4IDIA

Crystal structure of rurm1-related protein from plasmodium yoelii, py06420
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
122
structure length
119
Chain Sequence
MKVKIELKFLGGLESYLEDKSKNYVTLEIDSKELNFENLIAFIRDNIIEKKFVFSDYDIDEKLCKVMVDNKEYSNYNLKDKAKIKPGIIVLVNEYDWEILGTYSYQIKNDDKICFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oryza sativa Rurm1-related
publication title Crystal Structure of Rurm1-related protein from Plasmodium Yoelii, PY06420
rcsb
source organism Plasmodium yoelii yoelii
molecule tags Protein binding
total genus 32
structure length 119
sequence length 122
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09138 Urm1 Urm1 (Ubiquitin related modifier)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4idiA00
1NEKB 1TYGB 3AN1A 3BIID 1N5WA 2H88B 3AH7A 4C80A 5H8YE 1RM6C 1YJJA 2QJLA 5AUIA 2MJDA 3AE7B 4HROA 4WWMA 1KF6B 5H92C 1CZPA 1VDVA 2W3SA 3AE8B 3W5UB 1RWSA 4YTPB 2W54A 3NRZA 2WDRB 2FBWB 3AEGB 1OFFA 1XLPA 4WQMA 4IDIA 1ZUD2 3AE1B 3P4SB 2KAJA 3LXFA 4YSXB 1JW9D 1V8CA 2E3TA 1J7BA 3HUIA 2MJEA 2BS4B 1E9MA 2LEKA 3DWMA 1VJKA 3P63A 1QOGA 3W5VB 1FIQA 3AECB 2DBYA 1WXQA 1N63A 2WU2B 1GPXA 1RFKA 4N58A 1SF0A 2W55A 4HRSA 1E0ZA 1WWTA 1I7HA 1OQRA 3AB5A 5G5HA 1UWMA 2HTME 5MPOA 1PUTA 3AMZA 1TKEA 2G1EA 2BS3B 2AX5A 2CJOA 3AV8A 3PO0A 4YSYB 1L5PA 3VR9B 1QOAA 1L6UA 2Q5WD 3FAHA 2DWQA 4YT0B 3B2FA 2MH7A 2Y5CA 3AEDB 3AM9A 1OQQA 3NS1A 1XLQA 2K9XA 1T3QA 4US8A 4JWSC 3AE9B 4ITKA 3SFEB 2WDQB 1N62A 3NVYA 4US9A 3SFDB 1YQ4B 3P1MA 1E6EB 1DGJA 1NYQA 2JQRB 1N5XA 4USAA 2OHFA 2WU5B 1TKYA 2BS2B 2KMMA 1TKGA 2QIEB 3ETRA 3CWIA 1DOIA 2JX5A 3P4PB 5GXGB 1JROA 1FMAD 1ZXIA 4FXCA 3AE5B 1F0ZA 5AUKA 1FXAA 1YQ3B 1J7CA 2WLBA 3VRAB 2MJ3A 2H89B 1WRIA 2ACZB 5EE9A 4ZOHC 4JWUC 4C7YA 4YTMB 1AWDA 3AEFB 3HRDD 2N0SB 1SB3C 1FFVA 4N6EB 1ZP0B 3DWGC 5C3JB 4JX1C 1NVID 1DOYA 3RPFC 3SR6A 1FM0D 5C2TB 1IUEA 1XLOA 1N60A 3AE4B 3NVVA 3WCQA 1DOXA 5EE0A 4ZHOA 1PFDA 2CU3A 2K5PA 1TJEA 2WP9B 1NYRA 2M56B 2PKOA 3AEEB 3FC4A 3AEBB 4N59A 2WQYB 1JRPA 1KRHA 1L0VB 3B9JA 3CIRB 2K22A 1L6VA 1NENB 1SIJA 4LTUA 1FRRA 4P6VF 4YSZB 1N61A 3AEAB 1E7PB 2L52A 1FRDA 2PVGC 3KWLA 3ZYYX 3EUB2 1WYGA 3W9CB 4YXDB 1QLBB 1NI3A 1YJIA 1V97A 3AE3B 1JWBD 3LB8C 3P4QB 4YTNB 1FXIA 5EE3A 5G5GA 1QT9A 3ABVB 3P4RB 1JWAD 3NVWA 1RYJA 2BT6A 2EKIA 1KFYB 1WGKA 2L83A 3L4PA 1GAQB 3VR8B 2M19A 1QF6A 2PIAA 2CJNA 1ROEA 1CJEA 2PVOD 3NVZA 1E10A 1XLNA 4KX6B 3VRBB 1J7AA 2W3RA 1JQ4A 1A70A 1EWYC 1QOFA 3AE2B 1JALA 1VLBA 3HVZA 5EE1A 1FFUA 1PDXA 1FO4A 2WS3B 1AYFA 2B76B 1QOBA 1XO3A 3B2GA 1B9RA 1R7SA 4A9AA 4ZHPA 4C7ZA 1ZOYB 2WDVB 3AE6B
chains in the Genus database with same CATH superfamily
3D32A 2KQ7A 4MJSA 2ZZPB 1X1MA 1RM6C 1RFAA 2KJRA 1P3QU 4OHJA 2D3AA 4G50A 2MSED 1XLPA 2GBKA 2K6QA 1I4XA 1L4DB 1SJHD 4IUMB 3W5VB 1D3ZA 2WXRA 3DBLI 3CSTA 1E0ZA 3NOBA 1IP9A 3RNCC 1Y8RC 2BPSA 2L1AA 1V80A 3ZNGC 2Q5WD 4TQ1A 2DWQA 3EFCA 1GB1A 2L00B 4KGSA 2MEKA 5HHDG 3MTNB 4GXBA 4WWNA 3L16A 3P1MA 1NYQA 2JQRB 2BKFA 4USAA 3U4EG 2G9HD 4A3PA 2N1WA 3UIPB 5T8IA 1FMAD 5D2MB 2KQ4X 3L13A 2H89B 3KH0A 1WRIA 1RAXA 2DZJA 3Q8BA 1VD2A 4HPLB 1FNUA 4D2KA 1DOYA 4RGMA 1HA5A 2RD0A 4K3BA 3N3KB 4HK2A 4PK1A 2KACA 2LGXA 3CIRB 5G55A 1FRRA 2JT4B 4GU2A 2KWCA 1I4QA 4X57B 3B1LX 1V97A 2FE8A 3HHMA 2KDBA 3AE3B 3N1YC 1KFYB 3BK1A 