4IDHA

Crystal structure of the large terminase subunit gp2 of bacterial virus sf6
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
463
structure length
451
Chain Sequence
SINPIFEPFIEAHRYKVAKGGRGSGKSWAIARLLVEAARRQPVRILCARELQNSISDSVIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGIDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTKVEMKQKLGIPSPNLADALMMCMHCPALVREETEIYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the phage Sf6 large terminase provide new insights into DNA translocation and cleavage.
pubmed doi rcsb
source organism Shigella phage sf6
molecule tags Viral protein
molecule keywords Gene 2 protein
total genus 166
structure length 451
sequence length 463
ec nomenclature
pdb deposition date 2012-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04466 Terminase_3 Phage terminase large subunit
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4idhA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4idhA01
2C9CA 4KFSA 1HEIA 2IYSA 4CIDA 3SBDA 4IOMA 3K0CA 1UAAA 1E2DA 4HYYA 1OKKA 3VR5A 2RGNA 2ECKA 2ZJ2A 4DVGA 2BBOA 3PENA 1W0KD 2JJ1A 2NIPA 2G88A 4XH9B 4MRPA 5M1FA 1T4GA 3NH9A 4UXIA 3IQWA 3CW2A 1W1WA 2NZ8A 3CRMA 1ANKA 3KX2A 4FWIB 1L8QA 1Z5ZA 1V43A 5DNYB 1AS0A 2PLRA 3SN6A 1DARA 1G21E 1OXSC 1U9IA 4OHVA 2AX4A 4PC1A 4ZPXA 2OLJA 4O2RA 3V4RA 4B43A 1CJTC 3IPYA 2RB4A 2EFHB 4QG7A 1VIAA 3A1VA 3L0PA 5CDFE 3BH6A 2YNMA 3ND8A 3BD9A 2KWIA 5CYPA 4EPYA 3HWSA 3EAQA 5F9HA 1E1QA 4PPFA 2HDNB 4ZCLA 4M9SA 1JEEA 5F98A 1W36B 1XJ0A 4KJZA 4DT1B 4N0EA 4LYFA 1AM4D 2AFHE 3KKNA 1N6NA 2JAQA 4G3XA 1YZKA 2ZREA 1TUIA 4AYXA 2IHBA 3A37A 2XEXA 1OSNA 1HV8A 3DMNA 3NWJA 3ONWA 5EXTA 1UBGA 1Z63A 5BN4A 5JSZB 1DVRA 1A2KC 1Z0DA 2QPOA 2ONKA 3PUZA 1GOTA 5JCZA 4YMUA 2IXGA 4C4PA 5KNCA 3T06B 1XJQA 2OFWA 3CPHA 1FP6A 3BFVA 1VG9B 4OK6A 4NCIA 2ONJA 2R44A 2DWQA 3LW8A 3PEWA 1G8YA 2EFGA 1SXJC 4BLRA 1JPNA 2C8VA 4TZ0A 1K5DA 1KI2A 2L0XA 4UXJA 1CXZA 4RY2A 3TAHA 5AJWA 2ZAOA 2FFHA 5DSZA 2IF0A 1GSIA 1G3RA 3IPXA 3C41J 1MRNA 3JVUA 2GVZC 3GLHB 1VHLA 4PC6A 4DXAA 1JXMA 3A36A 2LWIA 4HAZA 3GPLA 1E32A 1E98A 3LXXA 3NBYC 5EUMA 1XCPA 2J5XA 2ZSBA 1J99A 3TSWA 2AD1A 4LYJA 2QSYA 3BWDD 1GG2A 2IWRA 3FKSA 2ZRDA 3JZAA 5FUVA 5EP2A 3IIMA 5AWFC 5DLQC 3MWLA 2JDID 3QPWA 3OESA 4DLWA 1LNZA 2J1LA 2XJ9A 5B30A 2GEDA 1T9HA 1XCGB 3Q85A 4IKEA 4RVCA 5K8UA 2B8TA 1W0KA 1T5IA 3DKVA 3F0TA 5CLLA 5JJLA 5G53C 1P60A 3EZ6A 1S96A 1U81A 2GAAA 3GFOA 3UG6A 2ZE7A 3VR6A 3IEUA 5HTKA 1AS2A 1M7GA 1RIFA 1QVAA 2OFOA 2IYRA 2EQBA 1Z6AA 3KKPA 2P65A 1XU4A 5C18A 3T34A 4Q1FA 1IY1A 5HKKD 2D62A 4OJKA 5DO9A 4IDOA 4CVNA 1KY2A 2YZ2A 1RZ3A 3AVVA 3HU1A 1RRFA 4CEJB 3EC1A 1KO7A 4S35A 5H1YA 3R9WA 1BIFA 1E1RD 1P7CA 2PX3A 1JB1A 2QPTA 4KXFB 4W9MC 3RS5A 2HF8A 4GMXA 4TN1A 5EQTA 2MSEB 2OXCA 5J4HA 3PIRA 3FPAA 4HI0E 3NBZC 1BMFD 1E2NA 4DBLC 1VPLA 2CLCX 2GZDA 5JWRA 1IN6A 1N6OA 5KU1A 1U0JA 1ESNA 2VHUA 4FIDA 2WMOB 3SU8A 4M1OA 3F8TA 3PITA 1RRGA 4FMDB 4LV5B 3QBVA 4CDGA 4P32A 3VFDA 1COWA 1JXOA 2WMNB 2G1JA 4LOAA 2YC2C 5FL3A 3REFA 5B58C 1H8HA 4KYUA 5FI1B 1KDTA 2J9RA 5TDHA 1D2EA 4A0HA 3I5XA 2WWXA 2V54A 3T1TA 5E7IA 2FH5B 1S9DA 1XPOA 5JCPA 3SE0A 2OEPA 4JBXA 4PHFA 1XEWX 4DEYA 5FTLA 1JQJC 1N6KA 3A6PC 4I1UA 3QXJA 1ZUNB 4Q18A 4JZKA 3GJ4A 3AVQA 1G4AE 4L9SA 5EXSA 1PVOA 2XTNA 1XXHB 2BM0A 4HAYA 5TXGA 5KSYA 4C7OA 3MUFA 1KSFX 3ZDQA 3I4LA 4I1OA 4ESVA 5GJVC 3BB1A 1X3SA 3MFYA 2V6IA 2DFKB 3IGFA 3FMFA 4DEXA 3SDZA 1NVXQ 5CIWA 2DY1A 2IW3A 1D2MA 4IW3B 1KI1A 1CIPA 1T5LA 2Q9AA 1K6MA 4LJ4A 1KAOA 4B32A 4EPXA 4L16A 4TL7A 2OHFA 3DOEA 2C03A 1YR7A 2V55B 4JT2A 3VKGA 2DFNA 3J81k 1PV4A 3HP1A 3AP3A 1OPXA 1OFIA 1ZCBA 4JYBA 2WOJA 3KTAB 4DLUA 2VSXA 4ILEA 4MUBA 2NOAA 2GVDC 2VF7A 4JIMA 3TVTA 4CEJA 2SHKA 3L2OB 1E69A 4XSHA 2YWHA 4YLGA 3SI7A 4MA4A 4QOSA 4P0TA 2IUUA 1Y63A 1W4BA 1W4AA 1ESMA 4FN5A 1UF9A 1SXJB 2IL1A 4B44A 2VSFA 2O52A 2ZROA 2C77A 3KB1A 3CRRA 2ZR7A 1N6LA 3ADDA 1U90A 2AXNA 2B92A 3QKUA 5C2DA 5EE0A 3B8HA 5EUQB 1QHHA 4D4MA 1P6XA 1IQPA 2F1JA 3BB4A 3B13B 1MV5A 1E79A 2WJVA 3BOSA 3GFPA 2AFIE 3QKRA 3SHFA 3L0SA 3U7GA 4OBEA 1G7RA 2ZRCA 1XTIA 1QHYA 2V4ZA 2W0SA 1BMFA 1RYHA 1YZQA 2ZE8A 4I4LA 2OCPA 4TLDA 3SJZA 4WIAA 3G82C 5FBRB 3K70C 4X8MA 2O8FA 3A4NA 4PO8A 2GJSA 3D31A 2O8CA 2NZJA 5CK5A 5DN6A 5JI3E 1T91A 2HCBA 1Z6YA 4A4DA 4D2IA 1M6NA 4K8OA 4GPTA 4LV8B 2JLXA 3IILA 4X8LA 1FQKA 3QXSA 4B76A 1KDPA 4G5OA 4MKGA 3FGNA 1N0UA 2F1IA 2WVJA 1ZM3A 1LY1A 1Q3HA 2GZHA 1B23P 1Z0AA 1OT3A 3K9LA 5FR1A 3K0AB 1MR3F 2JDIA 3THOA 3DM5A 2XNDA 1SXJA 4V0MA 1R5NA 4Q9HA 2PJRA 1K5GA 1TX4B 5AK0A 4MYTA 3MSXA 2FZ4A 2CBZA 1F2UA 4RFVA 3PXGA 3LQRA 2GJ8A 5KTYA 3TW8B 2JLWA 3VKHA 3SYLA 3TKLA 2X77A 4U7DA 1AQUA 3BE4A 3NVAA 5JSZA 4LYAA 2BKEA 1XP8A 2F3TA 3FHCB 4Q5IA 3TE6A 5HKKA 4AD8A 2ZI6A 3RLFA 4E03A 5CITA 5FPKA 2Q3MA 4LC0A 4KI0A 2QAJA 1YZGA 3I72A 1FW6A 1OYYA 221PA 3CX8A 2OLKA 2J46A 2UKDA 3K9NA 5FPYA 4DT1A 4JBYA 1G3MA 4UXHA 3KDSE 2BC9A 1TEXA 4NYMQ 1B0UA 4G5SA 2VP2A 2YHSA 4R7ZA 1R0XA 2ZUCA 1X6VA 2X2FA 5FUXA 1YZUA 2XZPA 2IYZA 1LV7A 1W46A 4BWYA 4HSEA 3QEOA 2WWIA 1G17A 1A82A 4EPRA 4JVNA 4DSTA 4QJ5A 1CJKC 2R6CA 2HYDA 5FBQB 1R5BA 3K9GA 1KKMA 3GLIA 5FUWA 4IDQA 4LJ6A 3QI2A 1GDDA 2JLVA 1XTQA 