4IDHA

Crystal structure of the large terminase subunit gp2 of bacterial virus sf6
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
463
structure length
451
Chain Sequence
SINPIFEPFIEAHRYKVAKGGRGSGKSWAIARLLVEAARRQPVRILCARELQNSISDSVIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGIDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTKVEMKQKLGIPSPNLADALMMCMHCPALVREETEIYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the phage Sf6 large terminase provide new insights into DNA translocation and cleavage.
pubmed doi rcsb
source organism Shigella phage sf6
molecule tags Viral protein
molecule keywords Gene 2 protein
total genus 166
structure length 451
sequence length 463
ec nomenclature
pdb deposition date 2012-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04466 Terminase_3 Phage terminase large subunit
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4idhA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4idhA01
1ZBDA 2J0UA 4HAYA 2O52A 4TYPA 3KJGA 3NHAA 1YRAA 4M53A 3DMNA 3SZRA 2AD1A 4B73A 4IFBA 2Q6TA 3EZ2A 2OCYC 3PJRA 1G7CA 3L8ZA 5AUOB 2IXEA 1XMIA 2H18A 1E2EA 2IT1A 1D6JA 1A2BA 3H2YA 3TKLA 4N1AA 1S9HA 2G0TA 5JJKA 3UWOA 4D26A 1IOZA 4BLPA 1P9WA 3GJ8A 3W6OA 1KI9A 4O25A 3BK7A 4RD4A 4Q66C 2GEDA 3NC1C 1W48A 1NVVQ 4PSKA 4Q01A 1LV7A 4J0QA 3C6AA 4RD0A 4US1R 3NG1A 4QM6A 2CLDX 2P65A 2OZEA 4LJ5A 5DGXA 4BFWA 3GLIA 2WWFA 4JVLA 1NIJA 2X1VA 2IEYA 1N5KA 3SJZA 4IFEA 5J4HA 1SVIA 2CJWA 2GZAA 2DWOA 3AP1A 5FTLA 4Q5IA 2V3CC 3FPAA 1XBTA 4M1TA 4QM7A 3OEED 2GCPA 1FNMA 5FOWA 3LWNA 3X1DA 4PFSA 5BYKA 2XSZA 1J99A 2FMXA 3THYB 2XTZA 1U8YA 1TEXA 4OI2A 2QA5A 4NP6A 2XJ4A 3FMOB 4JLNA 4JBYA 2AD5A 1YR6A 2QM8A 2V4ZA 5KNDA 4Q4JA 2PH1A 4NCHA 3U44A 4A0GA 4OQMA 2JLRA 3CF2A 1RJ9B 3TGPA 3W8RA 3NBZC 2JLQA 3QBVA 3K9NA 2BIFA 3CLVA 5H8WA 3BGWA 2D4HA 4L5BA 5HE8A 3A1UA 4A82A 2BM1A 2XTNA 4H1UA 3WMEA 1FP7A 3OEHA 2VHQA 4PTLA 3LW7A 1RJ9A 4HB4A 1EFHA 2PZEA 4NYIR 3TUIC 2DB3A 2V54A 3K53A 1LF0A 4IOKA 2XITA 1JR3D 4HATA 4G01B 3A8TA 4I4LA 4CEHA 2PEZA 3FKQA 2IF2A 4XTCS 3ZZUA 3KJIA 4HLQB 4RZ3A 1AM4D 4OI0A 3SBEA 1P5ZB 1UBGA 4QGHA 4AYWA 1N6RA 2PL3A 4G5RA 1Z0KA 4IDQA 1C1YA 4Q9HA 4TLEA 1NKSA 2W0MA 1OB2A 2YOGA 4R9UC 1U0HC 2BM0A 3KQKA 4CEHB 4KVAA 1E2DA 3T15A 4ZO4A 2XOKA 3RS5A 1OXTA 1XTJA 2VRWA 3TSWA 1A7JA 4JVMA 3WYFA 1OFIA 1NN1A 3OAAD 4B6EA 3P1JA 1Q20A 2IHYA 3KKQA 4X8LA 3ZVMA 5CJ2A 3RHFA 3DEFA 4YXWD 3B7GA 1YU9A 5FPYA 1NN0A 1TQDA 3K0EA 2CNWD 3ZD6A 2ODNA 2REBA 4PC2A 4IHQA 3K9GA 2F7SA 4IVQA 1T5LA 2ZIAA 2W58A 1OPXA 2R65A 4AK9A 5AUPB 3R9IA 1G18A 2FSGA 2UZ3A 2QBYA 4QGGA 2OLJA 5SZJA 2GCOA 4TYNA 4HAWA 1T9HA 1U99A 1J90A 1GFIA 3EAQA 2V1UA 4C3ZA 1G1MA 1I4TD 1JB1A 4Z8YA 3DVLA 3RS0A 1Q1QA 2V1XA 3GLIE 5KO2A 2ZUCA 1NG1A 3K1JA 4EQ6A 2QBYB 1Z08A 2R2AA 4BLSA 4LJYA 1XNJA 1TPZA 3E1SA 5LD2C 4YONB 3AF1A 4HUQB 1IM2A 2C9CA 1TQ2A 1U94A 1OH5A 2O8FB 1NN3A 1YKSA 1NVUQ 3VHXA 4AY2A 2NZ8A 4HEJA 1CR1A 3N2EA 1M6NA 5GJCA 3QIAA 5HKKD 1ZNZA 2HEIA 2QE7D 2WPDA 1JPJA 2CHQA 2FA9A 2XB4A 4DUGD 2ZM5A 1AKEA 2QAGA 1SHZA 4UNRA 4TMTA 1G4UR 5KSYA 2WWYA 3SYNA 3L2OB 3KUCA 2ZRFA 4MKIA 2FPMA 3CX8A 5G41A 3WYAA 4OHYA 3WXMA 4AKEA 2P2LA 1Q3TA 4F4IA 4KFTA 1E94E 3U6KA 3EPHA 3EPJA 4B2LA 3K0FA 4B74A 2KSQA 3T34A 3C14C 1JPNA 4NYMR 2O8BB 1JAIA 3WMFA 2A78A 3P27A 1AQUA 2BMEA 2C8VA 5JJLA 3A58B 4GDFA 3IBYA 4G5SA 4D0LB 2W83A 1XEWX 5GJBA 2CCJA 4PC3A 1KY3A 2ZR9A 4JJKA 2GJ9A 4QHSA 2I3BA 4DCSA 1W2HA 2PJZA 5CB8A 4AYTA 3AVOA 3GLGB 3KXLA 5B58C 1ZVQA 2WJJA 2YZ2A 2HYIC 1G6OA 1DO2A 1ZU4A 2QAGC 5GJVC 2IWHA 4TQ9A 1IBRA 1MR3F 4QJ5A 3LD9A 1PLLA 2YWFA 2NG1A 4NYJQ 3ASYA 5E3HA 4D4LA 3NKVA 2BJVA 2K5UA 4QBFA 5TY0A 2XOKD 4QJ3A 1OLOA 4FXPA 3F5FA 4MH0R 2GVDC 1RC8A 4RKEA 4R2IA 4C0SA 1LVGA 2C5LA 2YNMA 4KU4A 4B6FA 1WBBA 2DHRA 3C6HA 2BMFA 3V9PA 4H9GA 2F3TA 1MT0A 4MGIR 2FH5B 5L3SA 1Z83A 3CH4B 4TMZA 3TW4A 1JXMA 3ZVRA 1ZM3A 3SJAA 5JS7A 2ZRJA 1SVWA 2P3SA 2IS6A 1Q1EA 5JEDA 1DAEA 3QQ5A 2P6RA 1RRGA 5C2FA 5K8UA 2O5VA 2H57A 2HV8A 2KI5A 2EFHB 2BCJQ 4V0NA 4A6PA 2ZJZA 2H16A 3CPJB 3L8YA 1L4UA 4OBEA 2OSBA 3PXGA 1DE0A 3NXSA 4L8GA 3TK1A 1RKBA 4TMKA 5FUYA 1VHTA 2VQSA 3LFUA 3RYTC 2FSFA 1FP6A 4EFNA 4JKIA 2R62A 1B23P 4NDZA 1E1RD 1KIMA 1FOEB 2J9RA 4B2IA 2FN4A 1ZUIA 2AWNA 4L15A 3TVDA 1XTSA 1VCIA 3U7GA 1WCV1 5HCNA 3T06B 3MWYW 2HUPA 4XOIA 2IYYA 2GJ8A 3W3ZB 4A92A 4C0QC 2HJVA 5HZKA 721PA 2J7PD 3H84A 1XFAA 1G7SA 4LJ8A 2WIAA 3Q85A 4MDEA 4G3XA 1OV4A 1N6NA 4MRNA 1UBEA 3GPLA 1PLJA 4IKEA 4P0TA 4PPQA 1ODFA 4AWXA 1Z6XA 1KJWA 2YYZA 2BCGY 4Q7JB 5EP4A 3IO5A 4MYUA 3KB1A 3VMFA 3DM9B 1OH8A 1G20E 1ZNXA 3AVWA 4L4UA 4TTQA 1Q3HA 2HT1A 1Z8FA 5DIFA 1QHXA 3DPUA 3GMTA 5FTNA 5FTJA 1T0HB 2HLDD 5J47A 4RD3A 3PUVA 4URYR 3RWOA 1VHLA 1DVRA 1JEDA 2F43A 1CJUC 1D2EA 4JLPA 4P4SA 4QHYA 3BS4A 1BKDR 4BFZA 4D81A 1XMVA 2QP3A 2ZJAA 2ZRBA 4MKGA 3U4QA 2A30A 4Q47A 4FWTA 1ZCAA 2P5SA 2QRNA 1DADA 1NBMD 1EFUA 3CRRA 1ZAKA 1UJ2A 2CCKA 3RWMB 1F48A 4P31A 2GF9A 3CKLA 4Z54A 3VKHA 5C4GB 4Q02A 4B3DA 2F43B 1UADA 3AKEA 2KWIA 1K5GA 2B21A 3C8UA 3HPRA 5C15A 4EPTA 3THWB 2P67A 2WMOB 3UG6A 2GZHA 2W6IA 3TRFA 1GSIA 3EZ7A 1UF9A 3B9PA 3D31A 3N2IA 1OXSC 2VHUA 4XD7A 3W5JA 3UMSA 4JT2A 2QN6A 4O0MA 1E98A 