3QAQA 3VDZA 1LXDA 1ROEA 3FILA 2D3GA 4A3OA 3WIMA 1T0RC 3VAWA 5TR5A 3DBRB 1D6EC 1YJJA 1TS4A 3URYA 2MJDA 2PW9A 3MC0B 5IP4D 3GZNI 2KC1A 5BYQA 2BGFA 2K8HA 1FNWA 1ZDVA 4NY0A 1SBBB 2CKHB 3Q8CA 4DXAB 4ARCA 1WXVA 1V1PB 2JUOA 2O2VB 2WXKA 4JLCA 4EFOA 3U7ZA 1HTOA 3AMZA 1R4NB 1IBXA 2M1MA 5IOIA 2D5GA 2X8XX 3Q8FA 4GN1A 2RSUA 3B2FA 4HKQA 2JVCA 2Y5CA 3AEDB 3UQAA 1EF5A 3RD2A 1WGDA 4OVVA 4NQLB 1MPEA 3PREA 1WGHA 4HVBA 1E90A 3ENEA 1E8XA 4AJYB 3AE5B 4DQOC 2YLMA 4I6PA 4LJPB 2RDBC 2BKRB 2Z8LA 2FIDA 5IKCM 3HRDD 4BFRA 4JX1C 2ZW0A 2DZKA 1GC6A 3I57A 1SXTA 4HDOA 1M4VA 3OLMD 4TUUA 1PGAA 3TEXA 4MSQB 1KJTA 4DHJD 4EE2A 5D94A 1WYWB 2PEAA 4IM0A 3ABVB 3PRMB 4KV2A 1NI2A 1JQ4A 1IGCA 3HVZA 4JL9A 4FA6A 3ZQ4A 3B2GA 1TY2A 1WZ0A 3PSEB 5CHFA 4DXFA 1D4BA 1GJZA 3BVMA 4FLHA 4WIPA 2LGYA 1NEKB 3BIID 3JSVB 1WJUA 3PRPB 1L0XB 2QEJC 2IBIB 3IVFA 4GB9A 1ZW7A 2KYWA 4I6LB 1XXGA 2QMTA 4DBGA 3T8MA 1F1HA 1V2YA 3Q6BA 3MHZA 1N6ZA 3Q3FA 1QOGA 2D07B 1V1PA 1WXQA 4OZCA 4CO7A 2O2VA 1R4MB 3L08A 2V3NA 1I7HA 4KKIA 5MPOA 2ZPYA 2K3UA 3SDLC 4XWWA 2ZCBA 1XQQA 1OGWA 2LWPA 5J17A 1E8ZA 3AE9B 4KIKB 3SFEB 2WDQB 4XE0A 2WDTB 2L3ZA 4XX5A 2NBUA 3Q2AC 2V4IB 2LVQA 2KC2A 3AU4A 3BVZA 2N7DA 2LHDA 2UWQA 2QSDA 1VRAB 4C7YA 2CHWA 3TUOA 4N9F4 5C1ZA 1TT5B 1WJ6A 4W9CA 3BZDB 3RPFC 2J0MA 3KYDD 1YIWA 4MGIE 2X38A 1JRPA 4FJZA 1L0VB 4BKSA 2GBJA 1B1ZA 3EGRA 1L7YA 5DCNA 1WYGA 2ZJDA 3VTWA 1CK1A 2QCZA 3M3JA 2JZ3B 4EOYA 3NUHB 1T0SC 2BT6A 2NR2A 2CJNA 2ZVNA 1J7AA 1P7FA 2W3RA 2AQ3B 3UINB 1FO4A 4KGRA 2LUMA 1ZKHA 3IT4B 2VZKB 3N32A 3ZTCA 3RZWC 1I4PA 1WE7A 1TY0A 1YX6B 2KN4A 3JSVA 4EEWA 1WXMA 1KF6B 2C9WB 2FBWB 4HDQA 2K0PA 5FR3A 2RPQA 3A9JB 4W9FA 3PLUA 2BWES 4ASWC 4IC7B 1QQRA 4C4VB 1SE2A 3AECB 2D11A 4ANWA 1RFKA 3MJWA 1L4ZB 5G5HA 1WE6A 1JCKB 5IA7A 2KT7A 4IG7B 3V05A 4B9KA 4ZRIA 2L0TA 2NBWB 1V86A 3VTVA 2BWFA 2WXFA 4YT0B 4DK5A 3IG3A 1YQ4B 2LGIA 2KMCA 5DPTA 2FUHB 2BS2B 3E56A 1TKGA 2VH1A 2ONQA 5JHAA 4K7SA 1T0QC 3KUCB 2CU1A 1VR9A 1WX8A 2QC8A 5JXVA 4ZHOA 3RCZA 2LVOA 2CU3A 3MHSD 3AULA 3B9JA 2HDEA 2Z0EB 1KTKA 2PMVA 2LFIA 1FRDA 4YXDB 1QLBB 1NI3A 1YJIA 2D10A 1MJDA 3HVDA 2INDC 2J4XA 2KO3A 4YWGG 3NVWA 1QF6A 3NVZA 1E10A 4XDCA 1OEYJ 2V1YA 1YN3A 4NNJB 3PZ7A 2RPVA 2VZKD 1XO3A 4B95A 3ZNZB 4A9AA 4C7ZA 4XZ4A 1TBEA 3SEBA 4DHZB 2KWUB 4ZRKA 1SE4A 3PLVA 3W5UB 4G11A 4RF1A 3LYYA 3QWZB 1E7UA 2D2QA 1ZE3D 3AEGB 4ACFA 4W9GA 3QX1A 2M4NA 2CHZA 2KHWB 3ZJUA 3E9SA 2FCNA 2JU6X 3VUYA 1UBIA 2EMTA 2LXAA 4XGAB 5DPSA 3R2IA 1C3TA 2FCMA 3ZNHB 2KDMA 2MCNB 2HJ1A 3PTFC 1UBQA 3PV1A 3VHTC 3AV8A 2KMAA 2YVCA 4YSYB 1KOTA 2AL3A 3FAHA 2OEDA 3OG5A 1PGBA 1NDDA 2K8CA 4FHKA 1FNVA 1C79A 4DHZE 1FPYA 4LNNA 2UU7A 2WU5B 2LRUA 3ML9A 5D6JB 3ETRA 1XCQL 1DOIA 1UF0A 3BYTB 3QIJA 5TSSA 2LHEA 3T3NA 4JWUC 2WXNA 3IAS1 4WH4A 4EZLA 1AWDA 4IWQA 4IOIE 4XWTA 1P1AA 5CX3A 2C7NB 2AWTA 2V4LA 1N60A 2G4SA 4IM3A 4TSSA 4KVGB 3V61A 1YNTE 3ZO5B 2KTFA 2JPHA 1XCTL 2O6VD 5FR6A 3RUIB 2NCNA 3AEAB 3EC8A 2CR5A 1JWBD 3KUDB 3P4RB 3ECIA 2EKIA 4NAWB 2M19A 1A5RA 2RR9A 1XLNA 3ZGZA 3A1QB 4BOSC 2HTHA 1E8YA 2MX2A 2MRPA 2V3SA 3A4SC 3R3MA 1SJED 5DPRA 1ZOYB 4BVUC 2IGGA 1WM2A 1ET6A 3AE7B 4HROA 2JRHA 4CYEA 4AWJA 4K7UA 3L17A 3I63C 2WDRB 4ZRQA 2KZRA 3MJ5A 4K3CA 2N9KA 4A90A 2WX0A 3RNFC 3LXFA 1EUVB 4MGZE 2NBVB 2A5UA 2MBBB 4NPNA 4FADA 3OAWA 2XK5B 4NAMA 1TKEA 2FNJB 2PE6B 1YX5B 2BYFA 2C7MB 