1WE2A 1XFAA 2AL7A 3BJIC 4LBWA 1Y3AA 3CKLA 3GJ5A 3UG7A 4AY2A 1JJ7A 4H1VA 1Q44A 3LV8A 4TYWA 2YINC 2Z83A 2GHIA 4PC7A 1FQJA 3TUJC 1YR8A 1TU4A 4XVQA 4B33A 1SKYB 3EIHA 1KMQA 5H8WA 2CDNA 1T3HA 2X19A 1M2OB 3ASZA 1DAMA 1DAFA 4P4TA 4V02A 2AKYA 1AK2A 3RHFA 5L3SA 4HB4A 2ZR9A 3U60B 1W5TA 1EFUA 3QEJA 3CB4A 1U2RA 3QKTA 2IEZA 3B7GA 2IYYA 1W5SA 2GA8A 2IYQA 3IO3A 4M2LA 3OF5A 3VU9B 2ZE6A 3X1WA 1ZCAA 3MLEA 4UNNA 4ASUA 5BN5A 2QNRA 4MKHA 2ZRFA 3X1DA 2ASEA 3FTQA 2IS6A 3PEYA 4RFSB 3WMGA 1Q21A 2DHRA 2GXAA 5EE5B 4TSFA 4G5GA 2QQEA 3P4YA 1YZLA 3NBXX 4TMZA 3DMDA 1NNEA 2J7PA 3U3OA 3K0CC 3A8TA 4E07A 1P9NA 4X8OA 3U3KA 1MRSA 1OB5A 2WJIA 1A1VA 5JI2E 3GJ3A 2F55A 2QENA 4PHTA 3SQXA 1FMJA 1Q22A 3IHLA 1NJFA 5JZVA 1WBDA 2GCNA 4W5HA 4A2PA 2VP4A 5FOSA 1S2MA 2Q3HA 3K0FB 4YMWA 1XTSA 4IVRA 1Z07A 1U0HC 1XMSA 1YE8A 4DWJA 2IUSA 3WMFA 2ORWA 1VCIA 5J5CA 3WYAA 2WSSA 3QE0A 2FNAA 4A0FA 1X1RA 3TIFA 4UNRA 3WYGA 1NLYA 4DDWA 3NHAA 5KHOC 1LS1A 2E1RA 1UDWA 3MMPA 1DAGA 1D9ZA 1EFCA 4MRRA 1Q57A 1KGDA 5M1KA 3E2IA 2G3YA 4KFTA 1M1YE 3FE2A 4XWAA 2GJ9A 1KDOA 3CLVA 3LVQE 4TLBA 5EP1A 1GIAA 1NMYA 4NKRA 3C16C 4HDOB 1ZM9A 3RRZA 3GLIB 4KLNA 1KSHA 2OCBA 5TMPA 2FDCA 1DAIA 1KNQA 1HT2E 1GTVA 2FFBA 4N0DA 2CXXA 1KI6B 4A9AA 3ZQ6A 2JJ1D 2QM7A 1P3JA 3FVQA 3PUYA 3KKOA 2J0VA 5C1BA 1II8B 2QL6A 1OHHD 4C0HA 4M1MA 1CJMA 3S1AA 3NEYA 5GJCA 1E9EA 1OV4A 5FBWB 2OG2A 1ZC3A 1IN8A 4EQ6B 3A1UA 3OIYA 4C2TA 4JVSB 1FNNA 1ONBA 1R8SA 5CB8A 2G77B 1U8ZA 1KO1A 3V9PA 5GVSA 2WTUA 4II7A 2WIAA 2BHRA 4MUAA 1W2GA 4I99A 1J7KA 2CMKA 1W49A 2QMOA 2ODNA 4XIGS 3I3SR 4GDFA 4LHZA 4WW0A 2OM2A 2WKQA 1YJ5A 2YOHA 3W5JA 3CWZA 3AKCA 3QKSA 4PSKA 1E9BA 2GJAA 1XTKA 5AR1A 2KE5A 5FTKA 1GZSA 4OHXA 3VMFA 5M1QA 4OK3A 3ZIAA 4DCNA 2IUTA 4TMTA 4B3BA 1D8TA 5FL7A 5C4GB 4C30A 2QI9C 2VF8A 3GFTA 4LJ9A 4B74A 621PA 1G8HA 2FA9A 2RGGA 2XZOA 1S9HA 2CVHA 3SYNA 1DO2A 3K0AA 3REGA 3SJAA 3VHLB 1W48A 1NBMA 4BECA 3U3RA 2JJ8A 2CLDX 1N5IA 1FTSA 2ZAMA 4GBMA 2EFCB 2AWOA 2QGNA 4G5QA 2CNWD 3MRSA 5M1PA 1L7VC 3AKDA 2REOA 4A0RA 5BYJA 1GL9B 4PC2A 4WXPA 2IT1A 1BO6A 1ZVQA 3T61A 1O3YA 2OXRA 4BPBA 3ETLA 4Q1BA 3RWMB 1G9XA 2QN6A 2WKPA 4JLJA 1UEIA 5HE8A 4B2LA 1ZINA 2IS2A 2O8FB 1YVDA 4X8HA 2H18A 2JLSA 3OAAA 4AURA 5P21A 5SZJA 1GRRA 2IBMA 4Q1EA 4Q4HA 3B9QA 4OHYA 5LB2A 4F4IA 2JLZA 2BBWA 2QA5A 3AUYA 2ZYWX 1OXVA 4GZLA 4KBGA 1S1CA 4DCSA 1T8TA 2CK3A 2HT6A 3GLFE 4D4LA 2F1RA 4MRVA 4EIWA 3I8XA 1Q20A 2A9KA 4L5BA 4Q4HB 3LDAA 1AA9A 1RRCA 2NO0A 2ATXA 4JLKA 1IXSB 1YHNA 1G3QA 4H1UA 1MT0A 4ARZA 4IDPA 2OV2A 5JEDA 2O0KA 1OFHA 4V03A 1AGPA 1IJEA 2BV3A 2ZRGA 3IIJA 3ASYA 3AV0B 1NMZA 3EG5A 2OAQ1 2XOKA 3P26A 2JEOA 3AVPA 4Q02A 4JLNA 1RPZA 3RC8A 1JI0A 2A7QA 2ZI7A 2DBYA 2VLIA 4LJAA 3VR1A 1QBKC 2A2ZA 5C46F 2ANCA 1AZSC 4DLTA 5B2ZA 2FSGA 3TVDA 1NN3A 1I2MA 2QP3A 3ZGXA 5GJWC 1QF9A 1K8RA 5ELXA 4Q47A 4IXNA 1XCMA 2ZM5A 2GBLC 2HJGA 4Q21A 1NIJA 1N5KA 3IUYA 1KZGB 2KBEA 1S4QA 1CJVC 4LHYA 4M1SA 2VP5A 3QKSB 3TW4A 1GNRA 3LBIA 4M8NE 2RGXA 2BKUA 1QHGA 2OBLA 3T15A 1EFRA 2QRZA 4JL6A 4PAQA 1CF4A 1RJ9A 2RGNC 2P5SA 3B2EA 1IHUA 3CM0A 3MAAC 4FW9A 821PA 2FSIA 2O8EA 3KJGA 2D3WA 2CNWA 4B6EA 5KPDA 1CR4A 1MO3A 4NHOA 4Q9LA 1G1MA 1XX6A 1AS3A 1MO5A 2C9OA 4AKHA 1NG1A 3H2YA 1OLOA 1UEJA 1JR3D 4DLSA 4D0GA 3ZH9B 3HDTA 2AD5A 5JLJA 1OIXA 1S3GA 5FTNA 4B3XA 3BFKA 4M22A 2FX3A 5LD2B 1P9WA 3LO5A 4W5WA 3SFVA 4OQXA 4MRNA 4MGKR 4QBIA 2KI5A 2BIFA 2UVQA 3K09A 2HXSA 4D82A 1WQ1R 3QF4B 1ZBDA 4ZIRB 1P2UA 2AR7A 3SEAA 2RH5A 1TTTA 3R9XA 4EPVA 2VP6A 3I1FA 5JJKA 1E99A 1KI4A 2FE4A 2CCKA 3U3JA 4KCGA 2WZQA 3VNUA 1KMHA 2QMHA 4MITA 3U6BA 1Z0JA 3PEUA 3LXRA 4NZYA 5KSZA 5JS7A 2ZIAA 2H1LA 4YMVA 5IT5A 1XB2A 1PLLA 4YMSA 1OKKD 4TYPA 4Q66C 2I3BA 1GFIA 3R7WB 4B6FA 2GK6A 4FINA 4A6XA 3GMTA 2YOGA 2ZQ5A 3FB4A 1G20E 1HY3A 1SVLA 2GZAA 4YDSA 3WHKA 2ERXA 1RVDA 2XB4A 1DBSA 1UM8A 2ODWA 2OT3B 4OQNA 2XOKD 4RD4A 3W6OA 3IDQA 2W6IA 1FTNA 1E0JA 1E96A 4F91B 3GLHE 2I1QA 3QJYA 4UJ3A 3W5IA 3WP0A 1NBMD 2GCPA 4DDVA 1CS4C 4OI1A 5JRZA 2QP9X 2NPIA 1U8AA 3GJ0A 4OI0A 2JCSA 4TMXA 1T0JB 1DADA 4ZV4A 1J8MF 1OFUX 1TEVA 2NO1A 1IY0A 1L4YA 4QBGB 4BGDA 4A0GA 1KK2A 4ZKEA 2QE7A 1N5JA 1M7HA 1BH2A 1XDBA 2A78A 2CVFA 3H1TA 2YYZA 2GILA 1TQ2A 3SJBA 4BFZA 1FX0B 1XZQA 2V8OA 4GRAA 3MWJA 2E87A 2QMEA 1W47A 4KBFA 2ZSFA 3BORA 3VU9A 4QXAA 3QOFA 4R98A 3PFIA 1SVIA 4I1VA 3NEJA 1FUUA 3BIFA 3LD9A 4O25A 5AJZA 1CU1A 4JLPA 1XPRA 2XITA 3K09C 1XMJA 3E70C 4IFEA 4P4UA 4XVUA 2UZIR 4QBHA 1Z6GA 1ZM7A 3T1OA 3KZ1E 4HAVA 4WVFA 4Z1MA 3T12A 1N6PA 5JHGB 1LF5A 2ZVPX 4KSBA 1VKJA 3Q3JB 1ZYUA 3DO6A 4AYWA 1FX0A 3BH0A 4RZ3A 3VTKA 1P72A 5FUYA 5JEEA 2F3RA 2ZRAA 5M1NA 1IONA 2N42A 1FFHA 2BCJQ 1CR2A 2IA5A 2J0UB 4PHGA 4MYUA 3RC3A 2HT1A 3QG1A 1YQTA 2ZYUX 1N6HA 3MG9A 4A8JA 1ZUHA 3D3QA 3UXMA 1ZP6A 1E3MA 3I73A 2GWHA 1JEDA 1BYUA 1NKSA 2JIZD 1WF3A 4LHVA 5JECA 1S3SA 2CCGA 4D0NA 1VTKA 2HJVA 4WZAE 4GI7A 2ORIA 2C98A 1KY3A 2GEUA 2KJQA 2WPDD 2XTZA 4C0KA 2PEZA 1N2CE 3CNOA 5LPNA 4S2EA 1JPJA 4MGIR 2ZU0C 3QPVA 4UNPA 1I4TD 2N46A 5BN3A 4CRWB 4EFNA 2BWJA 1E2QA 1SHKA 3W3ZB 4GT1A 5DHAA 4Q1DA 1IXZA 3SS8A 3SC3A 3K0SA 4PC3A 3U4QB 5D3MB 2G83A 1SKYE 1SXJE 4V0ME 3KQLA 6Q21A 3ZVMA 5SZIA 2QZ4A 2H16A 2EYQA 4FCWA 1T6NA 3O8CA 3MJHA 3UWKA 2RAPA 2Z0MA 3TH5A 