4IDHA

Crystal structure of the large terminase subunit gp2 of bacterial virus sf6
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
463
structure length
451
Chain Sequence
SINPIFEPFIEAHRYKVAKGGRGSGKSWAIARLLVEAARRQPVRILCARELQNSISDSVIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGIDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTKVEMKQKLGIPSPNLADALMMCMHCPALVREETEIYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the phage Sf6 large terminase provide new insights into DNA translocation and cleavage.
pubmed doi rcsb
source organism Shigella phage sf6
molecule tags Viral protein
molecule keywords Gene 2 protein
total genus 166
structure length 451
sequence length 463
ec nomenclature
pdb deposition date 2012-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04466 Terminase_3 Phage terminase large subunit
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4idhA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4idhA01
3GJ6A 1DO2A 4JIMA 2BMJA 2QZ4A 4DLSA 4Z8YA 4QG7A 3V4FA 3SHFA 4C0KA 2ZE6A 5TB5A 1VMAA 3IIMA 2VA8A 1VPLA 2F3TA 2QE7D 3KXKA 2HEIA 3DKPA 4D26A 2OBNA 1UEJA 4ZIRB 4Z1MA 3SNHA 1WXQA 4AIIA 3HU2A 3IHLA 3CNNA 3DOEA 2Q9BA 2UVQA 4ZDWA 2HXYA 2WPDD 1NL3A 1RC8A 3AUXA 2GETA 3VNUA 3W8RA 1KAOA 3I5XA 1OFUX 2QMUA 2QTHA 1ZM4A 2W6JA 4BLQA 1YE8A 3IGFA 3GCGA 4Q9HA 2G0TA 2B8WA 3EXAA 2LKCA 4FN5A 4KSBA 2UZ3A 3OIYA 2OM2A 4B35A 3X2SA 4GOJA 2IYSA 2V7QD 4I81A 1EXMA 3ZVMA 2HF8A 3U4QA 5DI3B 3QEJA 1EFCA 4DBLC 1E99A 3C6HA 5JI2E 3F0TA 4BWYA 1CIPA 4RVCA 2Z6VA 3HPQA 3V00A 3ND8A 2ZRBA 4URXR 4KFUA 4K8OA 4UNSA 1WQ1R 1QHGA 1ZAKA 2C04A 1T3SA 3P4YA 2RGXA 1E9RA 1GAJA 3QBTA 4OHXA 1IN8A 1FTNA 4RCYA 1UPTA 2VBCA 1RYHA 1E9FA 1QHNA 2WJYA 1N6PA 1OSNA 2XNSA 4LOAA 4RZXA 1RE0A 2BCJQ 3G5UA 4EPYA 1EESA 3RHFA 2WAYA 1SVKA 2ZRJA 4LJYA 3F8TA 1R5NA 1ZUHA 3EWSA 2V1XA 3IBYA 3K09A 3BWDD 4FWTA 3KQHA 3B8HA 1GKIA 4UXHA 3QY0A 1N0VC 5JBQA 5FOTA 1KKMA 5JMTA 1CJVC 1XZQA 3UANA 2O52A 1Z0FA 4B34A 1DELA 1F2TA 3BFKA 2BKEA 3ONWA 2QA5A 2H7VA 2QMHA 5JS8A 1G5TA 4LJ9A 1EWQA 3TGPA 1XRJA 3NH6A 1ZUNB 5CITA 2G77B 1G21E 1ZNWA 3U6BA 4DVGA 1P7CA 2A9KA 3T1VA 3DZDA 3GJ4A 4GNKA 1P5ZB 2FV8A 2I1QA 5DIFA 4B3GA 3K9GA 1KNXA 3PUZA 4HAXA 1LS1A 1G20E 2XNDD 1JR3A 3KFXA 4Q02A 4TLCA 3QXSA 2AK3A 4LV8B 4ZKDA 4IOLA 5EXXA 2H57A 4QFMA 4DZZA 1E0JA 3AKDA 3I4LA 3I32A 1SXJA 2RGAA 3ZZTA 1LF5A 4DCNA 3L82B 3UXMA 2DB3A 3MWJA 2ORIA 1Z22A 4G5OA 5FPHA 3WRYC 4WIAA 4FD2A 1DADA 2CLDX 3AF1A 3Q8XB 4O2RA 4DSUA 4P4SB 1II8A 1Q3HA 4DDUA 2RMKA 4X8MA 4D4KA 1VIAA 3R9WA 4CW7A 1GRRA 2K5UA 3FKQA 5FTJA 4HLUC 3MUFA 3EPKA 2EYUA 4LHZA 5FUWA 4UNRA 1YZQA 1H8ED 2G3YA 5GVRA 4QRHA 2ONKA 2ZI6A 4EJSA 2JIZD 3ZDQA 2HUPA 4I1SA 2O8DA 4D82A 3LX8A 3W9YA 5JSZB 4Q4LA 5EJEA 3K09C 3KJEA 3X1XA 4LBWA 3PVSA 4AG6A 1TQ6A 4JBXA 3SN6A 1QBKC 2CNWA 5SZKB 4D4JA 1Q1ZA 4P4SA 2BBSA 2GF0A 1PZNA 5G3YA 2J7PD 5H1YA 2CK3A 2WICA 1ZNYA 2AX4A 1XEWY 1XB2A 4A6PA 2XX3A 3FTQA 2XITA 2EU8A 1G3IA 4KBGA 1ELOA 4YLGA 3A6PC 1WE2A 1XD8A 2QORA 3Q5EA 1KTVA 4Q66C 5M04A 1GL7A 1P75A 4Q4AA 4M1MA 1P2VA 1VHLA 2BKUA 2XOKD 2ZS7A 2QN6A 3H84A 1TF2A 1CULC 2ZJ8A 3KDSE 5EP3A 4E5UA 4HYYA 2DHRA 1MRSA 1LB1B 4M1SA 2QGNA 3D3QA 1NBMD 4AI6A 2GRJA 2ZUCA 1M7HA 2D62A 1WMSA 3IIJA 5FR2A 4YMSA 1SXJC 1SHZA 1AKYA 1OJLA 5IRCD 5LB2A 4BZXA 4TYYA 1T3HA 4O2LA 3THXA 3MCAA 3TAHA 1S2MA 4TTPA 1CXZA 3BRWD 3HU1A 1ZW6A 2YWEA 2ZI9A 3Q7PA 4PFSA 2QAGA 1MV5A 3UMFA 2J45A 2VRWA 4LC1A 4V02A 3OEEA 2IYRA 3N70A 1Q57A 1F5NA 4LYAA 2JLYA 4M8NE 2ZYTX 3VTKA 5TY0A 1E94E 3SHWA 4ZCIA 2JJ8A 5K8LA 2AHOA 1YKSA 2QMOA 4DHEA 3L8YA 2PL3A 1Q0UA 2JASA 3T5DA 4EJSC 2J0QA 3UMSA 2FMXA 2YZ2A 3VKGA 2IHBA 2B21A 1E9SA 1E2PA 2C5LA 3VR1A 3X1DA 4HLQB 5J4YA 4GP6A 1G3QA 1QHSA 2XJ4A 3U3MA 5FTLA 1OXTA 3FMPB 4JMPA 4QHYA 3GLIA 1X6VA 2JJ2D 2LWIA 2OHFA 4B3DA 1AJEA 1YRAA 1T6NA 5G53C 3DKVA 1DAMA 4JL5A 1TQDA 2OFOA 4BRWA 1F3OA 1Q3TA 1SVSA 2ANCA 2XNDA 2YNMA 4PC3A 1IAQA 2WHXA 2XTMA 3B5JA 3LH5A 3P27A 3KXLA 4GOXA 1BMFA 1UEIA 1ZJ6A 1OH6A 1NKTA 5BW8A 4FINA 2OXCA 4GZMA 3TUIC 4PAOA 4DDWA 1W4BA 1FMLA 4M9ZA 1DTSA 3EW9A 4HAWA 3ADKA 3DVLA 3RLFA 3C6AA 1E1QD 1TAGA 5C12A 3RS5A 1NF3A 5TARA 3TNFA 4EJSB 4URUR 2YYZA 1IY0A 4IVPA 5HKKA 1PUJA 5KPDA 3SR0A 1R5OA 2ZRKA 1JNYA 1XTJA 2I3BA 3A1TA 4Q4JB 4A92A 1HQYE 1WCV1 4D0NA 1N5IA 2GBLC 4C0QC 2JJ1D 4M1WA 3CH4B 1W0JD 4PSVA 1U2RA 4BASA 4U02A 1II8B 1ZU4A 3GP8A 4BZQA 4US1R 3KB2A 4PO1A 3SFVA 4IKEA 5G3ZA 4NL4H 2V6IA 2H8KA 1PUIA 3ASZA 3QQ5A 4BEBA 1OB2A 1YZLA 2PJZA 3KKPA 5AJVB 1WF3A 1NVWQ 2IF0A 3W5IA 2QAJA 2JGNA 3U7EB 1KIMA 1VYVA 1PLJA 1C4OA 2OFXA 1JR3E 2BMFA 2CVHA 2VP2A 1JB1A 2QT1A 2Z5FA 3BB4A 3NBXX 4QNMA 3PFIA 4AURA 4HEJA 4B33A 4Q1DA 2DCUA 2V1UA 2GILA 2WWIA 4JLPA 1E0SA 3RRZA 3ETLA 4A2PA 3K70D 1TF5A 1VCNA 3KJHA 5D3MA 2JA1A 4OK5A 2G1KA 1KMQA 1I2DA 3MWYW 2GCPA 4KXFB 4NP6A 2A78A 1EFHA 4WA7A 2WSSD 2YWHA 5E7IA 2NOAA 5L3VA 1Z47A 4LHXA 5CM9C 5KYKA 3L2OB 5M1QA 1M7GA 2JLZA 2SHKA 4Q9IA 4CEJA 2FSIA 1ZVQA 2PLFA 2Q0HA 1YJ5A 3LW7A 4KJZA 4L15A 4YMTA 4YQFA 1HY3A 3TRFA 2AKAB 2QBYB 4TL8A 3RRYA 1CEEA 4ZCLA 1C9KA 3CLVA 1VKJA 4LY6A 1KY2A 4LV6A 2XSZD 4C9BA 3AVUA 4EQ6A 1I4DD 2GZAA 4BE7B 3GLGE 3FMIA 3NDBB 1QF9A 1NBMA 1KI2A 