1S3SG 1E8WA 4OZAA 2I2YA 1P9DU 1WM3A 5JH5C 2ZPNA 3VXWA 3VH3B 1E6EB 4EKUA 4WJPA 1N5XA 1L0YB 3BVGA 2KMMA 4II3B 1E7VA 3GE3C 4GOCA 1KLVA 1F0ZA 2V3PA 1FXAA 1MVKA 3APDA 3Q3JA 3DVNV 4WQOB 3AEFB 5JZEB 2N0SB 3PRZA 3H6NA 4XC2A 3QC8B 4GGQA 4R3DA 5IO9A 2NS5A 4F8CB 2WQYB 3PZ8A 1GNUA 3W9CB 3L54A 5G5GA 5I4DA 2KTRB 3L4PA 1WGKA 2OJWA 4IWPA 1CJEA 2GLSA 4KX6B 2NPTB 4HKZE 2KK8A 3AE2B 1PDXA 2WS3B 1CQVA 3N20C 3O13A 3C19A 3AN1A 3H9DA 3RNGC 1PGXA 3C0RB 4DHJB 4WJNA 2I38A 2N9XA 2EELA 3X23A 2SEBD 1ZXHA 1VZ8A 3JW0X 4LNIA 2K1FA 4AJWA 5C23A 1BUIC 1ZUD2 1GB4A 1J7BA 3HUIA 3ZIMA 2LEKA 2PE9A 1Q10A 4N58A 2I1KA 1OQRA 1STEA 2CJOA 5AZHA 1VZ7A 1F2RI 2DX5B 1I4HA 5BMIA 4YL8A 1OEYA 2Y5BB 3HM6X 1DGJA 3KVFB 2DYOA 3CWIA 3V3XA 1JROA 2J52A 1ZDXA 1I4GA 3H7PB 4M02A 1UELA 3KW5B 4DDGD 5KHQA 4XYCA 2LGSA 4HWIB 1ZP0B 4BKTA 4TV3A 5LXIB 2R2QA 1QKZA 2PJHA 5EE0A 1SSNA 2WXOA 3LDZE 2L76A 3EFUA 4P6VF 1UZXB 2EKEC 1JWUD 1N61A 3UI3A 4RF0A 4MDKE 2QHOA 1RYJA 1RLFA 2GB1A 3KQ4A 2W82A 3TEYA 3ML8A 2WX1A 4WWPA 3WAOA 2NPTA 4AOFA 1QOBA 2M8SA 1OTRB 2M17A 3DBSA 2L32A 2LMCA 1XF5L 4A55A 5BMGA 4M0WB 4PS7A 1WJNA 3V60A 4MELA 3A9KB 2W9NA 2V0GA 3DPDA 1MHHE 2KAJA 2IZVB 3DHHC 4KZ0A 2FCQA 4P1CC 4RGNA 1I35A 1SE3A 2WWZA 2MP2B 3QARA 3PPAA 4HJGE 4HRSA 2I1JA 3ZNID 4MM3B 1TZ1A 2LI5A 3LJ3A 2G3QB 2MH7A 1WMHB 3NS1A 1XLQA 4HCPB 4E71A 1FEHA 3C8YA 5HG2A 1HE8A 4NJCA 2JF5A 4NJ6A 1K50A 4FXCA 3WA0A 4RCOA 1Z5SB 3AU5A 2MBQA 1TS3A 3H7PA 2MLBA 4M8NA 2MA9B 3EHVA 1V6EA 3N1ZC 1YMHE 4NJ7A 3NJTA 2K39A 1DOXA 3WCQA 1TJEA 3AEEB 4N59A 3H8HA 1KRHA 1NENB 4LTUA 4K81A 1PYWD 1MG4A 3ZYYX 2GBNA 3ZVVA 3DBHI 3APFA 2IDYA 4EUTA 4AUQC 3DDCB 3WALA 1QOFA 1JALA 1VLBA 3DVGX 5EE1A 2B76B 3N30A 2KN5A 3DBLB 2WGSA 2WDVB 4ANUA 1HEZE 1WX9A 1GOZA 2N7EA 2GOWA 2UYZB 5D3DA 2MWSB 4ICUA 4GDKB 2INPE 2TSSA 4IDIA 1WFYA 2WXIA 3VUXA 4ZYNA 2KFJA 2DBYA 4URKA 1GPXA 5IAAC 2ZEQA 1KLGD 2HJ8A 2MP2A 4PYZA 3VQIA 1J8CA 3MC9A 4MM3A 1MHXA 3GOEA 2LVPA 4MGYE 1BMLC 1EWCA 1WR6E 2K9XA 4EZJA 1WZ3A 4RH6A 2XNAC 1WMHA 2L8JA 4ITKA 3KYCD 3U8ZA 2INNE 3P4PB 4M01A 3NG0A 4AP4C 2AEHA 5EDSA 5EE9A 2FAZA 4LCDE 2LXCA 1GC7A 4DWFA 2JXTA 1IUEA 1ACCA 3DVGY 4LK0M 2DYMA 4KIKA 1L6VA 3TIXA 3KUZA 2PVGC 3W1SC 4W9LA 3ZJVA 3LB8C 4YTNB 3NHEB 3GZNB 5EE3A 4KDIC 5FK9C 5LLIA 5E6NA 3ZDMC 2KLGA 1ISNA 3UIOB 2L0FA 3GS2A 3WANA 4JGHB 1FFUA 2OOBB 4GIVA 1AYFA 2NVUI 5AEKB 3QK0A 1LGRA 3AH7A 2O6VB 5BYSA 4BZAA 4YTPB 3PT2B 1Q5WB 1K53A 2DZIA 2DYBA 2LJ5A 1S1QB 1JW9D 4II2B 2MHJA 2K6DB 2BS4B 5BMHA 4HCNB 3HM3A 4B6WA 2W55A 1SEBD 1K51A 1AW7A 2GRIA 2JWZA 5BYRA 2NTSA 4WURA 4WAFA 4GSWA 3N1XC 3I9V1 1PQSA 1C76A 2N4FA 1UNSA 4L23A 1UD7A 4JWSC 3A9JA 3NVYA 2V9HA 3EA6A 2JWUA 4C4VA 2MQJA 1P98A 2HD5B 3R66C 2REXA 1R4NI 2JY6A 4OVUA 1GG3A 1WI0A 3WAPA 2N1VA 1WH3A 4KDLB 3DWGC 3DCGA 4HJKA 3TJPA 4LNOA 3NVVA 1WGRA 1PFDA 1HTQA 2M56B 1BT0A 3AEBB 3JYUA 2DAFA 3VUWA 4MJSB 2CHXA 2N9PC 3EUB2 4GDLB 4IKGA 1G6JA 1T0YA 2N9LA 3A33B 4LDTB 2PPHA 4LNKA 4E74A 2WXHA 1WXSA 2JYEA 1EM7A 3ZRCA 4F1SA 4MSMB 2KKCA 4RM9A 5HFYA 3RN9C 2DHZA 1WJ4A 1N5WA 1IPGA 2O6VA 2WXPA 2IO1B 1FCLA 2KXJA 2KDFB 2JRIB 2QDFA 4W9EA 3BWUD 1H4RA 2BYTA 2MJEA 2Y3AA 3P63A 1N63A 1D5MC 1IGDA 1SF0A 2DENB 5J18A 1WWTA 4FBJB 2Z0DB 1UWMA 2AL6A 2Y5PA 1F77A 2BYVE 2AX5A 3UGBB 1L5PA 1ENFA 4L2YA 1YD8U 3AM9A 1N62A 1MG8A 2R2OA 3P42A 5IN7A 2MW5A 4HEA1 1ZGUB 4BAXA 3Q8EA 