3GQBA 1KK1A 1GDDA 4W9MC 2MSEB 3K0SA 2OCBA 3PFIA 5AR1A 3OF5A 4OI2A 3NHAA 4HAYA 2VP4A 2GAAA 1CRQA 1SVKA 2GBLA 3C7KA 4JJKA 4RSGA 1WB9A 4C2TA 1S4QA 3EW9A 1Z3IX 4IRUB 4EPTA 3R9XA 1P75A 3HU1A 3FTQA 3B8HA 3FMOB 4HUQA 4ZKEA 3KQHA 1W47A 2JJ1A 5A5GA 1UBGA 2D62A 1KAOA 2FX3A 3U44B 1W0JD 2YNMA 2OLKA 2QE7D 2ZI7A 1CLUA 4Q9HA 1OXXK 2Z4RA 3O8BA 3THWB 4KFUA 4GSYA 1OPXA 5EP4A 4PHGA 3UPUA 3BORA 3THYA 3D6TB 1QF9A 2QUZA 1N0UA 5KDDA 1Q1EA 3NG1A 1FP7A 3K9LA 4D82A 4C2UA 2C5LA 4M1MA 2ZQ5A 2F7SA 3OIWA 5C1BA 1OT3A 3L82B 1DAEA 1Z6GA 3NIBA 1LTQA 5DGXA 3KKNA 5JS7A 3EXAA 3MWYW 4BLPA 4DIEA 2NO0A 4TZ6A 3WNDA 3TR5A 3Q7QA 5CLQA 1QHHA 3RNLA 3WY9A 1MO5A 3GPLA 2P5SA 4D26A 1NVWQ 3SR0A 3ZGXA 2J46A 4US1R 4HUQB 3L8YA 3THOA 1BKDR 1UKZA 1W0KA 5G41A 4AG5A 2DBYA 4OHWA 4P4SA 5DIFA 3SU8A 1NMYA 3KDSE 1PV4A 4U02A 1XNJA 3PEYA 1RRFA 2ORWA 1W46A 5FI0B 3U7GA 1NKTA 1VHTA 3UKDA 1VYVA 1E2NA 2UKDA 4IEIA 2EFCB 4X8MA 4EJSC 2G0TA 3THYB 3QE0A 1UEJA 1E9BA 1ZIPA 1T6NA 2YWEA 2ZI9A 4LOAA 4Q4AA 4NYIR 3O8RA 3RS5A 2VA8A 2PEZA 1E2QA 1G6HA 1CKEA 1TEXA 4G5OA 5KSZA 1AQUA 1GNRA 2MMCA 2QP3A 2GA8A 2QMHA 1OE0A 3K8YA 3TSZA 4E5UA 3IBGA 4LJ6A 1JAHA 1XTJA 3ZVMA 3SFVA 4L9WA 1UDXA 3T34A 3G82C 4XVUA 2NPIA 3DOEA 1QHHB 1KI2A 1I4LD 4DHEA 1GRNA 4F4CA 1OB2A 1GL9B 1Z0DA 3KKPA 1DAMA 4FW9A 3MWKA 4NP6A 2ZRGA 3CR7A 4YQFA 5KUTA 1CJTC 3AF2A 4P3YA 4DB2A 4HZUA 4P4SB 1ZD9A 1GM5A 5AUQA 2ZREA 2BVNA 2Q0HA 3FHCB 2WAYA 1GL7A 5L3QB 1G1MA 1KMQA 1H8HA 2OO7A 2B7CA 3R9WA 1XP8A 2PMDA 2ZR9A 2W6ID 5EP3A 3HR8A 4YC7A 3Q7PA 4E09A 1ZRHA 3CPEA 1G5TA 3LQRA 4PXAA 2FSHA 8OHMA 2QRNA 4ARZB 4XD7D 4BZXA 3QF4A 3UG6A 2JASA 1SQ5A 3SQWA 3QBVA 2IUTA 1GL6A 2J9RA 2G88A 4PZYA 2VO1A 4C30A 3L0SA 521PA 2QPTA 4A0GA 3A1TA 3K09A 1ONBA 3OE7D 2KI5A 1WBBA 4V0MA 1AKEA 4Y0VA 4Q1CA 3ZZUA 2FG5A 2ZJ8A 4F93B 1T3HA 3LLMA 2Z5FA 1VTKA 1M8PA 2FV8A 2BM0A 5C46F 2GF9A 2OCAA 4G5QA 1XZPA 2WMOB 1R5OA 2LWIA 3BFXA 4O2RA 1ETUA 5H1YA 4NONA 2OAP1 4B75A 1Q22A 4MKGA 4OQLA 3Q3JB 3PEVA 4GZLA 1VPLA 5AUOB 2CEAA 4C0SA 5AUPB 2JATA 5E95A 5LPNA 2BIFA 3C5CA 4C7OA 3PR1A 5A4JA 1XD2B 3ICEA 4LYAA 3NBZC 3QF4B 3K70C 2OXCA 1QDEA 1W0JA 4DLTA 3ZJYA 3O8CA 1RYHA 2QE7A 2GAOA 2XJ9A 4ZCLA 1E2MA 2R6CA 1XXHA 4S2EA 4JS0A 3OEED 2HLDD 1C1YA 4WZAE 3EZFA 1E98A 3B1VA 1YKSA 3MUFA 2IYQA 1IN6A 3BOSA 2BDTA 2ZJOA 1FNNA 3DMDA 4IVRA 1A2BA 5G3ZA 2H17A 2ZEJA 3CH4B 1UAAA 3RC3A 2OG2A 1KKMA 5AJWA 1NLZA 1FMLA 3LVQE 5FPSA 5JWHA 4BLTA 1P4SA 5AJYA 3U6BA 2CVFA 2C96A 3KUDA 4IXNA 5FR2A 5IDVA 3ICQB 1AS3A 1G3IA 4A15A 4X8HA 2CJWB 2VQSA 4HLQB 3QKSA 1IY2A 1H65A 2GHIA 4JKYA 5J47A 1E2EA 2CL6X 4A1FA 2EVWX 3CPHA 4YONB 4C7OB 3SOPA 3EIHA 3QG1A 3IEVA 1HEIA 5DN6D 2RH5A 2IUSA 2XAUA 3QPUA 3MD0A 2RGAA 5BXQC 3GP8A 1RPZA 2J0SA 2V3CC 2P6UA 2QMEA 4Q5IA 5K8TA 3IGFA 3KJIA 1ZM3A 4Q7JB 2IYUA 2Q6TA 3CBQA 1NF3A 4V0ME 3V4FA 1XXHB 3KL4A 5EE1A 4ZCIA 5FOVA 3K0CA 1DAGA 4KV9A 1QG2A 1QHGA 1CU1A 1UADA 2DFLA 2FZLA 4I1VA 2CL7X 4OBEA 4DRZA 3BAFA 5EP1A 1CULC 3QBTA 1J8YF 4Z54A 1G3MA 4UQOA 5H70A 1L7VC 2F9MA 1E3MA 1MH1A 2ATVA 2NO9A 6Q21A 2EFEB 3NDPA 4AK9A 4LSGA 4O0MA 2BM1A 1D2MA 2I3BA 1Q20A 1ZNWA 2DPXA 4BRWA 1CF4A 3IQXA 1Z2AA 1BS1A 3IIMA 1GRRA 2FSIA 1NG1A 2VLIA 4KAXA 2ODBA 1X6VA 4Z1MD 4FN5A 1HH4A 3W8NA 2AWNA 3NH6A 4JL6A 1XTIA 3QKSB 3SN6A 3QKRA 3W5JA 3NKVA 1DS6A 1T3LA 1X1RA 2GF0A 1TQ4A 4KYUA 1T91A 2EWVA 3WNBA 2WSSD 5TB5A 5JRZA 4TLBA 1KNQA 5DLQC 4A6XA 3B2EA 2QEQA 4BZQA 2AK2A 2W6IA 2HYDA 2ATXA 2CHVA 1VMAA 2RGNC 1E0KA 4XD7A 3ECCA 4NCHA 4TMKA 5FUVA 3RRZA 1O87A 4HB2A 3EC1A 4PPFA 4QHYA 4AC9A 2ZJYA 3HR7A 4OJQA 4IVQA 3KUCA 1GKIA 2BBOA 2FEOA 2RHDA 1U8ZA 1I2MA 2WV9A 4RFSA 3TR0A 4PQRA 3TW8B 2VP2A 3IKJA 5CYOA 2HYIC 2ZI3A 4Z51A 1RJ9A 3GLFA 4M9SA 4DDWA 4TTQA 1HUQA 3OE7A 1ZD1A 1VG1A 3RS4A 2WZQA 3K0AB 1RRCA 2YV5A 5KDOA 4LI0A 4CT4B 4TMXA 4AKHA 2ZUCA 4CT5A 3QKRB 2WKPA 4TTPA 3CF0A 4A8JC 4LYFA 5K8IA 3T61A 4L15A 3J81k 1OFUX 3HYTA 3UMFA 4QM6A 3DPUA 4R98A 3OAAD 4F4JA 1AIPA 2I1QA 3KKQA 2GDJA 4BFTA 2REOA 5CJPA 4M1KA 2H92A 1MR3F 4RD3A 2WIAA 2W6JD 5C15A 3CZPA 4JLMA 1M7BA 4HAXA 1X86B 1XMJA 2EYUA 4NH0A 3LA6A 2CE2X 4JL5A 1KO7A 1MO4A 2H5EA 3PV0A 4OQMA 3MWJA 4MYUA 5HZHA 3OEEA 3QXXA 2HLDA 3SFZA 4NU0A 3RDPA 3FYHA 2QAJA 1E1RD 1YZLA 1GKUB 3GLFB 3B6EA 3I73A 4Q7MB 5JJLA 1ODFA 1YR9A 2HCJB 2IT1A 4NKRA 1HE1C 1YE8A 5FL7D 3K70D 1XTSA 1NKSA 1L8QA 5F9FA 2O52A 1KOFA 2WJHA 4V02A 4PC3A 4CEHB 2V8OA 3AF0A 3HYRA 4G0NA 3AVOA 3A4MA 4URZR 4URYR 2R2AA 4DVGA 4QC2A 4HDCA 1NIPA 1AJEA 2QL6A 1UM8A 4NCNA 3K9HA 1R0WA 2GCNA 2ZSFA 4WW0A 3RS3A 1ZC3A 