1TQ6A 2VHJA 3QY0A 1K5DA 2TMKA 3THOA 4Q03A 3X1ZA 3CH5A 3QVUA 1KZ7B 2QSZA 1KOFA 2EVWX 3IHWA 5IK2A 3ICEA 4I1UA 5FBVB 3W8NA 1II9A 2AXPA 2WSMA 3P4XA 5JWHA 2WOJA 4G0NA 1F6BA 3ICQB 4ZIRA 2JIZA 5GADl 1E2PA 1NLYA 5KTYA 2EYUA 3H86A 5EQTA 1KTVA 2GBLC 4Q18A 5IRCD 2HF9A 4B76A 4AC9A 1AS0A 2YKGA 1XB2A 3QPWA 4O3MA 4FIDA 1RE0A 1IN5A 2YC2C 3GJ6A 3L0OA 2JDIA 2W6JD 3LVQE 2IEZA 5EUMA 3KXKA 3NEYA 4OK6A 4Q1FA 3GFTA 1S0UA 4D2IA 4TMXA 1YZUA 3PEYA 4RD6A 1GNQA 4PQRA 3RC3A 1PVOA 4HLDA 5L8VA 2JLSA 2JLZA 1R5OA 1GAJA 1P2VA 3AF2A 3PQCA 1CR4A 4LGMA 2ATVA 2Q21A 2BKUA 2WICA 1HE8B 3T61A 2GJSA 1E0AA 4DB4A 1CJMA 4UJ5A 4NYMQ 4U5XA 3LBNA 1L4YA 5M1PA 3WP0A 4YMUA 2XSZD 4A6XA 4ILEA 4WZ6A 2G3YA 1Z6GA 4R7ZA 4M9SA 3EIHA 5EE3A 1KZGB 3K70C 1VIAA 5EZ5A 2ZJYA 4UXJA 5EUQB 4YQFA 2C96A 1TQ4A 3M6AA 4I81A 4F4JA 2HCBA 1GKUB 1W4AA 1ELOA 1GL9B 2Z4RA 2AFHE 1UBFA 3X1XA 4MDFA 1T0JB 1AS2A 4WZBE 3PEUA 3A1SA 5CLLA 1BMFA 4EPYA 3JZAA 2GILA 2GXAA 1W7AA 1D9XA 1OJLA 2ZVPX 4KYUA 4QNMA 3WRYC 1E9FA 1S4QA 2YJTD 4CRWB 3EC1A 2ZXUA 1ONBA 4NONA 1VYTA 4TTRA 1W0KD 3DOEA 4PPFA 5FL3A 2OV2A 1HT1E 3S1AA 2IYWA 3HR8A 2QTHA 5M1OA 4GP7A 2ZU6A 1FQJA 1ZM4A 4P3YA 3T5GA 2JJ2A 5KSZA 1P9NA 1G7RA 1XCGB 3FMPB 1U8AA 3EX7C 4ZDIA 1WDTA 2L0XA 1MO4A 5M1FA 2ATXA 3LX5A 4JLOA 2RGDA 3VNVA 2ZUBA 1XX6A 3FTQA 2OXCA 4NTZA 3TVTA 2NMVA 3TLXA 4A0HA 521PA 4JLDA 3NC0C 2XZOA 4A0FA 1T8UA 1E1QA 5ANRB 3CM0A 4TYWA 2HDNB 1HURA 2Q3MA 3NHBA 4NYJR 4UNQA 2VBCA 3HYTA 4HLUA 2GEUA 4DLYA 4UNSA 5EXXA 2Q3FA 1S3GA 2W0SA 2WAYA 1X8JA 2EQBA 3MAAC 1Q44A 3BB1A 1IJEA 4DLSA 3CX6A 4KFRA 1VPLA 2V6JA 1D2MA 1C4OA 2UKDA 1MO6A 4CZ2A 3RS3A 1CR2A 2VF7A 4A2WA 2CK3A 1A5TA 3FGNA 4LCBA 3UMRA 2XEXA 4V0OA 1U2RA 4HAXA 4B32A 1NY6A 1Q12A 3WMGA 1KJZA 2VF8A 2ZTSA 4Q1AA 4MQBA 1G3IA 2ZJ8A 2C77A 2ZU0C 3QKTA 1AN0A 4ZI2A 1OKKD 2WOOA 4ZDWA 5CDFA 2NPIA 3RAPR 4KI0A 2IUTA 3A37A 4YLGA 2IYZA 2ASEA 3PIRA 1CTQA 3F0TA 4ZCIA 1SXJD 4QBHA 4TTPA 5GVSA 3JVUA 4AIIA 3C5HA 3K0AA 2AKYA 3NTUA 4RZ2A 1MRNA 1VKJA 3WBKA 1SXJB 3QKSB 4E22A 3KJEA 4EFLA 1L2TA 3KJHA 3RRNA 2EFEB 3DOFA 3ZZ0A 3QXXA 1TF5A 1ZW6A 2VP0A 2AL7A 2MSDB 2V9PA 3SHFA 4TMVA 3QKSA 2CNWA 3UMFA 3BAFA 4Q21A 1US8A 4B43A 3QKUA 4M8NE 3BJIC 3I5XA 4C0JA 5JRZA 1UM8A 1TEVA 2NO0A 4DDVA 1BH2A 1P62B 5TXGA 2D2EA 5CDFE 2BEKA 1AQYA 3U3OA 2RGXA 1OFHA 4II7A 4Z1MA 3WNCA 1A2KC 4ACAA 2WAXA 3NH9A 4RD2A 5CIWA 1E2MA 5JCZA 2QZ4A 4JS0A 1CJKC 4URXR 4US2R 1D2NA 5JJIA 1KK3A 1YZKA 2UVQA 1KK0A 3OIYA 1G3QA 1KI2A 2PT7A 2GXQA 1CEEA 4Y0AA 1GRNA 3FKSA 1XCPA 4FD2A 3MFYA 4B34A 3U6BA 2WJVA 3TMKA 4IOJA 3PFIA 5GVRA 4B33A 4F92B 1IQPA 1ZIPA 2B7CA 3IBGA 5C4MA 3QENA 5J40A 4XIGS 1ZUNB 1OH7A 4UXIA 2D06A 1E99A 4YDSA 5D3MA 1YR7A 2O0KA 1N6HA 2R6GA 1E9EA 3KKPA 3LLUA 4P4UA 5AJXA 5DI9A 5DN6A 3NBYC 2XNSA 4A0RA 5JEEA 3GP8A 2G1JA 3R7WA 3RANA 2OILA 2CL6X 1E69A 3NDBB 3SYKA 1DEKA 2OAQ1 4MA4A 5FTKA 3R8FA 2X2FA 3KQNA 2ZRPA 2CK3D 3CNLA 1A4RA 1SVMA 3KFVA 3TJZA 1QVAA 2AR7A 4CEJA 4DHEA 1IN4A 3HYRA 3R9XA 1EWQA 1XU4A 4ZDJA 1GKIA 2GWHA 2GESA 1G4AE 1Q1BA 2PZGA 4DLWA 1NLFA 2ZSDA 3N5CA 3AV0B 4JLKA 4S35A 4C2TA 1QHNA 3TW8B 4DWJA 3IIJA 1UPTA 3GLFA 4R2HA 1OHHD 2NZJA 2CVFA 3W90A 4JLVA 1Y63A 3EZ6A 5P21A 3L0IB 3L0PA 4DIDA 2QQ0A 2QMHA 4LJ6A 2FFAA 2RGAA 5AJYA 1ZD9A 4BZXA 1IXSB 4N0DA 2P6UA 3M4YA 4JL5A 4NL4H 4EQ6B 2REOA 4WXPA 4QG7A 4AKIA 3EIEA 4LV5B 1ZRHA 2DWQA 3W34A 3AKDA 3AVXA 2FFBA 2ZYTX 3K9HA 3M0EA 4GOJA 4JYCA 3SBDA 1WBDA 2IXGA 5M1QA 1QG2A 4C0LA 2O8FA 1G291 1X6VA 1CKEA 1DBSA 2BBOA 2ZS9A 2ZRGA 2J1LA 3IGFA 4I1VA 2GK6A 5EXTA 3BRWD 2JJ8A 3NVAA 4HI0E 3GLHA 1SVOA 1UEJA 1TAGA 2CHVA 2WVJA 4LDJA 2PBRA 2NO6A 1QHSA 1SHKA 4KSCA 4KFUA 2GAOA 3L82B 3N70A 2NPFA 1KAOA 1YR9A 3EARA 4JJZA 5SZIA 4C4PA 3KQUA 1N6IA 3LAWA 2OESA 1PJRA 3QF7A 2JAQA 4HDOB 2ZVQX 1NKTA 2FEOA 4MYHA 1ZCBA 4X8HA 4D4JA 4E09A 2QY9A 1DAIA 1R5NA 4PR0A 3Q5DA 3AF3A 2AK3A 1W36C 4Q9JA 4GFDA 2EFCB 4OKSA 1P4SA 2BOVA 5A0FA 2HXSA 3OE7D 3ONWA 1OFUX 2CE7A 4HAUA 4PPGA 2FPKA 2X19A 1Z0DA 1PV4A 1JQJC 2C9YA 2J7PA 2NTYC 3PV0A 1QZXA 1NJFA 1SQ5A 4Q4AB 2OG2A 3BD9A 1NL3A 2GAAA 1J8MF 3EZ9A 1E32A 4LZZA 5DN6D 5FOVA 1NRJB 3FHCB 4LRWA 3OF5A 5BN3A 3MUFA 3U61B 5ELXA 2J0QA 2H5EA 2VEDA 3A36A 3AH8A 2RGNC 1G8PA 4C9BA 1MKYA 2ZRIA 1ZMXA 4V0KA 2YHSA 4IDPA 4PZLA 2ZETA 5DLQC 1ETUA 4LY6A 1XTQA 2OFXA 3ZIAD 1IY0A 1YJ5A 4EKDA 1NBME 1CULC 2QI9C 5FPHA 4ASUD 3DKPA 2FFQA 4NZYA 1GRRA 2YWHA 3IILA 3AVTA 1H8HA 4BECA 5J4YA 2Z83A 4I1SA 2FPLA 4LPSA 3THXB 4Q7LA 1N6LA 3JVVA 4TYYA 3GJ0A 4M9QA 4Q19A 3ZQJA 3KDSE 1MABA 4LJAA 2Y8EA 1UAAA 2F1JA 2IUUA 4XVRA 2J0UB 2RMKA 3T5DA 3QPUA 1IONA 4A15A 3RRYA 4PC7A 1GNRA 5B57C 2B7BA 2ZSFA 4HZUB 3CRMA 2H8KA 1Z29A 3ECCA 4P4SB 3EZFA 1E1RA 2W6ID 4MKHA 5JWOA 2GBLA 4IEEA 2ZE8A 4LBZA 2IUSA 3K09A 1GL6A 1Q22A 3U7FB 5IT5A 4JLBA 2ZJ5A 2WJYA 1QG4A 3SOPA 4W5WA 4GRAA 4B47A 3BE4A 2QQEA 4HAVA 1WMSA 2ECKA 3CNOA 5FH9A 4PZZA 1EWRA 1DPFA 1T91A 3IEUA 4NMMA 1J2JA 1G8FA 1FL9A 2PX3A 2NOAA 3VR3A 4GNKA 4MGYR 3OFND 2WIBA 3B82A 4OHZA 5JFGA 5FOTA 3CRVA 1RIFA 1ZC3A 2WJIA 4JKYA 5HZHA 1G8YA 1Z5ZA 4CDGA 5KU1A 3EXAA 4JL8A 1AGPA 1Z07A 1ZM7A 4K81B 5AJZA 4JSTA 3VQTA 2J0VA 1FMJA 1HA3A 5KOYA 2F1IA 1KMHB 3QF4B 1SULA 3K09C 2VSXA 2HLDA 4I99A 1SVLA 1JBKA 5AJVB 4JLAA 3SYLA 1G8GA 4WBSA 