1P9WA 3IQXA 4EDHA 1OXSC 2P6UA 1KK2A 1G4UR 3NIBA 3B9PA 5TV2A 2C8VA 3C41J 3X1WA 4KU4A 4LJ7A 4OJQA 3A1UA 1JEDA 4EPWA 1OYYA 2C78A 3IIKA 4F4JA 2IL1A 4NDZA 4AY2A 5DI3A 1HURA 1W2GA 4LZZA 4TT3D 2LCFA 2GEVA 5FTMA 1OFIA 5M1KA 4FXPA 2EWVA 4GBMA 3KX2A 2REBA 5AUQA 3THYA 2IUSA 1Z0DA 1UKEA 2BEJA 3SBEA 1AGRA 1R2QA 2FSFA 1IONA 2WKRA 4A1FA 3SYKA 1QHHB 1R7RA 1UDXA 3NDPA 4TYNA 5LBIA 4D81A 4C2TA 2OCAA 4LV5B 4BRUA 4DCVA 3R7WB 4HDCA 1Q12A 3ADDA 4Q03A 5CK4A 2DFKB 5DHFA 4F91B 4DUGD 4TMXA 4KYUA 2J87A 3MWKA 3DO6A 3FFAA 3BJIC 5GVSA 1E98A 2QI9C 3LNCA 4B71A 1AIPA 4D0GA 4BFZA 1BO6A 3K0CA 5EZ5A 1AS3A 2F9MA 4LJ5A 4X8LA 1EGAA 3CF2A 2GZHA 2OLKA 4PPNA 2G9NA 3LLMA 4WXPA 2FPKA 1UBGA 3KZ1E 1BMFD 1U0JA 3QG1A 2FEMA 2IC5A 1GRNA 5JWHA 4GPTA 1E4VA 1XD9A 1Z0AA 4WBSA 1EFRD 4R7ZA 2GVZC 4FCWA 2B7BA 5FOVA 3CW2A 4A8JB 3UIEA 1XTQA 3MLEA 4MYTA 4R9UC 2F43B 4C0SA 4XVUA 1FPMA 2FU5C 3TQCA 1N6HA 2YVUA 4MYHA 3DHWC 2VF7A 3LXXA 3A36A 2EVWX 1RZ3A 1EX7A 1YR8A 1R10A 1XCGB 1SVIA 1GP2A 4Q7LA 1KO7A 1R5BA 3FDIA 1L2TA 1XFAA 1SHKA 2GAAA 3QXCA 3MRSA 4N3NA 2CL7X 1G41A 3CPJB 1W0JA 4XTCS 5M1OA 3QPUA 4IDOA 4DIDA 1GL6A 1MO6A 4J0QA 3RDPA 5C46F 4AKHA 3GLIB 3AGPA 5KUTA 1Z6XA 2BOVA 4RD3A 3W6OA 4B74A 5JJIA 4U7DA 1E2KA 2WWHA 3SE0A 3WMGA 3BGWA 5JRZA 1U0LA 5L3QB 5D3MB 4AG5A 2B8TA 3KJGA 1M1YE 3EG5A 4TLDA 5FOSA 1BIFA 3WXMA 2C03A 1KDOA 1FOEB 2QENA 5FR1A 2IT1A 1G5PA 4DDVA 3B85A 1G6OA 2HV8A 4JLDA 3FB4A 2W6ID 2F6RA 3QXHA 4R98A 1YZTA 2CK3D 2N1BA 2O5VA 1YR9A 4JYBA 5FOWA 5BN3A 2ATXA 4LI0A 1DAGA 3BFVA 2QM8A 3BH7A 3H4MA 1IN7A 2ZS9A 3K0CC 3HDTA 1QZXA 3PEYA 2PT7A 4OQLA 3THXB 1NG9A 1NIPA 2GCOA 4YMWA 5FOXA 4JJKA 1WA5A 1W36D 3EZ7A 4HUQB 5IK2D 3QPVA 4L8GA 4Q9KA 1ZRHA 2A30A 2VF8A 4JT2A 3B13B 1MR3F 1KSGA 4C7OB 1XTRA 3OESA 5JECA 4KVGA 2YOHA 3REGA 3SQWA 1N6OA 4EPRA 1KYIA 1BKDR 1Z0IA 4TLBA 1EWRA 2WOOA 3VHLB 1G18A 3B60A 4MYCA 5DYGA 4E03A 3R9IA 1OB5A 1G8YA 1Z83A 4DLWA 4W9MC 1AN0A 5BQ5A 4OI1A 2QPAA 3UKDA 1FP7A 3OEED 5HE9A 2YINC 1ZD1A 1NIJA 5K8UA 1BYUA 3TK1A 1OFTA 4WZBE 3THYB 1NLFA 2PX3A 4ZDIA 5FL7A 4ZDKA 2ZR7A 3U7GA 2RKOA 1E2LA 5HPYB 2C9CA 2VSFA 3ZZ0A 4Q9JA 2Q21A 2A5DA 3FKSD 4CYMA 1AZSC 1LV7A 1XMSA 1XXHE 4V0KA 1NP6A 2QSZA 1X3SA 4S2EA 3CUEF 5HTKA 1LS6A 1PLLA 1S0UA 3SBDA 4EIWA 3R20A 4L5BA 4XTRA 2FF7A 3IDQA 1N6IA 2VHJA 2I4IA 3I62A 2FZLA 2PJRA 1E2QA 1JPNA 2CLSA 1Z0KA 1FNNA 1VYTA 4ZO4A 2HJGA 2OG2A 2V55B 1E2MA 2ASEA 2YJTD 4ACBA 3PCRB 3VU9B 3CX7A 1EFRA 1S4QA 1T0HB 3NG1A 2HYIC 2QBYA 3WNDA 1FP6A 3F3YA 4JLJA 2GDJA 5CLLA 3RVBA 2IXEA 1QG2A 5DHAA 4C2UA 5E3HA 5BWMA 2YV5A 3CO5A 2P5SA 4CRWB 3BC1A 2CJWB 1BH2A 1KAGA 3O8BA 5CIWA 1YQTA 1QVAA 2GF9A 1G4AE 2DWQA 3SYNA 1CR2A 1E2HA 2IYWA 3EASA 3LVRE 1CTQA 3QNUA 2IUUA 1XEWX 3THWB 2A5YB 2P6RA 3IEVA 3A4LA 2ZU0C 1ZNZA 1YR6A 4ASUD 1ZIOA 4TLEA 4UJ3A 1SVLA 1L4YA 2H5EA 3ZJYA 1EFUA 1TF7A 1XMJA 3AVOA 1JQJC 1P62B 5KSYA 1O3YA 4Q5IA 4DEXA 5L3RA 3EZ9A 1XMVA 1KI6B 5FUXA 1UFQA 1XP8A 1OXVA 2Y8EA 2Z4RA 2E9SA 1CRQA 4NCNA 2QAGB 1CR1A 1H8EA 4CF7A 3C14C 1XWIA 2BJVA 1SQ5A 2OZEA 4DB2A 4CT4B 3WYAA 3H1TA 5EQTA 1G8PA 2YWFA 6Q21A 4TZ0A 2FX3A 3BS4A 4JVSB 3SU8A 1YHNA 2J46A 2Q9CA 4HAYA 4P4UA 3WHKA 1IQPA 4LRWA 1OKKD 4YXWA 3DM9B 3G0HA 2W00A 1R0XA 4G01B 1XJCA 2HCJB 1M7BA 3T1QA 5KNDA 4PZZA 1F48A 2CCGA 2WV9A 3TR5A 1GM5A 2WJVA 1Z0JA 1J2JA 1NBME 3I8XA 3SYLA 1QVRA 2AD1A 1VG1A 1Z63A 3WNBA 3PENA 1JECA 1MT0A 3DMDA 2NO7A 1E3MA 2OV2A 1XCPA 5KSOA 3H0KA 1GITA 3HYRA 2ZRGA 2HT6A 4LYFA 4MKIA 2FPLA 2W2VA 5F2EA 1AKEA 1SVOA 4CZ2A 3Q5DA 3LBNA 2GK6A 1ZM2A 1FTSA 3GD7A 4EFMA 4LPKA 3GJ0A 3Q72A 5J4KA 1NN3A 3JVUA 1FX0B 4KVAA 1KI4A 1WP9A 2IYVA 3EC2A 4TWZA 4TMKA 5JEEA 1EK0A 1OIXA 4XD7A 1GFIA 1TEVA 2AK2A 3UWKA 4C4PA 3BERA 3CPHA 4TSFD 3E70C 2FFHA 1TUEA 2GXQA 2UZIR 4HLUA 4V0ME 3FYHA 2NGRA 3QE0A 2GJSA 2PEYA 2FEOA 1XTKA 1FW6A 3EPLA 1G7SA 4HZUB 4MRNA 2ZJBA 4B3FX 4ZI2A 3U61B 5E7MA 3A37A 2R2AA 4C7OA 4GFDA 4DLRA 3E5HA 3K9NA 3OIWA 1NVVR 1S1MA 1XU4A 4RD2A 3WNCA 2BMEA 1R0WA 4FMDB 4OBEA 2GESA 5C18A 1HEIA 3GEHA 3K1JA 3LBHA 1F2TB 221PA 1C1YA 2BIFA 2ZSAA 4GL2A 2QEQA 2X2FA 1E9DA 5HZKA 1G3RA 2ZJ2A 1YU9A 3N5CA 1IN5A 4JVNA 4BFYA 2NO1A 1ZNXA 4JVLA 3DZ8A 5J40A 2VHCA 1T8UA 3RS7A 4B2IA 121PA 3W5JA 1M6NA 1A5TA 4MH0R 4W5HA 1W7AA 4IXNA 1ZCAA 1P3JA 3AB3A 3NWJA 3QVVA 1RKBA 3QKRB 1DS6A 3N2IA 4MRVA 3MJRA 4G5RA 1E2EA 4HZUA 4PC2A 4G5SA 4M0LA 1ONBA 1IXSB 3SJAA 2IS6A 2MMGA 4DLXA 3ZIAD 4ZV4A 2Z83A 4TMTA 3RAPR 1DVRA 1GILA 1A7JA 1DG1G 4LJ6A 2J5XA 2QPOA 4FMCF 1XPUA 4TYWA 5GJCA 1Q1QA 1G3MA 2A3RA 4DDTA 3CWQA 3TE6A 4Y0AA 5JLJA 1US8B 5LPNA 2KE5A 3EA0A 1KZ7B 1DARA 1J99A 2BWJA 4ARZA 4HI0E 3IBGA 1ODFA 4WAUA 2ZAOA 4IEIA 2ZSEA 4WVFA 4EFLA 3THOA 3LLUA 3D31A 3OIUA 1L8QA 1N0WA 2JIZA 3BH6A 2ATVA 3AKEA 1K8RA 4YXWD 2ECKA 4KITB 2GJKA 5JCPA 8OHMA 3CX6A 3QKSB 2VP0A 3CZQA 4K46A 1E0AA 1KK1A 3CRRA 1VCIA 4PC6A 1T0JB 3AP1A 4DCUA 2OT3B 2QE7A 2V54A 4ABYA 3VX3A 1WRBA 3QXJA 4JSYA 4NMMA 4CDGA 4X8HA 2BV3A 1RVDA 2QUZA 2ZUDA 3CZPA 2E87A 4L9WA 3EARA 5AUPB 5JI3E 1Q1BA 1E79A 1CP2A 5KDOA 3QF7A 1OH7A 3LX5A 2OXRA 1A2BA 2IHYA 5KU1A 1CJMA 3PUYA 1NMZA 2XAUA 2J0VA 1TUIA 1T5LA 1HV8A 4OI4A 2VSOA 5E95A 4OJKA 1GDDA 1SKYB 1IM2A 2QM7A 1NVXQ 3NBYC 4PC1A 3TSOA 4B76A 5JEDA 2WWFA 3AP2A 5CK5A 4MRSA 2WWYA 