2RHMA 1Z6XA 2WJIA 3NBXX 1MV5A 5D3MB 4DIDA 2RGGA 3BH7A 1FUKA 1T0JB 4RKEA 1Q1QA 5TDHA 3AVTA 5DN6A 4CEJB 4M1WA 5LDDC 1EX7A 2N46A 4ERNA 3C5HA 4F7WA 3GLFE 1A82A 2AK3A 3KB2A 1G3RA 3EZ2A 4QBGB 4UXJA 3X1ZA 2FE4A 1WCV1 3GCGA 1JPJA 1U0LA 4GOJA 4D4MA 4CEIA 4TLEA 1B23P 5HE8A 4QG7A 2BBTA 4GOXA 2VHUA 2QT1A 3OEHD 3TUJC 3RANA 2V7QD 3Q9LA 3KQLA 1S1CA 1IXZA 3GLHA 3RHFA 3U3RA 3W3ZB 4PPGA 5AJXA 3V00A 2EW1A 1WF3A 4IOLA 4FIDA 2AFIE 3GLGA 5B2ZA 1N0WA 4KYIB 2A5DA 3NWJA 4PFSA 5BN3A 1YHNA 3T1TA 1JNYA 1TUEA 1S9DA 3BH0A 1YZKA 4Z1MA 1PVOA 1OFIA 2FNAA 4PTLA 1EGAA 1U0JA 4G3XA 2XJ4A 2KBFA 3QOFA 1Z8FA 2Z0MA 5HPYB 2GVZC 2F1HA 2F9LA 4LHYA 2WSSA 4EQ6A 4H1UA 4LUCA 1XZQA 4Q9KA 1KSGA 3CRMA 2ZE5A 4ESHA 1E69A 3DKVA 1FMJA 2VH5R 4B44A 3PEUA 3GJ4A 4L8GA 1OSNA 4Q19A 1KDTA 4TZ0A 1KI9A 1VIYA 4DCTA 3TW4A 4OJKA 4GT1A 3HPRA 1ZM7A 2A30A 4ZO4A 5ANRB 1P61B 5FOUA 4IKEA 3SYLA 3A4LA 4PZLA 1S2MA 3AGQA 1KMHB 3GLGB 4OHXA 1XTQA 2P6RA 4N0EA 2IA5A 5FTKA 2VP9A 1II0A 4CF7A 2FGKA 1A5TA 4KCGA 4LC1A 3VU9A 3KJHA 2IC5A 3Q5DA 4DSUA 2QZ4A 3NVAA 2AN9A 3FMFA 1WQ1R 1N6OA 2J0UB 1K5DA 4JLVA 3PEWA 3IQWA 3MJRA 3C6AA 2XX3A 4EQ6B 1BO6A 1KHTA 4WBSA 3FMIA 3OAAA 1IJEA 2CNWD 5JZVA 4KLNA 1KO4A 1R5NA 4W5JA 1LFDB 4IOJA 3GLHE 3KQUA 1KJYA 1W2GA 4PHTA 2W6JA 1PLLA 1TF7A 4E22A 4A9AA 5DHFA 5BQ5A 5AUNB 4Q4JA 3IO3A 4PPQA 5HKKD 1UKVY 1TUIA 5IRCD 2RGXA 1PLKA 1FP6A 3CUEF 2FSGA 2IXEA 3AVWA 5LB2A 1M1YE 5LB4A 3QSYA 4DT1A 2CMKA 3AUYA 2FPKA 3IHWA 2ZVPX 2G3YA 2ZRNA 4HSEA 4EPYA 5B64A 4LBVA 4MUAA 3RS7A 2JJ2D 2VF7A 1E1RA 3SJCA 1LB1B 2OCYC 1FW6A 2O8FB 3DKPA 4KXFB 4P32A 1G8FA 3GJ7A 1EWQA 5FL7A 4YDSA 3KTAB 4QHTA 1MABA 2R44A 4Q1DA 5FOSA 1SVWA 5DYIA 2EU8A 3JVVA 3O8DA 1E99A 4NHOA 1TMKA 2V4ZA 2OBNA 1UDWA 3REFA 1E4VA 1NL3A 3CRRA 5JECA 1GNQA 2QAGC 2BEJA 3A1VA 3A1UA 1K5GA 3HDTA 2VBCA 2PX3A 4TYNA 2ZXUA 4ILEA 2XEXA 1Q1BA 5FPTA 4Q4JB 2QTVB 4R2HA 1B0UA 1Z0JA 2ZJ2A 3OFND 5B58C 2ZVQX 3MCAA 1KKLA 4Q4LA 1JBKA 3ZZTA 4DB4A 1RRPA 3NC0C 4M0LA 4DT1B 4C0AC 3IO5A 1TQDA 3TRFA 4KSCA 3SBDA 5FUYA 3LAWA 1AS2A 4X8LA 5FR1A 2IWRA 3I8XA 3KX2A 5SZIA 5FPKA 2GRJA 3QJYA 3OEHA 2VHJA 2V7QA 1YZNA 3ASYA 4L9SA 4Q00A 3W5IA 1E0JA 4C0LA 1Q12A 3ZS9A 1DAIA 1SVSA 4JT2A 2WTUA 3K70B 3AUXA 3GFTA 5LBIA 3OZXA 4V0KA 3GD7A 1CR2A 4UNNA 2OLJA 2CE7A 4LV6A 1QG4A 1Z6AA 1E0SA 4MRRA 2QM8A 2ZYTX 1U90A 4C0KA 1KJWA 2W0SA 3KFVA 1XMVA 2I4IA 2VL7A 5JBQA 1SVMA 3I61A 1OV4A 1YU9A 5SZHB 2HXSA 1Q3TA 1Z08A 3IDQA 4A0RA 1EFUA 1P9WA 2Q9AA 4FMDB 1AZSC 1G3QA 3NDBB 4XWAA 2PX0A 1SKYE 3B1YA 4KODA 3MGCA 3E5HA 4NYJR 4PANA 621PA 3AVPA 3W90A 2MMGA 4XTRA 3PUWA 3AGPA 3OESA 3CO5A 1RW4A 3ADKA 4OL0A 2DR3A 2GVDC 4Q9LA 3SZRA 2XTMA 1RRGA 2R6FA 1N5JA 4BFYA 721PA 5FPYA 4W7SA 3CNLA 1OF1A 1BIFA 1XD8A 2QQ0A 3C16C 1W36C 4PAMA 2HF8A 4LK2A 2BWJA 3V4RA 1E2LA 1MO3A 1OXVA 2ZJ5A 1D8TA 3DL0A 3FFAA 2Z4SA 3Q85A 3MWLA 1P62B 2HXYA 3LH5A 4TT3D 3EWAA 3ONWA 2GCOA 2PJZA 3UK6A 2RGNA 1CJKC 2X8AA 3DEFA 4NMMA 4IFBA 4ACBA 4NYJQ 1JAIA 4NL4H 1XRJA 3NHBA 1I4DD 4B71A 4G5SA 4B33A 2G77B 4UJ5A 2FFBA 2EYQA 3QKTA 3ZD7A 1U9IC 1G5PA 1MRNA 3H2YA 4B35A 3QF7A 4US0R 3X1XA 4AD8A 3BS4A 3B85A 2PZEA 2RGDA 5G3YA 2CNWA 2PEYA 3GFOA 3D31A 2MSCB 2XTNA 1A2KC 4HEJA 4F92B 1MT0A 1G18A 1WDTA 3CPJB 2NMVA 1RKBA 1PLJA 1VCMA 1U0HC 5HKKA 4A8JA 5L3VA 2H8KA 4IHQA 2ZI4A 2PLFA 3RRMA 4DDTA 1NBME 3CWQA 1BYIA 1GITA 4II7A 4ON9A 2GXAA 4GZMA 4A2PA 1U8YA 1E9EA 5GJBA 2WMNB 5JHGB 4HATA 1DO2A 2JJ2A 1HYQA 4Q1BA 4D80A 1T9HA 1M2OB 3T5GA 2YKGA 3LDAA 4DLUA 3EX7C 2P5TB 2P6NA 2IYLD 4GFDA 3LNCA 1N6HA 2W2VA 3TBKA 2VHQA 4OI1A 3C41J 3HU3A 2D2FA 4JLJA 2BCJQ 4US2R 1F6BA 5TY0A 4LJ7A 1WA5A 2SHKA 3TVDA 2G6BA 3B78A 1CR0A 1ZJ6A 1FL9A 1XEWY 4CVNA 3OIUA 2X77A 5EQTA 2CHGA 3KXKA 4A2WA 3AVYA 3C4JA 3EIEA 5FUXA 3SDZA 1I4TD 3ZD6A 1H8ED 1M34E 4D4JA 1SHKA 1LY1A 4V0NA 3OFNA 2CK3D 1E32A 2OUKA 2FA9A 4ESVA 2A5FA 1DBSA 1NVUQ 2O0JA 4RKFA 5CB6A 4B47A 4BFUA 1XEXA 1OLOA 5KHOC 3DHWC 1TADA 1BMFD 2JIZD 4MA4A 1S9HA 2V6IA 4PSAA 1TX4B 4GDFA 4Q18A 1G6OA 1VYTA 3ADDA 2CDNA 2GZHA 4DLWA 4QNMA 4OKSA 3WMEA 3AM1A 2CLCX 4TN1A 3PCRB 821PA 1Z0IA 2QI9C 2QSYA 2ZANA 4N0DA 5KSYA 2KSQA 2P0EA 1FOEB 1VCNA 1G7SA 3FDIA 4NTZA 4XVQA 1M7GA 4LJ9A 4OQNA 4XH9B 5C2JB 3U4QA 1K8RA 1DTSA 3MAAC 1HV8A 5GJCA 5BWMA 1L4YA 2N1BA 2BBSA 1J70A 3PJRA 2IWHA 5KSOA 2HCBA 3SI7A 5H8WA 3I8SA 3T5DA 2FN4A 2HJGA 2F6RA 4ZI3A 3F0TA 1ZINA 1OIVA 3AVXA 5J4LA 4B2PA 1RYFA 3UWKA 1VYUA 2AFHE 2GJKA 2AR7A 3QG5A 3PUZA 3QVUA 1T5LA 4Q4AB 3WXMA 3A36A 2VHCA 4CZ2A 3R9IA 1VCIA 5IF9A 4RFVA 1Q21A 4KO8A 4HI0E 4NYMR 