1I4DD 3P20A 3TAUA 2OBLA 4DSOA 3FYHA 3T1TA 3CZPA 5DISB 1XPOA 4B3XA 1AZSC 1W4BA 4V02A 6Q21A 3LLMA 5G3ZA 2D7CA 4BFYA 1KI1A 1V5WA 4TT3D 3K0AB 2ZSEA 5E7JA 2V55B 3WP1B 1KNXA 2P0EA 4BFVA 2N46A 2ZRCA 4AYXA 1E0SA 3UK6A 2H7VA 5CYPA 1Q0UA 2QGNA 2YWEA 2ZI9A 4KXFB 4OQXA 4IRUB 3A1TA 3KL4A 3LX8A 1WB9A 3HDTA 4HLCA 1N5IA 1FX0B 4F7WA 4UKDA 1R4AA 5CK4A 2R6AA 4V0ME 1GRQA 4DKXA 1LF5A 1KI3A 2PZFA 4RD1A 1RRCA 3HJNA 4PO9A 2WKQA 1IXZA 5L3RA 1Z2CA 5JSZB 1OF1A 1I4LD 1AJEA 4MUAA 2ODEA 2NIPA 1RFLA 5C10A 5F98A 2BMJA 1KAGA 2A7QA 4Q4JB 4LBWA 5C2JB 3BORA 1DAMA 4A2PA 3OAAA 1Z3IX 5K8IA 4Q4LA 4IEIA 1PZNA 1AKYA 4QBIA 2ONKA 1P3JA 1AGRA 2X77A 3JZMA 4URUR 1E2IA 3LV8A 2QSYA 4YXWA 1XEWY 2O8DB 1TF2A 5H70A 2NQ2C 2F3RA 2ZE5A 221PA 1AIPA 2JCSA 1MOZA 1YHNA 4RFSB 1KSHA 4GMXA 1EGAA 1IN7A 2ZRKA 4OJKA 1KO8A 3RC8A 1SZPA 3M1IA 2KJQA 4IXMA 1UBCA 3RRZA 3I5YA 3KKMA 2A2ZA 3GJ5A 4JL6A 1JR3A 5BN5A 3HPQA 3VR6A 1UKZA 4JBXA 1NVVR 2GKSA 3MLEA 2ODWA 1W5TA 2LCFA 3B1WA 1GIAA 4LWZA 3QJYA 2IL1A 2E9SA 4JBWA 4XVUA 5FBWB 2IYQA 2JLUA 5EE9A 2PCJA 2W2TA 1XZQA 1YZQA 2G77B 1W36B 3B2EA 4IDNA 4AG5A 1E79D 3LVRE 2RB4A 4G5GA 2RGCA 1M74A 1ZP6A 2AKAB 4IOLA 4U02A 3V00A 4Q1BA 2VHCA 5F9HA 1CJTC 2FNAA 1GG2A 4GPTA 3DKVA 4DCNA 1Q57A 3BC1A 3ZS9A 1R0ZA 2CXXA 1NF3A 2WWHA 4WAUA 4EAQA 2GCOB 1W0KA 1ANKA 2Z0MA 4HLUC 4B3GA 4AI6A 1P7CA 2XXAA 1R0WA 4LX0A 4BFXA 4Q7MB 5EJEA 4OYHA 5IF9A 2QU8A 2ORWA 3B5JA 3WNBA 3QVVA 1CR0A 2OCAA 1E0KA 2Q9CA 1HYQA 1GM5A 1E2JA 4CEIA 3ADKA 3AM1A 3CUEF 5J4LA 3GLGA 2V6IA 4OI1A 2QGZA 2B8TA 5FTMA 1AA9A 1IN8A 4OK5A 1KI8A 1E1QD 1ZM9A 2ZI4A 1S96A 1QVRA 1X1RA 4DVGA 4C7OB 1W0JA 3P32A 2QT1A 1F2TA 2EWWA 4LYJA 4ESVA 1TU3A 3BFKA 3ZYCA 2EFDB 2F6RA 2EFGA 4B2PA 4EPRA 2V7QD 3RABA 2Z6VA 3GEIA 3GLIB 1SXJC 4W5JA 2FJUA 3QOFA 1IY1A 2XZLA 3PEWA 4DC9A 4D80A 3B6EA 2ODBA 1RRFA 5JBQA 3SQWA 3U3RA 4ACBA 3B85A 1B0UA 4A8JB 1Z6AA 2PMDA 2SHKA 1OYYA 1G5RA 4KHZA 5LD2B 2G0NA 3SE0A 3PG5A 3CR7A 3FE2A 5EP3A 1E9RA 1CS4C 2OEPA 3GJ7A 3EWSA 4PHGA 1W4RA 4BRUA 4LHVA 1CJVC 2HF8A 5DHAA 1AS3A 1XD2B 1IHUA 2QEQA 2IS2A 4JVSB 1XCMA 1Z63A 4AG6A 1KI6B 4FMDF 5AUQA 4BASA 4XD7D 1PUJA 1VECA 2WWIA 4P32A 2IYUA 2MSEB 3OHMA 1WP9A 1SXJA 4LBVA 5BN4A 4DRZA 4KLZA 4B48A 1XD2A 4HDCA 4MRSA 1COWA 3BBPA 2AWOA 2REXB 1G21E 1IN6A 3AUYA 3W5IA 1K6MA 1HUQA 4FMDB 3ND8A 3F8TA 2ORVA 3K0SA 2WWXA 2A5JA 3IQXA 4M1WA 1NMZA 3AP3A 2AX4A 4P33A 1U0JA 1N2CE 3I8SA 3OIUA 1US8B 2GA8A 4M1YA 5JZVA 1E9AA 2H92A 2ZUDA 2O8EA 4NCIA 4HZUA 4A2QA 5JMTA 1KKMA 2ZAOA 1SKYE 5DE3A 2O0HA 2ZEJA 3CB4A 4HYYA 1OHHA 1R0YA 3P26A 4QNRA 2DBYA 1BYUA 1G6HA 1YZLA 1VYVA 2ZI6A 1HQYE 4GP6A 4L9SA 4FINA 3OE7A 3ADBA 2KBEA 5FBRB 5HE9A 5AUNB 1KJYA 4LYFA 3K8YA 3GEEA 2QTVB 1ZJ6A 4GOXA 3VNUA 3MG9A 4JSYA 4ARZB 2JLYA 3GQBA 2J46A 2J0SA 3CW2A 1SGWA 4KYIB 2WSSA 4QHTA 4TSFD 5FL7A 2BVNA 2DCUA 2FOLA 3LY5A 2ZQ5A 5IDVA 4NCNA 2ZRMA 3AVUA 3AQ4A 2VTKA 4OQFA 1JALA 3NEJA 1M7BA 3H1TA 2DYKA 2HT6A 1N6KA 4HZIA 3SNHA 5SZKB 2GNOA 3BIFA 4UQOA 4PO8A 3BOSA 1EG7A 4XWAA 1W0JD 2W2VA 3EWAA 1KSFX 2CL7X 2RHDA 4DEXA 2IYLD 3C41J 2C78A 4KAXA 4MUBA 5BQ5A 4BLTA 4W9MC 2H17A 3TIFA 5CITA 1G3MA 3I4LA 4PO1A 3GLFE 2OBNA 2OBMA 2R8RA 2YWGA 2ZRHA 3EASA 1BS1A 1X1SA 4KSBA 2VP4A 5KSPA 1G16A 3CPHA 3ND9A 3W6NA 2A9KA 1ZINA 3AKYA 4PX9A 4CGZA 5F2EA 2ZJOA 4D0GA 5FOXA 2ZS7A 3GJXC 5F9FA 1TADA 2PLRA 4M2LA 1I2MA 4LV8B 2GCNA 1G5TA 3GJ3A 1N25A 5C1BA 1G19A 4S2EA 1S9DA 2WKPA 4AKGA 5AWFC 3L43A 2JIZD 1MRSA 1G7TA 3W6PA 4CIDA 4D4MA 3Q3JB 1M7HA 1G9XA 3Q7QA 2FZLA 1OB5A 3LO5A 4MGKR 3RVBA 4M1KA 5FI0B 4C0KA 1GP2A 1G5PA 2OM2A 4ON9A 4X8OA 2D7DA 2A5YB 4IVPA 5L3QB 4N0EA 4LHYA 3ETLA 2F9MA 1X8LA 4PC1A 2FX3A 2JEOA 5JHGB 4C30A 3CF0A 1YZNA 1ZNWA 4KBFA 1W44A 4RFVA 3ZQ6A 4X8MA 3U5ZB 3LW8A 3MWLA 4F4CA 1XJCA 5EP1A 2YC4C 4Q4AA 2Q0HA 3ZIAA 4F38A 2IK8A 2NO7A 3IIKA 1ZUHA 2IXFA 2CDNA 1S8FA 1SVSA 2QPOA 4LJ9A 1DARA 5E4FA 2N1BA 4ASUA 1XTKA 1ZNYA 3R20A 1G41A 5G40A 4DLRA 2IWRA 2XJ9A 5B64A 1E3MA 1QHHA 3FWYA 1ZM2A 1F2UA 2QL6A 1Z6YA 1AZTA 1NVWQ 4E03A 5TB5A 2ZYVX 1DOAA 2QUZA 2E1RA 2JLVA 1RRPA 3SDZA 4KLNA 2DFNA 2G88A 2QPTA 4UNPA 1XTIA 3GLGE 1II0A 2EWVA 3T1VA 1OIXA 1WRBA 3Q5EA 1QHHB 4KJZA 4DIEA 4OHVA 2WSSD 3KZ1E 3WRXC 5E7IA 5KDDA 2GHIA 3BFVA 1XDBA 4NCKA 4TT3A 2C99A 1K8RA 2D3WA 3EW9A 1GNPA 1T8TA 1YZGA 2RAPA 4I1OA 4TLCA 4DDTA 4B35A 3TQCA 1XPRA 2PJRA 2FWRA 2BBSA 4RJLA 4CW7A 4MITA 2PCLA 4ZCLA 4YMSA 1SKQA 3S1AB 5E95A 4BE7B 1U81A 1DO0A 5CJPA 4NPHA 3FHTA 3BB4A 3FDIA 4M22A 4RSGA 1YZTA 2VH5R 4B3BA 5EXPA 2A5FA 3SHWA 5DNYB 5KPDA 2OO7A 1QHGA 2LWIA 1R7RA 3J81k 1P2UA 1T3LA 1E2FA 1M1YE 2W2XA 2F55A 2IHBA 3GCGA 2ZJ2A 5G53C 3SJCA 4BLOA 1DTSA 1RW4A 1W4CA 2GJKA 2KB0A 4OI4A 3SS8A 1MO5A 3EC2A 1XD8A 3B60A 2B92A 4WIAA 1OXXK 2O0JA 4M9XA 4MGZR 4LK2A 5C2DA 5LB2A 3VU9B 5LDDC 3D7MA 1KDTA 3ZH9B 4HUQA 4IDOA 4YC7A 4GL2A 1BMFD 3KTAA 1W5SA 1E2NA 1Z0JA 2OCBA 2IS4A 4QGFA 2Z4SA 2QRZA 1EFCA 4H1VA 8OHMA 1JJVA 2BHRA 1BO6A 1W47A 2OAP1 4E5UA 5B2ZA 3LXRA 2IX3A 1OFTA 4B3CA 1E2KA 2DFTA 3I61A 3W3AA 4LC1A 4O2LA 3MWJA 1TNDA 1CF4A 1CU1A 2F1HA 4NE2A 4PHFA 2ZI7A 1XMJA 4OK3A 1CIPA 1TTTA 4URZR 4C7OA 4JVNA 1HH4A 1RVDA 1Z0FA 2C9OA 3OESA 3H4MA 4O2RA 1UEIA 2NO9A 1PLKA 2BDTA 3MGCA 5DSZA 2BBWA 3I73A 3QI2A 2VP2A 4LPKA 2GDJA 3DHWC 