4ICVA 1VCBA 2WLBA 4MT5A 1F52A 1QZEA 2ACZB 4ZOHC 1K8RB 1ET9A 3FILB 3OJ3A 4MH0E 5C3JB 4B0MA 1FCCC 1GUAB 5C2TB 2INCC 3GB1A 2Z59B 3TBLD 4DDID 1EO6A 2K5PA 5HKHA 2PKOA 2GMIC 4P16A 4ZYSA 4LLGM 3IBEA 1DYQA 4A6QA 1V5OA 1E7PB 3RT3B 4C00A 4GDLA 4LDTD 1WGGA 1C78A 2DLBA 4HPMB 3T9LA 3VR8B 1L2NA 1HZ6A 1HQRD 2K25A 3M62B 1YN5A 1YJ1A 2ZW1A 2BB5A 1TS5A 1R7SA 3SHQA 5J2RA 4ZHPA 1UGJA 3M63B 2H88B 1IBXB 5H8YE 2QJLA 4WWMA 3U2SC 3QA8A 2E6XA 1V49A 4ZRJA 4A20A 4WQMA 3Q8AA 4NAWA 4TMAB 2WXLA 3M95A 1WGYA 3VH4B 3A1QA 3NS8A 3ALBA 3L10B 1UH6A 2HTME 3APCA 5CTRC 4W9IA 3N9YC 1EU3A 2CS4A 3GP7A 4FHJA 2KDEB 2IO3B 4E3CA 2J0KA 2BF8B 1V5TA 3SFDB 3SU8X 3K9PB 4HLEA 1YQBA 1WXAA 4L1BA 1HZ5A 2C60A 2JZZA 2XK5A 2LUEA 3QJZA 3ZLZA 4PT5A 2KDIA 4MEMA 1I4RA 1NVID 4BBNF 1BXTA 3SR6A 2WHIA 1ESFA 1NYRA 3R8BA 3U7DA 3I5JC 3Q3MC 1SIJA 4FN2A 4J3OD 2N7JA 4FJVB 5JHBA 2KX0A 1WIAA 2QILA 2DZMA 3P4QB 2M0AA 2PTLA 1JWAD 1NBFC 3ZDTA 4NZLB 1UUPA 2KFKB 2NTTA 2JXXA 1A70A 1WX7A 5HI1A 3Q14C 2BYEA 3A4RA 4RM8A 4J6IA 1Q1OA 4PS3A 1TS2A 4RGOS 1EU4A 1TYGB 1MI0A 3T3OA 5AUIA 3ZW3A 1WR1A 2D3CA 3V6EB 1K52A 1F9JA 3ZXRA 2C7HA 1OFFA 2KTRA 5LXHA 3AE1B 2C5LC 3P4SB 4G3XB 4GMVA 4LJOB 3K9OB 2E3TA 1V8CA 2KANA 2VH2A 3TL5A 1EF1A 4BBNC 2R61A 2ASQA 1HXYD 1FIQA 1T5XD 2GI9A 5CHVC 2RDGA 3SD5A 3W1YA 4WAAA 1KLUD 5BO4B 1PUTA 2IY0B 2BS3B 3PS6A 2KLCA 2IO2B 3BY4B 4BKGA 3B0AA 2WNMA 3R7RA 1T3QA 1JWMD 3RNBC 3DOWA 2WXMA 1Q0WB 3IHPC 2LJIA 2XEWA 1V1OA 2IYDB 3IFWB 3RMKC 1TKYA 3H1UA 2QIEB 4M8MA 4Q2JA 3FKYA 2LGDA 3L0WB 3WAMA 4YTMB 3NZUA 3QQ8B 1FFVA 1U4AA 3NZ3A 3HK0A 1FM0D 1SIFA 1I42A 1XLOA 2BVCA 1WF9A 2ICIA 1V9JA 3NZSA 2EMSA 3VVWB 3KWLA 2L52A 5LNK1 1FXIA 4WJQA 1QT9A 1P7EA 1C4CA 2XN9C 4FJYA 2IGHA 3RYTA 4W9DA 3ZKJC 2KFKA 2FUG1 2GBRA 5KHOA 1RRBA 2ON8A 4KKJA 2MBEA 2M0XA 4AS1A 4MGKE 4KGTA 3AE8B 5E6OA 1FXTB 1D5XC 4UDUC 3NRZA 3P2BA 4ARIA 4G0NB 4RGTA 2ZCCA 2DAJA 1C4PA 4WJOA 2BBCA 4MACA 1E9MA 2AYOB 4OZBA 3DWMA 1VJKA 1XD3B 3W1SA 1SE9A 3AB5A 3QHTA 3BK2A 2G1EA 1ZPSA 1M94A 2RMMA 3IAM1 5D3IB 5G2NA 2ZNVB 4W9JA 3VR9B 3NY5A 3GE8C 4FULA 4M0WA 3CF6E 3AXCA 1SGHA 2IJ0A 1P0RA 4BKSD 5E6PA 3A9KA 2KOXA 3PZDA 2B3AA 1QILA 3Q69A 1Z2MA 2J42A 2JX5A 2G4DB 4ANXA 3VRAB 3ZXVA 1KH0A 1IYFA 3ZJTA 3MFGA 3PGEA 3RULA 4EZKA 3PHWB 3ZUNA 2KQSA 3PVLA 1SB3C 4MH8A 3AI5A 3AE4B 2KVRA 3OWEB 1CMXB 2WP9B 2OJRA 4PS8A 4ZRPA 5AUKA 4M00A 3RZFA 3R2TA 3X0WA 3BINA 1C77A 3IT6B 2LD9A 2HE7A 2L83A 3VTUA 2PIAA 3DQVA 1Y56A 1UGMA 3VFKA 3DVNU 2A4ZA 3V6CB 1B9RA 4JPSA 4GLSC 1VZ6A 4C80A 3ZTDA 2W3SA 1RWSA 2D3BA 2KX3A 4C56C 2W54A 2XBBC 5FKAC 1OQYA 2K8BA 4ANVA 2PLPA 4YSXB 3RI7C 2G45B 1J19A 2IPKD 2JSVX 3TEZA 3TCAA 3I3TB 2J7QB 3O65B 3PHXB 1C9FA 1L6UA 1WSPA 2VRRB 5CHWA 1OQQA 3CMMB 1TIFA 4GDKA 1T6BX 1LO5D 4US9A 2LZ6A 2AQ2B 2OHFA 2L05A 3U52E 1FD6A 1YQ3B 1J7CA 2YEPB 3TMPB 5E6JA 2MJ3A 1JWSD 3DBRI 4CQNA 4RNAA 1KM7A 3MC8A 1D5ZC 2J53A 5AZFA 3RNEC 2WYQA 4O1NA 3FC4A 1V81A 1YOVB 2MBHA 2K22A 4YSZB 2IO0B 2KWDA 4QAYA 5DPWA 4K7WA 4F7ZA 1C1YB 2KJ6A 1TGZB 1WY8A 1GAQB 2KNBA 4NQKE 2N9EB 2PVOD 1WRDB 4P7IA 4BOZB 1EWYC 4KSLC 2BTEA 2WXGA 4HXDA 3S2AA 3UF8A 4TKNA 1H8CA 2DNFA 4B0EA 3B08A 1XEEA 2RDHA 4DXGA 3JVZX 1UWXA 4XDDA 1CZPA 1VDVA 3DHGC 5H92C 3RFZB 3KWVA 2BB6A 1JMLA 1XT9B 3DHIC 3ONSA 4KZCA 3BYYB 1J0GA 3KLSX 2ZNVC 2WXJA 2L7RA 4JQWC 2WU2B 2WXQA 4H2AA 4OVZA 4IWOA 2SAKA 3HIZA 