5IT5A 3SBEA 2YHSA 1YVDA 2CLDX 2DY1A 3RRNA 2EFGA 4ACAA 1W44A 4P31A 3QXCA 5C2DA 2LKDA 1BYUA 1G16A 3HJNA 4TT3A 4TMTA 4ZDKA 1ZUIA 1GG2A 1SVIA 2GCPA 3Q72A 3BIFA 5D3QA 4QNRA 3SHFA 1CTQA 1EFTA 3LX8A 2VSXA 1W36D 2QROA 4HZUB 1M7HA 4RVCA 1ZD8A 1US8A 1XJCA 1G8PA 3NBFA 4DEYA 2EFHB 5DISB 4GOKA 3AF3A 1IXRC 4EUNA 2ZRJA 4Q48A 3ZYCA 5F98A 4ZDIA 5GVRA 5C4GB 2HJVA 2VP6A 4DCVA 4U7DA 4PAQA 2J7KA 2BC9A 1XF9A 3NEYA 1E1QD 4PC6A 4NYMQ 3X1WA 5JEEA 1SXJC 4JYCA 2VSFA 4Q4HA 2A7QA 3W34A 2HDNB 2VTKA 3G5UA 5GVSA 1BH2A 2QN6A 2C95A 1N6LA 2OBMA 1M74A 2VHTA 2FF7A 4YDHB 2ZRFA 4Q02A 3FVQA 5HZKA 3ZLJA 4Z8YA 4B73A 4GBMA 3FOZA 2J87A 4JLNA 2IYVA 5KNDA 3VTKA 4F91B 2IYXA 3P20A 3VMFA 2BMEA 3I1FA 3PUXA 3A37A 3QVVA 3CNNA 1IM2A 4MKFA 2ZROA 3MRSA 2DFKB 4NPHA 4TYYA 4MUBA 2AX4A 4JSTA 2WIBA 2GXSA 4JVNA 1YRBA 4BLRA 5B57C 1IY0A 2ZSBA 5F9HA 4L5BA 2XXAA 4DUGD 1FTNA 4D0GA 3VQTA 1WBDA 1E2FA 1IHUA 4L4UA 5HCNA 4BRUA 2D7DA 3SQXA 1KK3A 2ZRLA 1G291 3GFPA 4IFEA 4CYMA 4G5GA 4F4IA 2V55B 1AS0A 3GEIA 3U7EB 4QM7A 2O0HA 2QQEA 4LRWA 5H68A 4GMXA 3VX4A 1GRQA 2ZE8A 4AI6A 4YMSA 4KFSA 4Q9IA 3IIKA 4LHZA 5L3RA 1H8EA 2IEZA 2C03A 3A1WA 4IJMA 1X3SA 2NQ2C 4FMCB 2CK3A 3SJAA 2VYFA 2ZRBA 1LF0A 1Q1ZA 4URVR 4TMZA 1QHNA 2WVJA 2QAGA 2D74A 3SYNA 3CRW1 2ZR7A 3WRXC 2XTZA 1Z0AA 1JI0A 3CX8A 2GZDA 4I99A 1BMFA 2JIZA 1XWIA 2P65A 3VFDA 1HE8B 3LD9A 4URUR 2RMKA 4IDNA 4OK3A 2XXAB 4TQUS 2R8RA 3U3MA 1K6MA 1LS6A 4CDGA 1R8SA 1E9DA 3QXJA 4B6EA 4TYWA 2RAPA 2ZETA 2HV8A 5JFGA 3HWSA 5AK0A 2A5JA 2ZU6A 1C4OA 2H1LA 4PQFA 1P5ZB 2GWHA 3KZ1E 4MQBA 4B74A 2JLZA 1EXMA 2QORA 3ADBA 4TL6A 2NO6A 3QPVA 3AH8A 3PITA 4WVFA 1DAKA 5FBWB 2AL7A 2FOLA 4JLKA 1EG7A 4B6FA 3I92A 5EJEA 3U61B 2IXFA 1QZXA 3VR1A 1SULA 1U99A 3QI2A 3EZ9A 1IY1A 4PO1A 3AKDA 4EFLA 1R8QA 4A36A 4B32A 2GZAA 1R2QA 4LY6A 2WWWA 2ZRMA 1EWRA 3MFYA 1WP9A 3MG9A 4I1SA 2QPAA 1XD9A 1MRSA 4RJLA 4XJXA 1XCGB 1NN5A 2UZ3A 3SYKA 3K1JA 1YR8A 2AD1A 5GJVC 1ESMA 3PXGA 4AURA 2GILA 4RCZA 1PJRA 4MGZR 2H16A 4DLXA 4P0TA 3VNUA 4K81B 4LWZA 1IQPA 2IL1A 1UKEA 4KLZA 3B9PA 4EPXA 2ZSEA 4HAVA 4IEEA 1TQ6A 1JQLB 2ZJAA 5IK2D 4KBGA 3U7HB 1G5RA 4DSTA 1N6PA 1KDRA 3AEZA 1OW3B 1ZNZA 3EZ7A 5FOTA 2Z6VA 3CM0A 4KI0A 4Q01A 3UMRA 2OFXA 2QG6A 3JZAA 1T8UA 5E7JA 2GEDA 2DFNA 1XFAA 2ERXA 2O0KA 4JL8A 5HTKA 4JBXA 1E1QA 2KWIA 1CJMA 4DDUA 2JAQA 3FKSD 2IX3A 3SC3A 3VHLB 5EXSA 2UVQA 1TU4A 3L43A 3FMPB 4UXIA 2W83A 1N6RA 2C9OA 3U2QA 1E6CA 1U9IA 4RFSB 1DG1G 3VNVA 5BW8A 4KU4A 3CLVA 1UBCA 1F5NA 1RIFA 1RE0A 1RJ9B 1U2RA 1T8TA 3DOFA 4MH0R 3B13B 3EAQA 3H1TA 1UBEA 3TMKA 1SXJD 1J7KA 4PX9A 1D6JA 1DVRA 1AGRA 2V54A 1VCOA 1X1SA 4FWIB 2QTFA 2QGNA 1GAJA 4PAOA 4WZ6A 1W36B 3UMSA 4DUGA 1NVVR 2CCJA 5IHPA 5LD2B 1TF5A 3WMGA 4A4DA 3FB4A 2X2FA 3C6HA 4RD1A 3EA0A 1W5TA 1P9RA 3BWDD 3MJHA 1HT2E 1GSIA 5E7IA 1QHIA 5F2EA 5M1OA 3L0PA 4HZIA 4DCSA 2D3WA 1LF5A 3LX5A 5CM9C 2ECKA 1G9XA 1HA3A 4P33A 3T06B 1KAGA 2YVUA 1XU4A 3P26A 4YMUA 3SHWA 2W0MA 2WWYA 3MSXA 3F8TA 5JRJA 4B3DA 1F3OA 1JB1A 3EA5A 3C14C 3T12A 2G83A 4QRHA 1QVRA 3E1SA 3TUIC 4MRPA 4B3CA 1FFHA 1ZU5A 2JJ8A 2R6DA 3KKMA 3TNFA 2CBZA 2WM9B 4LHXA 4KSBA 1Z29A 1RVDA 4DC9A 3T1VA 4WXRA 1NVVQ 4EPVA 1OHHD 1AZTA 1ZAKA 3VX3A 1F2UA 4E03A 1E2KA 4B48A 1NBMD 5TMPA 1DE0A 1EFRD 1G17A 3VKWA 1IAQA 1AK2A 5EE3A 2KJQA 4EJSA 1XMSA 3CW2A 2OFWA 3UG7A 1QBKC 5KNCA 1HQYE 2B6HA 2QBYA 2XSZD 2J0VA 3X1YA 2X19A 1V5WA 3KFXA 1DAFA 2XZLA 2BV3A 4LBWA 3CB4A 2Q3MA 5DH9A 3GMTA 4HB3A 2I1VB 2WKRA 5BN5A 3DMNA 3BD9A 4RD4A 1IN4A 1G4AE 3QENA 4B3FX 3I72A 3M6AA 4LC0A 2G1KA 2JLXA 1G8HA 3R8CA 1NY5A 2GETA 4C0QC 4HDOB 4RZ2A 5M1QA 4TL7A 4CEIB 2R6AA 4N1AA 4NCJA 4M53A 2NPFA 3DZ8A 3GJ3A 2J1LA 2Q3FA 4AYTA 4D4LA 4IW3B 1RZ3A 4WA7A 4ZV4A 4A0HA 1KNXA 3GLHB 3B9QA 1X8KA 2GEVA 4RCYA 4OI4A 3AP2A 4BLSA 5JMTA 3QIAA 4BFSA 2OAQ1 4R7ZA 3ZIAD 5UKDA 1F2UB 4DLYA 3Q8XB 1VKJA 4BZPA 4RD6A 2WOOA 3A4NA 1KDPA 5EUMA 5BYJA 1IONA 1E94E 2J7PD 1YRAA 4JVSB 3ZZ0A 4EJSB 1EX6A 3N70A 4A2QA 1OIWA 1OH6A 1II8A 4ZPXA 4PZZA 1S3GA 1G4UR 1VHLA 4Z8XA 1Z6YA 2ZPTX 3TKLA 3BK7A 1OJLA 5J40A 1NMXA 1MKYA 3B1ZA 5FH9A 4YMWA 5IK2A 4B3XA 4EFNA 2OE2A 3I32A 4BFXA 1E4YA 1J90A 4JZKA 3SS8A 1Z22A 2C78A 2B8TA 1SHZA 2VRWA 2Z83A 3EG5A 2YZ2A 1COWD 1JEDA 3KXLA 3KQNA 2DWOA 2BHRA 2ZITA 2Q21A 1XDBA 2PZGA 3LXXA 3R7WA 1UJ2A 2W2TA 3FKSA 1S0UA 2ZTSA 1E2PA 4DXAA 3WYAA 2O8EA 3TGPA 3K9NA 3FPAA 5FBQB 1OYYA 2WOJA 1JR6A 1FNMA 1G21E 4I1UA 4EPWA 4HAZA 1ZNXA 4TLDA 3VAAA 2IXGA 3VU9B 1SXJA 1N25A 4NCKA 2JLWA 2JLYA 3DM9B 2PMKA 121PA 3IEUA 3AKEA 4TL8A 4MDFA 2B8WA 5G53C 1IOZA 