4RZUA 4B75A 1S1MA 4QGAA 2BV3A 5A4JA 4N3NA 3NBFA 4Q4HB 2DFLA 3LNCA 5FFMA 3SI7A 3A1VA 5KPJA 5B30A 2O8CB 3NDPA 3GLHE 3U44B 5BW8A 3BERA 4CF7A 5CM8B 2FEMA 2NGRA 3C15C 1KI4A 4C0AC 3GD7A 1VMAA 3PR1A 3IDQA 1FUKA 1W2GA 1XTRA 2Z43A 2J87A 4BPBA 1QDEA 1A82A 4FW9A 3RNLA 1II8A 3UWKA 1OIVA 3PCRB 4IW3B 2QM7A 2VL7A 3KQLA 2R44A 2I4IA 2VO1A 4TLAA 3Q7PA 2GTPA 1E96A 5TDHA 5AR1A 1Z22A 1AK2A 2D2FA 3P4YA 5J5CA 1P2TA 5CM9C 2QT0A 2GRJA 2KBFA 1JQLB 2GEVA 1VG1A 3O47A 1U90A 4M21A 3RSLA 2C04A 1U0LA 1R2QA 1G3RA 2E87A 1FX0A 2ZR7A 1KI7A 2ANCA 1LS6A 5FPSA 2BWJA 3RS4A 4DEYA 4XSGA 3MSXA 2ZRDA 3K70B 1KSGA 1R8SA 2CBZA 4MKFA 3TBKA 3SC3A 2JATA 2ZE7A 1GZSA 1KY2A 1DG3A 1KDRA 3CIOA 1FQKA 3FFBA 3CRQA 3KFXA 3VAAA 5DI3A 3BFXA 4YDHB 1IXRC 2HYDA 3OZXA 4QJ4A 3GJ4A 1BIFA 4KO8A 4MYCA 3L0SA 1VDZA 1OSNA 2C03A 4M1SA 5FBQB 5D3MB 2ZSAA 5LB4A 4D4KA 2LKDA 3A6PC 2B8WA 3AVYA 5AK0A 4NCJA 3U3KA 4PAQA 4DLVA 1XP8A 4RFSA 5HTKA 2MMGA 1T6NA 4GMDA 4DLZA 1EXMA 1FPMA 4OQLA 3C5CA 4POAA 4WVFA 1X8KA 4GT1A 4Z1MD 3O8CA 3ZLJA 1XMSA 3C16C 5FUVA 2JA1A 1NIPA 1VTKA 5KSOA 3FHOA 3SN6A 3EPKA 2JASA 3VX3A 4HB3A 3TSOA 4BGDA 2KE5A 4FCTA 1P73A 2PMKA 3O8DA 4LSGA 3LA6A 3OIWA 1G17A 4KV9A 3LQQA 5C12A 3EA0A 4V03A 3R8CA 3QPVA 3TR5A 1M34E 2HXYA 3MD0A 2QROA 4PSAA 4XVQA 4M0LA 2XXAB 5DO9A 2VPPA 4LBYA 4ZDKA 1QHYA 3WNDA 4PQFA 5JCPA 2ONJA 1QHIA 2JLXA 1N5LA 4LYHA 5KDLA 3R7WB 2I1QA 3TUJC 1TUIA 1JR6A 3D3QA 4KVGA 3KXIA 3NH6A 2OCPA 2W00A 2AHOA 4BEJA 1KO4A 3TH5A 2QG6A 4JLMA 4D25A 4M4SA 4PSVA 3TNFA 1NSFA 1EFRD 3FVQA 3GLHB 4IJMA 1XPUA 1SKYB 4URWR 3U7EB 2RHMA 3Q8XB 3VR5A 1ZIOA 1W36D 3T1QA 4PANA 3D6TB 2GXSA 2QMOA 1OH6A 1XEXB 1ESMA 1U9IA 2GETA 4Q1CA 1PUIA 3IEVA 4Q1DA 2QAGB 3B8HA 1VYUA 4Q9KA 2R6FA 5G3YA 1JEEA 3X2SA 3GFPA 2RGEA 3QG5A 3BH0A 3QXJA 1JAHA 3KX2A 3TAHA 5GJWC 3ASZA 3QG1A 4DZZA 1L8QA 5KUTA 4A8JC 2FSHA 1VCNA 4BLQA 2VSOA 2OFOA 2CLCX 2OE2A 4BEBA 3MRSA 2QTFA 2J5XA 4LYAA 1BOFA 4W5HA 4B71A 1RZ3A 3U60B 3UIEA 3UG7A 4LOAA 2JJ1D 1KI6A 1OW3B 5JRJA 4P4TA 2G6BA 3IPXA 4DDUA 3K0FB 1VG0B 3PENA 3Q9LA 1NLZA 2QAJA 3HU3A 2Q9BA 3T12A 5L3SB 5DHFA 2XTMA 4AKHA 2BBTA 5L3VA 4IXNA 4Q48A 2Z5FA 3WY9A 2CVHA 2PEYA 5EE0A 4ABYA 2C2HA 2WWWA 3NBXX 4NH0A 3KB2A 2BEJA 2IYSA 3MJRA 5JLJA 4EPWA 1TF7A 1IJFA 1TUEA 3ZVLA 3HR7A 1H8HD 5TMPA 4TQUS 2RKOA 1E9BA 1DG1G 2BJWA 3QXSA 5HCIA 2XAUA 4A8JA 2I1VB 4B3FX 1NJGA 3FB4A 1G8HA 1E2LA 5FUXA 5E7MA 3THXA 4C0BA 4G5QA 1FUUA 4ERNA 1D8TA 1JECA 3CWQA 5JWRA 1OE0A 4LV6A 3EPLA 121PA 2ZYWX 2G1KA 4ITRC 4KBGA 5FUWA 2V8OA 5EZ6B 1XD9A 3QNUA 1F3OA 3WBJA 2BC9A 2DY1A 4TQAA 1LFDB 2EU8A 1LY1A 2R9VA 1HE1C 4JYBA 3LH5A 4BFUA 2ZI3A 3K9LA 4DSNA 5H1YA 4WW0A 1D5CA 3PUZA 3AVVA 3V4RA 2ZRLA 2VA8A 1Q21A 1E9DA 5FOUA 2J7KA 1COWD 3A4LA 3A4MA 2B6HA 4M1MA 1HEIA 1EFRA 4CYMA 4UXHA 1H65A 5K8TA 3T1OA 1CRQA 3X1YA 4PXAA 4PC6A 2ZYUX 1Z06A 3OFNA 2CE2X 2WKRA 1GUAA 2NO1A 2PT5A 4IDHA 1R10A 3BWDD 1MABB 2QNRA 1KO7A 2ANBA 2OLKA 1FFHA 3QEOA 4R71A 1U9IC 2FGJA 3PEVA 3VKWA 1RPZA 421PA 4JLJA 3VKGA 4TL9A 3WYGA 2FSIA 3B1ZA 2C98A 2MMCA 2HJGA 2IF0A 4FMCF 3FMIA 2OHFA 2YINC 4K8OA 5CLQA 3CZQA 5EXSA 1E4YA 1N5JA 4CEJB 4BLRA 4NU0A 4FWIB 4G1UC 3THWA 3PUYA 2IYRA 4Q7KA 4L9WA 1MV5A 2WBLC 3G82C 2AN9A 1IY2A 3IKJA 2ZAMA 5A5GA 1KMHA 2EYQA 5SZHB 4Q4HA 1E0JA 4QKQA 3AVPA 2D62A 4F93B 2FV8A 3QEJA 3H0KA 1GITA 3EA5A 4LJ4A 2XNDD 1KK2A 1ZC4A 3X1WA 5JECA 1E6CA 3THYA 1T4GA 2D74A 1T3HA 1CBUA 3AP2A 4E07A 1N6PA 1P60A 4EDHA 1DELA 1T3SA 3SFZA 2GJAA 4BQSA 2BMDA 3VX4A 1P75A 5CYOA 1F2UB 1YQTA 2WM9B 1JJ7A 2GXUA 3SR0A 4F91B 3UPUA 1NBMA 3QF4A 4ZCMA 5K8LA 3MMPA 2ZREA 1FZQA 4Q00A 4BFSA 1JR3E 4MYTA 2VP6A 1RYFA 1HQCA 4W7SA 3LBIA 3T35A 1ZD8A 4NYIQ 2O8DA 3KUDA 3B78A 2FZ4A 3REGA 5FOSA 1CLUA 2X2EA 3VR4A 3RSOA 2A3RA 1GDDA 4XSHA 3RDPA 1DAKA 5D3QA 3OEEA 5FR2A 4Z51A 4K46A 5BXQC 1NI3A 1R0XA 3CNNA 1H8ED 1VG8A 3QBTA 1J7KA 4NBSA 2XB2A 2XGJA 1Q1ZA 4YMWA 4DCVA 4DJTA 3V4FA 5KYKA 5CB6A 1NY5A 2OUKA 2RGGA 1DAFA 4BRWA 2QPAA 2IA5A 4XH9B 2JGNA 1O87A 4BZQA 4DSUA 3ADCA 3ZJYA 5JSZA 2OT3B 2PLFA 2ZRNA 2QORA 1P72A 3ZVNA 3AB3A 3B13B 3I62A 3TQFA 5F3WB 4TWZA 4B44A 5J4KA 1OT3A 1F60A 2QMUA 3AKCA 1N6OA 4Y0VA 1L7VC 2OXRA 5BWMA 2ERXA 2J59A 1GILA 3I92A 3DO6A 3BH7A 3IQWA 2LKCA 1Z0IA 3F3YA 3QKRB 1VCOA 4PAOA 4PAMA 4QOSA 4LHZA 3DMDA 4FCWA 4IVRA 4DCTA 4ESHA 2ZROA 3RLFA 2XX3A 1UKEA 1WF3A 3UXMA 4RZXA 3AF4A 1TMKA 4D6PA 2IS1A 1E9CA 1P2SA 2R6CA 1ZD1A 3I32A 1Z2AA 2WV9A 4XWKA 4MRRA 3CBQA 4HB2A 1GVNB 5LPNA 1N0WA 3D8BA 4QRHA 1W1WA 4C0HA 1U8ZA 2VHTA 3O8RA 2A5DA 5HKKA 2QE7A 2WJGA 3BB3A 1DAHA 3NIBA 3QUSA 2CCGA 2FF7A 1EESA 3G5UA 5H68A 1GOTA 1OXUA 4M1OA 3CF6R 4PZYA 3ADDA 5KHOC 1V43A 4A9AA 1CP2A 4FI3C 4TMWA 4TLDA 3CPEA 1KKLA 4DSTA 2GF0A 2VP5A 1UKVY 3U3MA 2BKEA 1LW7A 3EIQA 1FNNA 3AUXA 4G5OA 2F9LA 3GFOA 2CLSA 3WHKA 4QXAA 5KDOA 4CEIB 2HCJB 2RCNA 1E79A 3LDAA 4URVR 4A36A 3DDCA 3RS2A 1F2TB 1G64A 2F1RA 2O8CA 1XXHA 3MJHA 3PUWA 4NHOA 5TARA 3GEHA 2RGBA 4NKRA 4DLXA 4OL0A 2CEAA 4KITB 4CT5A 4BFTA 3SJBA 5TV2A 1SXJE 1KNQA 3OEHD 3W9YA 1II8B 3SEAA 4HAZA 1XXHB 4KODA 2PX0A 5DYGA 1JI0A 4HDQB 5DYIA 1H8EA 2MSCB 4EPVA 1KMQA 3AF0A 3VR2A 1BYIA 3CONA 2DR3A 2FU5C 3TE6A 3REFA 4LC0A 1TX4B 1YVDA 3QE0A 3TR0A 3UATA 2UZIR 5KNBA 1LTQA 1R6BX 3ZDQA 4RCZA 4ZV4A 1JXOA 