3PO0A 2BQQA 1QOAA 3R7QA 1YN4A 4JIOU 2FIFA 2GBMA 4I6NB 2IY1B 4W9KA 4WWOA 4US8A 1AN8A 4AQ7A 3H7SA 4REZA 4CHKA 3IXSA 3TEWA 4A8XC 2IGDA 1LM8B 5GMVA 3QCAA 4W9HA 5GXGB 3W2DA 1ZXIA 4HPPA 1MFWA 3DBHB 1LQBA 3ZRFA 2JZPA 5L83A 1TZOA 4IM2A 5L95C 1AARA 2LRWA 4ZDVA 4K1RB 4PYUA 1JRUA 2JYTA 4N6EB 2NMQA 2BW2A 2KJHB 3RNAC 4LNFA 2MBOA 3CSFA 3EECA 4RMAA 2J0JA 2FCSA 3MP9A 1R4MI 1C4AA 4RFBA 2YEPF 4JE3B 2LASA 2ZVOA 4IW0A 4P1BC 2KVZA 3V62A 3UQBA 1LFDA 3U30A 4KSKC 3TSSA 3Q3NC 3VRBB 2RGFA 2AQ1B 4TQ0A 1TTNA 1F2RC 5AZGA 2KD0A 2KWVB 1E5WA 3J9CA 3Q3OC 5D7GA 4OW0A 4S17A 4S0RA 3OJ4B 3AE6B
chains in the Genus database with same CATH topology
1TS2A 4RGOS 1EU4A 1HEZE 1TYGB 3SEBA 1MI0A 1GOZA 3T3OA 1RM6C 5AUIA 1SE4A 3W5UB 4OHJA 5D3DA 4RF1A 3LYYA 1K52A 1ZE3D 3AEGB 4GDKB 1OFFA 1XLPA 2INPE 2TSSA 4IDIA 3AE1B 3P4SB 1I4XA 2E3TA 1V8CA 2WXIA 3ZJUA 3E9SA 1L4DB 2R61A 1SJHD 2JU6X 3W5VB 1HXYD 1FIQA 1T5XD 2DBYA 2GI9A 1GPXA 2WXRA 2RDGA 3R2IA 1KLGD 1E0ZA 2KDMA 1KLUD 1PUTA 3VQIA 2BS3B 3AV8A 4YSYB 2L1AA 1MHXA 2Q5WD 3FAHA 2OEDA 4TQ1A 2DWQA 1PGBA 1BMLC 2WNMA 1EWCA 1GB1A 2K9XA 4KGSA 1FNVA 1T3QA 1C79A 2MEKA 1JWMD 2XNAC 4RH6A 5HHDG 4ITKA 2WXMA 2LJIA 1V1OA 3P1MA 2INNE 1NYQA 2JQRB 4USAA 2WU5B 2G9HD 1TKYA 3U4EG 2QIEB 1XCQL 3ETRA 1DOIA 3P4PB 5T8IA 1FMAD 3BYTB 4Q2JA 2KQ4X 5TSSA 2H89B 1WRIA 2LHEA 3T3NA 3Q8BA 5EE9A 4JWUC 2WXNA 3IAS1 4YTMB 4WH4A 1AWDA 4IOIE 4XWTA 1FFVA 1FNUA 2JXTA 4D2KA 1DOYA 3NZ3A 1FM0D 1IUEA 1XLOA 1N60A 4RGMA 1HA5A 1ACCA 2ICIA 4LK0M 2KACA 4TSSA 3CIRB 1YNTE 2DYMA 1L6VA 1FRRA 1XCTL 3AEAB 3KWLA 2L52A 2PVGC 1I4QA 3ZJVA 5LNK1 1V97A 2FE8A 3AE3B 1JWBD 3LB8C 4YTNB 1FXIA 5EE3A 5FK9C 1QT9A 1P7EA 3P4RB 1C4CA 2XN9C 2EKIA 4NAWB 1KFYB 3BK1A 2M19A 2IGHA 1ROEA 1XLNA 3GS2A 3FILA 3ZGZA 1FFUA 2FUG1 1AYFA 2ON8A 4KKJA 1SJED 1ZOYB 3AH7A 2IGGA 5BYSA 1D6EC 1ET6A 1YJJA 1TS4A 3URYA 4AS1A 2MJDA 3AE7B 2PW9A 4HROA 4KGTA 3MC0B 3AE8B 4YTPB 1D5XC 5BYQA 4UDUC 3NRZA 1K53A 2WDRB 4ARIA 4ZRQA 4RGTA 1FNWA 3MJ5A 1ZDVA 1SBBB 2N9KA 4A90A 3Q8CA 3LXFA 1C4PA 4ARCA 1JW9D 2BBCA 4MACA 1V1PB 2BS4B 1E9MA 4OZBA 3DWMA 1VJKA 5BMHA 3W1SA 2WXKA 2W55A 1SEBD 1K51A 1AW7A 3AB5A 3U7ZA 4NAMA 3BK2A 3AMZA 2GRIA 5BYRA 1TKEA 2G1EA 1ZPSA 2NTSA 1IBXA 2RMMA 4WURA 3IAM1 5D3IB 2D5GA 3VR9B 4WAFA 3Q8FA 3I9V1 4M0WA 3B2FA 1C76A 4HKQA 2Y5CA 4OZAA 3AEDB 2IJ0A 2I2YA 1UNSA 4L23A 4JWSC 3NVYA 3EA6A 1MPEA 1E6EB 1QILA 3Q69A 1N5XA 2JWUA 1L0YB 3BVGA 2KMMA 2J42A 2JX5A 3AE5B 1F0ZA 2V3PA 1FXAA 4DQOC 3VRAB 1KH0A 3ZJTA 1MVKA 3MFGA 2Z8LA 3AEFB 3HRDD 2N0SB 1SB3C 3DWGC 4JX1C 4MH8A 2ZW0A 3AE4B 3NVVA 3OWEB 1PFDA 2WP9B 3I57A 4R3DA 2M56B 1SXTA 1M4VA 3AEBB 2WQYB 4ZRPA 5AUKA 1PGAA 3TEXA 3PZ8A 3R2TA 1C77A 4GDLB 3EUB2 4IKGA 3W9CB 4EE2A 3IT6B 5G5GA 5I4DA 2N9LA 3ABVB 2L83A 3L4PA 1WGKA 2PIAA 1CJEA 2WXHA 4KX6B 1JQ4A 1IGCA 1Y56A 4HKZE 3AE2B 2JYEA 1EM7A 3HVZA 1PDXA 2WS3B 3ZQ4A 3B2GA 1TY2A 1B9RA 1CQVA 4DXFA 1D4BA 3O13A 3BVMA 5HFYA 4WIPA 4JPSA 4GLSC 1NEKB 3AN1A 3BIID 1N5WA 1VZ6A 4C80A 1L0XB 1PGXA 2QEJC 2WXPA 2W3SA 2I38A 1RWSA 2EELA 2SEBD 1ZXHA 1VZ8A 1FCLA 1XXGA 4C56C 2W54A 2QMTA 5FKAC 1BUIC 1ZUD2 3BWUD 2PLPA 4YSXB 2BYTA 1J7BA 3HUIA 1GB4A 2MJEA 3MHZA 2LEKA 2Y3AA 3P63A 1QOGA 1V1PA 1WXQA 1N63A 1D5MC 1Q10A 2IPKD 4OZCA 1IGDA 2JSVX 1SF0A 4N58A 3TEZA 2V3NA 1WWTA 1I7HA 1OQRA 4KKIA 1UWMA 5MPOA 2Y5PA 1F77A 2K3UA 1STEA 2AX5A 