1ZP6A 1WRBA 2FH5B 4B3GA 2PCLA 4Q03A 2DWPA 3BB4A 1BOFA 4DCUA 1OH7A 4HAUA 2WWHA 2J41A 5FPHA 1DPFA 4BE7B 5FI1B 2HT6A 3LWNA 4FCTA 5TVKA 3AKYA 4I4LA 4UJ3A 1ZM2A 3IHLA 3AQ4A 4KFRA 3BJIC 4ASUD 1WMSA 2OXRA 4MRVA 3R7WB 3G0HA 1Z83A 4KFTA 3B1WA 5JHHB 1CP2A 3K0CC 3ND9A 5DE3A 3KQKA 2O8EB 2WHXA 3F3YA 1E9AA 1W7AA 1MO6A 1Q0UA 1SKYB 1XPRA 1XTRA 1DEKA 4GL2A 2QSZA 1CXZA 1E9FA 1OH5A 1JEEA 2EWWA 1U94A 3GJ8A 5TV2A 3EPKA 2OCPA 2A5YB 1KO1A 4AYXA 5KO2A 4OI0A 1PUIA 2C9CA 4DEXA 4IOMA 1ZC4A 1MABB 1TAGA 1A7JA 1OHHA 5EZ5A 2DWQA 4BLOA 1GWNA 4K46A 1ZYUA 5CDFE 1NBMA 2G1JA 3L0OA 1EFRA 2ZR0A 2OHFA 4JVMA 2HUPA 3UXMA 3A6PC 5EP2A 2BKUA 4EFMA 1J99A 3EASA 1KSJA 5TARA 2XSZA 5M1NA 2OSBA 2VEDA 2Y8EA 1Y3AA 1TU3A 5DI3A 5JLJA 5FL3A 5M1PA 1SGWA 4POAA 5CYPA 2YOGA 1CEEA 4N3NA 1YJ5A 4OHVA 4DJTA 4DSNA 4G5RA 1KI8A 5KOYA 4FI3C 4UNSA 4X8OA 3WHKA 1KK0A 1UFQA 2WPDD 3N2IA 3UANA 5L3SA 2FJUA 2R62A 2VPPA 2VP5A 4ZDJA 4Q66C 2R9VA 3M1IA 2QMOA 3X2SA 2LCFA 1SXJE 4MGIR 2IUUA 4UXHA 2F43A 5JCZA 2QY9A 2OEPA 1XMIA 1XPUA 1NIJA 1NP6A 1W49A 1FQJA 1YZGA 5DHAA 3C8UA 2C77A 1D2NA 2WWIA 4AG6A 4KVGA 1U81A 4LV8B 3TSOA 1P2VA 2AXNA 1W4AA 3LRPA 3T1OA 2QTHA 2BMFA 4FMDF 3EZ6A 4HLUC 5JCPA 4HUTA 3ZIAA 4YMTA 3ZH9B 3RLFA 2ZAMA 2A5GA 2UZIR 2WWGA 2J7PA 3U44A 3TLXA 3V9PA 1S8FA 1OXSC 4MRNA 4PSKA 3I4LA 4G01B 4L16A 2V6JA 4OQFA 2LKCA 4OHZA 5C18A 5KPDA 1SKQA 1G3UA 1IBRA 3THWA 4BEBA 4DBLC 3FE2A 4OHYA 4QBFA 4V0OA 3I5YA 4LDJA 2QENA 2GEUA 4TQAA 4TSFD 2FEMA 3TAHA 1R4AA 5CK5A 3WMFA 1FQKA 1D5CA 4BFZA 1VG8A 3ZS8A 4IDHA 4Q9JA 1GZSA 2R65A 5EE9A 1HQCA 3AVQA 1COWA 3LW7A 2C8VA 3A58B 4DZZA 4M1OA 2WAXA 5FBRB 3RSLA 4EIWA 5J4KA 3N5CA 1GNPA 4CGZA 5JJKA 4MKHA 5CK4A 4BLQA 2V1XA 1GILA 2C2HA 2D7CA 4JLAA 2CHQA 3FHOA 4AIIA 1S96A 3AB3A 1W5SA 2P2LA 2GCOB 2JDID 3P32A 2YC2C 4G1UC 4M1TA 4U5XA 1EK0A 1E9RA 4TL9A 4M9XA 4DCNA 1G7CA 3KJEA 5HE9A 4IXMA 1E0AA 1QHSA 2JEOA 5JEDA 1Y63A 4R9UC 1S1MA 3VHXA 1GUAA 3OIVA 2WBLC 4XTCS 2XOKD 2IHYA 2WWXA 3PUYA 1ZW6A 2PCJA 1R0ZA 4D2IA 4YXWD 3BFVA 2GK7A 2XNSA 1E96A 1M6NA 2GXUA 2KE5A 3BXZA 3E2IA 4QFMA 4D6PA 3K0FA 4EAQA 1VG9B 4BPBA 3JZMA 1KJZA 4W5HA 4GRAA 5EXTA 221PA 1GP2A 3CONA 4A8JB 4ASUA 2OT3B 3QEJA 4FCVA 2GJAA 4J0QA 1TL7C 1ZVQA 3ZVRA 3KJGA 4HYYA 3WBJA 2HF9A 3THXA 4RD0A 3P27A 3EARA 1LW7A 4M9ZA 3TAUA 2ZRCA 1DOAA 2RGCA 2O8DA 1Q3HA 1E2HA 1J2JA 1QVAA 3I62A 4PPNA 1JECA 5GADl 5L3QA 3NC1C 1W48A 1CS4C 4PSVA 2ZU0C 1Q44A 2N42A 4B3BA 2NIPA 2F3RA 3DO6A 4M9QA 2ZRPA 5TXGA 3REGA 2ERYA 1S3SA 1JALA 3BC1A 4M4SA 3IUYA 1FUUA 4ARZA 3VKHA 4IVPA 3B60A 2TMKA 2WKQA 2FMXA 3K0FB 3VR2A 1KTVA 2RCNA 1XCPA 4C0HA 1G7TA 2BMDA 2EFDB 3ETLA 4MGYR 5EUQB 4LJ4A 4TYQA 4Q7LA 4LZZA 2REBA 2WPDA 4LPKA 4UNQA 1Z2CA 2E87A 2ZSAA 3VKGA 1ZM9A 2ZIAA 4B2LA 1KI7A 1CIPA 3MMPA 4U00A 3THXB 2QU8A 5E7MA 4ZIRA 1N5IA 1XEXB 4GP7A 2YC4C 2YOFA 2W00A 4LCBA 4BFWA 4PQYA 5E3HA 4CW7A 2O8DB 1D9ZA 1XBTA 3TVTA 3L8ZA 2JCSA 1KY2A 4ABYA 4DLRA 4H9GA 4EKDA 1ZIOA 4LYHA 5AJVB 4A92A 5CM8B 2FWRA 1T4GA 4NYIQ 4MKIA 4C0BA 5C4MA 1SZPA 2AKYA 4C9BA 1G8GA 1IJFA 4MYCA 1XD2A 2DHRA 3BGWA 4Q1AA 2AD5A 1Z0FA 2JGNA 3W6PA 1JJ7A 1VIAA 3U4QB 2KBEA 2BMJA 5FFMA 2QP4A 1E79D 3I5XA 3WHLA 2NZJA 5EE5B 3JVUA 5FOXA 2CCGA 3HPQA 2ZJZA 1NN0A 4M2LA 1F60A 1G64A 1T0HB 3VR3A 4JKIA 1KI4A 3PG5A 1DG3A 1JXMA 5FTJA 4LHVA 4PR0A 4TSFA 3RS2A 4QKQA 1HY3A 4HDQB 3MLEA 3L2OB 2QNRA 2Z43A 2ZS8A 4ZIRB 3DVLA 4GPTA 4ZKDA 1YQTA 4RZUA 2IYSA 1NN1A 3R20A 4JLPA 1T3SA 2A3RA 2GJ8A 3LY5A 3AP3A 2CVHA 1D2EA 4D81A 4KITB 1P7CA 2B92A 5KSPA 5DYGA 1YZQA 1KZGB 2CJWA 1NSTA 3CF6R 2ASEA 4P4TA 3O47A 3M0EA 5E4FA 1X8LA 1KO5A 1SVLA 3NTUA 2AHOA 2J5XA 1L4UA 3IPYA 2RGEA 5FUWA 3UWOA 4IOKA 1P72A 4D0NA 2J45A 2JDIA 1OB5A 1XX6A 1Z07A 3U7FB 1Z06A 3W6NA 3QKUA 2IEYA 1U98A 1IXSB 2C99A 1P2SA 2F1IA 4TYPA 4HB0A 4LYJA 5K8LA 2ZYUX 3U3JA 3BE4A 2IS1A 3I3SR 3U6KA 1UF9A 1US8B 2OZEA 4FMBB 4RZXA 1NN3A 1E2DA 2QPOA 4QBIA 3R8FA 1R10A 2XOKA 2F1JA 3QNUA 4WOPA 4YXWA 1P6XA 2A78A 2KB0A 3P4XA 4QGGA 2X1VA 3H4MA 2YJTD 3RC8A 3SJZA 1X8JA 2IS6A 3KXIA 2IYTA 3CKLA 2BCGY 3Q5EA 4Q4HB 3TK1A 5M04A 3SNHA 4NBSA 2ONJA 3RYTC 2ZS9A 2B21A 2IK8A 4TWZA 5KDLA 1KI3A 1HTWA 1XEFA 1GFIA 4P4UA 3RWOA 3EIQA 1N5KA 1NY6A 3LV8A 1P2TA 2NG1A 4B76A 3U60B 2PT5A 3T35A 1NMZA 5P21A 3BH6A 3TE6A 4QXAA 2FGJA 4NZYA 1Z0KA 5FBLB 3GLIA 1W4RA 4JBWA 4DKXA 3ZDQA 2IYWA 2ZRAA 1NLYA 2REXB 5J5CA 1OXUA 1XJ0A 4Q1FA 1NLFA 3HU2A 2NGRA 3GJ0A 1QHYA 3W3AA 5FTMA 4FMCF 2Q3HA 3ASZA 2BEKA 3UATA 4A6PA 2OBLA 3QEOA 2XB2A 2AKAB 2D4HA 1EESA 2PT7A 4TMWA 2FFHA 2Q9BA 2NZ8A 2WICA 3E70C 4PC1A 3WRYC 1NG9A 4KJZA 1Z6TA 2XNDD 1D9XA 4WZBE