1OXVA 4QL3A 3B1YA 1QBKC 1N0UA 3DZ8A 3HWSA 4CT4B 2J3EA 3MCAA 1KSJA 4CVNA 4TZ0A 4AURA 2CJWB 1EX6A 4KFSA 2WPDD 1NN5A 3G0HA 1FTSA 2R6DA 4ZKDA 3HP1A 3CO5A 4TLBA 5HR5A 4TZ6A 2AXNA 1XZPA 2QP9X 4PQYA 5FPKA 5M04A 1FTNA 2QENA 1UKYA 1NMXA 1Z0AA 1OYWA 2IYTA 1KGDA 1XJ0A 1JNYA 5M1NA 2V7QA 3QXCA 4GOKA 4DCUA 3K70D 2ZRAA 3VFDA 4BWYA 3AGPA 3I1FA 2YV5A 2ZPTX 3IHLA 3PUXA 4L16A 1ZU5A 4WA7A 1YR8A 1XRJA 2FFHA 3FKSD 1ZYUA 2FE4A 1XF9A 3EG5A 3I3SR 4DLUA 4LUCA 4A4DA 2FDCA 4XTRA 3I8XA 1HT2E 2WZQA 3HU2A 3A4NA 3TSZA 5C46F 1KK1A 3SFVA 2JJ2D 4C2UA 3VR1A 5JHHB 4LHXA 3U3JA 2G9NA 1X3SA 2J45A 4U7DA 4R98A 2G83A 4TSFA 5FL7D 1I2DA 1OIWA 4M9ZA 5CIQA 2JJ1A 2JLWA 5EE5B 1XEFA 5EP2A 2DPXA 1KO5A 3B1XA 4PPNA 3UANA 3U2QA 1GTVA 3CWZA 2VLIA 5FPTA 1E2GA 1NP6A 2IW3A 4JIMA 1LS1A 1IAQA 1WQ1R 3VTKA 1J70A 4DT1A 3A1WA 1HV8A 2ERYA 3ZD7A 1E4VA 1DS6A 1S1CA 3K0CC 4A1FA 1KDPA 4DUGA 1GL7A 3CRW1 4ZPXA 3SU8A 3LBHA 1XWIA 3C4JA 3TUZC 5DI3B 2ORIA 3R9WA 1EX7A 3PITA 1UFQA 4LHWA 2AK2A 2RGNA 4QBGB 1XXHE 5AJWA 4RVCA 4DT1B 4YMVA 3KKOA 4FMBB 2GVZC 4HSEA 3FOZA 3GLFB 2ZANA 2ZR0A 3MWKA 2VSFA 2CMKA 2WMNB 1VG9B 4EFMA 4RY2A 2ZJBA 1DAGA 4GZMA 1R8QA 3IPYA 3QXHA 4EJSC 3RRMA 2ZSBA 4ZKEA 4GBMA 5CK5A 2Q9AA 1F5NA 3ZS8A 1EK0A 2AFIE 3SQXA 1Z6TA 4WOPA 4YMTA 1E2QA 1OKKA 3HU1A 4JZKA 4HUTA 1N3BA 4LJ7A 3K0CA 4DLTA 5IHPA 3AGQA 1S3SA 4XJXA 4TYQA 4UNNA 3DZDA 4BZPA 1A1VA 3RS7A 2DFKB 2QP4A 4DB2A 1J8YF 2GK7A 1WXQA 5JI3E 1N0VC 2P6NA 1KYIA 1LNZA 2ZI5A 3O8BA 4GZLA 4UJ3A 5C18A 1WA5A 5IK2D 1UDWA 4GSYA 4WXRA 4RCYA 1TL7C 4Q1EA 2P5TB 1S2MA 3QSYA 1R5BA 4EIWA 1QRAA 1RYHA 4V0MA 2OFWA 4EPXA 2YVUA 1QF9A 3U4QB 4ZIRB 4KCGA 4RKFA 2XZPA 1U98A 3I72A 3KQHA 1GWNA 3Q72A 4MRVA 4TN1A 2JDID 3E70C 3C7KA 3BXZA 4GI7A 1Y3AA 2ZITA 1O3YA 1XEXA 4Q9LA 2A5GA 4FMCB 1P61B 5M1KA 4U00A 1G3UA 4FN5A 4FCVA 2WWGA 2DWPA 1NG9A 2O8BA 1CXZA 5FI1B 4V0LA 4D82A 821PA 3FFAA 5L3QA 1X86B 4EUNA 1WE2A 1EFTA 1TU4A 4JT4A 5TVKA 1P6XA 2GZDA 1XJQA 3FMFA 4OQNA 4TL7A 5LBIA 3LXXA 4BUJA 4OHWA 2IYXA 1E9SA 3E2IA 4AD8A 2VP9A 3NWJA 4DBLC 3AEZA 3U7HB 4PHTA 2X8AA 3LQRA 4XWOA 5J4VA 3ZGXA 2YOFA 5HPYB 2VIIA 4JMPA 4QC2A 4OJQA 1MH1A 1E2HA 2ZE6A 1NVXQ 4QFMA 4PHHA 1M7GA 2Q3HA 2ZS8A 3CX7A 4WZAE 2J41A 4Z8XA 2WHXA 3IO3A 2N42A 3IIMA 3LRPA 5DH9A 3CR8A 5FR1A 1T5IA 1HY3A 2FGKA 5BYJA 2WTUA 1UDXA 4LI0A 3OIVA 2WJHA 3QKRA 4D0NA 1M8PA 1CRPA 4US0R 2YOHA 5EE1A 4TL6A 5FBLB 1P9RA 3BH6A 2IBMA 4HB0A 4OHXA 3DM5A 1MO3A 4EJSA 1NSTA 3UKDA 1VCMA 2VYFA 1D9ZA 3AVQA 2FG5A 1Z28A 1YE8A 1KO1A 2CHGA 5JS8A 2W6JA 3E5HA 1W46A 3B9QA 1KDOA 1NMYA 2O8EB 2CL0X 3KKNA 5UKDA 1HTWA 3PVSA 4EJSB 1Z47A 4DXAA 621PA 3ZZTA 1FMLA 2EW1A 1LB1B 2IYVA 3DL0A 3B1VA 2IC5A 3VU9A 5KNCA 1SVKA 1KHTA 1YRBA 2QMEA 1FW6A 2XNDA 1ESNA 3WHLA 4ZI3A 4IOMA 2H1LA 1GKYA 4TL8A 2C95A 3KTAB 5JI2E 3IUYA 4DDWA 1VIYA 2RH5A 1M2OB 1C9KA 1W49A 4ARZA 4Q9IA 3VHLB 1NNEA 4MRPA
chains in the Genus database with same CATH superfamily
4HAYA 4R3WA 2O52A 3C1TA 4FWLA 1V1RB 1ZN2A 1Z4IA 1S5JA 2IY8A 2QRKA 3KJGA 1T0IA 1RT1A 1UP6A 3MNFA 3PKIA 4DCCA 4DQKA 2OK8A 3Q2OA 1TYQA 2AD1A 4GWGA 3SZRA 1BWFO 3UJHA 4IFBA 3D6RA 2ETXA 2OZLA 1RPNA 5DX8A 3RVSA 3UKJA 2OAGA 3PJRA 4ARSA 3L8ZA 3KWJA 4XCXA 2C9BA 4YT4A 1U6ZA 3EZGA 3KYCB 3OJCA 1JT9A 2XXJA 3WGLA 1X7HA 2MYUA 3QFFA 3GROA 4N1AA 4NYNA 1BMTA 3UWOA 2RB5A 3RD5A 3A05A 3A1NA 5TQ0B 3VBCA 2DBZA 1KOJA 3ZT4A 4WEQA 3PCXA 4AQDA 3ZE6A 4NF2A 1LLCA 3D9QX 3HZRA 5D7BA 1H3NA 4O25A 2HZBA 5GGXA 5DASA 1W48A 4LJKA 3QOYA 3OVNA 3ZX3A 1PJSA 4FW2A 1JEJA 2FDRA 3L1IA 4J0QA 3HUUA 2YV3A 4RD0A 3OW2M 4LE2A 5K6AC 5ICMA 3NGMA 5DGXA 4JKGA 3AJ9A 1WMEA 2ZWHA 2CXQA 1QUFA 1NIJA 2WWFA 2BE2A 3O4FA 4O59O 3WGJA 2IEYA 1GAXA 4G5FA 4IFEA 3TIVA 1UFKA 2CJWA 1QCYA 1KYZA 1XBTA 4M1TA 2NU7A 2P35A 3DUFA 1QAOA 4MIYA 2XZDA 3PS9A 2GCPA 1FNMA 4MLCA 3LWNA 2Q1WA 5FOWA 2A67A 4F5DA 4H6PA 5KNBH 1I3AA 3FMGA 2H9AA 2R8YA 3QBEA 3K0KA 4CR6A 1PEDA 5TPZD 1M75A 1TEXA 4WQ5C 2P9KB 1TLTA 4WK0B 4Y6QA 4NP6A 3DR5A 3JCZA 2EW2A 5IVKA 4JLNA 4UBIA 1YR6A 2LW7A 2V4ZA 2H1CA 2VJLA 3CF5L 5DF1A 4KR9A 3T41A 4AZ0B 3O1BA 3QX7A 4NCHA 4IYJA 4O08A 2XYVA 1NRXA 4BE1A 2JLRA 4OQMA 5MN4A 1ZLXA 2I3GA 7ABPA 1JW9B 2JLQA 3BXGA 3QBVA 1SD5A 1A9PA 4JENA 5JNTA 1MEOA 4B5LA 3BGWA 3G2OA 3PR2B 2YJ6A 3TLEA 2XQIA 3S3MA 2NADA 3GVHA 2FP4A 3PXDA 1IQUA 4BNUA 1YUWA 1FSPA 1RJWA 4IFVA 2WU0A 2VHQA 1LNQA 4UFPA 1JLHA 2G28A 4LISA 4CBUA 1U65A 3U7GA 5T8KC 2G72A 5HOOA 1R12A 3TUIC 1URPA 3DOIA 3U19A 4LVNA 1LF0A 4GVXA 3PHBE 4IOKA 3E9YA 1JR3D 2BY4A 4J49A 4EK9A 1FFGA 4G01B 3RC9A 1PSDA 3T3IA 3A8TA 1DKPA 5T4HA 2IF2A 2D8AA 3HR4A 3KJIA 3W4JA 3NCHA 1ZONA 4XSVA 5FQNA 4NBKA 3ZGYA 3LCUA 4U1RA 2ON6A 1VQ4N 1IL0A 1KFCB 3HYFA 1TTQB 3B48A 4QGHA 1N6RA 3MUOA 3ZHXA 4A1OA 4E4TA 4RA6A 4G5RA 1AQLA 5JARA 1Z0KA 2J3LA 3OCVA 2R4TA 2QTGA 1L3TA 4RLFA 4R9NA 2LCQA 4EYEA 1YT3A 5LMUK 4AL4A 4BLUA 2HBLA 1OB2A 4OQPA 3O7WA 1E1DA 1JTVA 2MINB 4M1ZA 4XJTA 2KM1A 2XOKA 4NLCA 1IFXA 1RCHA 4JEPA 2JKZA 2F4NA 2VRWA 4R1NA 3RS5A 5BMOA 1LTHR 2NLOA 2QIOA 2Z58A 3VC2A 1W76A 1NN1A 1PBNA 3O90A 5GOTA 4DTMA 5H80A 2XQJA 4B9VA 2ZBUA 1T5BA 3FF1A 1YGPA 4YT2A 2OPPA 3QLVC 1T13A 3D4OA 3B7GA 3KAKA 4RK4A 5FPYA 3RFCA 3ZI7A 5JAHA 2WT9A 3PQFA 2ZUSA 3D2LA 3SUPA 3K0EA 4GI3A 3M8KA 1PIWA 1ZSNA 4M49A 