2CJOA 4XWWA 1C9FA 1L5PA 1VZ7A 1L6UA 1F2RI 1ENFA 1I4HA 1WSPA 4L2YA 3AM9A 1OQQA 5BMIA 3AE9B 1T6BX 2WDQB 1N62A 1LO5D 4US9A 4XE0A 3SFEB 3P42A 2AQ2B 1DGJA 2OHFA 4HEA1 2DYOA 3CWIA 3V3XA 2V4IB 1JROA 3U52E 3Q8EA 1FD6A 2J52A 3BVZA 1YQ3B 1J7CA 2WLBA 1ZDXA 1I4GA 2MJ3A 2YEPB 1JWSD 5E6JA 4MT5A 2ACZB 2LHDA 2QSDA 4CQNA 4ZOHC 1VRAB 4RNAA 3TUOA 4C7YA 1ET9A 3FILB 1D5ZC 1ZP0B 2J53A 4B0MA 5C3JB 3BZDB 1FCCC 3RPFC 1QKZA 5C2TB 3GB1A 5EE0A 1SSNA 2K5PA 4O1NA 2PKOA 2WXOA 3FC4A 4P16A 4ZYSA 4LLGM 2X38A 1JRPA 1L0VB 2K22A 1DYQA 4P6VF 4A6QA 1B1ZA 4YSZB 3EGRA 1JWUD 1N61A 3UI3A 1E7PB 4RF0A 1WYGA 2KWDA 1CK1A 3NUHB 1RYJA 2BT6A 2GB1A 3KQ4A 1C78A 1GAQB 2DLBA 2W82A 3VR8B 3TEYA 2CJNA 1HZ6A 2PVOD 1HQRD 1J7AA 1P7FA 2W3RA 2AQ3B 1EWYC 1YN5A 2BTEA 2ZW1A 1FO4A 4KGRA 2BB5A 2WXGA 1TS5A 1QOBA 2LUMA 3IT4B 1R7SA 2VZKB 4B0EA 1I4PA 1UGJA 4ZHPA 1XEEA 2L32A 1TY0A 2RDHA 2H88B 2LMCA 4DXGA 1IBXB 2KN4A 5H8YE 2QJLA 4WWMA 1UWXA 1KF6B 1XF5L 1CZPA 1VDVA 4XDDA 5H92C 3U2SC 5BMGA 4A55A 3RFZB 2E6XA 3KWVA 2BB6A 1JMLA 2FBWB 4WQMA 2K0PA 3BYYB 5FR3A 3Q8AA 2V0GA 4TMAB 2WXLA 1MHHE 3KLSX 2KAJA 2WXJA 1QQRA 1SE2A 4RGNA 1SE3A 3AECB 2WU2B 2WXQA 1RFKA 4H2AA 4HJGE 4HRSA 4OVZA 1L4ZB 5G5HA 2HTME 4MM3B 1JCKB 2SAKA 3PO0A 3V05A 3N9YC 1EU3A 1QOAA 1YN4A 3GP7A 2WXFA 4YT0B 2MH7A 3NS1A 1XLQA 4US8A 1AN8A 4AQ7A 4REZA 3SFDB 1FEHA 1YQ4B 2LGIA 3C8YA 5HG2A 3IXSA 3TEWA 4A8XC 2IGDA 2BS2B 3E56A 1TKGA 4NJCA 3W2DA 5GXGB 2ONQA 1ZXIA 1K50A 4FXCA 1HZ5A 4L1BA 4RCOA 2JZPA 1TZOA 1TS3A 4PT5A 1VR9A 1I4RA 2JYTA 4N6EB 1YMHE 1NVID 2NMQA 1BXTA 3SR6A 2BW2A 1DOXA 3WCQA 5JXVA 4ZHOA 2CU3A 1ESFA 1TJEA 1NYRA 3AEEB 3R8BA 4N59A 3H8HA 1KRHA 3B9JA 2HDEA 1NENB 1SIJA 4LTUA 1KTKA 2PMVA 2N7JA 4J3OD 2LFIA 1PYWD 1FRDA 3MP9A 3ZYYX 4YXDB 1C4AA 1QLBB 1NI3A 1YJIA 2QILA 3HVDA 3P4QB 4RFBA 2J4XA 2YEPF 2M0AA 4JE3B 2PTLA 2IDYA 4YWGG 1JWAD 3NVWA 1QF6A 4NZLB 1UUPA 3NVZA 3TSSA 1E10A 2NTTA 3VRBB 4XDCA 1A70A 2AQ1B 4TQ0A 1QOFA 1JALA 1VLBA 5EE1A 5HI1A 1F2RC 1YN3A 3PZ7A 2RPVA 2VZKD 2B76B 1XO3A 3J9CA 5D7GA 4A9AA 4OW0A 4C7ZA 2WDVB 3AE6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NEK B;  1TYG B;  3AN1 A;  3BII D;  1N5W A;  2H88 B;  3AH7 A;  4C80 A;  5H8Y E;  1RM6 C;  1YJJ A;  2QJL A;  5AUI A;  2MJD A;  3AE7 B;  4HRO A;  4WWM A;  1KF6 B;  5H92 C;  1CZP A;  1VDV A;  2W3S A;  3AE8 B;  3W5U B;  1RWS A;  4YTP B;  2W54 A;  3NRZ A;  2WDR B;  2FBW B;  3AEG B;  1OFF A;  1XLP A;  4WQM A;  4IDI A;  1ZUD 2;  3AE1 B;  3P4S B;  2KAJ A;  3LXF A;  4YSX B;  1JW9 D;  1V8C A;  2E3T A;  1J7B A;  3HUI A;  2MJE A;  2BS4 B;  1E9M A;  2LEK A;  3DWM A;  1VJK A;  3P63 A;  1QOG A;  3W5V B;  1FIQ A;  3AEC B;  2DBY A;  1WXQ A;  1N63 A;  2WU2 B;  1GPX A;  1RFK A;  4N58 A;  1SF0 A;  2W55 A;  4HRS A;  1E0Z A;  1WWT A;  1I7H A;  1OQR A;  3AB5 A;  5G5H A;  1UWM A;  2HTM E;  5MPO A;  1PUT A;  3AMZ A;  1TKE A;  2G1E A;  2BS3 B;  2AX5 A;  2CJO A;  3AV8 A;  3PO0 A;  4YSY B;  1L5P A;  3VR9 B;  1QOA A;  1L6U A;  2Q5W D;  3FAH A;  2DWQ A;  4YT0 B;  3B2F A;  2MH7 A;  2Y5C A;  3AED B;  3AM9 A;  1OQQ A;  3NS1 A;  1XLQ A;  2K9X A;  1T3Q A;  4US8 A;  4JWS C;  3AE9 B;  4ITK A;  3SFE B;  2WDQ B;  1N62 A;  3NVY A;  4US9 A;  3SFD B;  1YQ4 B;  3P1M A;  1E6E B;  1DGJ A;  1NYQ A;  2JQR B;  1N5X A;  4USA A;  2OHF A;  2WU5 B;  1TKY A;  2BS2 B;  2KMM A;  1TKG