chains in the Genus database with same CATH superfamily
3OLCX 4JLOA 3SZLA 5TQ2A 5F3DA 2BMAA 4JKBA 4JDUA 1NRJB 1FFSA 3CCRN 1JCEA 5AW8A 2QAGB 4AO6A 2O4IA 3UK7A 4JBHA 5FTWA 1T4BA 4DR3K 4J8FA 1KJ9A 3TIFA 4DQKA 3GV0A 4BBPA 4YAUA 2BR3A 5C0YA 2OQVA 5AVSA 1HOXA 5AWFC 1ULUA 2QG9A 3CZQA 1UZMA 2DECA 1GGEA 5E3JA 3BY5A 1O9GA 2FEKA 2AQKA 4ID1A 2C98A 1IQUA 1L6RA 1IHPA 4HCCA 3A6GA 3CIOA 1ONSA 2ZRIA 2C5FA 3PGXA 3RWBA 1FFCA 2WWFA 1W1WA 1DHTA 5THQA 3L0YA 4MYDA 2HQRA 1O94A 1IN5A 4B5LA 5C8VA 4U7TB 2ZPUA 2FPIA 2W90A 3P2MA 5KHLB 3AR7A 3VKUA 4JYAK 2C84A 3UMYA 1U7WA 5EE0A 2IODA 4O6VA 1BNCA 3TEMA 4Q3KA 2HSZA 5JO0A 3ZQJA 2KTQA 1XQ6A 2UXBK 3JS6A 3KR2A 2XGSA 5CG1A 1E61A 1C1DB 1QP8A 1KI6B 3QVWA 5DYWA 2IY8A 3EK2A 5HFJA 2C9DA 1KGDA 3UK2A 1H6AA 3C6KA 4KHZA 5B6JA 2VSNA 4P3PA 5D7BA 1BAPA 3ZY6A 4EAHD 3FFBA 3JAMA 3KQTA 1FJHA 1KETA 4IP0A 3T0GA 4DLVA 3CM5A 2NTJA 4QUEA 1QX4A 3LPAA 3BGRA 4BV8A 3R9KA 1AOXA 2QM7A 3KQVA 1BCOA 1G21B 1XLUA 2J3KA 4K8XA 2X1LA 2JCYA 2B4JA 2BW0A 3RARA 3FTPA 2GJ9A 3ECSA 2JZOA 4XCXA 2XBLA 2W6MA 3IMCA 1OIXA 5I9SA 3LLUA 4OQ4A 3V4SA 3T1QA 3S41A 5EXPA 5B1EA 2JJ1D 4ER6A 1D5AA 1II8B 1NMSA 1OILA 1O96A 2EX3A 1CQXA 2XB4A 3ZU2A 4TS3A 3WNQA 4QL3A 2A41A 4LYDA 1NOYA 1HLFA 3HBAA 3NDKA 4YT8A 4L57A 1F48A 9LDTA 2R6GA 3PO5A 3ANMA 2DT8A 3RJTA 4XIUA 4BFVA 2NUPA 4ZJZA 1SKWA 4JP1A 1DHRA 3CCFA 2CLKB 2C9YA 3MNFA 4LZJA 2P9NA 4BMNA 4ZV9A 4TWBA 3DZCA 4PIVA 2HAEA 3ZVLA 4ZO7A 2CVZA 1T2VA 3WOVA 4GMDA 4DCHA 4J0DA 4DPLA 3UAWA 1A5XA 2BP7B 1TL1A 1H8HD 3BJZA 4EBFA 2YY5A 2A59A 1DLJA 4ZV7A 3LBNA 2O9JA 3DG9A 1BCSB 4I36A 4CL3A 2JLQA 4P92A 5FOWA 2BFFB 3AW8A 3H7IA 5EGNA 1LDBA 2EF0A 4MMYB 1IM8A 2G07A 4JZYA 4J7XA 1W4CA 4PS1A 4MQ3A 5HOOA 4YEDA 1EVQA 4MUJA 4AULA 2GAAA 1UAXA 4M60A 4B8YA 3EW9A 3GDOA 3TJRA 3BFPA 2CNOA 2HSTA 1H0SA 2RH4A 4F84A 3DO5A 1SQFA 4R51A 1C7RA 2WAAA 4NULA 3E61A 1VLZA 3NOQA 3A6FA 3NG1A 2VCYA 3E8SA 4X1KA 2HHUA 1PQYA 4MZXA 4KHSA 2PV0A 5ER6A 4KLAA 1HNIA 1A9ZA 2YV3A 1U8FO 4AG5A 3UT0A 4DHWA 3CETA 4R5PA 4UPVA 1YS4A 2IGTA 2UKDA 4LOAA 1PR3A 3KT3A 5AK4A 1CKEA 4UCXA 3ZBTA 1JVSA 2ODAA 3DLKA 1YCGA 3I01A 4BV2A 4C43A 4G84A 3ZSVA 2O7SA 1JSXA 2BVNA 3TLJA 5AW1A 6LDHA 3OO0A 3BE5A 1EVLA 3LQRA 5KYGA 4KMOA 5K3AA 4Q9AA 1PS9A 4ARBA 2IZ6A 5EJ6A 2MR5A 1MUUA 5AHRA 1WTAA 4D8TA 4V0MA 2FMUA 4G8CA 4YAGA 2BM0A 4FB4A 2COEA 2V5VA 3A6HA 2CV2A 3R3HA 3Q3JB 3KDAA 4C4TA 4HRAA 2RH8A 3C5CA 4JGBA 3V46A 1W0JA 1K97A 1R8XA 3O8CA 1XXHA 1RCTE 1KQGA 2IYQA 3OF3A 1ZRNA 4FYPA 3KSZO 3LAKA 1HNXK 3IFRA 3TTXA 4I6MA 5EXEA 1P4SA 3QJ5A 1AB6A 2C96A 3ICQB 1ZCZA 1VSBA 4OGWA 4A15A 3I42A 1H65A 5KU7A 5BSGA 4LDZA 3RS9A 2IUSA 3QPUA 3GFFA 5ARBA 2D1FA 3I9OA 1VSDA 3LK7A 2V6GA 2YHXA 3O1JC 4DRZA 1T0IA 1T1RA 2JJYA 3FNGA 4B9AA 1U4SA 2VSYA 1VJDA 3Q40A 2NO9A 3ZOKA 4RH0A 4CM4A 2W71A 4IV5A 1Z2AA 3HJGA 1DBPA 3MDQA 5A62A 1P0CA 5J2QA 3TG2A 3SN6A 2GSWA 3L6BA 3NKVA 1X1RA 4EF6A 3DBVO 2FSKA 4NZNA 4NCBA 2EHDA 4OFXA 3DHYA 3W8EA 1I9GA 1YQGA 1JX6A 3OFSA 1OZ0A 2ORED 2O2CA 5KKNB 3CRNA 2IEIA 2XB6A 2YHWA 3FX2A 3O9UA 4RX1A 1RJ9A 5HBMA 4TTQA 4YJHA 3GGJA 4BO3A 3ZHBA 3QLJA 3DPUA 1AIPA 3IBTA 4TUYB 5IYZB 1IUKA 2NYRA 1JHZA 2W6JD 3C3YA 5KNCH 3SK3A 1ZSYA 3FFXA 3KLMX 4HMPA 1KO7A 4QVIA 3O0DA 3QRWA 1QIJA 2X76A 2PUWA 5JSYA 2IPAB 1TA0A 4O63O 4UEQA 3B6EA 1HG0A 2KFZA 2QRHA 5AJUA 5GMOA 3WLRA 4BR4A 1L8QA 1XI2A 4YLYA 5E3IA 1VPWA 3AF0A 1PFUA 5K8VA 4URYR 4V2IA 1NIPA 4DTRA 4F2SA 3TG8A 5F23A 3GBPA 3D02A 1UZUA 3BRQA 3U4DA 4OPAA 3URKA 4F7WA 3R7DA 4Q0MA 3OQMA 4JQYA 2DUJA 2X4GA 2YN2A 1B23P 3H17A 4S05A 2MYNA 5D87A 3W3ZB 4EIAA 5B2ZA 3OQVA 4KYIB 3DMHA 4WH0A 2I03A 1BGXT 2GVZC 4H7EA 4Z9YA 3PXCX 4RJIA 1N5RA 1XF1A 4WTOA 3V4PB 4BIMA 3LUHA 5C1IA 1N2CB 1TIBA 4KQ6A 2DWCA 5I5EA 4CIAA 1XRQA 3K9QO 3GEMA 5EIBD 5JTTA 4Z99A 1N8RO 4O4IB 2QTDA 2OWEA 1EP2B 3DBHA 1CUXA 1WR8A 3H5OA 1YWGO 3G23A 4ZOLB 1XZFA 3EZNA 1NM5C 3L7MA 1C6VA 4RKYA 2Y68A 4CJTA 3G0OA 1TF7A 4UTXA 3EEYA 2EDAA 1XNGA 1WSGA 1Z8HA 4YRTA 5K6RA 1E1RA 3ABSB 3T7TA 2VJMA 5FP0A 1CZLA 4KNYA 2OHIA 3GJ7A 1EWQA 3SIRA 5DYIA 4DRYA 3O8DA 2V4ZA 1FTYA 1FBNA 4FK0A 2IHKA 3GVCA 4N39A 3L2UA 1RP7A 4QTZA 3KT0A 2RHHA 4ZYZA 2O0MA 3WLAA 3K8QA 4KSCA 2HRDA 3IJPA 4A5OA 3DYIA 2V6FA 2D2IA 3CNEA 5CPFA 3C3DA 3KWIA 4UTOA 1DAIA 3ET5A 2WTUA 3FN4A 2W6OA 4MJLA 1DLOA 4JHDA 5B37A 1R4NB 1U90A 1KJWA 4EELA 4HDMB 2VL7A 4YAFA 2CXNA 1Q3TA 4C7MA 3R44A 3P0FA 1OA0A 5BW4A 2A1TR 3B48A 1Z4NA 1D8YA 2BAGA 3AZQA 1QFSA 3WNHA 1ATRA 2FPRA 4F5WA 1EVIA 