3AGPA 1UKEA 3BFXA 4IEEA 4HLDA 3TQCA 2QGZA 2W0MA 3I62A 1ZNZA 5TVKA 1NG9A 2O0JA 3IBGA 2GESA 3JZMA 1P2TA 4GFDA 2YV5A 4PQRA 1U99A 3ADBA 1KYIA 4LI0A 1EFHA 2OCAA 4TYNA 3VQTA 2KSQA 1JBKA 2PMDA 4AWXA 4BEJA 2IXFA 2O8BA 4TMWA 5EJEA 5H70A 4Z8YA 1TQ4A 4PANA 1RFLA 3KFVA 2NO7A 4KAXA 1US8A 4BASA 4W5JA 4DLRA 4ZDIA 4QGFA 1R0WA 3P27A 5KDDA 1CEEA 2F9MA 4K81B 4B3DA 3EARA 4M1WA 2A5YB 2CCJA 3FWYA 5IK2D 4P33A 3G0HA 2QT1A 1E4YA 2PL3A 4XTRA 1W36C 2XXAB 1GVNB 1YU9A 3W6PA 4EKDA 4M1TA 2O8DB 3K0EA 2DWPA 4NYJQ 1N6RA 1Z2CA 3JVVA 3U6KA 4QC2A 5EP3A 3CNLA 4LJ5A 1W4CA 2XX3A 3FKSD 2G1KA 4IVPA 1NP6A 1LB1B 5BWMA 4B75A 4Q7LA 4PHHA 1TU3A 2ZJAA 2JJ2A 2XSZD 2FSFA 1NI3A 4POAA 3VX3A 3GJ8A 2DFLA 5KPJA 1NSFA 1RE0A 4BFVA 4HLUC 1YR9A 1ZU5A 5FTJA 4M9QA 2VSOA 3LLMA 5IDVA 2QY9A 3C6HA 2QM8A 2OBNA 1LFDB 5HR5A 2BDTA 3KJEA 4QBFA 4FWTA 1GL6A 4L4UA 4Q4AA 1ZJ6A 5J40A 2ZI9A 1PUJA 5KOYA 2VH5R 4WZ6A 1EG7A 5BYKA 1Z22A 5G3YA 3HU2A 5HZHA 1KK3A 3EX7C 2BVNA 3ZQJA 1VIYA 2WIBA 2RMKA 1COWD 1DELA 4NYIQ 1E2EA 4BFUA 2FU5C 3KJHA 5AJVB 3K70D 5K8TA 5EE9A 4RKEA 4N1AA 2AN9A 2ZJBA 3TSOA 4ARZB 4FD2A 5FOTA 3UMFA 3A1SA 1DPFA 3AGQA 3W8NA 3DDCA 4HZUB 4QM6A 3Q5EA 2G0NA 3CPJB 2YC4C 2PZEA 1Z3IX 1ETUA 4M1KA 2RGDA 2R9VA 1GRQA 1G5TA 4DCTA 2FG5A 2A5JA 4LRWA 2HF9A 3B60A 1ZW6A 5TB5A 2AK2A 1E2LA 1XTJA 2BBSA 3EIQA 2Z6VA 3UMRA 1D6JA 2EVWX 3KXKA 2ZE5A 5KSPA 3GLFA 5DI3A 4URWR 1TF7A 2XXAA 1W0JD 4OKSA 5FPHA 2F6RA 2VPPA 2FJUA 1J90A 2Q9CA 3GLGB 1WP9A 2F1HA 3RANA 1CRPA 1VG0B 3U44B 5J4KA 2ZRLA 5C2FA 1UPTA 2AKAB 2CK3D 2RGEA 3WP1B 1SVMA 2ZRHA 4YQFA 3U7EB 1X8JA 2J59A 2P5TB 4QRHA 2JGNA 1FPMA 1L2TA 1WBBA 4DZZA 2BJVA 4HUTA 4M4SA 4KLZA 3H0KA 1XTRA 4XJXA 1XD8A 1KO4A 2ZUDA 4UNSA 2X1VA 1IN7A 2QUZA 1QHXA 3DEFA 4JMPA 4TT3D 1XMVA 5HPYB 4C0QC 3AP2A 1GWNA 1IN4A 4IEIA 2B6HA 5FPTA 1F60A 3WY9A 3TGPA 1G41A 4LBVA 4DLXA 4I81A 1NBME 1GNQA 4A82A 3R20A 5JRJA 3THXB 3EZ9A 4Q19A 4PQYA 4Z51A 3GLGE 3PUVA 1EGAA 721PA 1Z0IA 3LFUA 3U3MA 1OF1A 2A3RA 1PLKA 2N1BA 4PQFA 1TNDA 2IXEA 3RS0A 1JR3E 5C4MA 1P73A 5AUQA 1V5WA 3QXCA 4EFLA 1N25A 4DLYA 4TL6A 5DIFA 1G3IA 1VG1A 1J2JA 1IJFA 1NMXA 1RW4A 3Q5DA 3KKQA 1AZTA 1Z6XA 2AHOA 4RJLA 4RD6A 3EWSA 3RS2A 3OE7D 4NTZA 2H92A 4US2R 3VHXA 2DR3A 1F6BA 1R8QA 2BOVA 1KSJA 2V7QD 5KYKA 1H65A 3WHLA 1C9KA 2R6AA 4LK2A 2WWGA 2XNSA 4M21A 4Y0AA 4GL2A 5UKDA 1GP2A 2EFDB 3NH6A 3T1QA 1P9RA 3BB3A 4LPSA 3RS3A 1M8PA 4M1YA 3NC1C 3ZLJA 1F2TA 1E2GA 2EWWA 2GXQA 3RYTC 4GOXA 1QG4A 3FKQA 2DWOA 3MJRA 4PZZA 5JS8A 3R8FA 2ORVA 5GJBA 3SHWA 2V9PA 3W3AA 4ACAA 2REBA 5E7JA 4UKDA 2MSDB 2Z5FA 5L3QA 1S0UA 4TQAA 3I5YA 5GADl 1VYTA 5KSOA 3ZD7A 1Q1QA 4TL9A 1X1SA 2OESA 4M53A 2PCJA 1G3UA 1PJRA 2C5LA 2NG1A 5FTMA 2RGAA 4MGZR 3AVTA 2WOOA 4TQUS 3CNNA 2F7SA 1TADA 4XOIA 4BFWA 3IHWA 3DVLA 2J0QA 4EJSB 2IK8A 3B9PA 3N2EA 3E1SA 3L43A 1TAGA 2HCJB 2PH1A 4F92B 1SVOA 1TUEA 2YWEA 2Z43A 3OIUA 2ZUBA 3A4MA 3EC2A 4KHZA 1FMLA 1HE8B 4ON9A 5AJYA 2PX0A 2P3SA 4TLAA 4QKQA 4HZIA 4XWOA 1H8EA 5DYGA 4HB2A 3EPKA 1SVWA 4BFTA 4Q01A 4QHTA 2H17A 4B73A 2ZU6A 2D2EA 1OFTA 8OHMA 3THWA 2FPKA 1HURA 1DAHA 2OAP1 4DSNA 4UQOA 1IOZA 3QENA 4NCHA 4ITRC 1CBUA 4BZPA 3Q7PA 5CDFA 4RKFA 1RRPA 2IYTA 4URUR 2NMVA 5LDDC 3C5CA 2IYXA 2CE2X 3P4XA 2ZTSA 3P32A 1N5LA 1VYUA 3AF0A 4KSCA 2PBRA 4PO9A 4YDHB 5ANRB 1KK0A 4TTQA 2NO9A 2OCYC 4BLTA 1CR1A 2PMKA 5IRCD 2WWYA 2VTKA 4F7WA 5L3SB 5EE3A 3TSZA 1GM5A 4LBYA 1WMSA 5EE1A 4CZ2A 1JR3A 5K8LA 3O8RA 4L15A 1EX7A 4DDUA 2FPLA 5C12A 3OZXA 5C10A 3PUXA 1E2JA 5G3ZA 1WXQA 3PCRB 5CM8B 4KITB 4QJ3A 2EW1A 4OYHA 4IFBA 3GLGA 4IOKA 3PVSA 2ZYVX 4NONA 5GVRA 1J8YF 2VRWA 3GLFB 4FMDF 3ZZUA 2IYUA 4D6PA 1KZ7B 3N5CA 3FYHA 3CPEA 4YC7A 3W6NA 2J87A 3WNBA 1BOFA 3B78A 1T0HB 3VX4A 2G9NA 3WNCA 3M6AA 3UK6A 4CEIB 2DYKA 3KQHA 2BMDA 2VIIA 3OIWA 5A0FA 4DRZA 3GEHA 1G5RA 2GEVA 4HZUA 4FCTA 4JKYA 3BRWD 2ERYA 2BBTA 2MSCB 2CEAA 4OHZA 3MCAA 1U0LA 2RCNA 2W2TA 2YOFA 4I1SA 4MDEA 3THYB 4E22A 4E5UA 5IF9A 3CH5A 2ZRMA 1NKTA 2J41A 2NQ2C 4IOJA 1Z28A 3EZFA 1Z2AA 2PZGA 4YXWD 3A4LA 4AKIA 2CHGA 3LVRE 5CM9C 3R8CA 5EZ5A 2Q6TA 2HLDD 5F3WB 4Q4AB 1A5TA 2F43A 1UKVY 3AKEA 4FI3C 3C6AA 3AKYA 1LVGA 2WWHA 3NKVA 3ZS9A 2GBLA 1P62B 3LX8A 4QFMA 1X8LA 1H8ED 3ZZTA 3T1VA 4ERNA 3OHMA 3GQBA 1HH4A 3CO5A 2VHJA 1XJCA 3KKMA 1T3LA 4BQSA 3CUEF 4JKIA 2VQSA 4V0KA 4QJ4A 2ZI3A 4C0LA 1KJWA 2IX3A 4JLOA 4URXR 2DFTA 4Q7JB 5FL7D 3VR3A 4JVLA 3WMEA 1NLFA 4A92A 4HB0A 3RWOA 3QXXA 1EX6A 2B7CA 3PG5A 4F4CA 4RD3A 3HR8A 3L82B 2JLYA 2ZS8A 4Z1MD 2GF0A 3F5FA 4EAQA 421PA 4LV6A 3B1ZA 2RHDA 1RYFA 1UFQA 1ZIPA 3IBYA 1US8B 3I8SA 4BE7B 4LYHA 2BMEA 5HCIA 4CEIA 2CL0X 2WV9A 1A2BA 3KUCA 1VYVA 4LJYA 4CT4B 2JLUA 3C8UA 2V1UA 1M34E 1GL7A 1N0WA 1OHHA 2R6DA 4LUCA 3MWKA 1JALA 2P6UA 4JSYA 3X1YA 4LSGA 2JIZA 3ZJYA 4F4JA 1OH6A 2Q9BA 5DN6D 4U5XA 2A5DA 1Q12A 1U8YA 3EXAA 4BLOA 1UBCA 4NP6A 4OL0A 3DOFA 2YWGA 1EWRA 1FL9A 1QHSA 3C15C 4D81A 2CLSA 1Q1ZA 2WPDA 3VR2A 2XGJA 3ZVLA 3QVVA 1EESA 4AKGA 2QAGB 2ZS9A 5A4JA 2UZ3A 4CEHA 3KXLA 1DTSA 2BJWA 3KTAA 2XB2A 2B7BA 3PEVA 2R6FA 3I92A 4DJTA 3VAAA 3AVYA 5FI0B 2W6JA 1G8FA 2H57A 2ZI5A 3ZVRA 2LCFA 2QPAA 3A1TA 4TLCA 3GEIA 4AK9A 4LPKA 4A36A 5B57C 1XPUA 3NTUA 1S8FA 3OEHD 1SGWA 4ZI3A 4PX9A 1XEXB 2WJYA 4H9GA 4YMTA 3RRMA 3SYKA 2B8WA 4HLQB 5KNBA 