A;  2QIE B;  3ETR A;  3CWI A;  1DOI A;  2JX5 A;  3P4P B;  5GXG B;  1JRO A;  1FMA D;  1ZXI A;  4FXC A;  3AE5 B;  1F0Z A;  5AUK A;  1FXA A;  1YQ3 B;  1J7C A;  2WLB A;  3VRA B;  2MJ3 A;  2H89 B;  1WRI A;  2ACZ B;  5EE9 A;  4ZOH C;  4JWU C;  4C7Y A;  4YTM B;  1AWD A;  3AEF B;  3HRD D;  2N0S B;  1SB3 C;  1FFV A;  4N6E B;  1ZP0 B;  3DWG C;  5C3J B;  4JX1 C;  1NVI D;  1DOY A;  3RPF C;  3SR6 A;  1FM0 D;  5C2T B;  1IUE A;  1XLO A;  1N60 A;  3AE4 B;  3NVV A;  3WCQ A;  1DOX A;  5EE0 A;  4ZHO A;  1PFD A;  2CU3 A;  2K5P A;  1TJE A;  2WP9 B;  1NYR A;  2M56 B;  2PKO A;  3AEE B;  3FC4 A;  3AEB B;  4N59 A;  2WQY B;  1JRP A;  1KRH A;  1L0V B;  3B9J A;  3CIR B;  2K22 A;  1L6V A;  1NEN B;  1SIJ A;  4LTU A;  1FRR A;  4P6V F;  4YSZ B;  1N61 A;  3AEA B;  1E7P B;  2L52 A;  1FRD A;  2PVG C;  3KWL A;  3ZYY X;  3EUB 2;  1WYG A;  3W9C B;  4YXD B;  1QLB B;  1NI3 A;  1YJI A;  1V97 A;  3AE3 B;  1JWB D;  3LB8 C;  3P4Q B;  4YTN B;  1FXI A;  5EE3 A;  5G5G A;  1QT9 A;  3ABV B;  3P4R B;  1JWA D;  3NVW A;  1RYJ A;  2BT6 A;  2EKI A;  1KFY B;  1WGK A;  2L83 A;  3L4P A;  1GAQ B;  3VR8 B;  2M19 A;  1QF6 A;  2PIA A;  2CJN A;  1ROE A;  1CJE A;  2PVO D;  3NVZ A;  1E10 A;  1XLN A;  4KX6 B;  3VRB B;  1J7A A;  2W3R A;  1JQ4 A;  1A70 A;  1EWY C;  1QOF A;  3AE2 B;  1JAL A;  1VLB A;  3HVZ A;  5EE1 A;  1FFU A;  1PDX A;  1FO4 A;  2WS3 B;  1AYF A;  2B76 B;  1QOB A;  1XO3 A;  3B2G A;  1B9R A;  1R7S A;  4A9A A;  4ZHP A;  4C7Z A;  1ZOY B;  2WDV B;  3AE6 B; 
#chains in the Genus database with same CATH topology
 3D32 A;  2KQ7 A;  4MJS A;  2ZZP B;  1X1M A;  1RM6 C;  1RFA A;  2KJR A;  1P3Q U;  4OHJ A;  2D3A A;  4G50 A;  2MSE D;  1XLP A;  2GBK A;  2K6Q A;  1I4X A;  1L4D B;  1SJH D;  4IUM B;  3W5V B;  1D3Z A;  2WXR A;  3DBL I;  3CST A;  1E0Z A;  3NOB A;  1IP9 A;  3RNC C;  1Y8R C;  2BPS A;  2L1A A;  1V80 A;  3ZNG C;  2Q5W D;  4TQ1 A;  2DWQ A;  3EFC A;  1GB1 A;  2L00 B;  4KGS A;  2MEK A;  5HHD G;  3MTN B;  4GXB A;  4WWN A;  3L16 A;  3P1M A;  1NYQ A;  2JQR B;  2BKF A;  4USA A;  3U4E G;  2G9H D;  4A3P A;  2N1W A;  3UIP B;  5T8I A;  1FMA D;  5D2M B;  2KQ4 X;  3L13 A;  2H89 B;  3KH0 A;  1WRI A;  1RAX A;  2DZJ A;  3Q8B A;  1VD2 A;  4HPL B;  1FNU A;  4D2K A;  1DOY A;  4RGM A;  1HA5 A;  2RD0 A;  4K3B A;  3N3K B;  4HK2 A;  4PK1 A;  2KAC A;  2LGX A;  3CIR B;  5G55 A;  1FRR A;  2JT4 B;  4GU2 A;  2KWC A;  1I4Q A;  4X57 B;  3B1L X;  1V97 A;  2FE8 A;  3HHM A;  2KDB A;  3AE3 B;  3N1Y C;  1KFY B;  3BK1 A;  3QAQ A;  3VDZ A;  1LXD A;  1ROE A;  3FIL A;  2D3G A;  4A3O A;  3WIM A;  1T0R C;  3VAW A;  5TR5 A;  3DBR B;  1D6E C;  1YJJ A;  1TS4 A;  3URY A;  2MJD A;  2PW9 A;  3MC0 B;  5IP4 D;  3GZN I;  2KC1 A;  5BYQ A;  2BGF A;  2K8H A;  1FNW A;  1ZDV A;  4NY0 A;  1SBB B;  2CKH B;  3Q8C A;  4DXA B;  4ARC A;  1WXV A;  1V1P B;  2JUO A;  2O2V B;  2WXK A;  4JLC A;  4EFO A;  3U7Z A;  1HTO A;  3AMZ A;  1R4N B;  1IBX A;  2M1M A;  5IOI A;  2D5G A;  2X8X X;  3Q8F A;  4GN1 A;  2RSU A;  3B2F A;  4HKQ A;  2JVC A;  2Y5C A;  3AED B;  3UQA A;  1EF5 A;  3RD2 A;  1WGD A;  4OVV A;  4NQL B;  1MPE A;  3PRE A;  1WGH A;  4HVB A;  1E90 A;  3ENE A;  1E8X A;  4AJY B;  3AE5 B;  4DQO C;  2YLM A;  4I6P A;  4LJP B;  2RDB C;  2BKR B;  2Z8L A;  2FID A;  5IKC M;  3HRD D;  4BFR A;  