4RC9A 4AO6A 2X76A 3K31A 3ZD6A 3UFBA 2VRBA 3K9GA 3QV2A 1QWSA 4A27A 4WI1A 1T5LA 5I7AA 1OD6A 2CDRA 3L0QA 1IQRA 1WPXA 2R65A 3OPYB 1HNNA 3V4OA 5AUPB 1Z5PA 2V97A 2FSGA 4DCMA 2QBYA 2BFPA 4FWRA 1BGXT 1UJBA 3FSRA 3RIEA 4ZHQA 1OAKA 1JIQA 3UGJA 4DV5B 1S7GA 2J6BA 1J42A 3OF3A 4H5VA 1T9HA 4HAWA 2GKGA 4RBNA 4TYNA 3T6KA 5KVSA 4M3WA 2R0QC 1ZCZA 3UK0A 4KHWA 1ODLA 5JJBA 4QS9A 4I4TF 1SURA 3KSDO 1ZGZA 1Q1QA 3SY8A 3H0CA 3K1JA 3R5FA 2LDBA 2QBYB 1Z08A 4LF9B 4CL3A 3E22B 5EIBC 5GAJA 3UJPA 4O2AA 4BRDA 2KZZA 4KMOA 2FSUA 5LD2C 4YONB 4JS5A 2AOTB 3QNOA 1IM2A 2IXBA 4HQ0A 4Y2HA 3SZMA 3VR2D 3WLHA 4C88A 5A3JA 5CFZA 1NVUQ 4Y1CA 1T9GR 2H9IA 1N2IA 3CLHA 3CUWA 3ISJA 4UDOA 4CM9A 4F46A 3AL0C 5GJCA 1WW2A 4MWCA 1ZNZA 3H7AA 2QRVB 2WPDA 3D02A 1JPJA 4TRMA 5LP6C 4BVKA 5KNBD 4EUSA 2QAGA 4B80A 5DXFA 1SHZA 5KSYA 2VVTA 1G4UR 1ISRA 1SBHA 3KLOA 4MQFA 1R9GA 2FE1A 3L2OB 1K06A 3M8SA 3UFXB 4E30A 3C3BA 4NG5A 2P62A 1IY8A 4J0JA 2WTAA 3CX8A 3EQZA 4IDKA 4PN3A 1LEHA 1G98A 2WDPA 1W30A 4F06A 1NC3A 3CVJA 4P0QB 3HFJA 1GSOA 3KLMX 3WR5A 3UGTA 2EZUA 2EP5A 1CDEA 3PJEA 5DYWA 3EPJA 4B2LA 3U6FA 3FOFC 2RKBA 5EVJA 4FLXA 2HA3A 1Q0ZA 1JPNA 2KSQA 4MQFB 4M8KA 3T34A 1U4SA 1JAIA 2IZZA 2P6PA 1R64A 2WUVA 1AQUA 3P27A 2BMEA 2C8VA 2W8BB 4FK8A 3UMBA 4XM1A 5JJLA 1SCIA 3EJ6A 2MSKA 3IBYA 3LY9A 3QM1A 2W83A 3TEMA 2HWUA 4JD5A 4A2AA 5E2AA 2WC9A 1L7EA 1NJSA 3ZGVA 2I3BA 1W2HA 1NJ8A 3QPDA 5CB8A 4EVRA 3CC7N 2XHZA 2ZUVA 3KXLA 5CU7A 4WXHA 5B58C 3LDNA 5AP9A 1NBHA 1Z4MA 2YZ2A 1EVYA 1OX4A 1DO2A 1ZU4A 4R2MA 5AVOA 3HO8A 4ZGGA 3HSCA 2HW8A 3O0TA 4TQ9A 1AVTA 3HEAA 3V81A 4MVJP 1LXCA 1VKRA 2G4LA 2NG1A 2YWFA 3O82A 5LQCA 1GFWA 1YH3A 4D4LA 3NKVA 2NLXA 4B1UB 1MDUB 4ZOLB 2CNOA 3NHPA 5F7ZA 5H3CA 2W5UA 4CQMB 3B3JA 4FXPA 2FHPA 5C7OO 1E66A 3GRYA 4MH0R 2AG0A 2ZYSA 4UMFA 1TKRA 1NYLA 1LVGA 3LUBA 4KU4A 3VVMA 1U49A 1GOBA 1BW9A 3TFWA 3C6HA 1JHRA 2BMFA 2VR1A 2YIVX 3WLIA 3W5CA 1RTKA 3D81A 1MT0A 4MGIR 1GSHA 4BE4A 2AJQA 4FO0A 5DM70 3CH4B 1U2QA 1JR4A 2Q2OA 5BYBA 3TW4A 3ZVRA 1T0UA 3SJAA 2ZRJA 1B2RA 1SVWA 3C3YA 4E19A 4X84A 2IS6A 1S2DA 5JEDA 2QX7A 3LHDA 2I6XA 2O07A 2DUNA 1LBTA 2VDPB 5EFZA 4WBNB 5G0TA 4QAJA 1SFRA 1R15A 1FUYB 1RLIA 1RRGA 2WFAA 1K66A 5E3JA 3RIMA 2HV8A 3F4KA 3LCVB 4XEIA 5KHLB 4COKA 4TV8A 2NQTA 5FNVF 1C9MA 4AFNA 2ZJPL 2AYXA 4HQFA 5KWJA 3PXGA 3AF6A 1YZ3A 1PS9A 1W6RA 2A88A 3NXSA 4F56A 1X1CA 3FM9A 4KDFA 1WG8A 4BATA 4XFJA 5HX7A 2PFGA 3RAEC 1FP6A 2R62A 4JELA 4NDZA 3FNGA 4H7IA 5CEEA 2J9RA 4B2IA 2WU1A 1GLEG 3MTBA 4LG1A 2NUPA 1XF1A 1ZUIA 3AL3A 3M1AA 1K89A 2BTQB 1HSZA 3PQ2A 4LC9A 4KIUA 4MV6A 1O8CA 1JFFA 4J2DA 4KE7A 4LXHA 2HUPA 1GRCA 4XOIA 3F9MA 3TTFA 3GFVA 5C8YA 4C0QC 3LHKA 2B37A 4YP1A 4JFAA 3ROEA 3ROTA 721PA 5HZKA 1E89A 1HR0B 3H84A 1XFAA 4LJ8A 3AZOA 1NK7A 4MRMB 3JU3A 2ZBRA 1EM8B 1N6NA 4OFWA 2H11A 4FGKA 3W0LA 4GECA 2YHBA 3GPLA 3LYAA 1PLJA 2NZXA 4G0PA 4P0TA 4TGLA 1G9TA 1ODFA 2G8LA 4GQAA 4ITVA 1KJWA 3GVCA 4MYUA 1QQAA 3O2JA 1SOMA 2IIBA 4DLNA 4BWGA 4HUJA 3CCEN 2QQ5A 1A5SB 1G20E 1PV1A 4NFYA 4IHKA 1EM8A 1E4OA 3UOAB 2HT1A 3W0LB 1N6QA 3NF6A 4CF9A 1MENA 1E3LA 1BI4A 1QHXA 3V80A 4MS1A 5KKCA 5MDHA 4ZAYA 4CKWA 5FTNA 2QD3A 1DKGD 5J47A 3CCSN 2C2MA 1W73A 1XCBA 2GBCA 2ZSUA 3GNSA 4GYJA 4J0FA 2J07A 3SNKA 5KYGA 1V4BA 1ISJA 4EP4A 4OY3A 4I6MB 4XKJA 3V4VB 1CJUC 3QELA 4FBGA 3EY9A 4JLPA 1UWLA 1N2CA 5AO9A 4BFZA 3HFRA 3OZFA 2BISA 2YX1A 2D5LA 4IHAA 4MKGA 5FBZA 5FWXA 1Q1NA 4O6VA 4Q47A 1ZCAA 1YR1A 2E6UX 2QRNA 3AUKA 4NABA 5IC4A 3AHIA 3G5TA 2I4RA 3NONA 3T1HB 4B08A 4JEHA 1K7XB 2EJBA 3RWMB 3ENNA 4Z54A 4P31A 3Q9NA 3ENWA 3A4VA 3H1FA 4CCHA 4B3DA 3LQYA 4RM2A 2FETA 3C70A 4ZV7A 5B7GA 2B21A 1MXHA 5MHTA 5C15A 4JJ4A 4EPTA 3THWB 3QUBA 2WMOB 4OSEA 3UG6A 3TRFA 1HMVA 1DTWB 1OYVA 1MJFA 4FBMA 2R87A 1X2BA 4BU0A 4IJUA 2IDOA 3IUSA 5TSDA 1P29A 4AF1A 4C76A 3ZJTA 1TQ6A 2HR1A 1TFRA 3C3PA 4YJGB 3FNBA 2P2CA 4J6FA 2TMKA 3CUYA 1RQ2A 3QVUA 4M0CA 4EG8A 4FGWA 1XRQA 2FFJA 3TAFA 4I3GA 4KQ1A 4HR7A 3BMCA 3J7TA 4O5AA 2EVWX 2D0BA 3IHWA 5IK2A 4W1RA 3SF8A 2EWSA 3U56A 5KYWA 1IH8A 3BDPA 5EIXA 1LDMA 5FBVB 3W8NA 1II9A 5AQYA 1LPOA 2PSFA 4QOZB 2WSMA 3GFSA 4J8PA 5LR6A 1S6PA 2IOCA 4KB1A 1F6BA 2A8YA 4S12A 3UB2A 1RAFA 1E2PA 1WVMA 4BQPA 2EYUA 4RZIA 5CFRA 5JMOA 3DV9A 3KWFA 2F9WA 1ZEJA 3OTIA 1KTVA 1BEZA 5DT9A 2C3YA 4BQQA 3W05A 2HF9A 4FR2A 5ADWA 3K2EA 1BA0A 1SUCA 2WUDA 4KREA 1T8YA 1S5PA 1XB2A 1RAIA 4FIDA 4OFZA 4BCBA 5EKDA 1U7HA 4P80A 1EDOA 4IG3A 3E3AA 2W6JD 1A95A 5C0YA 3UW3A 4ZYLA 3LBFA 4OK6A 4CZEA 1KL7A 4D2IA 4TMXA 5HNKA 4RD6A 5L7WA 2GAIA 4PQRA 4FZZA 1PFGA 4H4EA 1T36A 3EUFA 2JLSA 4L0MA 5DULA 1F2VA 1PF7E 3LUDA 5AXAA 2JLZA 1GLNA 4L5JA 4D3SA 3NF9A 3HUFA 1W4ZA 3OJFA 2J4RA 1FP4B 1WTCA 3ESAA 2ATVA 2UXDK 3ORYA 4RF4A 4TKUB 1ZLYA 4E89A 3GUZA 2BKUA 4NJEB 4QDTA 1FRZA 2PLNA 1DRKA 1HE8B 1APBA 1GN8A 2GJSA 2ID9A 3TZKA 1E0AA 1TD1A 4FHEA 4UCXA 4MO5A 2QTLA 1QPZA 1O95C 2AG8A 2AYZA 3HGTA 3PC8A 2H4JA 2HDWA 4YQYA 1W34A 3G8CA 2P9FA 4A6XA 1CB0A 4OM8A 5ALGA 4DZTA 2G3YA 4GZ6A 4U7GA 1Z6GA 3KDPA 1WSHA 4G26A 1JJAA 3VR5H 5JD4A 3QVGB 2KFNA 3CCQN 3VYWA 5IKOA 1E7YA 3FPFA 4IJ6A 1NW9B 1J09A 3VZBA 5K8JB 2Q0RA 1EDDA 1SCKA 2C96A 4I81A 4WLNA 5BNFA 3X44A 4RK5A 4O1MA 3ZNNA 4DUZK 1H5UA 2OZPA 2L17A 3FH0A 2Z4RA 1Q0RA 3HEBA 4LZWA 