1GGVA 3IDOA 1OF1A 2PGLA 3PL1A 3O2JA 3UT6A 3C16C 4FGUA 2HF8A 3RPEA 2BWJA 3NC4A 2Z4SA 3M33A 3TD9A 1X9WA 3KZNA 3ONWA 4EK9A 1ISFA 3I5MA 3G0GA 1XQ1A 2XTAA 2JI4A 1AU9A 1G9SA 3QF7A 3X1XA 1QS0B 2QWMA 2HZBA 5A3SA 4J0CA 1VRCA 3EBLA 4R1UA 1MT0A 3CPJB 3SQOA 4H8KA 4ZOEA 1TEHA 4OXIA 4DDTA 1CY6A 3OYHA 2FC0A 2GYVA 5DSTA 5GJBA 4IG4A 3OWOA 1U31A 3CQ9A 5DMHA 3F6SA 4D8UA 3ZW7A 3LNCA 5AZIB 2I34A 1VOTA 4BVHA 2BCJQ 1CRZA 2OBBA 2QJWA 1GQFA 3OMLA 4Q9DA 4G0PA 2X8BA 2H3GX 2AJLI 3IVCA 2FA9A 4KPFC 5KMGA 4H0YB 1L5HB 2AFVA 1YA6A 4GDFA 1VYTA 3G2OA 1V16B 4LHSA 1NRIA 1D6SA 3JYHA 4B9LA 2CLCX 1Y4UA 2GN8A 1Y33E 2NZYA 2X0IA 1VSUA 3U4QA 3MAAC 4INZA 4RHTA 2R68A 4M7PA 4YCJA 2FN4A 3ZLVA 3EKSA 2DUNA 1JV2B 4BKOA 2R8YA 3HZZA 2Q5HA 4Y6PA 5KYWB 4KO8A 3IEKA 3NPAA 3SBEA 2I55A 1UBNA 4ZDKA 4N0MA 1YR2A 2UYTA 2OP1A 4RHCA 4E12A 1USVA 5ED4A 4UTPA 5DISB 1POWA 3OD1A 1Z4PX 3LZCA 4HH3C 5F98A 5LA6A 1YS6A 1R9GA 1EFKA 4AICA 4BOYA 2NSLA 1PSDA 1KCFA 4EO4A 1TZ2A 3CSDA 2ZRFA 1JYFA 2O5EA 2IYVA 5IDYA 1IM5A 1KKUA 2DPHA 3I04M 3I1FA 4CJSA 3PUXA 4IFTA 1ZKMA 1FTNA 3RB8A 4YP0A 1E2FA 2JVJA 4QM7A 4LRWA 1W88B 4MDYA 5JC1A 3RVCA 4MULA 4BNWA 1H8EA 2FP3A 2LDXA 3A1FA 3P52A 1KYVA 1V2HE 1UOQA 5FAKA 2FLWA 1IKWA 1PO7A 3FWKA 4CMEA 4OXYA 3UK0A 2B4KA 5B2FA 1U3WA 5HIMA 5G02A 3V8RA 4IAOA 4HR7A 4CDGA 1ZVMA 4YT2A 2GGSA 4WD3A 2ZE2A 3NHUA 5JFGA 3KYCB 1V8ZA 1S8AA 1RHUA 4GKVA 4RZSA 4OGGA 3HN7A 4WQ5A 3I92A 4E1BA 4E30A 3QI2A 4PO1A 3OPXA 4YRLA 4X54A 3KK0A 4B1VA 4I1SA 1K7SN 3SSAA 4HDSB 4R1PA 2ZIXA 1K4YA 4AMGA 2AD1A 3G7UA 2DEUA 3QEVA 1MEOA 2H16A 4CLRA 2PUEA 3ORHA 4MQLA 5IK2D 2H7XA 4LHEA 3LWDA 1G5RA 1OW3B 4PSDA 3SZUA 2O2HA 2BZSA 4EHKA 1CY8A 1E1QA 2BFDA 1ODCA 3KLBA 5AQOA 5BSFA 4FWNA 3IR6A 2H0QA 5T67A 4CFDA 3WLQA 2UUBK 4FI3F 5E8JA 4IG3A 1XQYA 4H0OA 4RESA 2O8VA 4UCWA 2EOAA 1Z5VA 1TF5A 3LKDA 4KV8A 4ZAXA 3T54A 2PWPA 2X4IA 4I08A 1HT2E 4KPUA 4CJ3A 1ZN7A 5EIXA 5M1OA 3JWEA 1N7IA 2YVUA 3BXOA 4Y9TA 2Y76A 5EZQA 2NLOA 4X1YA 5CDYA 3Q3CA 1RQ2A 4LQ4A 3CLRC 3FYSA 4BWVA 3WK7A 4MEAA 3ELYA 4GZ5A 1S1XA 3WSWA 5JVDB 2EP7A 3BGOS 2Q3MA 1WMEA 3QFHA 1RC1A 4YJ3B 1RTKA 2V0GA 4B3FX 1WSHA 2I1LA 3M6AA 2Y93A 4TV9F 4FILA 2FOXA 2PNJA 5H16A 3ZLUA 4NCJA 4ZXFA 2O6LA 2PO7A 3GLHB 4JENA 3B9QA 5CD1A 3OCVA 1TK8A 5JMTA 2OAQ1 3VTAA 3HA5A 5BYJA 3GWZA 4MAAA 1YRAA 3N70A 4LIPD 1T6YA 4Y1RB 5FLYA 3K59A 5C35A 4OHUA 4JKFA 4HH1A 2NRRA 1ID1A 3T4XA 1KBOA 2ZXEA 3FA2A 3KTFA 2ECPA 1I1NA 2R8BA 3ZE2B 3DC2A 3FKSA 2O4UX 3KK1A 5G0VA 3Q3HA 4DXAA 3TDKA 4H0VB 3RFVA 1DDOA 1ZNXA 4TLDA 5IT9O 2GX9A 3JARA 1SBNE 3DV0A 3DM9B 5FJIA 5AK6A 5AQTA 5IAKA 3ZQUA 1JWBB 4UMDA 2JI9A 4GHWA 2P1DA 3ESXA 1QE0A 3AKYA 1DXYA 4EEXA 2D1QA 1GLBG 1QTQA 4N3GA 1VIVA 3RUDA 3F3YA 1DBRA 3UN1A 1CC1S 4MV7A 2XUHA 1OTYA 2WRZA 1L5QA 4OI0A 4AYXA 5CZ1A 3E1KA 4ER3A 3QVKA 3EGDB 4BRIA 5B1YA 2IVZA 1FRFS 2XUIA 4YOWA 3UKUA 2OK7A 4M63C 2LP4Y 1J99A 3UBMA 4X0EA 5M1NA 5TMEA 5DI3A 4NS1A 1O9HA 2YOGA 3LC2O 4BGAA 4G5RA 1AKUA 2JHFA 5EWLA 3C0BA 3HO1A 2VP5A 3ULKA 3EBPA 1BRMA 3NP7A 2OEPA 1NIJA 1XA4A 1WQ4A 3C8UA 4OCZA 4WCDA 1PBNA 3MT7A 5BWLA 1FDWA 2P9SB 3D59A 3SCZA 3N8HA 4AF7A 2IKQA 5EKXA 3WEEA 1SU8A 4MCIA 2FMKA 4BEBA 5DCUA 4MEJA 1EEXB 4QARA 3EQZA 3HUEA 3ADPA 1MDFA 3LW7A 3FJ1A 5HKAA 4M1OA 1OLXB 3RSLA 2P2DA 2B4TO 1MTZA 1M34B 1S7GA 1UZNA 2GCOB 5JXIA 3ENQA 3HM2A 1BCRB 3TE7A 2VFAA 1NBIA 4C76A 5MHTA 4BRAA 2DQSA 4RH3A 4GRAA 3DP7A 2KLBA 5HF6A 3KJGA 3I56N 4RK5A 4KUHA 1Y7TA 4O5OA 1E2HA 1NVAA 5ALMA 1CEQA 1Q44A 2W4IA 1JIIA 3CLTD 2I4TA 2ERYA 3A6LA 3R8XA 1K7YA 1XDDA 5JRDS 4M8KA 1POXA 3DRSA 3P4UA 2QLBA 2YV0X 2WPDA 3WMXA 5L51A 1C8BA 3QUQA 3I2JA 1HM5A 2XOXA 5J63A 1I6KA 1KAMA 3M82A 3UE5A 4FDVA 4YCMA 2DHRA 3BGWA 1ML3A 1Z0FA 2AD5A 5ALKA 1XHLA 1GV1A 1D1TA 4XUCA 1DIOB 3OYLA 2CCGA 3HPQA 1F60A 3TBHA 4CCYA 1FP1D 4TSFA 2VAVA 4PRLA 4CG0A 2Z2ZA 5IFLA 1JILA 4LJRA 4WESB 4D5EA 3U0VA 3LBYA 2CVHA 3RBVA 1B1AA 4KNVA 1RADA 1WOYA 1DTQA 3S1LA 3LNTA 3ZGYA 1S2GA 3U3JA 3BREA 5KQ8A 2PR7A 1CUEA 2IITA 5FRNA 2KB0A 3VQDA 3KXIA 2ZAIA 3HL8A 3PGJA 2GD2A 1F51E 2WUVA 2OZPA 2ONJA 5DIZA 2ZS9A 4TWZA 1DEXA 4AQYK 4CGYA 2GAIA 1Q0QA 2PGJA 4JLSA 1QAQA 3T7JA 4JKAA 5IT9A 3QK7A 4W8HA 2G9QA 5G1NA 3SNKA 4ISBA 1QZ6A 4A6PA 3QEOA 4EDFA 2P5YA 3WIBA 2YKNA 2F67A 3OQBA 3HB1A 6CHYA 4JJZA 3FVTA 1AQYA 5H3LA 3VR5D 4INOA 3L0IB 2QDKA 3P2YA 4JWTA 1X38A 1E3IA 3NEJA 2MSDB 3PDIA 3KQOA 3V2GA 5K7SA 4PYIA 3C4QA 1MN6A 2E2NA 1QCCA 4QXQA 1YVRA 3C3AA 3UAOA 4E4YA 1N8TA 5CM2Z 4IZIA 4BNLA 3PTLA 4QUAA 1NNUA 2GK4A 2HHHK 4CESA 1C0FA 3K71B 3FKQA 1C3EA 