1XBTA 3OFND 2GNOA 1GILA 3DZ8A 1HTWA 3THWB 2BEKA 4B35A 4C7OB 5LB4A 4W7SA 1VHTA 5CB6A 3ND9A 3QF7A 4QM7A 1ZD1A 4LC1A 4A8JB 4V0LA 4GNKA 3P1JA 4KODA 3WRXC 1W4RA 4CF7A 4D25A 4HLUA 2WWFA 5KO2A 4RCYA 1N6IA 4A6PA 2BMFA 1UBEA 3M0EA 1CKEA 3AVOA 4RCZA 1NY6A 2ZJZA 4K46A 4Y0VA 4EPTA 1JAHA 1YZTA 1SULA 1ZAKA 3FMIA 4ZI2A 1E2PA 1IM2A 4B48A 2V3CC 1KOFA 3HR7A 4Q9IA 4AI6A 3QUSA 2EFEB 3B1VA 4Q4JB 2RKOA 4MDFA 3M4YA 3QQ5A 1G19A 1R4AA 5J4VA 4D4JA 2ZSDA 2W00A 3C4JA 1MOZA 1TQDA 3EA0A 4CW7A 5LD2C 4GOJA 2HV8A 3T5GA 2ZYTX 4ZKDA 2CL6X 2QQ0A 3GJXC 4R71A 3S1AB 1G5PA 1OH7A 1ZNYA 3ICEA 3ZD6A 5E95A 1II8A 4A2WA 4FCVA 1NIPA 1KI8A 4ZCMA 3Q72A 5JHHB 1DG3A 4N3NA 1FZQA 1E1QD 1D5CA 5HZKA 3UANA 4OQLA 4P4SA 2IWHA 4DB4A 2IS1A 4MYCA 1G16A 5EXXA 3UKDA 4TZ6A 2VHQA 1SVKA 1TL7C 3K53A 5JWOA 4GP6A 2HYIC 3AUXA 4CGZA 1Z8FA 4ABYA 1ZD8A 4FMCF 2VEDA 3QIAA 1UJ2A 4PPGA 3EZ7A 1XEFA 1KK1A 4NL4H 3R9IA 1SZPA 3I32A 2HLDA 4JYCA 3KQUA 5DYIA 4PSVA 3KQKA 3OIVA 2GTPA 1J70A 1P75A 3SZRA 4BUJA 4PXAA 3FMPB 1FNMA 4R2HA 1HT1E 4OJQA 4BLPA 3TUZC 1VCNA 2BMJA 4M0LA 4B3CA 3RAPR 3AVUA 1YZNA 4A1FA 4FXPA 1BS1A 1LS6A 4TYQA 2WJGA 1XD9A 2AXPA 2I1VB 2MMGA 1E9CA 1KO5A 1KMHB 3GD7A 3K9HA 4TWZA 1KHTA 2X8AA 3BXZA 3CH4B 4WA7A 3CONA 5LBIA 4ZIRA 3EASA 3FOZA 3HYTA 1VDZA 3I61A 2WJJA 3KQNA 4HDCA 4XD7D 3WBJA 2BM1A 4BLQA 2ZEJA 4B34A 1F48A 4HUQB 1H8HD 3GLHA 1KKLA 4XTCS 4HEJA 4ACBA 1FP7A 3B1WA 1UKZA 2R65A 3LX5A 1TF5A 5FPSA 4PTLA 1EK0A 1G18A 3FHOA 4A8JC 3H84A 4HUQA 1T8UA 5CLQA 1KSGA 4EDHA 4EUNA 3NG1A 3TRFA 1KJYA 1NN0A 3LY5A 4LBZA 4V0OA 1BYIA 1E94E 1P2SA 3UIEA 1YRBA 3LW7A 4BFXA 2GDJA 4DKXA 2EYUA 3MD0A 1XMIA 4MKFA 2LKCA 1ZD9A 3U44A 3AVWA 2IYLD 1E9DA 1GAJA 1PUIA 4ASUD 4NYJR 3U4QA 4PFSA 4PR0A 3LLUA 2QRNA 3NDBB 3L0IB 4RD2A 2ZS7A 2HEIA 3NIBA 5DI3B 3U7FB 1G4UR 2E9SA 4PSAA 4NCNA 2D7CA 4JLAA 5CK4A 4Q7KA 4BZQA 2ZXUA 3AB3A 1EWQA 1GKYA 4XVRA 2NGRA 4D4KA 2QAGC 3K70B 3TLXA 1KDRA 2Z4RA 2OSBA 4GOKA 4QNMA 1KI3A 3EZ2A 4AG6A 3UMSA 3CIOA 2GJKA 2ZRKA 3SNHA 4LHWA 4Q00A 3U2QA 4FMCB 1XRJA 4RD0A 1D2NA 1NJGA 1ZNWA 4U02A 3QSYA 3M1IA 4ZDWA 3RVBA 4R2IA 4OQFA 1OXUA 1N0VC 2GKSA 2WSMA 3K8YA 3RSOA 2OO7A 2PLFA 4AC9A 2PEYA 2ZRJA 3CZPA 4D80A 5KDOA 3RNLA 1R0ZA 3FDIA 5IHPA 2J0UA 4B3FX 4P4SB 3SFZA 3WNDA 3KXIA 4NYMR 3ICQB 2GK7A 3OEED 1GKUB 4RSGA 1F2UB 3FFAA 4KVAA 3VR4A 1Z06A 3LBHA 3PUWA 4AKEA 3ZVNA 3D6TB 3RS4A 3AVXA 1HE1C 2QE7D 3CX6A 4QL3A 5A5GA 3SJCA 2YWFA 1HYQA 3T35A 1NRJB 1O87A 2HUPA 4JVMA 1OYWA 1WA5A 1ZC4A 5E3HA 2QP4A 1QVRA 4L8GA 4Q7MB 5FBVB 5L3QB 4DSOA 1KJZA 4CT5A 4MYHA 1SHZA 4LZZA 1G7CA 4MKIA 4OI2A 3X1ZA 2WICA 2FN4A 2R2AA 2RGBA 1G6OA 2H5EA 1QZXA 4XSGA 2O8CB 4DLZA 1GUAA 1L4UA 4NCJA 3E5HA 1UKYA 2PJZA 3QY0A 4JJKA 5HE9A 3PR1A 4DIEA 1KTVA 3UPUA 4WAUA 2C04A 3U7HB 2QSZA 2AWNA 4JLDA 4RZUA 3ADKA 2VHCA 1P2VA 4PZYA 1U98A 1YKSA 4MRSA 3TJZA 1I4LD 3QKRB 5EP4A 1CR0A 3NDPA 4IJMA 1P5ZB 1E0AA 1JQLB 3Q8XB 1QHHB 1ODFA 2P0EA 4TMVA 3AF1A 2R6GA 3PQCA 2XJ4A 3VNVA 2HXYA 3O8BA 4LHXA 1HA3A 3QPUA 1G8PA 3RABA 3AF4A 1T3SA 1ZRHA 1NF3A 2VBCA 3KFXA 2ZRNA 4G01B 5J47A 1AKYA 4O3MA 1XZPA 3BH7A 5FOUA 5SZHB 4PAOA 2B21A 2FFQA 2QAGA 4CEHB 2KBFA 2ZRIA 4MQBA 5J4YA 3THXA 3BERA 1CLUA 1X86B 3LBNA 4US1R 5D3MA 4Q03A 3WYFA 5M04A 4D26A 2DCUA 4BEBA 4CYMA 1QRAA 1KNXA 3AF2A 2P2LA 2CE7A 4Q1CA 1NL3A 1OH5A 4PPQA 3QVUA 3FHTA 4UNQA 3W34A 3CR8A 3IKJA 3UWOA 4IRUB 5JMTA 3EPLA 1P61B 1P4SA 3H4MA 3MGCA 4C0SA 3IQXA 3OAAD 3QBTA 1RC8A 1JNYA 3KB2A 3L8ZA 5G41A 1GNPA 1NN1A 1OXXK 2GXSA 3RS7A 3W8RA 3CRVA 1FOEB 3RSLA 2F9LA 1OB2A 4Q9JA 1DAKA 2VO1A 1VCOA 2VP0A 4EQ6A 5BXQC 2IYWA 3TNFA 3FMOB 2NPFA 3OEEA 2ZJOA 4XWKA 5F2EA 1R10A 4C2UA 3RRNA 1JECA 3NHBA 2WKRA 2Y8EA 1ZNXA 1AQYA 1Z83A 3LAWA 3LA6A 1G8GA 4R9UC 4ZDJA 2ODEA 3IO5A 1RJ9B 3AH8A 4LCBA 1Z08A 3B6EA 3GJ7A 5E7MA 3DHWC 5KNDA 5J4LA 2EWVA 4RZ2A 1XEWY 3CZQA 4JLMA 4MH0R 1SXJD 4PO1A 2FOLA 4M9XA 3CRW1 4WBSA 2QMUA 4RD1A 3CF0A 1ZMXA 1KI7A 2ZANA 2TMKA 4NCKA 4OHWA 3DL0A 1ZUIA 3X2SA 5L3RA 2QTHA 2OUKA 3D8BA 1TQ6A 3BS4A 1A7JA 5K8IA 2XAUA 2JLQA 1KIMA 1U9IC 2CHQA 1Q1BA 2WBLC 4ESHA 2EU8A 1GKIA 4TTPA 2W2VA 3EA5A 4P3YA 3NC0C 1E2MA 3EW9A 1XXHE 4C0BA 1Z47A 2C95A 1G7TA 3KUDA 1G64A 5D3QA 1SQ5A 1E2FA 3BAFA 2F43B 2GAOA 5DHFA 2PT5A 5KUTA 4Z54A 4B2IA 4NE2A 2ZRPA 4EJSC 4DUGD 4KO8A 2GCOB 3BC1A 1E2IA 1DS6A 2FZLA 4IXMA 4URVR 3UATA 3B5JA 2LKDA 1IN5A 3CF2A 2VL7A 4JLVA 3OEHA 1YRAA 1OIWA 2QBYA 3TAUA 3O47A 3ADCA 2FEMA 2ODBA 3AM1A 2IEYA 3D7MA 2RGCA 1JR6A 1KAGA 4KVGA 4ZCIA 1JAIA 2GETA 1EFRD 5TY0A 4IVQA 4TSFD 1ZM2A 3CX7A 2CJWA 2H8KA 1JJVA 3Q7QA 2OZEA 3IEVA 4URZR 1E9AA 4E09A 1WDTA 2A5FA 1MABB 2ANBA 2GXUA 4NBSA 5G40A 2CL7X 4US0R 2R8RA 1MH1A 1CJUC 4JT4A 3W9YA 2J45A 2IC5A 1DE0A 1SKQA 1A4RA 4IHQA 1EFTA 4Q1AA 1E9RA 4Q4LA 2VA8A 2C2HA 3B1XA 3DPUA 1E6CA 3BBPA 2WSSD 1IAQA 2G6BA 5CJPA 2ATVA 1E2KA 3QF4A 3B1YA 3OE7A 4PPNA 3AP1A 4GP7A 4WXRA 3EPHA 1W0JA 5C15A 3AEZA 1IXRC 1ZIOA 2V7QA 3GJ6A 1DO0A 2ZPTX 3WRYC 1I2DA 4G0NA 4BRUA 4URYR 5DI9A 5F9FA 4JLBA 4ZO4A 4C0AC 2WHXA 1OJLA 3SOPA 1HQYE 4PZLA 3GCGA 1II9A 1QHNA 1MO4A 1R2QA 1XF9A 4OI4A 3TUIC 2D7DA 2O8EB 2NO6A 1E0KA 1CP2A 1X8KA 2C99A 3F3YA 5FOXA 1TF2A 2GRJA 5DH9A 1XD2B 3IIKA 3V4FA 3ZIAD 3NBFA 4U00A 3V00A 5L8VA 4HAXA 4LDJA 5BW8A 1QDEA 1GITA 1XNJA 