3RS0A 5E7JA 1CS4C 3GJ3A 3C5HA 2JLUA 1FFHA 2J0SA 5IK2A 2GBLA 3VKHA 2KJQA 2TMKA 5M1NA 1NJFA 4NCHA 2FG5A 4WZAE 3ZGXA 4DRZA 4NYIR 5IT5A 4W5WA 3RSOA 2H1LA 3RANA 2IW3A 1G19A 4MDEA 4P4TA 1X8LA 4JBWA 3MJHA 4US0R 1CBUA 1E1RD 3GJ8A 4UXJA 1Z28A 4LHYA 1F6BA 2X8AA 2IS1A 2F1IA 4LSGA 3T06B 3VKWA 4O3MA 4UNPA 3SFZA 4Q1FA 1A2KC 1E6CA 1G16A 2AXPA 2ODEA 3MFYA 1KZGB 4P33A 5DE3A 3SJCA 3F5FA 3NVAA 1U8AA 2Q9AA 3QKTA 4C0LA 3T61A 4UQOA 1XCMA 4FI3C 4NYMR 4LX0A 3AVWA 4OHZA 4TQUS 3VU9A 2C99A 2ODBA 1F2UA 3RWOA 4D2IA 1NN0A 1NVVQ 1KGDA 4QL3A 3RWMB 5JRJA 4M1KA 1CF4A 4CGZA 4KSCA 3PEWA 4G5QA 1E2GA 2PZFA 4DLUA 1GSIA 5B64A 2O8BB 4QGFA 1U81A 1W48A 3BH0A 4JLAA 2IA5A 5K8TA 2VHQA 1Z3IX 4C0BA 4H1UA 4JL8A 2ZVQX 3L0PA 3NC1C 3K0EA 5CYPA 1ZU5A 2QQ0A 1XTIA 3VMFA 2AFIE 1TNDA 4XWAA 2RGGA 3P26A 1KO1A 1FNMA 3B7GA 1W5TA 2BBWA 1E69A 4PC7A 3KKMA 3TSWA 4AYWA 1KO8A 1KK3A 2VHUA 4M1YA 5ELXA 3Q85A 2ZJ5A 2CLCX 2GXSA 5AR1A 4M22A 3ZH9B 4BFTA 3ADBA 4TZ6A 3IKJA 5CJ2A 3O8RA 1W36C 4L16A 1YR7A 3TW8B 2CBZA 3DDCA 1G1MA 2KB0A 5J5CA 3JZMA 1XZPA 2XJ9A 4CEIB 5FBWB 4BUJA 5EUMA 3KQNA 2E1RA 2F3RA 5G40A 4JLBA 2W2XA 2LKDA 3GMTA 3TR0A 2CDNA 2A5FA 4CVNA 2PMKA 4LWZA 2HXSA 3W6PA 1SGWA 2WIBA 3EPHA 1Q21A 5FL3A 3B82A 2GXAA 1KJWA 5FBQB 4R2IA 1MH1A 2BCGY 1D6JA 2ZI5A 4XVQA 2AR7A 4I1UA 4GMXA 4A0HA 1TMKA 1QHHA 3ZQ6A 3DMNA 2VLIA 4GRAA 1NLZA 2RGCA 4Z1MD 5L8VA 1RRCA 1PVOA 1DAIA 3VAAA 2WOJA 3LBIA 4JS0A 1P6XA 4DLYA 2W2TA 1G64A 1CR4A 1GWNA 1NJGA 1J8MF 1KJYA 1Z07A 3CF0A 5A5GA 3QVUA 2P2LA 2QT0A 2ZRAA 5AUNB 1KI8A 3LWNA 3CRW1 4QM6A 2PZEA 3PQCA 4AYTA 5ANRB 2ZSBA 2BDTA 3TQFA 2F7SA 1PV4A 1MO4A 3GEEA 1Q44A 4AKEA 2GA8A 4M1TA 1E79D 3V4RA 2VH5R 4WZ6A 4TTQA 1E2FA 1S3GA 2EFHB 3P1JA 2IYQA 1D5CA 2I1VB 2C2HA 3P32A 1N0UA 2XOKA 2G83A 4QOSA 3B1ZA 2VTKA 4MUAA 4EQ6B 1TADA 2G6BA 2ZRCA 4PZLA 3W34A 3REFA 3TMKA 4HUTA 3EX7C 4FMBB 1OHHD 3B1WA 4IDHA 2XSZA 4KHZA 3RNLA 2A5JA 1RW4A 3HPRA 5GADl 3WP1B 4HAZA 4CEJB 2FSGA 4JLOA 3VR6A 4QHSA 1KHTA 4TL6A 4F93B 1E4YA 1P9RA 3UPUA 1S9HA 4M9SA 3TSZA 2P65A 1A4RA 3MD0A 3ZVRA 3KKQA 3TUJC 4C0JA 3TUZC 1KNQA 4IFEA 3PG5A 4HATA 4FMDF 1GL9B 3NBFA 4PSKA 2O0JA 4QC2A 2NPFA 2IF2A 2CL6X 4LBVA 4KCGA 2WKPA 3AKCA 5FL7D 1COWD 3U7HB 1Z6TA 1XJ0A 1ZIPA 1GKYA 2XGJA 2BEKA 3X1ZA 4POAA 4IJMA 4LGMA 4EUNA 2NO6A 3VR3A 2WM9B 2Q3MA 2WAXA 3Q3JB 4AKGA 2BBOA 2FN4A 5UKDA 2F55A 2QP9X 4NONA 5FTKA 2NO0A 2REXB 3R7WA 4BZPA 4K81B 4RD4A 3K70C 3QF4B 3T12A 3B1YA 3FFBA 2ZI3A 3EIHA 1OIWA 2C9OA 2ZI4A 1T91A 1HT2E 2WJIA 3SOPA 3T5GA 1DOAA 3RABA 4P31A 1N6KA 2MMCA 3LV8A 3CX8A 3W8NA 2RB4A 1VDZA 5AUOB 5JS7A 2IX3A 4KFSA 1NSTA 1GIAA 1KSFX 3K9HA 3TJZA 1HE1C 2ZS8A 2RGNA 1E1QA 2O8DB 3Q7QA 4N1AA 1MOZA 2DBYA 3B2EA 1GTVA 1VIYA 1SKYE 5EUQB 2P67A 1Z2AA 2QP3A 1DO0A 2F9LA 2G0NA 2IWHA 1W36B 3LDAA 4NE2A 3FGNA 1NRJB 3GJXC 821PA 3GLFE 2FDCA 1X1SA 1GKUB 3TIFA 2N42A 5EXTA 4BFVA 3GJ5A 4D0LB 2QNRA 1CU1A 3HWSA 4DT1A 3BB1A 2DFTA 2PLRA 3EPJA 4IOJA 1IXZA 1TTTA 3C4JA 2QSYA 3DM5A 2VSXA 1IBRA 1Z6YA 3VR5A 4BECA 4DEYA 1TL7C 2GWHA 1E9CA 1KMHA 1OFHA 1OPXA 3GEIA 1DE0A 2VL7A 3LD9A 2Z0MA 3O47A 4Q1AA 5BYJA 2G1JA 1XX6A 2FNAA 4NBSA 5GJWC 3GLFB 1QHIA 2HLDA 1N5KA 4IDPA 3HJNA 1Z08A 4LJ8A 1G9XA 3CRQA 2O8CA 4MQBA 4RZUA 4MITA 2J7PA 3AVPA 2ZJAA 4U5XA 5FPYA 5L3SB 3VNVA 4IDNA 2RHMA 3AKYA 4PPGA 3W3AA 2OE2A 4ESHA 2ERXA 4FIDA 3EIEA 2OBLA 3ZQJA 1D8TA 4DLTA 2QGZA 1D9ZA 1E0KA 5KDDA 521PA 1HYQA 1VCMA 2J9RA 5TXGA 1GNQA 2R65A 4I1VA 2ZI7A 4Q18A 4QGHA 1NY6A 3C16C 5TMPA 2IEZA 4PO8A 1BOFA 4BGDA 2NIPA 1G8FA 4XJXA 2NO9A 3IPXA 4RD6A 4O25A 2G88A 3CNLA 3GLHA 1N5JA 1U99A 2RGDA 1DAEA 1Q1EA 4A82A 4Z54A 2ZXUA 4MKGA 4TL9A 3U3JA 2Q6TA 2F1RA 2QRNA 3L43A 3FHTA 4TL7A 4PZYA 3RRNA 1FX0A 2D74A 2WWXA 1U98A 2GK7A 3QKSA 4HZIA 1W4AA 2B92A 1NI3A 3RC3A 1HUQA 4QJ4A 2V8OA 3KXIA 2JCSA 4UKDA 5J47A 4H9GA 3WHLA 4B73A 5DN6D 1UKYA 4KFRA 1ANKA 3IILA 1UM8A 2FE4A 4OKSA 1RRGA 1Z06A 2P6NA 1EX6A 4LUCA 4BEJA 2VEDA 1SKQA 3TVDA 2C96A 3WYFA 1NLYA 2EW1A 2YC2C 3IO3A 2WJJA 1H8HA 5JSZA 1XPOA 3H2YA 2XXAA 1LFDB 4FCTA 1W4CA 3AF2A 2PT5A 1X8KA 3FE2A 3AVTA 5EP4A 3U60B 5KOYA 5KNBA 5EE5B 1OXXK 5FFMA 2D06A 5TVKA 4G0NA 2IYLD 3A58B 3FWYA 1KI7A 1DPFA 4BLPA 4DUGA 4JLVA 3I73A 4UNQA 2XZPA 2MSCB 5EXPA 2XB4A 1G5RA 4C0AC 3EWAA 2IWRA 1JJVA 4TQ9A 1Z5ZA 4KO8A 4HSEA 4B32A 1F60A 4HB3A 2GJ8A 1XEFA 3RSLA 5G41A 4B2LA 4YMUA 1A1VA 2D4HA 4DKXA 4Z51A 3GLFA 3PEUA 4R71A 3MAAC 2B7CA 1M2OB 1JBKA 3U2QA 3DEFA 2WZQA 3K53A 3TW4A 5B30A 2Q3HA 1QRAA 4IEEA 4B3CA 2P0EA 2FOLA 2DR3A 5KTYA 2N46A 2OFWA 4RKEA 4I1OA 2CHGA 4QBGB 4D4MA 4MGKR 4OK3A 3RS3A 1KDPA 4MUBA 1VCOA 3AEZA 3LVQE 1FUUA 3UK6A 1TU4A 3QXXA 2CMKA 4ZCMA 1M34E 4Q4AB 4HLCA 1TQ2A 3B1XA 4IOKA 4PHFA 3IPYA 4PQRA 3A8TA 4O0MA 3K70B 1I4TD 4OI0A 4XOIA 4LCBA 2GEDA 4BLRA 1JAHA 2ZREA 3FMOB 3C5CA 1UDWA 3IQWA 4HB2A 5AK0A 4II7A 1L7VC 1LF0A 1JXOA 2ORVA 3NBZC 1U8YA 4G3XA 4KODA 3HR8A 5IHPA 1DBSA 3B6EA 2W6JD 4CT5A 2DWPA 3SZRA 3VHXA 3KTAA 2D7CA 1E9EA 2WSSA 5DISB 4HAVA 4G1UC 2FFQA 4Q21A 4Q1EA 1P73A 4MYUA 4EFNA 4TYQA 5B57C 1OXUA 4Q1BA 1XEXA 4JZKA 5F98A 1W1WA 4OQNA 4QNRA 2JLXA 2W0SA 4BFUA 2GKSA 3O8DA 1X86B 1KKLA 2IUTA 1MABB 2ZJOA 4PHTA 1D2MA 1G3UA 4FW9A 4PQYA 4CIDA 1XD2A 3RS2A 3ICQB 1G8HA 3FPAA 4DSOA 1NVUQ 1RYFA 1W4RA 2HF9A 