1WB5A 3X1XA 3R8FA 1YXMA 4CNBA 3KCNA 3A9CA 4UTVA 2E2QA 4QDKA 4EPYA 3JZAA 5LQSA 1VQLN 2GILA 5TRTA 3G0IA 2GXAA 4OHCA 4E33A 4FI3F 3VQAA 1LD3A 2YJTD 3PDIA 2H63A 1J24A 4FJHA 4GOND 3MJFA 5CX1B 2H1HA 1EXDA 3L01A 1DJOA 4OEHA 4PWYA 4MCAA 3VPSA 5CT5A 3Q6MA 1SUFA 2VQFK 3KWLA 4GP7A 4DQVA 2FWJA 5KX5F 2P3OA 1VLLA 3HDHA 4L3VA 4PL7A 1XCGB 5KSZA 4RLSA 1U9ZA 3LI2A 3GLTA 4PYJA 3PVCA 2O5EA 4JI0B 5IBQA 1MO4A 3OU6A 1BC5A 3M9LA 5IWCA 2HCFA 4KQGA 1IOVA 3NOXA 4H5TA 1LDGA 3TVTA 3K1YA 3FZLA 2M6LA 2YHUA 521PA 4A0HA 5DCYA 5HF5A 4CR8A 4X7BA 4LH5A 5AQLA 1T8UA 3O4NA 4MA0A 2PQ6A 5DM2A 1EB9A 1SAZA 1M73E 3DBHB 1HURA 1K8ZB 2CGJA 4NYJR 1EBFA 4UNQA 2BE7A 4B85A 4BMNA 4EH1A 4KQEA 3FTEA 1U7OA 2RK6A 2JBAA 1TVCA 2EWMA 1JL1A 1S3GA 3BGRA 2Q3FA 2W0SA 3I23A 1X8JA 1QQNA 2B78A 2XIJA 1NP7A 1Q44A 2R1VA 5GADP 3BB1A 3C43A 3H2HA 3PI6A 3QP9A 4TUYB 3ZI4A 1IJEA 4I4IA 5HBMA 3C7TA 2XCIA 3LVFO 4FSHA 4HNAA 1D2MA 1D6MA 2OTJN 3J7AC 3IEMA 4FJGA 3VTFA 2VF7A 3BZWA 3CSDA 1A5TA 3FGNA 2H8GA 3MQ2A 2KMLA 4V0OA 4HAXA 4JHXA 3TXYA 1FK9A 3L3UA 1W52X 2CD9A 1NY6A 1Q12A 1YQXA 3INTA 3FLCO 3O8OB 2VF8A 3OMLA 2CKDA 3QLEA 3WNZA 4ZYXA 5JXGA 1M5RA 4TTIA 3BMQA 4NMWA 5AQZA 2L18A 4NOJA 4TWBA 1CJSA 4FM0A 2A9QA 2QTMA 5T3YA 1N8KA 1QIJA 3I9JA 5GP1A 2W7TA 5ALRA 2A3ZA 4J1SA 3TM5A 4P5DA 2IUTA 3ETNA 4UHJA 5EJ6A 2GUWA 2CH5A 4KIFA 2X14A 4X66B 1CTQA 3CNBA 2OGSA 3OYGA 3HBAA 4UZFA 4YRGA 3PA6A 4ZCIA 5ICSA 2PX8A 3R7LA 2B4QA 2GPJA 1Y5NA 3PC8C 1IKWA 3RF6A 4D45A 1CRZA 2D1TA 3JVDA 4M60A 4RZ2A 3S2GA 4BC5A 5BR8K 1MRNA 2QSUA 3S41A 1IWPB 1JDPA 5I9SA 1UBSB 3KJEA 5JC8A 3KJHA 3P83D 2EIXA 2HFJA 3RRNA 1TUUA 2ADOA 3NBKA 2VCHA 3WG9A 2MR6A 3PICA 2B35A 2V6BA 4D9FA 3AAQA 3C65A 3ZZ0A 1GYRA 1QFXA 2FMUA 3CISA 5E0OA 3OYLA 2OSVA 4NCAA 1VSIA 1CJBA 2SECE 3ET4A 1DUIA 3PZBA 2TECE 4I5GA 4YGYA 5DOVA 3H65A 5HFAA 3S2ZA 1EB8A 4Q21A 9GPBA 1DFGA 1US8A 3AU9A 4LN1A 2QT9A 1MMFB 3EZXA 4HEHA 2IKSA 4JMLA 4RVUA 4C0JA 4DDVA 3SCXA 1YL6A 1BH2A 4X6YA 3HUTA 5HL7L 1AQYA 3NHKA 3U3OA 3P19A 4II7A 3CNEA 2ZK7A 1A2KC 2PYJA 2WAXA 1JCEA 1OZFA 2H0RA 2RGYA 3OYEA 3NH9A 1U0OC 2YZ7A 1V26A 1JSCA 5K3DA 1D2NA 1R9MA 1KK3A 4FFDA 1C1XB 4U63A 4A2WA 1JBEA 4JBIA 4MKRA 4BNLA 1FJXA 3ZV7A 3DW3X 5BR7A 1NZDA 1GRNA 4FD2A 4UDXX 4CMEC 3U6BA 2WJVA 4AB1A 2V3WA 3OZSA 4TXLA 1XI1A 1WHTA 3DOHA 3KWGA 4HFMA 1JFTA 3LKVA 1ZIPA 3FCOA 1HQUA 4A57A 1G55A 1TB4A 2OBYA 3QENA 1V47A 1UBUS 4XIGS 1ZUNB 1T25A 1Y81A 5J40A 1XTZA 4DPKA 1Y80A 4CM9D 2D06A 4DV0K 1ASWA 1E99A 4RLQA 3LHSA 4HRAA 5F7OA 4URFA 1YR7A 2O0KA 2PFUA 1N6HA 1C7FA 3LLUA 4JI3K 4G89A 5AJXA 2BFWA 4FLEA 3VYUB 5CXUA 2C3PA 2V5UA 2ONZA 1ENOA 4A0RA 4DMRA 3GP8A 2NXJA 1OWLA 2IPLA 2OILA 2YQZA 3NHRA 3WB1A 3DQQA 3PQ4A 3QU4A 4QXRA 4YRNA 1L7RA 2WSLA 1TAQA 4FOLA 4BQEA 1QS4A 1E7WA 1W25A 1BJTA 2R5WA 1A5XA 3A1EA 2DJIA 1OASA 4RTRA 3V1OA 2CK3D 3C6XA 1SVMA 3V6DA 1XDUA 3OYNA 1Y89A 3TJZA 1KOGA 3FWKA 1R37A 4ALLA 4CEJA 1IN4A 4PCAA 3WDSA 4A59A 1EWQA 4B9NA 2UYQA 2R8ZA 1DUVG 3BEOA 4G8CA 4JP3A 4MSUA 2W6KA 1U7UA 5DNWA 1G4AE 2H2WA 2ZATA 3PXCX 3ZDFA 3KJXA 3WKAA 1QH1B 2ZSDA 3N5CA 4ELTA 3H83A 4S35A 1QU3A 4R2HA 3F6PA 2E6KA 1T1EA 3KPVA 3DE3X 5EXEA 4F5ZA 1IN1A 1ZA1A 5CZ1A 1Y63A 4E12A 1N34B 4G0UA 2DP4E 3HRHA 1SC1A 2I80A 5TS3A 1E7QA 1XYGA 3GRFA 3I2HA 3L0PA 4N3AA 5FPQA 3RVOA 5LZ9A 4JYAB 1QZ6A 2PGJA 2ZSIA 3L7OA 3N2ZB 4J29A 1WZEA 1QH1A 2W8BA 1M67A 5IPFA 3P0IA 4OMDA 2NW6A 4N0DA 4WJKB 5AJYA 4IZ6A 3SQMA 5FDLA 5EHXA 5GIPE 2XDQB 4JL5A 4OM7A 1JHAA 3DP7A 2HHVA 3QE3A 4H7JA 1H4TA 4BOYA 2WD7A 5BP7A 4AKIA 1P5FA 1NKEA 3JXEA 1ZHFA 2WLSA 3L6EA 3R5SA 5FCDA 5KQSA 2G09A 2ONCA 2ZYTX 3C2QA 3F71A 2AQ8A 4JYCA 4OF4A 3SBDA 3K9KA 1C3EA 1S8OA 3L6CA 4LTDA 3G2JA 4M0FA 2C7GA 1K3FA 1U02A 3DB2A 4CKEA 1N32B 2GGSA 2PD4A 4WZAB 3ZE0B 4RX1A 4BO0A 2OXIA 4ZEVA 1FSZA 3D6UA 4PCVA 2GK6A 4D02A 4JI4B 5LZ7A 1B8UA 1DIAA 2NX2A 4TX1A 1XDGA 1UEJA 3O2NA 2CHVA 2WVJA 2PBRA 3TD9A 3PFCA 1QRSA 1SHKA 1Q15A 1VGQA 4R1SA 3PNLA 5BSEA 1D09A 1OI4A 3D4NA 2BF4A 2FR0A 4JJZA 4JXXA 3JYPA 2N47A 2OK7A 4L75A 3S3TA 1C8KA 4DBLE 1CEYA 1V6AA 3PKZA 4M41A 4EFHA 4UW9A 5AH0A 1GEEA 1KYTA 5CVVA 3I04M 1U3GA 1USIA 3EW7A 2FEOA 4ROTA 3W2TA 4D4JA 1SUEA 1Z74A 1NAIA 2QKYA 1ULUA 3Q5DA 3K71B 4BNWA 2GD2A 2Z2JA 1A3CA 2HD4A 2VLBA 1RJDA 2Q45A 1PVVA 4XPZA 5K45A 1VGVA 1E4GT 3I34X 1BQEA 1LGYA 3MCAB 1P4SA 2BOVA 2CXRA 2YWCA 4O63O 1DT9A 3UMGA 1NBAA 2Y1EA 3ONWA 3QVJA 2FPKA 1SBYA 3VSCA 5ALZA 4L0DA 5DVZA 1PEAA 1AKNA 1PN3A 3T7CA 3K9QO 3L0ZA 2OG2A 5C80A 1CF9A 3LQ2A 4HDKB 1E32A 5FOVA 1X9HA 6ADHA 3CI5A 1NQOA 4EARA 1NRJB 1U80A 4AM6A 3FHCB 3OF5A 4H4DA 3ITDA 4LRWA 4K6OA 2NU9B 4CCYB 1V8FA 1CIVA 2G0AA 3MUFA 1K8KA 1VRTA 2VEDA 3NU1A 4LC9B 5AVWA 2YWRA 4BBZA 2HSGA 4DJDC 1N2EA 2OV8A 4PZLA 2ZETA 2Q2RA 5BT9A 1GJRA 1XTQA 5JSKA 2UXBK 3QV1A 1R88A 4R0MA 2ILVA 4HADA 5TQVA 2IQIA 5T3UA 3NMUA 5TPZA 3BXFA 3IOMA 2ZJ3A 4ETNA 1J9EA 1FFEA 1SCDA 3PD0A 1DXQA 5FPHA 4DR1B 5GQSA 1NGJA 4OUKX 1GRRA 4NSNA 1UDRA 3QE2A 4X95A 2VBFA 2EKQA 5JH7B 4LZAA 4BAUA 4EENA 2G5CA 2Z83A 2FPLA 4XWYA 2H2HA 2QW8A 3V7YA 4F12A 2BSQA 2HU7A 3JVVA 5K3AA 1XC9A 3PHHA 4A62A 1IKYA 1IBLK 3RE1A 5F33A 4FSVA 4M9QA 3ZQJA 5B2FA 3TQTA 2CVZA 1MABA 2PKWA 3H45C 1TJYA 4BV2A 3DM2A 1KJJA 1UZAA 2GSDA 3H1AA 2I6UA 3JQEA 4QG3A 4CKZA 