3OFNA 2R62A 5FH9A 1SVSA 2JASA 4DCUA 3DZDA 4IDNA 2VYFA 4KFUA 1XD2A 1Q0UA 2QT0A 4M9ZA 3GLIE 5M1OA 1Q3TA 1CULC 1R5OA 3CBQA 4LWZA 3LNCA 4TMKA 4EJSA 1VECA 1E1RA 3WXMA 2GF9A 4L9WA 4JSTA 3BGWA 1HUQA 2W58A 1DAEA 4GZMA 4B71A 1Z29A 2JLRA 4TTRA 2ZSEA 3C5HA 1WCV1 4AYTA 4HDQB 2ZJ5A 1KI9A 3FFBA 2Q0HA 4C0JA 2QTFA 4HAWA 1AIPA 4LJ8A 521PA 2IHYA 3A58B 4FMBB 2DPXA 1IY2A 1DOAA 4NYIR 4AG5A 3TK1A 2D4HA 5JJIA 4DB2A 2A5GA 4HATA 5AUOB 2A30A 3C14C 2REXB 3AQ4A 5C2JB 2ZSAA 1W44A 4DSUA 1F2TB 2DB3A 2ZJYA 1E9FA 1ELOA 3SR0A 4IOLA 3QXHA 4DLVA 3DM9B 4MGYR 5DE3A 5TV2A 2CHVA 1HQCA 1PZNA 2VHTA 3RDPA 2OFXA 3LWNA 1Z0KA 1OE0A 1R7RA 5FOWA 1Z6TA 1VMAA 2FMXA 1MO6A 4Q9KA 5FR2A 1NSTA 3H86A 1CRQA 1E9SA 2C9YA 2IS4A 3CRQA 3HJNA 4Q4JA 1M74A 5KDLA 1E4VA 1R0YA 1E2HA 5L3VA 1G6HA 1AGRA 1MABA 2D06A 4LY6A 2WAYA 2O0HA 4G1UC 3AF3A 1M7BA 5CIQA 4D0LB 2CJWB 4A15A 4KFRA 4TQ9A 1UADA 1BKDR 1D9XA 2V1XA 4C9BA 3O8DA 5IK2A 4OQMA 2WAXA 3U61B 1WB9A 1U94A 1W36D 4P31A 3N70A 2Q21A 2K5UA 1PLJA 2ZJ8A 4TLEA 1W2HA 4B47A 3HPQA 3TR5A 4JBWA 4LGMA 4QNRA 3Q9LA 2QBYB 5AUPB 3PJRA 5SZKB 5JBQA 2QROA 3LQQA 3N2IA 4UJ5A 4KV9A 4EFMA 3QNUA 4KU4A 2JJ2D 2OBMA 1NVVR 2XSZA 3X1XA 2XNDD 3SQWA 1NN5A 4JL8A 3VKWA 4DUGA 2GCOA 3MWYW 4G5RA 4EPWA 5AUNB 4HB3A 5JWHA 1II0A 3EWAA 4O0MA 2YVUA 1XWIA 2FSHA 1F3OA 3BK7A 3HU3A 3K1JA 1Q1EA 1TPZA 1XEXA 1OH8A 3EPJA 1OW3B 1MKYA 2OE2A 4QGHA 1LW7A 4WZBE 1W7AA 4Q48A 3HYRA 4WOPA 1UDXA 1NLZA 3R7WA 4JL5A 3T5DA 4IDHA 4O2LA 4J0QA 4XD7A 1UBFA 1ZU4A 3LH5A 1AJEA 1GRNA 3NXSA 2FFAA 3P20A 1XXHA 4LJ7A 2IF2A 4LX0A 1VCMA 2BEJA 2C96A 2X2EA 4BRWA 1WRBA 1RKBA 3SBEA 5CJ2A 2PZFA 1E79D 4DDTA 2XTMA 3HPRA 4PAMA 5DGXA 2WWWA 3ZS8A 3QG5A 5BQ5A 3CF6R 2W2XA 4B3GA 2FPMA 4NDZA 3KL4A 1VG8A 3GP8A 1R6BX 3ZZ0A 2JATA 1S1MA 4KYIB 4B2PA 1NVUQ 1CTQA 2I4IA 2XZLA 4DIDA 2WM9B 2ZR0A 3EIEA 5CYOA 3TBKA 2WJHA 4QHYA 5AJXA 1TMKA 4HLCA 1YR6A 1G291 4NPHA 2QEQA 4C3ZA 2FF7A 1C4OA 1NY5A 3PV0A 4NMMA 4BLSA 3ECCA 1EXMA 2FEOA 2IYVA 2QORA 2P67A 2W83A 4BZXA 1ZM4A 3B85A 1KI6A 1Z0FA 2QTVB 4QHSA 3KJIA 5EZ6B 2Q3FA 2VP9A 3C7KA 5EXPA 2O5VA 3B82A 5E4FA 2Z4SA 4A2QA 4F38A 1C1YA 2ZVQX 4TL8A 2J3EA 1E0SA 1IBRA 1DG1G 2D74A 5HCNA 1NVWQ 4DC9A 2FV8A 1N3BA 2RHMA 4V0NA 4TT3A 5H68A 3CR7A 2JA1A 2V6JA 1QG2A 4JJZA 4NU0A 4F93B 4AIIA 1AKEA 3L0OA 3CWQA 2ZRBA 4BFYA 3ZYCA 4YXWA 2FGJA 1FUKA 2AK3A 5FOVA 2G0TA 4OK5A 4HAUA 4GSYA 2QG6A 2OILA 2J7PD 2D2FA 3LRPA 3K0FA 2C78A 2MMCA 2PT7A 1NVVQ 4BFSA 4NH0A 2YKGA 1OIVA 2H7VA 2ZI4A 2O8DA 4ZDKA 2W6JD 1AN0A 3THYA 1I4DD 4GMDA 121PA 1F5NA 3TR0A 3DKPA 2BCGY 2ZITA 5B64A 4Z8XA 2P6RA 3L8YA 2ZETA 1QHIA 1OXTA 2QU8A 4RZXA 2KB0A 1G7SA 2FGKA 3U5ZB 2J7KA 1LTQA 1KO8A 2FWRA 3G5UA 1DEKA 2W6ID 3RRYA 2J0SA 2YJTD 3GEEA 4RFSA 4YONB 4DCVA 4QGAA 1LF0A 3A1WA 5FFMA 5JFGA 3WBKA 2O8BB 2PCLA 3TQFA 4TYYA 4JS0A 3W90A 5FBLB 3TMKA 2P6NA 4DHEA 4QGGA 2NTYC 5TARA 5DISB
chains in the Genus database with same CATH superfamily
1DBWA 2C9CA 3EXEB 4KFSA 1HEIA 4CIDA 3SBDA 3DMTC 3ULEB 5FUMA 1R18A 3K0CA 1QSLA 3H11B 1U3TA 1EK6A 3KR2A 1UAAA 4HQ6A 1MEJA 2P8JA 2XKJE 3N4QA 3A5NC 2Z1HA 1OKKA 2C2KA 2E7ZA 1QLJA 2M98A 2RGNA 2V5AA 3VR5A 2BBOA 3ETNA 4NSNA 1B8NA 1W0KD 2JJ1A 1XMOB 2NIPA 1NE2A 3EVFA 1S9EA 4YK7A 4MRPA 3NH9A 1KS9A 3KJFA 4JYPA 1ZGAA 1Q84A 2NZ8A 3BXEA 1ANKA 3KX2A 4FS3A 4PEVA 3D5QA 2PKQP 2QLBA 3L2VA 1CZRA 1L8QA 2H1HA 1HDEA 1QIMA 1Z2OX 2ZT7A 3ORQA 4HGRA 4C7JA 4D74A 5B6IA 4OLBA 4C05A 3DL7A 1YKFA 2HHVA 1YI0A 2ZIEA 1DARA 1G21E 1OXSC 3C6MA 3DNMA 1OYVA 1XQVA 3VQ4A 1KFJB 2AX4A 1ENOA 2OLJA 4LSLA 5J2MA 4MUYA 5AH0A 1T8RA 5BN3B 1SQ0A 2PBFA 1CJTC 2EFHB 3B3QA 1VIAA 2CHFA 3I2IA 2VYQA 2JD2A 3L0PA 4NZNA 3DT9A 1YT5A 3BH6A 4C6SA 5CDFE 2YNMA 3ZDAA 2IU6A 2D5BA 5B37A 4C7KA 2N3ZA 5B3JA 1PV1A 3BD9A 1ML4A 5KWIA 4MIYA 5CYPA 3OM0A 2YWJA 2P9PB 5DB4A 3DOHA 4JLUA 5M5BA 4EYOA 3H8JA 2HDNB 5CX1B 4M9SA 1XA3A 3K9QO 3ANYB 3D6VA 3RVRA 4DIKA 4H1WA 2ASMA 3BSWA 5LUBA 3ENNA 4X24A 4DT1B 4YMGA 1QU3A 2D6FA 4QU5A 4QXQA 1PGQA 2NSDA 3G25A 2DSTA 3PBKA 3T3EA 2P9PA 1B93A 2VHXA 3OWOA 1DQRA 4AYXA 4XA8A 3S2GA 2JH3A 2IHBA 3A37A 3QX9A 3D1VA 3G7NA 4KIUA 1YO6A 1ULTA 1D1SA 3H17A 3K1ZA 5LLTA 2PN1A 1PCXA 2YHUA 3KG2A 3NWJA 3GA5A 2PTHA 3KPYA 1UBGA 2V96A 1J09A 3HVUA 4GMFA 3W5UA 1T29A 1PUXA 1A2KC 2QPOA 4BG8A 1TW3A 2ONKA 1E9VA 3EQ2A 3PUZA 4FIZA 1AF4A 2CH5A 2WJ6A 1CR6A 2IP1A 3BKXA 2IXGA 3HADA 4C4PA 4F6CA 4RHEA 4NBVA 2GZRA 5HMLA 2KLBA 1VHWA 4DXHA 5EJ9A 3LDOA 2IEBA 2DULA 4AJ1A 4F84A 4HNUA 1KR2A 3D43A 4OK6A 3GOIA 1IG0A 1V25A 1MXFA 4RW8A 4M3ZA 2FZ5A 2R7LA 4TM7A 5HIKA 3JTEA 3LW8A 1K9MO 1OWMA 2QIPA 5FX2A 2ZCJA 1ORIA 1G8YA 1H9AA 1PSDA 4IX9A 3STHA 4DBZA 2C8VA 1I1QB 3UT6A 3ZHSA 2HMWA 2CLLB 3BD8A 3H11A 1CXZA 1PZEA 4E94A 3TAHA 5JICA 5AJWA 1U3VA 5TGDA 4HUFA 4ARVA 1M8GA 3I2GA 3IP5A 5U9CA 4M8LA 1ORVA 3IPXA 5DTMA 5HW0A 4Q7EA 3W2TA 1VHLA 1GOAA 2QVYX 4ES6A 3KQWA 4F9FA 3KLHA 2FEPA 1JXMA 1PKEA 3A36A 5JZBA 1RZRA 3IV6A 4HAZA 1I3AA 4IJ5A 3GPLA 1E98A 3LXXA 2XZDA 4R7GA 1LH0A 4TLLB 2B4JA 2IZ0A 5DYWA 3T0IA 5FEUA 2YHXA 5SY4A 3AR6A 3ACCA 3L7LA 1TK8A 1IM8A 4PLVA 3F3MA 2ZRDA 1K8ZB 4JSRA 2JAUA 3MK6A 3G0OA 5EPOA 2W6LA 1VPDA 2OC4A 5AWFC 5HF5A 1JDVA 4FYMA 1L7PA 5CH3A 4EI8A 1Z05A 5FBZA 3OESA 1XKQA 4JA0A 4J1NA 1LNZA 2J1LA 2TMYA 4KUHA 