3GPLA 3U4QB 1BS1A 1ZINA 3SC3A 1CR0A 1GG2A 1NY5A 3B78A 4JVMA 3CRMA 4B75A 5EE1A 2ONJA 4IVRA 4ITRC 3KQUA 3KQKA 1Z2CA 2HDNB 4RFSA 2PEZA 5JHGB 3ICEA 3HP1A 4QBFA 3DOFA 5HCIA 4LJ4A 2PX0A 1TQ4A 2ZPTX 1ESMA 4CEIA 1UKVY 1SXJB 1OE0A 3I61A 3AF4A 4NH0A 2CL0X 1E1RA 3BOSA 4R2HA 4U00A 4EPTA 2O0HA 1ZMXA 1NSFA 3BAFA 1KI6A 1ZM3A 2EFGA 2ZE8A 1OH5A 2OEPA 3KJIA 2ZRLA 4IHQA 5EP2A 1AGPA 3UG6A 2D3WA 3B9QA 2DY1A 3ASYA 5F9FA 1COWA 5L3SA 1U94A 3QSYA 3EIQA 3PEVA 3FKSA 1XF9A 4A8JC 2IYZA 4TMZA 1ESNA 3BXZA 5KHOC 2C95A 4Q48A 4YMVA 1T8TA 2FH5B 2W83A 5KO2A 4YDSA 2F1HA 2QPTA 2DFNA 4F7WA 2NTYC 3OHMA 2JDID 2A7QA 4I99A 2XTZA 4DB4A 1AK2A 3SI7A 4A0RA 3SS8A 4Q4HB 1OYWA 3AGQA 1KY3A 1GRQA 1VG8A 1O87A 4ILEA 4JLMA 5FBVB 4HB4A 4IRUB 5FI1B 4GOKA 5SZJA 4Q7JB 4A0FA 2OSBA 2CCKA 3K0AB 3N2EA 2OCBA 1G7RA 4KAXA 2ZJZA 1E96A 3I3SR 5SZHB 4M9QA 2Z4SA 3NHAA 3I1FA 1E9AA 4MGIR 3SQXA 2BVNA 4KBFA 3PV0A 3ZIAA 1E9BA 2QTVB 5TDHA 4XSGA 2JLQA 3D6TB 4PX9A 1LVGA 3CF6R 1FQKA 1DAHA 2PCJA 1YZKA 2WJGA 4HDQB 4F4IA 4PPQA 2HJVA 2OBMA 5M1FA 1AQUA 5DGXA 2L0XA 4PQFA 4LHVA 2YHSA 2EFEB 3QJYA 4RFVA 1U90A 4CEHB 1FUKA 1N2CE 1R6BX 2CHVA 4IOMA 5FPSA 1IOZA 3PUVA 5A0FA 4DIEA 4RKFA 3GFOA 2GVDC 4QBIA 3U3OA 4Q7KA 1E2DA 3M4YA 2WPDA 5FI0B 2BJWA 3QEOA 2IBMA 2O8FB 2IS4A 1EFTA 4GT1A 3LAWA 1LW7A 5D3QA 4RY2A 4JL6A 1JXMA 4UXIA 3RS4A 3WRXC 3KKNA 5JCZA 2JLWA 3MSXA 3L8ZA 1A82A 1FQJA 4V0MA 3L0SA 2BM0A 4C3ZA 4TQAA 4DLZA 5FOUA 5CB6A 1IXRC 4OQMA 4PTLA 2W6IA 4NCKA 2RH5A 3SJBA 4RFSB 4XSHA 1N6RA 1OKKA 3HU3A 2V3CC 3SDZA 4ZIRA 2GEUA 5KDLA 1Z29A 4AWXA 2QY9A 4Q4JA 5KNCA 3M6AA 1DAFA 1TX4B 4NYMQ 5HZHA 2BM1A 2FFBA 3TLXA 4MKFA 5JHHB 4ON9A 3I8SA 4M9XA 1VG9B 4XD7D 3NC0C 2Z43A 2BC9A 2ANBA 4JJZA 3WBKA 2AWOA 2P5TB 2ZANA 1XNJA 3QI2A 1FZQA 4KLZA 3U3RA 4DCSA 2WTUA 1J90A 1XJQA 4UNNA 2ZTSA 2VP6A 5AWFC 5B58C 2YWGA 3ZD6A 2JLVA 1GUAA 2XZOA 1F2UB 2CE7A 3KKOA 4HB0A 2HCBA 1NMXA 3KTAB 5C4MA 1L4UA 1YZGA 1E32A 3IEUA 5CDFA 4TSFA 2J0UB 3P4XA 4LYHA 5LDDC 3FMFA 1P72A 5JJKA 4OHYA 2ZRNA 4TT3A 2QROA 4Q4HA 1SVWA 3RYTC 4ZDJA 3K0FB 4D80A 1CJTC 1PLKA 5CJPA 2XB2A 1J7KA 1HT1E 4HDOB 1XBTA 2D2FA 4GMDA 5EE9A 1I2MA 1QDEA 2BHRA 421PA 3CR8A 3AP3A 5CM8B 3VFDA 1FL9A 2GZDA 1IHUA 1VG0B 2ZAMA 1H65A 2EFCB 1NG1A 4MGYR 1GZSA 3P20A 1XTSA 1KJZA 2H18A 4EKDA 1W2HA 3QUSA 1ZP6A 2FJUA 2WSMA 3U6KA 3ZLJA 4E09A 5CIQA 1WBBA 2VP5A 1H8HD 1KI3A 2A2ZA 2CEAA 3ZVLA 2ZYWX 4A6XA 3NEYA 1HA3A 3EZ2A 3DL0A 3GLHE 3X1YA 4DWJA 1JR3D 2IYYA 4RD0A 4RSGA 1WB9A 2ZIAA 1T3LA 1ZBDA 2ZRHA 4E07A 3S1AA 4C0HA 4D25A 1MO5A 2F1JA 3KB1A 5LB4A 5DO9A 3T1OA 2ZU6A 2WIAA 5AJWA 4MRPA 3PXGA 2JDIA 4M21A 4DLVA 2HT1A 4XH9B 2DWOA 5HKKD 4IW3B 1RIFA 2B6HA 3AF3A 3NXSA 2GNOA 1Y3AA 2KBFA 4LJAA 2OILA 3CONA 2J3EA 4RJLA 4M4SA 3ADCA 2DYKA 2J41A 4ZI3A 1VECA 3VR4A 1E2IA 3OE7D 2D7DA 3PJRA 4X8OA 4BFSA 4V03A 1VYUA 4Q47A 2O8FA 3AM1A 1Z6AA 5DLQC 4YONB 4A15A 2ZQ5A 3AVXA 4NPHA 5DYIA 3EA5A 3GLIE 1N6LA 4A0GA 2H16A 2EYQA 1FMJA 2YC4C 2J1LA 1DAKA 2C9YA 1D9XA 1US8A 2MSEB 1CJKC 2CNWD 1ZD9A 3QBVA 1W0KA 4FCVA 1K5DA 2R44A 1XD2B 5EP1A 1TPZA 1MKYA 3FHOA 3LQQA 5BN5A 2JEOA 2VHTA 2IYXA 4URZR 4AD8A 5HCNA 4AK9A 1QHYA 4W7SA 2IYUA 3KQLA 3ZD7A 2C98A 1U8ZA 2DFLA 3A1SA 2FWRA 3OFNA 4JT4A 2CE2X 2FGKA 3R8CA 3LFUA 4GDFA 4V0LA 1W44A 5C15A 1QHXA 3QKRA 1I4LD 1JPJA 2ODNA 1P2UA 3GLHB 2W58A 4M1OA 4B43A 1RRFA 3BB3A 1N6NA 3W3ZB 3VX4A 2V9PA 4B6FA 5J4LA 4GSYA 2WMOB 3C7KA 5A4JA 2OCPA 2RGNC 2ZE7A 3T35A 2J7KA 1IY2A 3L0OA 1CKEA 3VQTA 4NU0A 2V4ZA 2Q3FA 2IS2A 1Z8FA 1AS0A 4BLTA 1WBDA 3KUDA 1P2TA 2ZRFA 2OAP1 4ZPXA 4BLOA 3CH5A 1MO3A 1W47A 4B6EA 5JWRA 2A5GA 3IHWA 3PUXA 2WBLC 1CLUA 3QOFA 4URVR 2O0KA 2AWNA 1DG3A 2WJHA 4ZKEA 3LW8A 4TYPA 5FUYA 1OT3A 3TBKA 2MSDB 1Z6GA 4XIGS 1KI1A 4PANA 2QU8A 1P60A 2WWGA 2IYTA 4L9SA 2VP4A 4IFBA 3AH8A 2PMDA 5DH9A 5BN4A 3K8YA 4P0TA 5KSZA 1B23P 1TEXA 2ZRPA 4JLKA 2ZRDA 2JJ2A 1OV4A 1IN6A 1ZC3A 1SZPA 1N3BA 5FUVA 3FHCB 2O8EA 1S96A 2IXGA 4BPBA 2NMVA 1AQYA 2WWWA 1UJ2A 3CIOA 3HYTA 2HYDA 3RRMA 3GQBA 5C4GB 3QKUA 1YZNA 3K0SA 1KSJA 4DT1B 4LHWA 2ZR9A 2WMNB 4F92B 5FPTA 4JYCA 1UBFA 2BBTA 4OL0A 4F4CA 2CXXA 3QPWA 4BFXA 5FBRB 4DXAA 4QXAA 1X1RA 3AVYA 3BBPA 2GCNA 2W0MA 2VIIA 3H86A 5FH9A 4I4LA 4TMVA 5LD2B 1KO5A 1KDRA 4A2WA 3BFXA 1MABA 4E22A 3PR1A 3ND9A 4Y0VA 2ZM5A 2PZGA 4XWKA 2ERYA 4QGAA 1XXHA 2ZITA 4P3YA 4A4DA 2OAQ1 4IDQA 4NHOA 2OO7A 2XXAB 4PAQA 1XEXB 3RC8A 1B0UA 2QP4A 5JWOA 4DSNA 3J81k 2VO1A 4ARZB 3NHBA 2RCNA 5EE3A 4DCTA 1U9IC 3CM0A 5JJLA 5C2FA 3ZS8A 3A4MA 4B47A 4ASUA 4FMCB 2AXNA 4B2PA 2O8EB 1VHTA 5DNYB 3LY5A 3A4NA 4HLDA 5CDFE 5EZ6B 1XXHB 2UKDA 2QAGC 2YKGA 1J70A 5FPKA 1NKSA 1HE8B 3TAUA 4B3XA 4LK2A 1AA9A 1EG7A 3V9PA 5EE0A 2H92A 2AD5A 3SJZA 3QIAA 2RGEA 4Q1CA 2PCLA 4G5GA 4N0EA 3PUWA 1GNPA 4Z8XA 3IO5A 1KOFA 5LD2C 5CYOA 3TVTA 3ZYCA 3FOZA 5JZVA 4BQSA 4LPSA 3TKLA 4US2R 3THWA 2FFAA 4P32A 2AFHE 1M8PA 1ZUIA 3OFND 3S1AB 4URWR 1ZD8A 4C30A 4JLNA 2BMDA 1G7CA 5B2ZA 1W0KD 1LY1A 4DJTA 4IXMA 4EAQA 4V0NA 2QL6A 1YRBA 1R8SA 3LQRA 3OF5A 1K5GA 1NNEA 1T9HA 4WW0A 2JLRA 2R6AA 2X1VA 3LRPA 3UWOA 5HE8A 4AYXA 1G6HA 2KSQA 5HR5A 3CPEA 4N0DA 2R9VA 4HAUA 5L3QA 2R8RA 3HR7A 2O8CB 5FTNA 1N5LA 5KSPA 2ZRMA 1W46A 2KBEA 3C8UA 3OAAD 5AJZA 1AS2A 1OHHA 1S9DA 3PIRA 1U9IA 4M53A 2R6CA 1XMIA 