1PJAA 1PTKA 4P3XA 1VECA 3UNXA 1L5GB 4RGVA 4I50B 3RABA 4CLDA 4LBZA 4MUXA 5DTRA 1GAQA 1TJYA 3A04A 1SC9A 1GZ7A 1JZSA 2JWKA 1NK7A 2M32A 4PG5A 3KZKA 2DFTA 1K4MA 2GKSA 3I1YA 5B1IA 2Y1JA 1VAZA 1XVAA 4FYDA 2PBFA 1C0IA 2QKYA 1WVIA 1SHUX 1F2TB 1FA9A 2W93A 2YY6A 4JBYA 4UATA 2G0AA 2PANA 4MKXA 1P0PA 2FRDA 2PR2A 2YX6A 4ZQCB 2DHDA 3VO2A 1VHQA 4BKUA 4LF5K 3L79A 1FX0B 3DW1X 4H1VA 1RLUA 5D6OA 4IO9L 1FMTA 3GBTA 4U9HS 1V8BA 3RYCA 3ZSXA 5DX0A 2PZAA 1EMDA 1P2GA 3EZGA 3WQBA 2MINA 4BS9A 4MWTA 3H9CA 2VF8A 3GGSA 3DM5A 3B3QA 3GARA 3TOXA 4YP5A 3TLEA 5AQMA 1M67A 2H1WA 4AZVA 1HDYA 2J0UA 3H0KA 1CJVC 1GZUA 1ULBA 4G36A 1XB2A 1DC7A 3C15C 1ZR4A 3OLZA 4FSXA 4MITA 4DNQA 5CE3A 1N34K 1KSHA 3DVRX 4CK3A 3H5WA 4Q7KA 1HYZA 1XVIA 5T6BA 5BN5B 4CEDA 5IJ0B 3WZ2A 4O4LB 3IALA 2H7YA 4I8XA 1A9XB 4JOSA 4C4ZA 1FCJA 1JJFA 4IH1A 4UHFA 1NVBA 1L5KA 4H27A 2OM2A 4EKEA 1KIMA 1M1UA 2PQMA 3AF1A 5EHZA 4AUMA 2ANCA 4C01A 2QYHA 4IDOA 4QG3A 1SAYA 3HH8A 2Q1UA 2X2PA 3T4PA 2BN4A 3M4YA 4M8NE 4DQVA 2WJYA 4PZEA 2JBAB 1C9KA 4PWZA 5F3RA 3FAZA 4JQSA 2O5VA 3D1LA 1KFSA 1D03A 4FHFA 5AXBA 2NUTA 4ZDWA 2A35A 2BBWA 4QU8A 1UBUS 2GLUA 1X39A 1WB5A 2P90A 1A9YA 2GO1A 4OLJA 5BN8A 2BH9A 3SE0A 3N8DA 4WY5A 1NNEA 3RAPR 3LHSA 2QRVA 1WMBA 1OR8A 2VJCA 3GVHA 3JQBA 3SJBA 1DADA 4XB6B 3PUJA 2HNZA 2XQJA 2EEZA 3NHPA 1YBHA 1ODSA 4JT9A 5BNZA 2HFJA 5EMHA 3K9GA 3FNIA 2WQ7A 3DFFA 3T1NA 1J24A 1BHLA 3IUNA 3NAEA 2H51A 5JD6A 3ZW9A 4D79A 1KE2A 1VJCA 3A4VA 4JIMA 4CKBB 5F3WB 3FFWA 1NTOA 4W9MC 1L4FA 3E9MA 4UQGA 4R9SA 5L7WA 1FDVA 5CX1A 1I13A 1WPGA 1EP1B 3FMOB 5K99A 1E7QA 1FLAA 2YZNA 3U44B 1UQRA 5FBKA 2QE7D 5LYYA 3TFOA 1NXOA 2PQ0A 4JT8A 4GSYA 1V95A 3OZEA 1LK5A 4DWVA 1RZRD 1ZD5A 4YRRA 1H2WA 3O31A 2C7BA 4FOPA 5F7XA 1SQ6A 4Y2SA 1VC2A 1JN0A 1UKZA 5IT0A 1QHAA 2PRSA 1FFYA 1EX4A 1A9OA 4CLOA 3TU5A 4H5VA 1E2NA 4CTOA 1HNVA 3VC1A 1QH1A 2I2XB 1AQUA 3I2HA 4JJAA 1BI4A 1OE0A 1VL0A 2V7XA 5KNDH 1Z7YA 1I4LD 3JX9A 4CLHA 4E5DA 3GRZA 4P3YA 4HZUA 3PI7A 1W2WB 1XP8A 3GG2A 4QJBA 3Q7PA 1QRUA 3SAFA 2QRNA 3LSTA 3FNEA 4L6AA 2ZIZA 5BSRA 3BE6A 2TRSB 4AZ0B 3QIPA 4UUQA 4BRNA 3Q41A 1WG8A 3ZZUA 2BY4A 1YMVA 3ITNA 2BGNA 2Z5FA 4LRYA 4OVLA 4G5QA 2WMOB 1KPGA 3H42B 1AKQA 1PK8A 5I9EB 3E05A 5AUOB 4KW7A 5E95A 4I2VA 5ICSA 2D13A 4ZYYA 3OM1A 3NBZC 2FMIA 1L6IA 3U4IA 1SUPA 3PZRA 2GYUA 3RJ9A 3KEGA 3CBGA 4R2WA 3FJOA 1FJGK 2PRYA 3MK6A 4YCDA 2CT8A 1WCIA 1G2QA 4OQEA 3W6ZA 1AS3A 4X8HA 1D1QA 4GKAA 1GT91 2CXOA 2J48A 2RCYA 4MS4B 3GIDA 3SOPA 2RH5A 3GP8A 2BUAA 1T7PA 2C4KA 3VO9A 4MA0A 4V0ME 3RG2A 1QHGA 3NTQA 4Z54A 4YNQA 1MH1A 2XUDA 3ZU4A 3KTDA 5EKDA 4I4TF 4MO5A 1RHJA 1X6VA 4MHOA 4UREA 1NPTO 2VBFA 2ZT5A 3CZ9A 2PSDA 4MB0A 4UQLA 3TRDA 5L9AA 5CB4F 3CEHA 4RAOA 1Y5IA 4F5DA 2CHVA 1LJUA 1CLEA 3GB9A 4XPIA 4XRRA 4RSRA 3ECCA 4X5OA 3PXAA 2D5AA 3CT6A 2HYIC 2JHGA 2B4QA 3CJQA 1SHJA 1ZD1A 1V1RB 2OECA 3L6CA 4BL5A 4CT5A 5AICA 1YJWN 3T61A 3FLAA 2DX7A 4BFTA 4CM9D 2WFBA 2X0DA 3WWZA 3DOKA 4QFBA 1X86B 2AT1A 2B8EA 2OV6A 4HBGA 3SFZA 3KVRA 3OZCA 3FYUB 4NU0A 4QTYA 1E6MA 1CZBA 3V8EA 1FDTA 3I73A 1XTSA 1K66A 2O52A 4RH1A 4O8CA 2IFTA 4EP5A 3RR8A 4HDCA 5CDGA 4QEDA 4RPJA 4XUGB 1ZC3A 3IXQA 4QUBA 1UZLA 5CW1A 3AETB 3H1EA 4QUJA 3K32A 1JXEA 4ZRNA 4QQ8A 4TV8B 4QBGB 4JI4K 1H2AS 3RI3A 3BZKA 1PWXA 4OU5A 3P9RA 5E0OA 1I10A 4CJFA 1UMKA 3TVYA 4P8RA 2G82A 3VZQA 4JK8A 2B83A 3VSDA 1SWVA 4WBXC 3SIWA 2XY5A 4H1UA 4Q9KA 3DKVA 3WV4A 2AR0A 4H5TA 4CNBA 4OJKA 3H2ZA 4PZLA 4RIEA 3QERA 1JGTA 3OYNA 4LC1A 4IJNA 5BURA 2AN9A 1WQ1R 3TMYA 3OY9A 3HSKA 3JXEA 4CBWA 3AI7A 5CA0B 4FGJA 1SA0A 3NFRA 1KJYA 5BQOA 5AUNB 4L0CA 2FJPA 1FP6A 1USIA 4DUZK 2AMJA 1NVDA 4BVBA 1KGSA 3BQNB 5IZCC 4BWJA 3K0BA 3U3DA 1Z82A 1J9ZA 3L2QA 2XUOA 2X5OA 3II6X 5F64A 5C5CA 1MWMA 3E1GA 4L4RA 4JA2A 1E4VA 3HDTA 2DBZA 3C6BA 4Q4JB 1XQVA 2C2XA 1KKLA 5ABPA 3OQJA 1D09A 2IZ1A 1T9AA 3KX2A 1JFFB 1U0EA 4MLZA 2PZ8A 2A14A 3RO7A 1VSEA 3GFTA 2BEVA 2OLJA 2POQX 3KT6A 1RS0A 3ZV4A 5JYCA 1N7HA 6PFKA 4ENTA 2Q9AA 3NDBB 5HQJA 1RBUA 3EJWA 1GZHB 3O9ZA 2PS9A 3PKIA 3SZRA 2R6FA 3ZV5A 4FLMA 2JIOA 1LLFA 2YJZA 4FLYA 4GQBA 1MO3A 3FFAA 1L4MA 2DUUA 4DFMA 4Z9FA 1PZHA 1WNFA 1LH0A 1LWFA 4OHCA 3F5SA 4XM2A 4AJ4A 4NXMK 1U1IA 3GCDA 5KVVA 5ALSA 2EYQA 2BDEA 2R6R1 3B85A 4DSFA 5JYEA 4F92B 4BVEA 4GX0A 3OPYI 1WD5A 2Q6IA 5CT6A 5J5VA 4JI5B 3SQ0A 2X0KA 1NBME 5HQ3A 1NOIA 5LL6Z 4PG4A 2WUGA 4DLUA 2P5TB 2FZEA 3L93A 5IG2A 3U4AA 2VRNA 3HSTB 3MINB 4GX5A 2G6BA 1CR0A 4CVNA 5BWCA 5EQTA 1CK4A 3J8AA 2G71A 3SDZA 1Y8QA 5C1PA 4R1MA 3TEJA 1SOVA 1SIUA 1S9HA 3U4LA 4GV6A 1ACLA 