2JIPA 2A59A 2W2KA 2WDPA 4LXYA 4M7PA 5EQFA 1HETA 1RU3A 5C7LO 1BSVA 1HK7A 1H2YA 5ESWA 1S2IA 4OGEA 1ECPA 1ISPA 4KHNA 3KPWA 1CDOA 1P60A 5CLLA 1RTKA 3EZ6A 4CQMB 1S96A 1DC6A 3GFOA 2XMPA 4UU0A 3GGOA 1XLTC 4NLLA 3AO2A 4KNVA 1AS2A 3EZNA 2AHRA 3HSTB 2W6MA 1QRRA 4EKYA 5K7SA 2P7IA 4LVUA 1DQYA 2I6SA 3E3MA 4FBGA 5CGZA 2D5AA 3I9FA 3GRYA 1XWFA 2POCA 1IY1A 3M81A 4KUGA 4K42A 2AJ8A 1KORA 4QQNA 5HIIA 2X7HA 1L4HA 3MJTA 2WYOA 3ET5A 4CVNA 1KY2A 3KAKA 2B4AA 2YZ2A 4B8ZA 4E3SA 1RRFA 1ZI9A 3HU1A 4UHJA 1W25A 4MW6A 1EB8A 4CEJB 3STWA 3FDJA 1WZCA 1BIFA 5H1YA 2CDAA 4W9MC 2C7OA 1ADGA 3R9WA 1XRMA 3G5AA 2O0LA 2AXQA 3I04A 5KPTA 4Q9NA 3RS5A 4CJLA 3H1VX 2HF8A 3CLHA 5HHTA 4PICA 2OAGA 1JLGA 3KWJA 3N4PA 4D9FA 4HI0E 4QASA 3CB2A 1VE9A 3GUVA 1BMFD 3QW4B 3FNRA 4QOEA 4RZQA 5C8YA 4CM3A 2FF6A 3GNQA 4DBLC 3PUFA 1IN6A 1YI2N 1K2WA 1H6CA 1U1FA 1ZXLA 2PRZA 1N6OA 1VL1A 4CHTA 1UQTA 3IQGX 1U0JA 1ESNA 5KU1A 4NZMA 2B69A 4U9UA 4BGIA 3SU8A 1WP4A 2VWBA 4LRXA 4NQRA 4XRGA 2QW1A 4CDGA 3IJRA 4RK5A 3UXEA 4P32A 1IATA 2VVTA 1COWA 1N0HA 2YTZA 3IP9A 4KXQA 4PG5A 2EF1A 4JWTA 4E1BA 3KAPA 3IPCA 7ABPA 3PJDA 3DB1A 1H3FA 2ZBEA 4X84A 2J9RA 1ZCFA 2OQ2A 4J16A 4LKRA 5TDHA 3LQ2A 4AHVA 1HKUA 3E8MA 4NFYA 3L1HA 3SP1A 4C23A 2V54A 2VXYA 3PGJA 2ISSD 3F96A 4PFJA 2FH5B 1KD1O 1S9DA 1YQGA 1ZUNA 2H85A 2LCIA 2QJRA 2OEPA 2Q7OE 5DXFA 5JCPA 2VPIA 4Z4CA 1UBJS 4N40A 1T44A 3VBCA 1WMBA 1ZJWA 2CXHA 1N6KA 3Q6NA 3ZWCA 3O26A 4OHBA 3LP5A 2M6SA 3GNLA 3QXJA 4I1UA 4KRGA 3TLEA 2ZWOA 1OX5A 2JKZA 1POWA 3HI4A 2XLCA 3GJ4A 3IJEB 3R5KA 4JZKA 1G4AE 3JASA 1ZK4A 1X3MA 1A4IA 2FSVC 4NG4A 5TPWB 2LRHA 2XQVA 3ZWAA 2Q8PA 4EFKA 1U9CA 5JVDF 1PVOA 1W76A 4MWGA 1XXHB 3HB5X 3ONNA 1VJ0A 3DH0A 2IUFA 2ZIZA 1NDHA 3BK2A 4WWHA 1JSZA 4QRIA 3CG0A 2IVPA 3ZDQA 1PZXA 3FOEC 4EB6B 2RI0A 2H4HA 4RS4A 3VH3A 4ESVA 1YTLA 2ZGVA 1RTIA 3AHIA 3IEIA 1X3SA 3QU4A 4Z86A 3IP1A 2MR5A 3V81A 2V6IA 3FOCA 2CLEB 3IGFA 3QIVA 3FMFA 4M88A 4X61A 4C43A 1ID8A 5M3BA 5CIWA 2I5PO 3V5NA 2J6HA 1XQWA 4YT2A 3AVHA 1RC0A 1XYYA 3DT6A 2HHXA 2FQWA 1RDWX 4CZJA 4NFSA 3TOZA 4LJ4A 3GR6A 4PYLA 1KU0A 2A3NA 4DSEA 2NQTA 1XMQK 4F71A 2OMKA 5L51A 4L16A 1CQIA 2FPOA 1YS4A 4KBYA 1YR7A 2V55B 4P7BA 1QONA 1Y37A 3VKGA 5I42A 3J81k 2EQ5A 2RKWA 1NM5A 4ZV4A 2C0PA 1ZH6A 3LPNA 3F7TA 2VDMB 1AN9A 2IEGA 2VSXA 3LLSA 1E89A 2NOAA 2O4CA 3HN2A 4KPUA 3I2HA 2VF7A 3RFVA 1XYGA 3PGXA 1IK6A 2O2CA 3L2OB 2P9YA 3QETA 3TVTA 3ERCA 1EVQA 2QK9A 4U1RA 4MA4A 2YIJA 4QOSA 5SYMA 3SI7A 1G60A 5FLKA 1LWFA 1W4AA 3RS8A 3K9JA 5T7BA 3AIKA 4IMIB 4TV9B 4EW2A 2Y1EA 4O29A 4N7MA 1EI9A 1SXJB 4UQGA 1GPNA 2VSFA 5AHXA 5DW0A 4X6UA 2O52A 3GRAA 3W2EA 1AD2A 3T9EA 5LZ9A 2BM9A 3WZ2A 3OZ7A 1W59A 2XTJA 2E48A 4Z94A 3ULEA 1LQ2A 3CRRA 1J20A 3D64A 3KB1A 1YQDA 4EF5A 3PX4A 3EXEA 3QX7A 4JIGA 1K7EB 1N6LA 5K0EA 2EP7A 4RF4A 5EE0A 1PRYA 1OBVA 3QBEA 5JIBA 2E55A 4CF0A 1IQPA 4N9WA 4R1UA 2WJVA 2IYEA 1ST3A 3BOSA 2AFIE 3DF7A 2O3QA 1NFRA 2HA0A 3EUAA 3QKRA 4INOA 4NK5A 4HYTA 5I8PA 1HOXA 4INPA 1RYZA 4QNNA 4MWTA 2WJPA 3QRWA 5BQXA 5J5AA 1R27A 1DRVA 4URHA 4OVLA 4K9MA 1RYHA 1YZQA 4ILKA 4RA9A 1IJBA 3TRHA 1GT91 2GM9A 3GEDA 3KWLA 3SKXA 5DTIA 5EAIA 4XYBA 1TKZA 2O8CA 1IG3A 2VBGA 5CK5A 1KDYA 1NQXA 1RJFA 2OBFA 4ZGGA 3OM9A 5LIRA 1Z6YA 1IG9A 1ILWA 2MINA 2NU6A 2O7SA 2ZAGA 1R3UA 2O50A 4G81A 4GPTA 4K8OA 1HDYA 5GIOE 2JLXA 2V9ZA 1X1TA 3DVRX 2PZLA 1FQKA 4I55B 4BLUA 3E7FA 2GPWA 4X6YA 2F1IA 1TUUA 2WVJA 4KPYA 3CZAA 3FPEA 5EWJA 1Q3HA 5LMNB 5HS6A 1OT3A 2HI0A 3D5EA 2FN9A 2RKIA 3MN7A 3K9LA 1KFSA 3AGRA 2JDIA 3VSDA 2AZ4A 1QFJA 4FLVA 2DUUA 2ZJ6A 4JLHA 3RVCA 2GX6A 2VZ9A 4FP9A 1R5NA 1NGDA 2QWLA 4UBKA 1TX4B 1UIRA 5JY6A 5AK0A 4WCEL 3IUEA 1VLHA 3ZSOA 2IXBA 2FZ4A 2I4NA 3IA2A 1IEWA 4RFVA 1V4BA 4DC0A 1G1AA 1KYYA 3LQRA 1M3SA 3NAMA 1LPBB 2GJ8A 4C89A 1V1MA 4ENTA 3T1NA 3OOSA 5ICFA 3WIVA 2C7RA 1H2BA 4DQDA 3VV3A 1QTMA 2KQ2A 3ZSWA 4Z4EA 1BDJA 2WM3A 3FRHA 4OREX 4BVHA 3ELYA 1WY5A 5FLEX 4CF9A 3BE4A 2UVPB 4FZ5A 4LYAA 5JSZA 1XP8A 5C1PA 5L4LA 2R1TA 1VRWA 1P4RA 5F5NA 4PKIA 3RLFA 2ZAIA 4E03A 2DKFA 2X41A 2XEDA 1GQFA 5CITA 1JZSA 5FPKA 1VE5A 2Q3MA 2BCEA 1V2GA 2GD6A 2IPNA 4OVKA 2I0FA 1J2YA 5CDHA 5IVPA 5KYYB 2QAJA 4YRMA 4M86A 4ZOQI 3NHGA 1WNSA 1OYYA 3C8HA 2HMAA 1D0SA 3EEBA 4DYHA 4DKJA 3CX8A 1C9DB 1RI5A 3K9NA 5FPYA 4BLWA 2VDKB 3QPAA 4WFJA 1P0PA 4HH3C 5GJVC 1B0UA 4G5SA 4LTNA 1GG9A 3RARA 3GRRA 1SVUA 2OPRA 1WXHA 3EPPA 2DHCA 1SNYA 1Z35A 3DPIA 3O1LA 1YZUA 2XZPA 3R5XA 5H16A 3KR9A 5DNAA 3SJAA 3P9YA 3ETGA 4S12A 1K5PA 1W46A 2GJ4A 1D0VA 1ZRSA 3NANA 3SVZA 4BL5A 1Z15A 3VPFA 5ALPA 5CYGA 1G17A 3BIWA 4KB1A 4KTZA 2FWPA 3B51X 3MRXA 4ZVLA 1N1DA 2F3SA 4EPRA 2ZWVA 3TPFA 1NHWA 4HR7A 1K0UA 3LUGA 1R5BA 3HPOA 1GGFA 4KQMA 4MLPA 4NBLA 3VQBA 5CBKA 3FH0A 3UKUA 3C6UA 1H5QA 3H13A 3WGKA 1HDXA 1WHTB 1TT5A 2A1UB 1WE2A 2BELA 3K4QA 4YCMA 4KFCA 2XDYA 3RVLA 2AL7A 3U0BA 4I7EA 4XYMA 1WLJA 5HMMA 4B1UB 1JJ7A 3O5BA 3IKVA 3LV8A 5DT2A 3QLVA 3ZWNA 4PGHA 1U7ZA 1L5HB 4XVQA 4ZO7A 4B33A 5K6TA 4BREA 1KMQA 4B8AB 3NFRA 4MPJA 4YUVA 1EUCB 3FPKA 4P4TA 1DAMA 1UC5B 8ATCA 1QS4A 1H9CA 3H9EO 1AK2A 4HB4A 4CL3A 4ND4A 3JWEA 3F6EX 5EHIA 1QNLA 1U2RA 2IEZA 2VSQA 3M2PA 4D3SA 2BI7A 3I9KA 3PIPL 1IAVA 5IJXA 4F8RA 3IUMA 1MN6A 3X1WA 3MLEA 4DR2B 2QX9A 5C3MA 2OPPA 3ZUPA 2HA3A 