3BE4A 4NYJQ 4TN1A 4V0OA 2J59A 4JKYA 4RZ3A 5E4FA 4NCIA 2REOA 3K0FA 3WMFA 4A36A 4F38A 2OESA 3KL4A 1U0HC 621PA 5H8WA 1MRNA 4W5JA 5H68A 3TH5A 5J4VA 3D7MA 3BORA 3OIVA 4GZLA 3AQ4A 4LDJA 4OYHA 5FBLB 2JLSA 4PSAA 2KWIA 4PPFA 2ZYVX 3AF0A 4Q7MB 4DC9A 4NCJA 2EFDB 721PA 2VPPA 1OIVA 3ZZUA 1OH8A 1QG4A 4NTZA 2FSHA 3BIFA 2NG1A 3Q9LA 5M1PA 4PR0A 4UJ5A 3BK7A 4KFTA 1XDBA 2CHQA 1M74A 4JBYA 3OEHA 4OI2A 3SEAA 1UADA 4ESVA 2CCJA 2X2EA 5P21A 4KYIB 1HTWA 1RFLA 1G291 2R6GA 4AC9A 4QM7A 1IJEA 1D2NA 1NMYA 5C2JB 3O8CA 4B44A 1T5IA 1YZUA 2VYFA 4TMWA 5EXSA 2NPIA 4XWOA 1P9NA 2R6DA 4S35A 4RZ2A 3NH9A 2ZE5A 1W49A 4L4UA 2FGJA 1SXJD 5BYKA 5GJVC 1R4AA 2RAPA 1J8YF 4YDHB 3C15C 3EAQA 3GFPA 3UATA 1LNZA 4QBHA 4LYJA 3AVVA 1ZM9A 2OLJA 4EPVA 2ZETA 4NKRA 4MA4A 3CNOA 4Q01A 2CVFA 4MDFA 4LBZA 1II9A 3OZXA 5IF9A 2EWWA 4JKIA 4KLNA 1GNRA 2XTNA 4OK6A 4NYIQ 3MMPA 1SVMA 1UBCA 2ZYUX 1JEEA 2GJ9A 4PO9A 1UAAA 3WBJA 2VQSA 1TU3A 3M0EA 2QQEA 3GJ7A 2QMEA 2GHIA 4A2QA 1GVNB 4BFWA 2WKQA 3OE7A 1G7TA 4B48A 2JATA 2CJWA 4MRRA 4RCZA 5AJXA 3GLGA 2YOFA 1PJRA 2YOGA 2ZEJA 1ETUA 4PXAA 1LTQA 1KMHB 2O8BA 2FPMA 3E2IA 1KK0A 3UG7A 1IJFA 4B3BA 3B1VA 1JI0A 3I92A 2R62A 5JFGA 1RRPA 4ERNA 1NN1A 2GJAA 4A9AA 1RJ9A 3KUCA 2XEXA 1V43A 2V6JA 2XZLA 3EC1A 3GFTA 3I72A 1UBEA 3LA6A 1P4SA 1AZTA 3LO5A 5SZIA 3R9XA 4A8JA 3DPUA 1OW3B 2IK8A 4WXRA 4OQFA 2AL7A 4YC7A 4D4LA 5F9HA 1N25A 3W90A 1Q20A 3GLGB 3CB4A 1DEKA 1JALA 3T1TA 1G8GA 2HLDD 3W6NA 2GXUA 3T34A 1JR6A 1JQLB 2ZJYA 3A1VA 1ZC4A 3AV0B 2DPXA 3D8BA 2JAQA 1ZCBA 3NKVA 1P61B 1XPRA 2ZUBA 5F3WB 3OAAA 4BLSA 2J0UA 3CBQA 4JSTA 5C10A 4DSTA 3BD9A 3QENA 4QJ3A 1X8JA 2X77A 4QGGA 3WP0A 1ZYUA 3MGCA 4OQXA 1D2EA 3U5ZB 2F43A 1R0ZA 4MGZR 4EPXA 1OLOA 4M2LA 4NYJR 1S8FA 2FA9A 1S1CA 1OF1A 3E1SA 3NEJA 1K6MA 1AM4D 4TLAA 2NZ8A 2GAOA 3M1IA 5AJYA 3QF4A 3IUYA 2OCYC 5K8IA 1NN5A 1II0A 2V7QA 4XVRA 4PHHA 2ZRIA 3ZVNA 4TTRA 2ODWA 2ZSFA 2ORWA 4KV9A 1BYIA 3T15A 3U7FB 5C1BA 3R8FA 2QG6A 2C77A 2GTPA 2PBRA 1E2JA 3WYGA 3JZAA 4HUQA 4MKHA 2EQBA 4Q19A 2X19A 2GCOB 2AN9A 2RHDA 1SXJE 3UMRA 1ZM7A 5GJBA 1UKZA 5KPJA 3KFVA 3AUYA 3G82C 1G17A 2AKYA 1UF9A 1KI9A 2KI5A 2P3SA 3CR7A 1W5SA 1YVDA 2IEYA 3A1WA 3CWZA 4OHVA 2H17A 4PAMA 1P2SA 4LBYA 5DN6A 1IY1A 1WDTA 5IDVA 4QHTA 2ZVPX 2RGBA 1GOTA 2QTFA 2ZSDA 4D6PA 5C2DA 2NQ2C 5DSZA 3U44A 1KO4A 1Y63A 4CEHA 2PH1A 1Q22A 1RJ9B 2QRZA 4KI0A 3WY9A 3AVQA 2D2EA 2IXFA 4WOPA 1HH4A 3OEHD 4Q9LA 3MWLA 4OHWA 3FVQA 1CRPA 4QKQA 2ZR0A 2ZROA 1V5WA 3K9LA 4GP7A 1R8QA 4QJ5A 1KSHA 1KDTA 3PITA 3ECCA 1T4GA 3EZFA 5H70A 1S3SA 1IN4A 1CJUC 4AKIA 3L0IB 1JAIA 2FZ4A 2VP9A 1HQCA 4URYR 5BXQC 2NZJA 4H1VA 2R6FA 1SULA 4IVQA 4ACAA 1JJ7A 3JVVA 3CRVA 1R0YA 4LC0A 2JJ1A 4FWIB 1RPZA 3LXRA 3K0AA 3QG5A 3EZ6A 2OUKA 4GI7A 4PHGA 5CLQA 5DI9A 3VR2A 4Q00A 3NTUA 3U44B 4NZYA 3WMEA 1E2NA 3I5YA 3MG9A 2WVJA 4RD1A 3ZS9A 3CKLA 5CB8A 5J4HA 3U3KA 1VTKA
chains in the Genus database with same CATH superfamily
3GJ6A 2PAVA 1DO2A 4QNNA 4F1KA 5HW0A 2G8NA 3ZWPA 1D09A 4DLSA 4GGPA 4YRIA 4C0KA 4QAQA 4DNPA 2PWZA 4MA0A 4MKZA 5TB5A 3N0VA 3UICA 4Q7QA 1ZH8A 4KWCA 2AFHB 3ZHYA 1M0SA 4GNRA 3ROTA 1C80A 4L0QA 1G55A 1K8YB 4LF8K 3EGDB 3LANA 1O9HA 3I04M 2ITGA 3IV9A 3BD6A 3CV3A 4HNHA 3T94A 3V3KA 3V1OA 3MX5A 5AI0A 3B6IA 3HU2A 3COYA 5A5EA 2CXSA 2PJDA 3VPXA 1N5YA 2PY6A 3DOEA 4L85A 4MV5A 4F4DA 5TQ0A 3ZDFA 2NU7B 1YJQA 5I3ZA 1XJWA 2HUNA 3W8RA 3CXUA 3C87A 1RE1A 2QMUA 1ZIYA 3M4XA 1PBTA 4YJFB 2C4NA 3RASA 3T9DA 2RBKA 5JH7B 3CNQS 3UGJA 4OGFA 1B2RA 2NTJA 3PQEA 4WGGA 1O0BA 1XRSB 1YH3A 3ED5A 3RAEC 1YE8A 3IGFA 1TIKA 2AR9A 5MFPA 4BBJA 2WD8A 4EECA 3L7BA 1IDOA 2UZ3A 4KVZA 4BWMA 1P0FA 3BG5A 4CLRB 2Y1EA 4B6RA 4E2ZA 4RDCA 2VKQA 2FPSA 2X5OA 2FQQA 4DW8A 4V1CB 2ID8A 3ZU3A 3CJ1A 2VDNB 2V7QD 1H3FA 4I81A 4KTTE 3VOBA 4U2BA 3HTXA 4OO1J 3EY4A 3OM8A 1KDYA 1EQ2A 4PSDA 3QHQA 3HI0A 3C6HA 3F0TA 4QU9A 5CX4A 4G0VA 4RVCA 1O13A 3HPQA 3VESA 1XAIA 2C2WA 4KQMA 5I4KA 2YUIA 3ENZA 1BRMA 4KFUA 2B3DA 4QVGA 4M8KA 2JGLA 4XGRA 3ZHTA 5CB4A 1OV6A 1T3SA 3DFKA 2BGKA 3ALYA 3QBTA 4G41A 2SBTA 4EARA 2YJ3A 1NOIA 5IJZA 2E5FA 4RCYA 5BN4A 4WCDA 1F6DA 2VDVE 2G7ZA 4KHPB 1USIA 1OSNA 4BO2A 1Z7YA 1U47A 1RE0A 2W6CX 3MPOA 4RZXA 4YRSA 3MNFA 4M41A 2H2HA 4HGPA 5ERYA 3KHKA 3RHFA 4GEGA 1OROA 3L4BC 2CBXA 1T29A 2COUA 3UK0A 4Z4QA 4BYGA 3T7EA 2ZCUA 1OVQA 4DIBA 4OAOA 3HZRA 5AQNA 1R5NA 4KDCA 4FC6A 1ZUHA 3V9XA 4GZ3A 4PG6A 4PEVA 3ZOZA 1B15A 1YSCA 2CFSA 4R1NA 1GKIA 2X5NA 3M6UA 1LLCA 4LYEA 3VPCA 5I3CA 2Z1HA 1P5HA 2OGZA 1J9GA 3HA7A 3QY0A 4FE7A 5BN4B 2BSQA 1UBOS 1EQAA 4DJEC 5H4HA 2PS0A 1G1AA 1BI4B 1Z0FA 2PS3A 3L0BA 1USKA 2CH5A 1F2TA 4B34A 1DXHA 4KXMA 3KVOA 5EFZA 1Z4NA 3K92A 2IUYA 5JS8A 3WZ2A 1EWQA 4UBNA 2DERA 3HB4X 4K9SA 4UTRA 1ZL2A 5KKAA 1L6IA 1P45A 3ZU2A 1S1XA 1LJUA 1Q3KA 4EKYA 4BE9A 2C31A 5JNWA 4WKPA 1IM8A 1KP3A 1X0VA 3GJ4A 2VG7A 3P2KA 4KTVE 2UZ1A 3ITEA 1P5ZB 3PNVA 4ENPA 1I51A 5DIFA 5E8RA 3VDMA 4FZRA 3HKDB 4DDMA 2FUNB 2FG7C 2XNDD 5DM2A 3KFXA 3NONA 2IEIA 1QV6A 3BTVA 5GZ1A 1FFAA 1FYXA 2IY9A 4LV8B 3AZOA 3WAJA 2ZD1A 2I6FA 4QFMA 4FGZA 1E0JA 3SLCA 3MS7A 1F38A 5AVJA 1SXJA 2RHLA 4CODB 1BA2A 4G4SO 4Q6WA 3KQVA 2Y99A 1LF5A 4E11A 2L82A 2GWRA 3MWJA 1Z22A 3VZQA 4YAGA 4ZO7A 2CFRA 1DADA 1KAXA 2L18A 4CZGA 1DTWB 3AY0A 3S2ZA 4OL9A 