4F3CA 2XY8A 2YQZA 1U2GC 1EBUA 1KEEB 3AR6A 4FXDA 1G7SA 2IY7A 4AJEA 5C2JB 4BC5A 4HPJB 2QYOA 1GGHA 2JFBA 1CY1A 2YJ5A 2NXCA 1U6JA 4ARCA 5E6UB 1CCWA 4B80A 4H77A 2NU6A 3HMKA 1O08A 1VYUA 3W6UA 1V11A 4YI5A 3IUJA 3LLVA 2XYPA 2YJ4A 1K0UA 3PHCA 3QXCA 4RM3A 2LKDA 4B9UA 3Q9SA 1GG2A 1E1YA 1HORA 4WZAB 3BIFA 2OD9A 2I76A 1YRYE 4F3RA 1GD1O 4I9HA 1KEWA 2BD0A 3QNMA 5JMWA 3T1YB 3ANXA 2GERA 2H4XA 3L8BA 3SNNA 2IOFA 4DTIA 5KYYA 3HYNA 1D4FA 1BH2A 4NBNA 2ECQA 2PU7A 1USUA 4O44A 3R3XA 4RFLA 4UAUA 4UBLA 4Q93A 3B89A 4HEQA 4XB1A 4DUGD 4OOEA 1T6XA 3KV3O 4BRUA 1IBMB 2NUAA 3OOYA 7AT1A 3WHPA 1OAAA 4HGZA 3EGWA 3CG4A 5H68A 1I4EB 3VX4A 4CMGA 5L3RA 3PRJA 1X3SA 1LBQA 2JFHA 4LNAA 2BJHA 2ZRBA 2I8AA 2XGGA 3OM8A 1KZ4A 4RLHA 1BRTA 4EKYA 2I80A 1NK8A 4NIMA 4URUR 2E3JA 4BMOB 5JH7F 3KOOA 1A96A 3ZLTA 2RAPA 4M99A 3FZEA 4PCVA 3NXKA 4PQFA 2BUBA 4N3AA 3H0EA 1NGFA 1AK1A 1SMKA 2NP6A 1QGZA 1BGWA 1I33A 4OQQA 3BMCB 1IY1A 1P7VA 2WWWA 3VZBA 4GXRA 2GUWA 3KBBA 2UVPB 4KPEC 2P8JA 2HNKA 2O3TA 3W2GA 3D2EA 4DLXA 1WSIA 4QU9A 3VNUA 2Y2UA 3KXPA 4K87A 4EPXA 4RK4A 1TQ6A 2QL5A 4DNPA 3IAEA 1O5TA 3GUZA 1U9IA 4RE6A 4RFSB 3LP3A 4KU4A 1QDLB 2QK9A 2YNIA 2MSWA 1JWAB 2HD4A 3T3EA 1JQEA 2C4TA 2QGNA 4OXNA 3VM6A 2OC4A 4P83A 4GVPA 4ZT2A 2FSPA 5EUCA 4BC2A 5AXCA 3OX3A 1QF6A 2D3WA 3GT4A 1G9XA 1Z4OA 1I14A 4RTLA 3OHPA 1QWSA 1F3OA 1JB1A 1XZKA 3RSGA 2Q2WA 3W1WA 4EYGA 3TNFA 3QVXA 5IJAA 3WK4A 1OHHD 4P7KA 2XRYA 5H9WA 4KI4A 1E2KA 3F96A 4AJOA 2IPXA 4XI9A 2FAXA 1P39A 1NFQA 1DAFA 4HT3B 5JQGF 5TPWA 2WKRA 3EMKA 4QEKA 5A7HA 3AF5A 4RZ2A 3J7YP 1O0CA 2Q3FA 1QQAA 3ET4A 4Y67A 3G1TA 8LDHA 4EENA 2E7ZA 1UFOA 1SRRA 5UKDA 1RMYA 3SBOA 2J7PD 3A2KA 1Q77A 4A2QA 3G2LA 4IDCA 2ZF5O 2XD9A 3R24A 1IJJA 2JZCA 1MKYA 1YT3A 4F8EA 1J90A 3IMEA 4HYTA 1SHZA 3PLAA 4JSRA 2Q21A 2PZGA 4YOXA 4ZREA 2ZATA 4X92A 3FPAA 3L0BA 1RAEA 2ID8A 1EXNA 1PFGA 2PMKA 4GBED 3AKEA 2PA3A 3HDJA 4MS3B 3OYKA 1IOZA 1WRBA 3O4HA 2PCLA 1YAHA 2HT6A 1QYXA 2FYTA 1ZM2A 3IHLA 5CMLA 4ASUD 4WF9L 1QSLA 3NRBA 3PBKA 1Z83A 4OF4A 1FMCA 3UK1A 1W7AA 1P1JA 2AC2A 4BRHA 2BUCA 3D8TA 3TW6A 4M9UA 2OCPA 3H16A 4ENVA 3VDQA 4DEXA 3LYHA 4HQLA 2I2FA 3MEGA 4WKBA 5AI0A 3EXFB 3ZETB 1JDZA 3E5RA 4LECA 3MYYA 1DEHA 4XDZA 1WIWA 1MW8X 4DSNA 1U04A 1KI8A 3WHKA 1ATZA 2B8JA 1B8VA 3FRHA 4F6RB 1H2BA 3R0VA 4XIYA 4R5HA 2A6AA 2HHJA 3D0PA 3O7WA 4K1LA 3BSFA 5AM1A 3FNFA 1LC0A 4ID9A 1I32A 1D9FA 2FHPA 2VK8A 4HUTA 3RLFA 1S8FA 5B3AA 2IH2A 4FWSA 3FOCA 2YXEA 4LDJA 2QENA 2C8JA 2PL9A 3AY6A 4HADA 3WMFA 4OJMX 1BZYA 3KYBA 3G25A 2C8VA 1RU3A 3W7AA 1PJCA 2QG4A 5ITZB 2O2IA 1PSWA 3TLBA 3AB3A 3MEQA 4B9SA 3OZVA 4DCNA 2WTXA 1TZCA 2JEOA 1TJ4A 1NUAA 2CKMA 3O8MA 4IH9A 4QOFA 2IHYA 2XNSA 1WVGA 1M6NA 2G5TA 4Q6BA 4NJMA 1Y8ZA 3FY4A 2BFEB 4IQ4A 3V8QA 4FCVA 3ZVRA 2NLXA 4RBNA 2C4UA 1FQOA 2O8DA 3OFKA 1RABA 1P8JA 2J07A 1OWOA 4IHJA 2F3RA 1S3SA 1K8QA 4K9DA 2RCNA 4RKRA 4LEIA 4ZD6A 4FFBA 4MGYR 2I2WA 1A7AA 4LZZA 4BVPA 2E87A 3VKGA 1CIPA 3MMPA 2CZQA 1N5IA 2N75A 3GT7A 4BFWA 5IC5A 3FPJA 1GN9A 3RCBA 4RW9A 1NVGA 1HFJA 3OYAA 2HV9A 2CF5A 4DLRA 4IILA 5CM8B 3D5QA 4QBTA 1N2JA 5CURA 1IJFA 1ABFA 3EDCA 1T2EA 3I09A 2QP4A 2VJKA 1AGXA 5EE5B 4R0MA 5FOXA 2H2GA 3O95A 1QQCA 1N3IA 1HY3A 3L04A 3P71T 1ORWA 3CCCA 3QELA 1YTLA 3O74A 1Y7LA 3AP3A 4D81A 1P7CA 1MXFA 3EFOB 3NFAA 1P7ZA 2C07A 1IH7A 3K2IA 2YX1A 1P17A 3VQBA 2V9ZA 3BE4A 1TKZA 5T3YA 2OZEA 2BTOA 2G04A 3FH0A 1ZOPA 4AM6A 4KDEA 1WF6A 5JXJA 5B7GA 3SNHA 4A26A 4BVFA 2A3NA 3BGIA 2W43A 1HTWA 1Y9EA 3VTFA 4P4UA 1N5KA 1HX7A 4QOJA 3EQ2A 4NEHB 1OI3A 3R5SA 4XR4A 5J2MA 1SBZA 1OXUA 1Q7RA 3KC2A 4BHTA 1WQ3A 3GJ0A 1U6KA 2CJYA 2V51B 2XB2A 3ZJ5A 3AIOA 1OI2A 1PT9A 1E5LA 4KK4A 3O0TA 2ZJBA 1L1EA 2ZUWA 4WAUA 1NJ1A 5DGCA 5PGMA 1JFVA 4TROA 5B58T 3TZQA 2WJGA 4GH5A 2H9IA 4FD2A 4YACA 3TTTA 2E48A 1OFHA 3B82A 3SG0A 3ZEUB 5HR5A 3CEPB 4YCNA 1ILWA 3C1TA 4HLUA 1N33B 5EPUA 3SCXA 1GLEG 4DQLA 1ZXLA 1R15A 2CUKA 2LSNA 2I4MA 4Y0AA 3L4SO 2PSEA 2C3YA 3TZLA 2H1FA 1GPYA 3EXHB 4EOGA 3LCVB 3P96A 5KNBA 3ODPA 3PHBE 4QGHA 2JAWA 1C1DA 4CL2A 4HP8A 4V1CA 3LUGA 1XV5A 1HNZB 1KI6A 2JLCA 4L72A 3LI2A 1A4RA 3QLHA 1KZYC 2A0UA 2W70A 4FDTA 2ZUUA 1RYDA 3A7EA 1G2OA 4CCSA 1KZ7B 1HLGA 3FUXA 1WSAA 3ESCA 2VAPA 4MPTA 1SBIA 2YVAA 1FX1A 3KETA 3RT9A 4M98A 4BQRA 5C12A 4FJ9A 1FKPA 2ACEA 2BE2A 4R2IA 1G21A 5K3SA 4CCWA 1SWWA 3GAMA 1G38A 2P2CA 1R0CA 2A2ZA 4LX0A 3CUVA 1MOZA 1RAHA 4UE6A 1TTTA 3PGLA 4F60A 3QMVA 4YAIA 4WOJA 1J5OA 1LU9A 3NEAA 1KQPA 4OK6A 2NTYC 3I9NA 1MAHA 3WUHA 4M9CA 5COQA 4LV5B 2GD0A 2X2EA 1AN9A 4RSHA 3PYXA 2O7VA