3C45A 1C1XB 2NN3C 1FJ2A 1L5QA 3I6MA 4LQLA 2ZRFA 1I10A 3X1DA 2ASEA 2QRLA 2PUDA 2VZ0A 3FLBA 1KZ4A 5CT4A 1VQ1A 1FXWF 4X0EA 1FYVA 3PFNA 3T1VA 4DY4A 1UP7A 3DAWA 3KHUA 3ZWDA 4IDKA 2BHTA 4DN6A 2JPDA 3ZW7A 2ZK7A 3U3OA 1P9NA 3AR3A 4IKOA 5H80A 4IF6A 1A1VA 4RGBA 3JWHA 3BEOA 5LLSA 1GDHA 3GJ3A 4PHTA 1T1RA 1Q22A 3TKYA 1LLCA 2Q31A 5JZVA 2B83A 4K6HA 3AVBA 1J49A 1EFPA 4Y6GB 2P3LA 3QM1A 4W5HA 4X3PA 5K3EA 3R75A 3FWZA 1CFZA 4K7JA 4REQB 4E5SA 2Q3HA 5AMXA 4RK1A 3JZFA 2YXBA 3QFUA 5FD8A 3L7NA 1WZEA 3O73A 4YT5A 5D5PA 5J5CA 2J08A 2Y2UA 4IV8A 3L79A 3WNEA 4UVHA 1BE1A 3WXKA 2C92A 3L5KA 3L7BA 5H4GA 4DDWA 3NHAA 5KHOC 4OFBA 2E1RA 1Q17A 2D0PA 3O8QA 3MMPA 3BQMB 2ETVA 4ZAXA 5FTJA 5LP6A 4EZ9A 4MRRA 1LK5A 3C97A 1G2QA 1KJIA 5F51A 3OY9A 1VBMA 2RK6A 2MDTA 3IAUA 5AESA 4CKEA 4V1CB 1JSLA 3ANNA 4BJHB 1NW7A 1QC5A 2X78A 1C1DA 3QLVC 1KDOA 2C5HA 3F5QA 4K9SA 4IQ0A 1TT5B 4B3MK 1GIAA 1WHTA 2A1UA 2PKEA 3MAJA 3P9CA 2GBPA 4PGGA 4ZEOA 3ZH2A 3ZCTA 3LWDA 1ZBIA 4HDOB 4V24A 3A4YA 1Y6GA 4DV1K 2I4LA 1F8XA 3PHLA 1HT2E 1Q11A 1E20A 2FFBA 1SB9A 1KI6B 3QVOA 4DTMA 1MGPA 2YN2A 2Z2JA 2QM7A 3AV9A 5JNRA 3FSEA 3FHJA 1XLVA 3ISTA 2C9MA 3N87A 2CZGA 4CZGA 1OHHD 4C0HA 3BMOA 3TLKA 3D5TA 2JS7A 3ZEUB 3WWCA 1V7PC 1OV4A 2CY0A 1WSEA 3BG5A 4FYVA 3NCHA 4BV8A 1D4XA 2Y93A 1IN8A 2FI1A 4IWYA 4RPGA 3F9IA 3DOLA 4ZC1A 1VQPN 4EEKA 3BP8A 2V9CA 1ASWA 3AFHA 3AVJA 4TTTS 4WV3A 5CB8A 2G77B 1U0SY 2W2PA 4F3CA 5GVSA 1EJ0A 3HEBA 4ARUA 3K31A 2BHRA 1W2GA 2H48A 2YQZA 2XHZA 2BAGA 2Y1CA 4IJWA 1VL8A 3KBBA 4FVUA 2HBQA 5EZYA 3ISNC 3ANTA 3JQGB 1S89A 3T9BA 3SYMA 2R751 3UCEA 2I22A 3OW2M 1RRMA 2GPTA 2YOHA 1L5GB 5LZ2A 1Z9BA 3G23A 2V8BA 3QKSA 4KGVA 4E7KA 3E9LA 2CDRA 3ZBTA 3OT1B 1KXZA 4XCXA 1FY2A 1B16A 1W30A 3CH6A 4CF4A 1J8QA 4O4IF 2X8JB 1AURA 1GKKA 1WO8A 3VMFA 5M1QA 4EHJA 2YH2A 1GD1O 3NV9A 5AKEA 4EEZA 1OQAA 3VQPA 1A9OA 2ZJ1A 3AERA 2PBLA 2A5XA 2DTXA 3UWMA 1APBA 1G59A 1YASA 4DILA 1TXGA 3ABRB 2VDPB 2KHZA 1E1CA 5E4JA 5IAKA 5GY7A 3UMJA 2XY5A 3BCRA 4OATA 3CC2N 2EGUA 5L9AA 3G6KA 3DWLA 3HYLA 4JI1B 4RLFA 2HHSA 1FTSA 3TECE 4WE1A 1ABBA 4BQEA 2B30A 3GJYA 2VSNA 4N8SA 2I2FA 3IL2A 1L7VC 2BGRA 3EQ9A 4N5MA 4UZFA 3T61A 4I19A 2WF5A 4XX0B 1M2KA 4ICLA 1ZA2A 2LZ0A 3PCTA 1I4WA 2FWIA 3ETLA 2R1VB 1F6WA 1V8DA 4MQ4A 1RJDA 5HE8A 1EIZA 1SC6A 2EBWA 4RUKA 3M1YA 3D3KA 4ITUA 4L8LA 1GARA 4GHWA 4X8HA 2E4WA 1L5KA 4AURA 4I4IA 4YT4A 4OLFA 3S8YA 4F12A 2CWWA 5IT0A 2NRTA 4CE9A 1NXOA 1GRRA 1PWXA 3ZDFA 5JW6A 3MC1A 2CFSA 5JZMA 4X6LA 2W41A 2FE1A 2I65A 1HEYA 4J0DA 3E9CA 2H2DA 3FF1A 3PKZA 4Q4HA 2SKCA 4BAGA 1I3KA 3GN2A 4CCWA 3LY8A 3PA8A 2HWWA 3NU1A 4P9NA 1GLCG 1RDUA 2J3IA 4QOHA 2BBWA 2QA5A 4MWZA 4R1QA 2JLZA 1YIDA 3DS8A 4E0BA 1MX9A 3AUYA 4ELTA 4P82A 5IHXA 2GEKA 4KBGA 1EGMB 2CT8A 2HT6A 4B3TB 3GLFE 1ZBHA 2HJWA 3M6VA 4J76A 3HBMA 4KI7A 5BOSA 5BUQA 4E30A 3SQ0A 1Q20A 1MDBA 2INGX 1GTG1 3IXMA 1OFVA 3LDAA 3N8HA 3CV3A 4YI5A 1JG3A 3DLAA 2EZ9A 3GA0A 3QW2A 2I8AA 4S3MA 4EG6A 6REQA 1O94D 4PXSA 5TVGA 1MT0A 5KJCA 5BVHA 3OJ0A 1UAXA 2B2NA 4YR9A 2I29A 5IULC 1EBFA 1QV6A 1VKOA 1WSHA 1AGPA 2B5OA 4BNMA 4W7HA 2IH2A 4OKIA 2JH9A 2DWCA 3EGWA 2C8LA 4WE3A 5JAPA 1P19A 3PC8C 2JFNA 1RLIA 4WKGA 1CS0B 1NMZA 1QAQA 1PTJA 2J6IA 3P26A 4LNUB 4PIMA 5CH8A 5KYTA 1RPZA 3AAPA 2DBYA 2JFGA 3VVMA 2NT4A 2ANCA 2ZJ3A 4Z9YA 4LZJA 5LBTA 3WYNA 1LLQA 1HF3A 3DM2A 1M6VA 4I4NA 3TVDA 4DLTA 4O63O 3T3PB 3DLIA 5IANA 1ORHA 1DP4A 3OCJA 1I2MA 2QP3A 4JBGA 3TLCA 3ZGXA 3EBPA 2GI4A 2P2CA 3NP9A 1IMOA 4WECA 5GJWC 2P9ZA 4BMZA 4CFDA 5ALDA 2NVUB 3KDAA 3UKJA 3V1KA 2HJGA 3SS9X 1L3CA 2YDXA 4KFBA 3LT5A 2X5OA 2NP7A 2NU7B 2YHWA 1SL1A 2JCVA 2VF2A 4P4LA 2EIXA 2EZ8A 1C1BA 3IUYA 5BUSA 2PXHA 4H7PA 1FSZA 1A9XB 3FGPA 1PNTA 3ZX5A 1NULA 3KVRA 3CEMA 1RLOA 4O4HA 2ENUA 1VB3A 2KBEA 4BQPA 1CJVC 2Q4RA 3KKRA 1JEQB 1GPYA 2WLTA 4H15A 4LXHA 3OF2A 2P2ZA 2KKZA 5EXWA 1GNRA 2ZTUA 1BTOA 2RGXA 1BXRB 1CHNA 3I6ZA 5A5EA 1HJRA 1PJTA 1U2EA 3IHTA 5KQMA 3BIXA 2C97A 1E3WB 4JL6A 4JJ6A 4MR8A 3AW9A 1N33B 2Q8QA 3VF2A 3ZDZB 1RJ9A 5JS2A 2A0UA 2RGNC 3KT6A 3PHIA 1NBWA 3L7JA 3DLBA 1NJ8A 2DJIA 3HC7A 5I01A 2VH2A 3SZGA 3HXQA 3O3FA 1EP9A 4N3AA 2CNWA 3EOAI 1CR4A 1JZQA 5DNCA 1AUQA 1MO3A 4NHOA 5LJIA 3C85A 1NBEA 4Q9LA 4BWVA 5HWSA 1CZBA 4ZO6A 4P2BA 5KAMA 3WGZA 4UTRA 4DJAA 2GYUA 3T5AA 1I6KA 4RIIA 4X1IB 5BVGA 3LY7A 2ZYIA 4U8GA 3LQFA 4DPMA 5JLJA 1EQYA 3GB9A 4Z6KA 1B41A 1KAEA 1NYQA 5AQ1A 3CPWM 4R9RA 2VGNA 1ATSA 3I8DA 1SUSA 2X7XA 2XLBA 3AXTA 1XQ6A 4M22A 4KO2S 5LD2B 3V4LA 2Y68A 1Q74A 1QS0B 1J9ZA 3N8NA 1I3MA 1TM7E 3Q3IA 4QBIA 2KI5A 5DX1A 3ALYA 3V2IA 3RRJA 1M54A 3DDZX 4NLBA 1CSEE 2HXSA 3CXCM 4M99A 4IIXA 2HU7A 4LY7A 4F1KA 1FFXB 3FPCA 5TPZA 2WWTA 1UMBB 3O75A 1P2UA 3SEAA 4DLAA 4ZIRB 2CXRA 2GUWA 2VUHB 4QIHA 1Q82O 1Y9AA 2I67A 2VP6A 3GCZA 3M5CA 2WTBA 3N07A 5EGSA 4EPVA 4LF9K 2FE4A 4ZVVA 4L27A 2WZQA 2Y77A 3PD7A 5DWDA 1JDJA 5DU2A 4Y6QA 1TJPB 1UPXA 5KSZA 1AUXA 3ITNA 1Q0RA 2H1LA 2J07A 2VXBA 3DAYA 4MCJA 4P7JA 4R05A 3IXQA 4Q66C 4EA7A 4JD2A 4JQCA 3PI6A 2P9CA 3ZXSA 2GK6A 4HPXB 2WF6A 3GMTA 1O1WA 2YOGA 3WA6A 1QWOA 3B6MA 1FMCA 3OA0A 3FB4A 2HQRA 4AB1A 4BCDA 1O95A 4EG1A 1HY3A 2H2AA 3SDSA 4CEDA 1T1EA 2C4MA 3PGLA 4JJAA 4BTLA 3ST7A 7REQA 3GBVA 2XOKD 4P86A 4RD4A 4C88A 1RFQA 4DTIA 5EXDA 1L5YA 4DKWA 