3PSAA 5J5AA 3I30X 5K3FA 3U7QA 1Q3HA 4C2BA 4FWBA 2O3UA 2RMKA 2WFZA 2GZ1A 3U4HA 1C3OB 2JGDA 3E61A 2PQ0A 1KXPA 3O0DA 4MAMA 5EWLB 2AF4C 4BMXA 3MMXA 1PE0A 4D4KA 4CQNA 2UAGA 2DPHA 3COSA 1GRRA 2QXFA 2K5UA 4U7PB 4CW7A 4HLUC 4Y2TA 4TS3A 2FRDA 2EYUA 3EPKA 4WT7A 2FPPB 4U7BA 3OYIA 1PQWA 2YVQA 1JF8A 1R0RE 1ATZA 1PEYA 1Z5WA 3IAXA 2XNHA 5HL7L 5I3UA 3HG7A 4LMPA 2JWKA 4BR5A 2ONKA 3PA6A 4HNTA 1DBPA 2ZI6A 1ORVA 2XQVA 4WACA 3ZDQA 1YOBA 3OQNA 2D6FA 4MWGA 2G67A 3OCUA 3M6FA 4FE3A 1RGIA 4Y9DA 2OP0A 2PQ2A 4HTAA 4N65A 2H1VA 4QPCA 2YS7A 5JPIA 3LX8A 4ZEMA 5LP1A 2H2FA 4Y1RB 5EJEA 4HRAA 4Y0NA 2HJSA 4GIBA 3HBFA 5KIAA 3PLRA 1N75A 1TQ6A 1U3WA 2LR0A 3GLRA 3GP5A 4JBXA 1QBKC 4EB6B 1NX9A 3QX7A 5EJ5A 4PIPA 1ITGA 5LJIA 2BKVA 3HWX1 3KELA 1UAYA 3ITDA 1TYQA 5F7XA 4XJTA 4WCVA 3WLKX 2SKCA 5FV7A 5G3YA 4Y1RA 5H1YA 4RAQA 5MN4A 2VHZA 2WICA 2QX9A 4O4LB 2QT9A 4OMCA 1QQ7A 4CKEB 2XX3A 4JK7A 4LDAA 2RC6A 4Q16A 2XITA 3C7NA 5AICA 5LC1A 3VGPA 5B5SA 2XOEA 3B89A 3V46A 4ENWA 1XXLA 3EDYA 4D45A 1A9SA 3ZW9A 3A6PC 1V8OA 1GOBA 4MW0A 2X9GA 1XD8A 4KHPK 4MO2A 13PKA 2X8WA 4QBKA 4M1MA 2FW6A 2FVXA 3WMWA 1UK6A 1BFDA 2BKUA 2QN6A 2ZS7A 3AQIA 3DAPA 3FGOA 4IGAA 2LZ0A 4M8LA 3V1UA 2M2IA 3V81A 1JZSA 2DBQA 2DHRA 3FF4A 5THXA 4BNNA 2JI6A 2BHLA 1JDVA 2ZUCA 3EIOA 1JR6A 4AI6A 3A26A 1Y7TA 4F1WA 1GR0A 4TZTA 5FR2A 5U1PA 4RCHA 3EOZA 2ZSHA 3ZDCA 1AKYA 2WE7A 2P35A 3FNIA 3FOAA 4H7KA 5LB2A 3W8EA 1DOHA 3OTGA 2O5CA 3THXA 1OA0A 5BT9A 1H0SA 4CKBA 5IJ9A 1TA4A 4FS8A 1T5OA 4CEJA 2ZI9A 1ZQ9A 3HRHA 1YA6A 2R1VA 3BMXA 2PZBA 1NJ1A 5DHSA 1EB8A 2CWDA 1WLSA 1EJBA 4MKRA 1F5NA 2AMVA 3VSDA 1XG5A 4ZCIA 3DHYA 5TQ2A 3OIDA 1PT5A 4B1UB 3LY8A 3UUFA 1VSJA 2DAPA 2EAUA 5B37A 1NJ5A 2I62A 4DHEA 1N77A 4DV6K 1CNEA 3S81A 4DTCA 4MICA 1U5CA 2CXNA 3ZI7A 4YJDA 2FMXA 3I2JA 4J2BA 1FVOA 3NS7A 5J2TF 2GTDA 3M6GA 3CLUC 1R0SA 2PX4A 4HLQB 4GP6A 2JIMA 1DEXA 2XJ4A 10MHA 3FMPB 3VNRA 4ILGB 2FLVA 3GU3A 1P74A 2JJ2D 2NUPA 5I9EB 4I9NA 4B3DA 4KRFA 1PWEA 3A05A 3F6RA 5J58A 1QO9A 5G53C 5K0BA 1DAMA 2JFVA 3A11A 4BRWA 4U7HA 4JLUA 3IHKA 1GRVA 4B6SA 1SVSA 3G5LA 4PFQA 3HOTA 4KGDA 4X1IB 4C7JA 3CFRA 2YNMA 1Y8RB 1WV0A 3FNQA 1WO8A 3B5JA 3CSDA 3OUTA 4YV7A 3I39X 1F2VA 1OH6A 1ZJ6A 1NKTA 1I1HA 1LI4A 1KS9A 3BRCA 2Q0QA 3TUIC 3GRYA 4BNGA 1W1IA 1WULS 5T67A 1TAGA 5C12A 2ZAIA 1NF3A 4DIUA 5TARA 3TNFA 4TKVA 4G0UA 5JD5A 2J9XB 1TAUA 3ZV7A 1IY0A 2Q45A 1U8CB 2I71A 2IX9A 2XECA 4E1MA 1QPBA 4IGEA 4Z5XA 5HKKA 5KPDA 1U4OA 1V7QA 4Z0TA 1NOZA 1JNYA 1XTJA 1Q82O 2I3BA 5DK5A 4Q4JB 4Y2JA 3R9KA 4XXHA 4EH1A 1FXWF 2Y0EA 1X1PA 5I42A 1M2VB 2JJ1D 5E4JA 2R11A 4ATNA 3V4SA 1UMCB 2R5WA 1W0JD 3GDOA 1JVNA 4BASA 2YHBA 7REQA 1O95C 1MORA 3BCUA 4MULA 1RJGA 1SZDA 2R751 4UHFA 2XRIA 1TCAA 3V32A 5JPCA 4PO1A 3SFVA 2NRXA 3FE1A 3MN7A 2PSSA 4FOOA 4FSXA 4IMJB 4XVCA 1UXOA 1WD5A 2E0IA 5KVVA 5EUBA 2GH1A 2WFMA 1DQNA 2IFTA 2ZYAA 3IKVA 3DLAA 4BEBA 1X13A 5TJ9A 1OB2A 3MCWA 3W2IA 2WINI 1JJAA 1LLDA 1U3DA 5AJVB 4L75A 1XTZA 1C1CA 4BLUA 3PHBE 3S2FA 3OZIA 3P0JA 3DXKA 4O5FA 1O6CA 2O50A 4PLCA 3EB9A 1APBA 1B9FA 2ZATA 3ZWOA 3I05A 4Y8VA 1JR3E 2BFFA 2BMFA 4HHTA 3KJZA 2QD5A 4RW4A 3PFIA 2AI3A 2DCUA 4GF5A 3MHPA 4JFAA 4Q12A 3KLHA 2X6RA 1FP2A 3E9CA 1H1LB 2QEXN 4KHNA 1THTA 4OK5A 4AQDA 2Z8ZA 3MWYW 3OT5A 2GCPA 4FFRA 1HR0B 3TAPA 3JCZA 4KL8S 4QICA 3WHPA 2XY4A 3E8MA 2WSSD 4KUHA 4AW9A 2YWHA 5E7IA 6PFKA 1Y9AA 4DCGA 5L3VA 3O94A 1Z47A 2XYPA 3KJNA 5IAKA 3AL0C 1W9MA 1LRJA 4EG4A 5GWXA 1I0IA 4YFVA 4HH4A 5M1QA 3NF6A 3AIKA 4IQ8A 1EWVA 2AB0A 2SHKA 3BSFA 3C7DB 2FSIA 4Z9YA 3TSCA 3UAVA 3OU6A 3NHZA 3LW7A 4YMTA 3F5SA 4YQFA 2P5YA 2D13A 1I3AA 2XUFA 3TOVA 3TRFA 3PR3A 4M89A 1CEEA 2YNHA 5B1EA 2JHGA 4I7FA 3CLVA 1WZNA 4UUNA 4IV0A 1KY2A 1ZJZA 1GNLA 4C9BA 2GZAA 3DV9A 3LQ2A 4F6RA 5ADXA 3BMNA 1EBBA 3NCIA 1ABEA 2JFHA 1IWBB 3FMIA 1QF9A 1K6IA 2V5AA 4JITA 5F5LA 4CVNE 1P9WA 3VYRB 3W5AA 3ICEA 1YQGA 4YMHA 2FPUA 2Y6VA 4HYEA 3JRNA 3QTBA 4GM1A 4Z94A 1CUCA 1WSDA 1Z4JA 1ZGJA 2AQ8A 3B9PA 3NIBA 2C8VA 1LSOA 3P71T 3L7AA 4QOJA 3CVJA 1ZH2A 2BRUC 3DC2A 1ZD2P 4WN9B 4B3TK 1JEDA 1SXPA 4FJLA 4DTRA 4CTMA 3NRJA 5IULC 1HNVA 1KERA 4KR0A 2PUTA 5IM4A 2PE5A 2P9ZA 2C29D 3MN9A 3MJSA 1ZN8A 3PDIB 4TT3D 1DRVA 2LCFA 3AV3A 5I9BA 4ZZIA 3ZEUA 1RCTE 2CKDA 3AO3A 3BGRA 4RADA 4HVLA 1WB6A 2FN7A 2ZM6K 2LDXA 3LPAA 1ZA2A 2IUSA 5FTWA 3O6VA 1UKEA 4EITA 3SBEA 1KRWA 3DO5A 1R2QA 2FR0A 4LFAB 5BVGB 3MBOA 1MC8A 5CA1F 1Q7YO 1AB6A 1QHHB 1ENYA 1R7RA 1UBKS 3C1AA 1NFFA 2G5PA 3EVZA 3MTBA 5EGSA 3Q0IA 3RVKA 2IVZA 3GT0A 1Q0PA 3GGDA 4FM0A 1JG4A 3OS1A 3ECSA 1GLFO 1QE1A 3DBRB 4YRDA 4BGEA 5CK4A 4F3NA 1RHRA 1Z18A 3MSCA 2H07A 1G2OA 3CJBA 4JI3K 5HP1A 1OBCA 5E0KB 4C7KA 5DHFA 2NLOA 4YACA 1JMKC 1K88A 3EE8A 1GTG1 4HPWA 1UC8A 2XCTB 1HQUA 3IQEA 5DM6L 1E98A 1CY4A 3QU4A 2XCSB 2O4IA 1IJJA 1BO6A 1VPVA 3QX8A 4YP0A 4CNBA 2R86A 4TWBA 2OO5C 4P4LA 4R1MA 4D4GA 5BQFA 5JBIA 1EGAA 2IIVA 1EXWA 2GZHA 2OLKA 4WSOA 3OCWA 3K1YA 3LLMA 4WKCA 5IC5A 4WXPA 3TL3A 4OHRA 3GUYA 3KSBC 2FPKA 3IE1A 1BVHA 3BZUA 3KZ1E 1BMFD 1PEAA 3OPMA 3QG1A 1I3LA 4NMXB 2IC5A 1GRNA 3S9HA 3TLMA 1EGMB 2C2XA 1E4VA 1XD9A 4G07A 1HE5A 2NTEA 4FCWA 4K05A 5LN1A 5CH3A 4N5SA 3M5RA 2YV1A 1R4MB 3SGLA 4OSEA 3UJBA 1FPMA 3FOCA 4OJTA 4KXNA 3QU7A 2VF7A 3Q2OA 4PCAA 1BCSB 4ZPJA 3C6MA 