2P6MA 2J0UB 2PMCA 2RMKA 2PLWA 3AUUA 1V25A 3NAGA 3QPUA 5EQJB 1JCFA 5IS2A 2CV1A 4KR0A 4AO8A 4Q12A 1CLQA 3PIIA 5B57C 1FY2A 2YS6A 2EF1A 2F1KA 1L7NA 3CRMA 1SIOA 3MK31 1BN6A 5A0VA 2BFMA 1QX4A 2AZMA 4A16A 1M83A 3MPOA 2CGKA 1RP1A 1Y9AA 3NWPA 3OSZA 4HH1A 4NZMA 4ARIA 2KLBA 2XD9A 1FMCA 2W6ID 4CFCA 2HMIA 1U1FA 2GBLA 3LQ1A 4ZODA 3QMWA 4CZJA 5JS6A 3V8BA 4P86A 3T4EA 4X71A 4GGPA 1H0SA 3A32A 3BN3A 4JSRA 4ZAVA 4DG9A 4YV0A 5NULA 4W63A 1PFKA 1V5EA 1QG4A 2OOKA 4IKOA 1GPWB 1BIZA 3BE4A 1LOTB 1X2EA 2BE9A 3GLKA 3IBSA 3NYIA 3J7YP 2JZOA 3FVVA 1EUCA 4XLLA 4X20B 2HF4A 3SEZA 4FFOA 4Q6WA 3KU4A 4QCLA 4N0QA 1CY2A 3L77A 3G79A 3IEUA 1DPFA 1FSFA 1RVV1 3WJ1A 2AOXA 2AC2A 1J2JA 2Q28A 1SBIA 2XUPA 3F47A 4RHYA 2PX3A 2XGMA 2GZ1A 4UU7A 3F9IA 4MGYR 2BP7A 1FSSA 4BNXA 3DEYX 4OHZA 2XUQA 4Z4EA 3CHYA 3CRVA 2WJIA 3AZPA 2K2QB 2E4YA 4JKYA 3GUYA 3HBNA 4RADA 4NJMB 1DKNA 1T26A 2B69A 1Z5ZA 4JKHA 3BXOA 3EYAA 3EXAA 3KBBA 5KU1A 1AGPA 1HJOA 1ZM7A 4GKKK 4K81B 5ER6A 3AHHA 3WEEB 5TJHA 3DMJA 1SR8A 2C8LA 2HMUA 1QKJA 2ZUUA 4WD3A 3GRPA 4DW8A 3HK2A 2P79A 4TTTS 2IEIA 1EP3B 2UU9B 2BL4A 4RS3A 4WX2B 1YZHA 3L02A 1ZJ4A 4AKSA 3IODA 4E3SA 2XVXA 1GTG1 2DKFA 5IASA 3R76A 5BOSB 1JBKA 3CJ1A 1HKUA 2CBXA 4EVIA 4F9FA 3SYLA 4DN6A 4ZJYA 1U2EA 1I4DD 3GA0A 3JWJA 3P20A 2OBLA 2VK1A 3FYHA 4HH3C 4DSOA 4DXDA 1KEEA 3R77A 3DL2A 5DISB 2H1VA 5H3LA 1Y3FE 1A5WA 1AZSC 4YT5A 1LWFA 3H3JA 4V02A 1NVTA 3LLMA 4G5YA 4H3KB 4UU1A 1TVEA 2BGIA 4CIYA 3K0AB 4PZUA 3CEJA 1PFUA 3VYRB 5E7JA 1GQSA 1KNXA 3H1GA 3NVDA 4BFVA 1TJ4A 3EQ6A 4NBWA 2K87A 4E1NA 3IP1A 3PLAA 2QW9A 3V4SA 2MSLA 3SQLA 4QTYA 3CC4N 1Z4JA 4DUZB 1QU2A 4OQXA 5DW0A 2V6GA 3A1TA 3ADCA 1WB9A 2DPNA 1I80A 3EE6A 4AMYA 1N2JA 4ICIA 2C94A 2V45A 3KKZA 3HZHA 1R4AA 3GX1A 2O50A 4IDAA 1WLSA 4UBJA 1LF5A 1Z5GA 2PZFA 4RD1A 5IKPA 5EJGA 3R3VA 3G8DA 1X7YA 4Z94A 1YB6A 3DAHA 3HJNA 4N9QA 4NVRA 5C52B 2WKQA 2BR4A 1OBHA 5L3RA 1Z2CA 2BI8A 4X65K 1EE2A 3U7JA 4AMZA 4RVDA 1K7CA 1AJEA 4BS9A 4MW7A 4RNDB 4JRPA 4BNNA 4ILGB 3VO1A 1QH8B 3QPBA 1LPAB 2QLNA 5CFNA 4AS1A 3UE5A 4LBWA 4KMSA 3GT0A 4I3FA 1ZXLA 4A2PA 7MDHA 5I3CA 1J0EA 1T3GA 4PBSA 4Q4LA 3C95A 1Z37A 4UEKA 4C4RA 2UUAK 1AC5A 1ZIYA 4HTFA 2ONKA 4QBIA 4X45A 1MOQA 1C9DB 1GV1A 2X77A 4OJRA 3CRNA 3CTMA 2PQMA 4CF2A 2O8DB 1TF2A 3NIGB 3O03A 4O4HB 5H70A 3G5MA 3TMAA 4BGUA 3S81A 1MOZA 1NK4A 2Z3WA 4CTJA 1POWA 2AI2A 4X60A 1X9SA 1QFYA 4LE1A 4XVCA 1E63A 4ZK2A 4GMXA 1EGAA 1FU8A 2CLHB 4QECA 2C9DA 2Q07A 2ZRKA 4JB3A 3NHGA 3NH0A 1ZICA 3TI7A 3PFBA 4GLJA 2VTDA 1K1EA 2PKYX 2WUWE 3L4IA 3MTEA 4IXMA 4XE5A 3KOUA 1EVLA 3S1SA 5JO9A 1U7WA 4D46A 1TM3E 4E7HA 3IAS1 3SCZA 2A2ZA 4XB2A 1NJ1A 2UUBK 5MFZA 1YJ8A 1SOVA 3CJRA 4ZOQI 3HPQA 4ZPJA 3UWSA 3RK1A 5B5SA 3SIPA 3AW9A 3UQYS 1NVVR 4L57A 5KU7A 3S5JA 5KTNA 2ODWA 1AQ6A 1ABBA 3LG2A 3W6PA 5L7TA 1DFIA 1ORHA 4F9GA 3EG9B 4XLTA 5JNWA 2OO5C 1DC4A 1DQSA 1TJNA 1FJGB 5FV7A 5AW7A 5FBWB 1U3TA 2IYQA 2JLUA 2PCJA 1ITZA 1QYVA 1Y1KE 3KHUA 3QZUA 4L3OA 1KKUA 2JPDA 2A1TS 1QIDA 2D0IA 4IMRA 4DVJA 3WAJA 3AEUB 3GIDA 2IHUA 1WKVA 3LFTA 1ZZEA 4QU9A 1ULTA 3L8HA 4ZMBA 2XMSA 1X3NA 3CF4A 3GJRA 4HFRA 5LXTF 4B8CA 4D8YA 2IYFA 3HM8A 4U2DA 2AKAB 3FYUA 5I7UA 1ZCJA 2O3SA 1P74A 2ISSD 3AZQA 3L1HA 1QUEA 2PG3A 1CJTC 3MWDA 4L8RB 2CFSA 4Q1BA 4Q3LA 4GPTA 2OGZA 4DR5K 1Q57A 1WOMA 3AJRA 4WL0A 5DTIA 3UMCA 1WAFA 2CSUA 3M5DA 4L95C 1M2NA 2BUCA 3C85A 3G85A 3ZS9A 5FUMA 2CXXA 2K4MA 5CA1A 1KQPA 3B6MA 2EJUA 4DR3K 3GNQA 1M8JA 1XAHA 1M5TA 1XTBA 2EV9A 2EX4A 4UVGA 3E84A 1ZSYA 4JLWA 5BNIA 4CZGA 2A0KA 2X8BA 2NP7A 4PG7A 1L3IA 4IXDA 4Q3KA 1ASVA 4KDCA 5E4JA 4NV0A 2NPFA 1P7CA 3CG0A 4Z4GA 5EUBA 2XNKA 1O6BA 2O0MA 3DV0A 5IF9A 2QUJA 1QRUA 1AHNA 2KYRA 5E8RA 5F5LA 1U1EA 2OCAA 3RBVA 3QFPA 3OE5A 2DAPA 2OWEA 3DPIA 3R3HA 5KOIA 1PO7A 2V6IA 1HNIA 4OI1A 2VDNB 3MWEA 5FWDA 3UQZA 3WIEA 2O4UX 3M49A 4DY4A 3DUWA 1T8SA 4YO8A 5CLJA 3STHA 3KG2A 1N5OX 1ZM9A 2HJ9A 1EFVB 2ZI4A 3M2TA 4U9IS 1VXOA 2WZBA 4DVGA 4JKCA 2XHBA 3PYXA 2YNHA 1CUGA 4ADSG 1L1RA 4HGOA 4EDFA 1FXWF 4A2CA 2EWWA 1JA9A 2XDAA 5L4NA 3BFKA 1BCSA 5HW0A 1RTJA 4FYYA 1YS6A 4ELUA 2EFDB 2F6RA 4JBHA 1JA1A 2GMWA 4GC5A 3WGMA 4QBKA 4BBPA 3UV7A 1PV2A 1X7ZB 1SXJC 1K75A 2GWKA 2WFBA 4RW8A 1HYVA 3K5MA 4FJMA 3QOFA 1M0WA 1QG0A 1Y4UA 4HGRA 2EBUA 2PIAA 1RRFA 3M83A 3P9XA 5JBQA 5L95A 3SQWA 3U3RA 4ACBA 5AK0A 1MFZA 1OLSA 3LPDA 3LT4A 1BVHA 4A8JB 3ZSOA 2ESRA 1KZ1A 3FBWA 3K35A 4D9HA 1U9YA 3K7EA 5H0IA 3VI3B 2VJKA 3KOWA 1NVBA 3SE0A 4OXKA 5K3EA 3PG5A 5HF6A 2O06A 1EWVA 1CS4C 1ZJ5A 1H2WA 1MU0A 4Y9SA 4Z9BA 4PHGA 5GAEP 2NU9A 1W4RA 2JGLA 2Z30A 3F6BX 2RK3A 4M0UA 2XKAA 1JQDA 3C7NA 1QJ4A 3L2RA 1OLSB 2HF8A 4FSDA 4OLJA 3FPGA 3ACBA 1QO0A 3H5OA 1T6ZA 4DSAA 1UJ4A 4LD0A 1OX4B 2AJBA 3QWBA 1QGAA 2JLBA 3G1WA 4YS6A 4JVSB 2IS2A 4JI7K 2FI1A 1SPXA 3Q87B 3SG0A 1ST3A 4AG6A 4BASA 3KK3A 1PUJA 1VECA 2JFWA 2PFKA 4R8KA 1Q0PA 1PR1A 4BC3A 3CVOA 2IYUA 5B6PA 4B3IA 4FWKA 3NEAA 2GEBA 3UB4A 2X4IA 1XZMA 5AOAA 1S22A 5BN4A 5JXHA 4UE3S 1LU9A 2DSTA 4KLZA 4EY3A 2PUTA 3VF4A 1PD0A 4YDUC 3LGAA 4J7UA 3KD2A 2HLHA 3R3JA 2G80A 4N7BA 5CRIA 3PU6A 4I9HA 2ORVA 3K0SA 2I66A 3EC7A 4INJA 2E20A 2A5JA 4H6WA 1NMZA 3GGDA 3BCUA 2AX4A 3WK7A 3GFBA 1UP7A 1IG3A 1YL7A 2BDEA 2J33A 2VZEA 3D0KA 4WY2A 2NTNA 1B0ZA 2H4YA 2O8EA 1CE8B