1M1NA 1R8JA 1TK3A 2JIDA 2Q1UA 4U2KA 2DUWA 3P2YA 3RJ5A 4WBNA 3WDSA 1SXGA 4P7FA 3QJYA 2I1QA 3WP0A 1V3VA 3CPSA 3HZHA 4H7KA 1KGSA 2BONA 4PBTA 4I3FA 5BPFA 3RIMA 2PL1A 2WFZA 2IHZA 2NPIA 4UDYX 3V7NA 3ZC3A 2JCSA 2E2QA 4M63C 1DADA 4RDXA 3LYAA 3SDBA 4EEXA 4DR4B 4S2UA 3GFQA 3HB0A 1PWHA 2NO1A 1IY0A 3CSUA 2B7LA 4QBGB 5TF0A 1ADYA 4R79A 4EIAA 3OYNA 2BGJA 5JEDA 3DULA 3T3FA 3ML1A 1B9FA 1M7HA 2TYSB 4JJ7A 5IU6A 3A70A 1UOPA 4M3RA 2GILA 3SJBA 4BFZA 5IX8A 1FX0B 1SBNE 3I01M 4V38A 5K3FB 1NKVA 1DTQA 3OJUA 2MWMA 4KBFA 3AARA 4B9VA 1O03A 3BORA 5DGTA 3ESDA 4I5IA 2V6GA 3KD1E 1FFDA 1ICIA 2C1XA 4I1VA 2VLBA 3CF4G 4JA2A 1ORRA 3NEJA 1FUUA 1U3CA 4EITA 5KMGB 4ZCPA 1GLEG 3QYJA 4CW7B 1ECFA 3K09C 3K2QA 1FMTA 1GN9A 4KIWA 5LFAA 1F8GA 1XPRA 2WSLA 3ISVA 3C6KA 3FSGD 2EHGA 5CMLA 3VU8A 1JFTA 1ZM7A 3R9PA 4AXXA 4QVGA 1U7TA 1JDPA 4PF1A 1D3AA 1L7RA 1V5GA 3QVGA 4DFDA 1ZYUA 1YUNA 1XDGA 4WOBA 3DO6A 3OS2A 3SF8B 3BH0A 1N8TA 2VJOA 1EBBA 4FE3A 3VTKA 1J1ZA 2HDWA 4LYYA 2D8MA 1YC2A 5FUYA 5K2MA 3LMKA 2F3RA 2VDOB 2N42A 1CUBA 1JXAA 1TKAA 1CR2A 1EDEA 1JHXA 1PL6A 3QLUC 1RWPA 5IKPA 1YQTA 1SHTX 3LUAA 4MLEA 2COEA 1H05A 1HE2A 1WVIA 1V11A 1ZUHA 4MA0A 3ZLVA 1ZP6A 4PN7A 2UYTA 1BMTA 2JH8A 3LM9A 1JEDA 2A88A 3A0RB 2DBZA 2C42A 2VRBA 1KS2A 2JIZD 3A7DA 3FR7A 3L01A 4ZD6A 1OPRA 1S3SA 4ABTA 4R69A 4BNXA 1M5RA 2HJVA 2HBKA 3RSQA 4YNQA 4WZAE 3WYEA 3ZY2A 4D7AA 1JEJA 1QKIA 4XB1A 1RBSA 3W1WA 3QE2A 5L7TA 4TOIA 3QE9Y 1U11A 2ORIA 1KY3A 2FSNA 1W36D 4ANFA 3KZMA 1ZZEA 3OE4A 4MYRA 3WZLA 4D44A 2X0EA 3V8EA 4F1JA 5A4AA 1WZNA 4YHHB 2Y66A 4S2EA 4MARA 3SWWA 1FRFS 5F64A 5FNVB 3QPVA 2ZB3A 4UNPA 3R7FA 4V3CA 1I3LA 2Q6IA 4DQPA 2NQ8A 1SHKA 3W3ZB 1U1IA 1ODKA 4GT1A 5JNUA 2PVPA 3E9MA 1F7VA 3TAFA 3WYCA 3SS8A 3SC3A 3ILHA 1STOA 1AKNA 3KTDA 3E84A 3R3WA 1U47A 4V0ME 4CFCA 1XQXA 2H4YA 2YHIB 4ZTBA 1P7WA 1I3NA 3I9MA 2WU0A 4W6ZA 5EU7A 1R8XA 2HW3A 4E12A 1Y1LA 4G84A 4G0ZA 3MJHA 2I4TA 3DD5A 3KELA 3OP1A 1QH8A 4IMRA 4HLDA 4KXYA 2G04A 4GPEA 1DIGA 4YQEA 3E4CA 5K0CA 2QD4A 4I46A 1BN7A 3I62A 5JISA 4EO7A 1RACA 5IPFA 4H7HA 2I6XA 3IBGA 2GESA 5H0IA 3OD1A 3S2IA 2XXBA 5JH7B 3M8SA 4UATA 3VC7A 2YV5A 3T99A 3D8TA 1J53A 4N56A 2H3EA 1I1HA 5KKAA 4LI0A 1FLAA 1MCZA 1DX4A 1WW2A 2GZSA 4L0DA 4U7JA 3ETCA 1WKCA 4TYNA 4PZ0A 4TKVA 5SICE 4AWXA 4HWOA 4DA7A 3QLJA 2IV3A 1J6UA 1NX6A 5J23A 1T24A 2XWQA 4UTVA 5EJEA 1PEAA 4HTAA 3P4UA 3EDQA 2NYUA 1BGXT 1A4XA 1VDMA 2YL2A 3B9RA 3C6BA 3KFVA 1Z0UA 4DLRA 1MJGA 3OX4A 3VV2A 2OECA 1E6UA 9ABPA 2HW8A 3RVMA 2LUOA 2F9MA 4K81B 5D7BA 2HWYA 4WN9A 2AG5A 1OBCA 16PKA 3TNJA 1EU1A 1C0EA 2DBRA 3SM3A 3QOXA 1N9GA 4ZZ1A 2QT1A 1E4YA 3D6FA 3C5WP 1G55A 3G0HA 4U67L 1YU9A 2O8DB 1KEEB 1TLLA 1YRQA 3CNBA 1E59A 4BX8A 3DTVA 4MROA 3B1KA 4R6XA 2XWPA 2PZSA 3IBSA 3K2BA 5EP3A 1NK8A 3VEYA 3HXMA 3PX6A 1J0XO 2O05A 3NM4A 4RKWA 2G1KA 3VC3A 1NQTA 5BWMA 1NONA 2AUMA 3FSJX 3DRPA 4GX1A 4BC3A 3J7AP 4R5HA 2AMJA 4BVKA 2HHCA 2IVZA 4GGOA 4PHHA 2XSZD 4AQYB 2QD5A 2B1GA 5EG5A 3L4SO 3OOEA 3OZUA 1M34A 4QGBA 2CJXA 4BQIA 1NSFA 3UUGA 5JYDA 1YR9A 4EHLA 1TU0A 5LQNA 2WQZA 4HP8A 1YAJA 4KWIA 2WUSA 5IDVA 5CD9A 4EP5A 1BA1A 1KQOA 3THVA 2BFOA 2P7HA 4L4RA 2F4VK 2BDTA 3DVAB 3KJEA 4CIVA 3QXGA 1Z62A 2JCXA 3AT1A 3PK0A 4L4UA 1Z74A 1PUJA 4NATA 4Q4AA 5J40A 3GMDA 1KQNA 1IY9A 5KTPA 3M83A 1KK3A 2E18A 2BVNA 2GYWA 3GX1A 3O74A 2BMVA 5EQJB 2KMLA 1RPTA 1RYYA 1AUPA 2Y4NA 5C7IO 4BRHA 1VCHA 3LRTA 4LHEA 4JI4B 3GUYA 1PR6A 2W71A 4ZVRA 3FDFA 3QEMB 5FADA 3CJTA 3EMKA 5AK5A 2PRIA 4EG4A 2VF4X 2ZWMA 2I87A 3GUUA 3HU5A 4N1AA 1BOOA 2AN9A 4KX3A 1RYBA 4FD2A 4OO3A 3IMXA 3TSOA 4ARZB 4FK2A 2PRKA 1G15A 3BWVA 3VDNB 1AOXA 3A5OC 1NR5A 1UJ5A 3AO5A 1Y3FE 4BO7A 1K6JA 4LWQA 2NZUG 4TKUA 2YC4C 1AZLA 4Z9BA 4XDZA 4YHBA 3I09A 5FRDA 1GSOA 4Q12A 4W82A 3ZTWA 2A5JA 1M2VB 4DRXB 1NV8A 1ZW6A 1DIOB 1LNQA 3AG6A 1L5FA 1PS9A 4FKMA 5BRNA 3O4VA 4M42A 2HRQA 1VQNN 4J7XA 3FG9A 3OKPA 4LA4A 4NS1A 3UMRA 3VZCA 1CUXA 4I9FA 4DR5K 4Z7QB 3KD2A 3KPJA 3GLFA 2ZE5A 4URWR 1PBNA 4P80A 1J4AA 4QSMA 5FPHA 4W5NA 4KG7A 1N32K 1DRWA 2Q9CA 3VTIA 3W6UA 1KYVA 1X2EA 2VNKA 3L9WA 4BKPA 4G0QA 1PVVA 3MCTA 4FR2A 4LJKA 2ZRLA 3NKLA 3NPMA 5C2FA 2H2FA 1YBAA 4J3FA 3MMNA 1C9MA 1SVMA 5DF1A 5BSRA 3AY7A 2CLOB 2R7KA 3SICE 1O6CA 2HRCA 2OTCA 1IBSA 1CZNA 1GN8A 2WAAA 5K0JA 3QMLA 2P5TB 1T03A 3VKVA 1DIRA 1BH6A 1JKXA 1RHKA 3M3ZA 2VAVA 3V7YA 4BMYA 3R9XA 1ODJA 3MS7A 2OOSA 5T5QA 1HDIA 4DZZA 1TO1E 2BJVA 2FW7A 3JX9A 4M4SA 2FVXA 1N8KA 1ZSNA 4KLZA 1E6WA 4YJHB 1JAZA 3CW8X 1X1EA 4XJXA 5JCOA 2GCEA 1J21A 3OIGA 1DEOA 4IJAA 1AY0A 1KO4A 1NLUA 2YCLA 2X1VA 2RJ3A 4O1MA 5H3LA 4JMPA 3VOSA 5K3SA 3ZWBA 2B61A 1XCBA 4TT3D 3V4SA 4WLNA 4IEIA 2E82A 1E3LA 3WQUA 4LSNA 1H93A 2D1TA 2NSHA 3UPDA 4B1XB 4NC9A 3WNVA 4PY5A 2G8VA 2CNBA 2YW2A 1ZZGA 1HTTA 3FRIA 1P0CA 2JGIA 2F9WA 2B6NA 3BE6A 3FZMA 3PRKE 5A6SA 3FUXA 5E9WA 4MO4A 3SAFA 1FTQA 5B8HA 1X2BA 3EZ9A 4HDRB 3RSEB 5AZIA 4PQYA 5CYMA 5EIBD 2OXTA 1BHJA 3VQ6A 1KR5A 4BV2A 3FCYA 2HIAA 4Y2GA 4E4RA 1Z0IA 4N39A 5AW1A 3LFUA 1CT9A 1OF1A 1U0RA 2VQ6A 2RKBA 5JQGA 3R0IA 3CMMA 4HTFA 5HJ2A 3K92A 1JR3E 3RG8A 4RJ2A 3QEWA 2ZSIA 1GPDG 1D07A 4NPCA 3PC8A 2GVNA 1TMYA 5KTOA 1VG1A 4I5FA 4JYAK 1RW4A 4PNHA 1HZZC 4KO3S 3JVDA 3KKQA 5EN4A 3G0GA 5HFAA 2ZSKA 1KJ9A 1FU7A 2AHOA 3EDOA