3FUCA 2XF2A 3IQFA 1CNMA 1D0VA 1JAXA 4A5BA 4ILHA 2Z2XA 3COVA 1SCNE 2AP1A 2GAAA 3DWGA 1T5BA 3E9DA 3QXCA 4LTNA 4XCXA 3DG9A 2P7IA 4DV5B 4YBRA 1X1EA 1G41A 2P4HX 2QAIA 1W0JA 3BXOA 3CPJB 5BN3B 2R00C 3V8RA 4G1VA 5JIBA 1N2HA 2GI4A 4AKHA 1GL6A 3RDPA 3OETA 3ANXA 4FYHA 3AGPA 4K8XA 3GLIB 1WKBA 3KD2A 5AVOA 3GJYA 2HTFA 5DLYA 3Q8LA 3TLGB 1NW8A 1YTLA 3RAGA 1LWEA 1A71A 1PDWA 2DVMA 3C5VA 4NWIA 5PGMA 3WNQA 3LP2A 1MIHA 3JPWA 3PQ3A 3VOAA 2ZBPA 5D3MB 1JFTA 2B8TA 2W11A 3EYWA 3CEHA 1UR5A 3KJGA 3KP1A 3IS9A 3SG0A 4D9FA 4QREA 2KQUA 4M9RA 4TLDA 1MGOA 5FOSA 4BO0A 5CXQA 1BIFA 5D5PA 5KPZA 3GUCA 1TLLA 5TQJA 5JZSA 5FR1A 4DLGA 5J1SB 1I3KA 2X3UA 1G5PA 4FBGA 3RKRA 5MGBA 5F33A 1G6OA 1YB7A 2CNLA 3QXHA 2W6ID 2F6RA 4JLDA 4Y1EA 3U0VA 3V1YA 4AXXA 2CK3D 1TCBA 2BUAA 5IBRA 1ZCZA 4ZEXA 5BN3A 1FRZA 2C2YA 1C3LA 3CQ9A 5FOWA 4ZWNA 4DV3B 4NRDA 1DAGA 2EIHA 3VDRA 1E6UA 1HLFA 1P33A 3H4MA 3MPUA 4ZAWA 4BC3A 1IN7A 3K0CC 1NAIA 5TSDA 3TTWA 4N56A 3ZLTA 3DGFC 2YJZA 5AZJB 4EABA 3N05A 1C4XA 5EIBD 1CQIA 4JJKA 1KYWA 4P4NA 4OKJA 2J8ZA 3R6MA 2YMMA 4UOQA 1W36D 2B2NA 2JANA 1ZRHA 2A30A 3V4OA 5C8ZA 3M8PA 3B13B 1MR3F 1M33A 4UUAA 1POXA 3QBDA 1B8PA 1VA4A 3OESA 5JECA 3EEOA 1MRZA 1A9PA 4KVGA 1RBUA 3RVMA 4QJBA 1C1BA 4RQBA 3REGA 5FA5A 3LI2A 1H1TA 4KH0A 4EPRA 4ABTA 3G6WA 4NV1A 3WFIA 1P1JA 4QUGA 5T57A 3RUAA 2QTWB 4B3JA 5FHQA 3CB2A 4ELTA 2I6GA 3UYLA 4JLWA 1YMUA 1O0CA 2O57A 3B60A 3TDKA 1U65A 5CVEA 3R9IA 3SZMA 4F8YA 1OB5A 1DKUA 2AI1A 4WK0B 4W9MC 3SYTA 4OI1A 3GAZA 2WJ4A 1L7EA 3F8WA 4HXGA 5CE3A 5BN8A 3QLVC 1CETA 5GOZA 5TGTA 3ZE2B 1NIJA 3CINA 3TK1A 4WZBE 1OFVA 2PX3A 4ZDKA 2XQGA 1P91A 5FL7A 4E2FA 2Y68A 1E2LA 1UM9B 1N8SA 1Y37A 5HPYB 4AF8A 2QVGA 3DDSA 3BCSA 5IVHA 2PGJA 1O9BA 4WOCA 3VR3D 1FTQA 3PHHA 4I9GA 4NVRA 3CMMA 4Q9JA 1YFLA 5FRNA 1C7IA 3MTDA 1XMSA 4IZOA 3ITKA 1NP6A 1XVTA 2D1FA 4N0MA 4FGUA 1OREA 2POCA 3PLNA 4S2EA 5FWXA 3E81A 4BKOA 4D8VA 5LQMA 1LA2A 1PLLA 3SBDA 3SVLA 1X7ZB 3R20A 2FYTA 1NDHA 2RB5A 3K1AB 3R5JA 1C2TA 2FF7A 2QZJA 3IDQA 5DM4A 5DT9A 1BXKA 4DJDC 3SYMA 4RY9A 3I62A 4L8VA 3C8DA 1EK2A 5GY7A 3WK9A 4YCCA 4LF9K 4WN3A 2X0DA 1OZAA 2M9MA 2OG2A 2FXIA 3GOQA 3D0PA 2Q0UA 4WCFA 3M7IA 5CTJA 1U1FA 1QH8B 3MMZA 3OI7A 3F7TA 1O89A 1OD6A 4FYVA 2O2ZA 3A1CA 4IV5A 1XA3A 2HYIC 1O96A 3GQBB 1GG8A 2WU4A 1R6XA 3OT1B 4P38A 5K99A 2QBYA 4FZXC 4OMUA 4YHHB 1K7CA 3F3YA 2OPSA 5J2UB 3MF4A 2IGIA 3K4HA 5EWJB 3RVBA 5DHAA 4KH1A 3Q4GA 2ID7A 3JALB 4U2FA 1CG6A 2YV5A 1BX1A 2VH2A 2ZDGA 2CZGA 3CO5A 3HQ4O 4MRAA 1HLUA 2Y0CA 1M2OA 3HDVA 3P5JA 3DPSA 4G0WA 2CJWB 1BH2A 3O8BA 3AAPA 3E1KA 1TZMA 1NQOA 4V3BA 1QVAA 1IZYA 2W37A 2I99A 4I5GA 2IHNA 3KPUA 1J5EK 2E4YA 2YIMA 4RVOA 4G09A 3SYNA 4RORA 2IUUA 3TEFA 3LVRE 3AHJA 1S2IA 2P6RA 2DUWA 1F5SA 1YCHA 2ZU0C 3AM4A 4YFYA 1D8AA 4IO9L 1U2TA 1MB9A 2Q4BA 2D1SA 1BW9B 2EG5A 3B52X 3RVJA 4TLEA 2BGJA 1Y64A 2FP3A 3IPAA 4RJJA 1J25A 1YUBA 3E7FA 3LCVB 3WYNA 1L4YA 1XMJA 3QNMA 4DTUA 2QLJA 1EP9A 3UT5A 4Z0HO 2XBMA 3GJRA 2RGYA 2Y8EA 1IQ0A 2E9SA 4NCNA 4C4XA 1H8EA 3QLUA 2HF4A 1S6PA 2HNBA 4U8HA 4J7UA 4ZGBA 4DMFA 1WABA 2QQ5A 2B4QA 1SQ5A 2BJVA 2OZEA 1B6SA 1Z7WA 3OZBA 4DB2A 5A7HA 3SJ7A 4JP5A 1G8PA 4D02A 2GN0A 3NGYA 1DV1A 1Z2EA 1QIDA 1EXNA 3AVHA 4XQEA 4CMKA 1QAOA 2BTQA 4CJWA 2FX3A 2LRHA 2PSEA 4HAYA 2Q9CA 1JNXX 3OQVA 5T4EA 4B5KA 1EUYA 3G23A 1C4KA 1XROA 3GN2A 4G24A 4AICA 2QIPA 3S0JA 4G01B 2W90A 3T6KA 1VXRA 4EY5A 5K0LA 3FPSA 1JYFA 3DOCA 3IFSA 1J2JA 1NBME 3D5QA 3EGIA 3I8XA 1YS4A 4IMPA 5F51A 3SQMA 4PYJA 1AQJA 5GIPE 1Z63A 3AAQA 3SYRA 3NU1A 4MR8A 5KSOA 2ZRGA 4FEYA 4IAOA 4TUYA 5F2EA 4CZ2A 3KKLA 4CJSA 4YV0A 1FVHA 5HRNA 3GVXA 1ZM2A 1YUMA 4I2QA 4EVIA 1XDUA 1R9JA 3AF5A 2RH8A 4AZTA 1U7WA 3GJ0A 3PB3A 3EY9A 4LPKA 1NN3A 2CXUA 4OKIA 4X5OA 5KU7A 1SPBS 1FX0B 4DR2B 1VOTA 1MPTA 4MJLA 3ZNNA 1G20A 3LDOA 1V3UA 1JU3A 4B0PA 3QA3E 2NSJA 1MG0A 1GFIA 4C4PA 2OBBA 3ZGZA 3GDQA 4M8IA 1G2PA 4I55B 3R74A 4TSFD 5LXTF 3E70C 1NM1A 3PPWA 4V38A 1M2GA 1X87A 4LCJA 2GXQA 1RI1A 1S6YA 1MP0A 2HPVA 3JQQA 4P36A 4V0ME 4FJXA 4DU3A 1DC8A 3NKFA 3NANA 5KYUA 4C6TA 4RTNA 3URMA 4DABA 1NASA 3JWEA 5JZOA 2O3TA 4CLHA 1X7YA 1XTKA 3E3NA 1UC5B 3KDAA 4R9VA 2IGTA 1EWKA 1EETA 1QGZA 2GM3A 4DJAA 4U63A 1O95D 2A0XA 3EPLA 4D6YA 3SIWA 3C70A 1DQZA 2YW9A 4HZUB 2ST1A 4B3FX 1J8FA 3MEEA 1JIQA 2G7MC 3IVCA 5E7MA 5HF9A 1VJRA 5EJ4A 4UHEA 4GFDA 4DLRA 2C2ZA 3E5HA 5K6TA 1YDFA 1M1YB 1S1MA 3ZYZA 4HC4A 4YY3K 1PJQA 4B6QA 1BWPA 1X7XA 2R6HA 4R5MA 3K1JA 3KC2A 3OA0A 2HWXA 2E18A 5I7HA 1P7PA 1C1YA 2ZSAA 4GL2A 1H85A 3IC5A 2X2FA 2YZMA 1MX9A 2KW4A 2B83A 3HCRA 3KU4A 4ND8A 1Z5VA 4O63O 1B41A 4CMAA 5HZKA 3CVUA 3ID6C 1W75A 2NO1A 2CH6A 4GLBA 4EEKA 3DZ8A 4HJXA 9GPBA 2P9IA 1TCCA 1EX1A 1WQ4A 3C3PA 2V6BA 4I8DA 2AC4A 4YCDA 4Z6KA 5G1OA 1T8UA 1S7GA 3ER8A 2QWRA 1SCAA 1DTTA 4AN0A 1M6NA 1A5TA 4MH0R 4KLCA 4RJ2A 3VTHA 1ZCAA 1P3JA 2FW8A 4IXNA 2HA5A 3QVVA 1X38A 1AG9A 4OM7A 1VHJA 4UTNA 4Z4HA 3N2IA 3ZHZA 3KOOA 1JLFA 4DV4K 4V0RA 1JIXA 1RAGA 3COWA 3L8GA 1YJBA 4YA6A 4DMHA 4B1FA 1S2OA 2F67A 4DSZA 2VDMB 2ZJQL 3P9PA 4BRSA 3HTVA 4KK4A 4G5SA 4R8KA 2PL5A 4BU1A 5K3OA 3H8JA 4JDPA 4OLBA 2OAEA 3B3QA 3K1AA 5BNWA 5HZGA 5IHXA 5AQQA 4TMTA 1N36K 1GILA 1A7JA 3HJFA 1I1OA 3I37X 4N7MA 3ZWBA 2J5XA 4FMCF 4PYNA 4ENVA 2D0CA 4TYWA 5GJCA 1Q1QA 1V37A 5CVTA 2QE6A 2CGJA 1G3MA 3MQ2A 4RO0A 1Z37A 4ZQFA 2XI4A 3GBPA 4L78A 4DDTA 5JLJA 3CXRA 4U9IS 3CCRN 1PP4A 4REMA 5DEOA 3RTAA 3V34A 4F72A 4QO7A 4EHDA 4F2GA 3F98A 4ARZA 2G80A 5I7EA 1JKXA 1Y5NA 4BR0A 2WM2A 2ZAOA 4BDZA 2JGRA 5LY3A 2VAWA 3LT5A 2VNHA 1TXGA 3IMXA 3D31A 1L8QA 4HPJB 4KPGA 2CEKA 4F3OA 2G82A 4RW0A 3AW9A 3IAM6 1TK9A 3FTNA 4YQZA 5D6NA 1RPAA 3FI9A 5JCPA 3E5RA 4EHNA 3SV3A 2O6HA 2V7TA 2VP0A 4MP6A 4K46A 3AO1A 3CRRA 3AEUB 3E7PA 4PC6A 4PW0A 1T0JB 1VFNA 3ZWQA 3RI3A 4ABYA 3VSAA 4NLBA 3T7TA 1WRBA 3BWCA 4CDGA 1H23A 1OZFA 3I5UA 4X8HA 1AUXA 4I1RA 2QUZA 3CZPA 1R1DA 2A6PA 2ETXA 2WVAA 3CVXA 4L9WA 1QE0A 5A3VA 3USCS 2GPSA 4KQCA 4CR8A 16PKA 3PWTA 3U7QB 1ONNA 1Q1BA 2P9FA 1CP2A 2GD6A 1NTRA 2PGIA 2XA9A 3HKEA 3OO0A 4GXRA 2QW0X 2OXRA 3KQQA 4YCAA 3NGLA 5KU1A 1CJMA 4HUEA 1NMZA 3U7RA 4IOCL 3WB9A 1MD9A 2AOXA 3G9QA 5K0EA 2IDKA 3UJ6A 4FE4A 5E95A 5ED4A 2BE7A 2UVDA 3SAGA 2X0JA 3V8QA 5CLFA 4ZAVA 3D1JA 1SKYB 4PC1A 4CT0A 5AQVA 3NBYC 4C8LA 4Y2YA 3TSOA 4B76A 4EA9A 5I7RA 5A04A 2ZYDA 2WWFA 1PWZA 1YJWN 3FWPA 4YRKA 2IOHA 1KQOA 4P08A 4AP6A 2IH4A 4I0WB 3NDRA 1A8QA 3ONFA 4GKKB 3C5HA 3QV1A 1FFHA 2JIOA 1UP4A 3VKHA 2TMKA 1KEZA 4WUTA 5M1NA 1NZJA 4B7CA 1PYDA 5BR9A 4WZAE 4X44A 3EDMA 2YFKA 5ECYA 5T4BA 5A5DA 4DTOA 5H3CA 2H1LA 5F3DA 4C1NA 1EGVB 2XE6A 5J2QA 3G2JA 3VV2A 1XMOB 4X84A 4MDEA 3PUHA 5E6SA 2RE8A 2P30A 3TW6A 3GJ8A 1XDDA 3AO2A 2C1XA 2WHEA 2QMZA 4HHEA 1NF8A 4PL7A 1CZRA 1SC4A 1UFRA 4LHYA 3B12A 4M76B 5E7QA 4Z4IA 2VNJA 1DIHA 4ETIA 3T06B 1LUAA 2YIDA 5KAPA 1S72N 1Y80A 3AVFA 2GUPA 2C2GA 3DMFA 2E89A 2V4MA 3NVAA 2WUGA 1LSSA 2GX6A 3UT6A 2B78A 5PNTA 1TE2A 1RHUA 2HU2A 2XNCA 4D56A 4B9VA 4C0LA 3NDIA 4FI3C 2XKAA 4JV5K 3EO3A 2YZ7A 3WZMA 2GERA 3ZSRA 1NFRA 5JRJA 1NN0A 1NVVQ 2FPOA 4ZANA 1LSJA 3PX0A 1NE7A 3OVMA 3QFHA 1IB0A 5CFOA 1CF4A 1RWWA 2BUCA 2QG4A 5JCOC 5TR9A 1TGOA 3LLVA 1MDFA 2HRBA 1E2GA 3RVCA 4G63A 4LNUA 5EHQA 3ZOKA 4IGFA 4BNDA 3AO0B 4V19S 3OX1A 3S3TA 4ZAZA 4DADA 3Q9SA 4QDOA 1XN1A 3RC7A 3FN4A 4O29A 4EG1A 5CB4B 2BI7A 4DCPA 1PWHA 2RGRA 5DCUA 4A8HA 1K6JA 1KRHA 3HACA 3S2GA 2ZVQX 4UZEA 3TI9A 4AY6A 5CYPA 1ZU5A 3T7AA 4AYWA 3PP8A 4JJ4A 3OYJA 4BTEA 3BF8A 3AKZA 1UZAA 1J8DA 3DKIA 3P26A 4UVDA 4X60A 1FNMA 2B4RO 2JGMA 1WW3A 1HC7A 3B7GA 3ODPA 3KSDO 4UREA 5T3YA 4C4SA 5JJCA 4I6MA 5EXEA 1K1EA 3NXKA 1VMIA 4IRMA 3UF0A 1ORWA 4Q3EA 3TSWA 4ZCPA 1KK3A 2P9PA 5DULA 1K68A 2QNIA 3OQMA 3ZEAA 3PI7A 2GXSA 3IE2A 5EMMA 5AR1A 1PCXA 1OC2A 3OKAA 4RUKA 3ZH9B 1UZNA 3HJHA 4TZ6A 1VSDA 5LFAA 3PNYA 3OM9A 1W36C 5AR0A 1YR7A 3VR4D 4FL9A 1IB6A 1ZMTA 3FWZA 3NCTA 5EJ7A 1FYFA 4EL0A 4XDHA 4M49A 4CIFA 2VT2A 5EVJA 2XJ9A 3M2PA 1LLQA 3JAMA 1DUSA 2PZMA 4N7JA 3WJ7A 1JKFA 4DV0B 4O8UA 2DRIA 2PLAA 5BWOA 2IYOA 1ZFNA 3CA8A 3CETA 2A1UA 2E1RA 3TQSA 4AUMA 5MN5A 3VUFA 1TMGE 1IZ7A 2G9QA 3GMTA 2CDNA 2A5FA 2XZDA 1R00A 2PMKA 5BR8B 2RG7A 4IFVA 3R7SA 5CBPB 2HXSA 3W6PA 3DCNA 5CMLA 3VNAA 3CCSN 1O77A 2O7SA 3KTFA 4M7RA 4Y2RA 3HHEA 3DDWA 4FGJA 3MAQA 2BFEA 4O4JB 5FBQB 3L2WA 4DJFC 3CMAN 4R0NA 3HT3A 3WSVA 3NJRA 2DETA 4NBRA 1D6JA 2PV7A 2O2GA 2WILA 4JUDX 4I1UA 4JB2A 2G9ZA 4GMXA 3HSTB 4NARA 1DWQA 4UARA 1QHAA 2Y0BA 3ZQ6A 4A0HA 2V3WA 3DMNA 5C25A 3E9YA 1CY1A 4GRAA 5ICCA 4QDTA 3R0VA 4CIWA 3U39A 4CJEA 1P6XA 4TXLA 5HRPA 4DLYA 2C7PA 1U63A 2HU7A 4WVLA 3D6HA 1GWNA 3F5MA 3NHFA 2V7WA 4OYRA 3CKKA 5DRTA 5A5GA 3JQ8A 3RG2A 2X9QA 3RJMA 5B36A 2DBVO 3O8OA 4OMDA 1KI8A 3LWNA 3VO9A 1WLYA 2OO5A 2PKQO 3DH0A 4PGGA 4GM0A 4ALMA 1CEYA 2Q0RA 3DLBA 4UHHA 2OPHA 3SLGA 2JRCA 2ZWOA 3N8KA 4OJMX 2BDTA 1IDN1 3HJGA 4ML3A 4QAJA 2X3FA 1QK4A 4EY3A 4I6GA 2VTVA 1BCOA 3JW8A 4AKEA 4DFDA 3EA4A 5ENDA 2VH5R 4K9KA 4HH3C 2Q46A 4MLCA 4QUIA 4Y7DA 1E2FA 1W19A 2DTEA 4GBGA 2IYQA 1UWLA 3HN6A 3P32A 1HRDA 3ISNC 3K5NA 1N0UA 2G83A 4QOSA 1QFMA 3B1ZA 4RLQA 3UB5A 1Q95A 1NQWA 3R41A 3MHTA 3VTIA 2YICA 3W34A 2GVNA 4HUTA 3FLCO 4HD8A 5A6VA 3TZ6A 1U0RA 4IDHA 3P4IA 2QYOA 2I4LA 3ZY4A 1BROA 5IU6A 3OLXA 3AI2A 4LWOA 5AI5A 2EW8A 3TAFA 5GADl 1GZVA 1INLA 1NGAA 3NBUA 1KJ9A 2UU9K 1YIAA 1K7XB 2DQKA 3LWZA 4PGMA 1C6VA 1EHIA 2QL7A 2X2OA 3AESA 4IBOA 4J3JA 5B3JA 2Q5FA 2QZZA 4TL6A 2R79A 2R00A 1TO6A 1BE6A 4R1SA 4A8PA 2VXBA 3UGQA 5C32A 3D2FA 3WLEA 1FFCA 2VJMA 2BEUB 4LE1A 2R7NA 3MD0A 3QNWA 1E1CB 3SS9X 3TUZC 4IFEA 4W9NA 5IZCA 2J30A 4UOEA 5HOQA 1WP4A 2O07A 2YXDA 1GL9B 2PR7A 4YAJA 5K51A 4Q5VA 1P4AA 4FI3F 4QC2A 3R75A 1J7JA 1UPFA 1XN4A 2CNDA 2IF2A 3UV6A 4PN3A 1G99A 1RXUA 2CL6X 2ISCA 3KOXA 4ETMA 5KX5F 3A7EA 5C5CA 4CGGA 1NMQA 4U7GA 3U7HB 1Z6TA 4M0MA 1W5EA 1M2EA 1ZIPA 2WPNA 3G0BA 3ORFA 3LCCA 2HK9A 3NHGA 1LD3A 4FFBB 4UQLA 4G2NA 1OC4A 4PS1A 2C9BA 4BWJA 2Q62A 5DHPA 3IYLW 4RVSA 4BATA 4CKCB 3U3XA 5TT1A 2Y1DA 2G40A 4I3FA 4NONA 1U1EA 5F12A 2I8LA 4EW3A 3QF4B 5K0TA 1NGFA 4RW7A 3WQUA 2O7RA 3T12A 3VR0A 3EIHA 3QITA 2B99A 2C9ZA 3LHKA 4W6QA 3L2UA 1KDVA 4BGUA 1OIWA 1JHZA 1XEAA 5AM3A 4M7PA 4OP1A 4MR9A 2OGWA 4NE9A 1KQNA 1T24A 2FAXA 2Z1IA 2FRXA 4FC7A 3SOPA 1B92A 4KI6A 3OZFA 4JI2B 4OIMA 1XELA 1N6KA 1Y3CE 3LP5A 1H93A 2RB4A 1I3OA 1KKUA 5LZ8A 2IX3A 1HMYA 1NSTA 2QTNA 4EZEA 4S0ZA 4I14A 5HTOA 1NZFA 1Z4KA 1HE1C 1Y8CA 4H18A 5A7FA 5CGQB 4E32A 5CDHA 2IPLA 5TLSA 1QVWA 4Y2PA 3P0EA 3QJGA 4I50F 5JVHL 1GTVA 5GZ6A 3T7IA 3WI7A 3WMXA