4JX1 C;  2ZW0 A;  2DZK A;  1GC6 A;  3I57 A;  1SXT A;  4HDO A;  1M4V A;  3OLM D;  4TUU A;  1PGA A;  3TEX A;  4MSQ B;  1KJT A;  4DHJ D;  4EE2 A;  5D94 A;  1WYW B;  2PEA A;  4IM0 A;  3ABV B;  3PRM B;  4KV2 A;  1NI2 A;  1JQ4 A;  1IGC A;  3HVZ A;  4JL9 A;  4FA6 A;  3ZQ4 A;  3B2G A;  1TY2 A;  1WZ0 A;  3PSE B;  5CHF A;  4DXF A;  1D4B A;  1GJZ A;  3BVM A;  4FLH A;  4WIP A;  2LGY A;  1NEK B;  3BII D;  3JSV B;  1WJU A;  3PRP B;  1L0X B;  2QEJ C;  2IBI B;  3IVF A;  4GB9 A;  1ZW7 A;  2KYW A;  4I6L B;  1XXG A;  2QMT A;  4DBG A;  3T8M A;  1F1H A;  1V2Y A;  3Q6B A;  3MHZ A;  1N6Z A;  3Q3F A;  1QOG A;  2D07 B;  1V1P A;  1WXQ A;  4OZC A;  4CO7 A;  2O2V A;  1R4M B;  3L08 A;  2V3N A;  1I7H A;  4KKI A;  5MPO A;  2ZPY A;  2K3U A;  3SDL C;  4XWW A;  2ZCB A;  1XQQ A;  1OGW A;  2LWP A;  5J17 A;  1E8Z A;  3AE9 B;  4KIK B;  3SFE B;  2WDQ B;  4XE0 A;  2WDT B;  2L3Z A;  4XX5 A;  2NBU A;  3Q2A C;  2V4I B;  2LVQ A;  2KC2 A;  3AU4 A;  3BVZ A;  2N7D A;  2LHD A;  2UWQ A;  2QSD A;  1VRA B;  4C7Y A;  2CHW A;  3TUO A;  4N9F 4;  5C1Z A;  1TT5 B;  1WJ6 A;  4W9C A;  3BZD B;  3RPF C;  2J0M A;  3KYD D;  1YIW A;  4MGI E;  2X38 A;  1JRP A;  4FJZ A;  1L0V B;  4BKS A;  2GBJ A;  1B1Z A;  3EGR A;  1L7Y A;  5DCN A;  1WYG A;  2ZJD A;  3VTW A;  1CK1 A;  2QCZ A;  3M3J A;  2JZ3 B;  4EOY A;  3NUH B;  1T0S C;  2BT6 A;  2NR2 A;  2CJN A;  2ZVN A;  1J7A A;  1P7F A;  2W3R A;  2AQ3 B;  3UIN B;  1FO4 A;  4KGR A;  2LUM A;  1ZKH A;  3IT4 B;  2VZK B;  3N32 A;  3ZTC A;  3RZW C;  1I4P A;  1WE7 A;  1TY0 A;  1YX6 B;  2KN4 A;  3JSV A;  4EEW A;  1WXM A;  1KF6 B;  2C9W B;  2FBW B;  4HDQ A;  2K0P A;  5FR3 A;  2RPQ A;  3A9J B;  4W9F A;  3PLU A;  2BWE S;  4ASW C;  4IC7 B;  1QQR A;  4C4V B;  1SE2 A;  3AEC B;  2D11 A;  4ANW A;  1RFK A;  3MJW A;  1L4Z B;  5G5H A;  1WE6 A;  1JCK B;  5IA7 A;  2KT7 A;  4IG7 B;  3V05 A;  4B9K A;  4ZRI A;  2L0T A;  2NBW B;  1V86 A;  3VTV A;  2BWF A;  2WXF A;  4YT0 B;  4DK5 A;  3IG3 A;  1YQ4 B;  2LGI A;  2KMC A;  5DPT A;  2FUH B;  2BS2 B;  3E56 A;  1TKG A;  2VH1 A;  2ONQ A;  5JHA A;  4K7S A;  1T0Q C;  3KUC B;  2CU1 A;  1VR9 A;  1WX8 A;  2QC8 A;  5JXV A;  4ZHO A;  3RCZ A;  2LVO A;  2CU3 A;  3MHS D;  3AUL A;  3B9J A;  2HDE A;  2Z0E B;  1KTK A;  2PMV A;  2LFI A;  1FRD A;  4YXD B;  1QLB B;  1NI3 A;  1YJI A;  2D10 A;  1MJD A;  3HVD A;  2IND C;  2J4X A;  2KO3 A;  4YWG G;  3NVW A;  1QF6 A;  3NVZ A;  1E10 A;  4XDC A;  1OEY J;  2V1Y A;  1YN3 A;  4NNJ B;  3PZ7 A;  2RPV A;  2VZK D;  1XO3 A;  4B95 A;  3ZNZ B;  4A9A A;  4C7Z A;  4XZ4 A;  1TBE A;  3SEB A;  4DHZ B;  2KWU B;  4ZRK A;  1SE4 A;  3PLV A;  3W5U B;  4G11 A;  4RF1 A;  3LYY A;  3QWZ B;  1E7U A;  2D2Q A;  1ZE3 D;  3AEG B;  4ACF A;  4W9G A;  3QX1 A;  2M4N A;  2CHZ A;  2KHW B;  3ZJU A;  3E9S A;  2FCN A;  2JU6 X;  3VUY A;  1UBI A;  2EMT A;  2LXA A;  4XGA B;  5DPS A;  3R2I A;  1C3T A;  2FCM A;  3ZNH B;  2KDM A;  2MCN B;  2HJ1 A;  3PTF C;  1UBQ A;  3PV1 A;  3VHT C;  3AV8 A;  2KMA A;  2YVC A;  4YSY B;  1KOT A;  2AL3 A;  3FAH A;  2OED A;  3OG5 A;  1PGB A;  1NDD A;  2K8C A;  4FHK A;  1FNV A;  1C79 A;  4DHZ E;  1FPY A;  4LNN A;  2UU7 A;  2WU5 B;  2LRU A;  3ML9 A;  5D6J B;  3ETR A;  1XCQ L;  1DOI A;  1UF0 A;  3BYT B;  3QIJ A;  5TSS A;  2LHE A;  3T3N A;  4JWU C;  2WXN A;  3IAS 1;  4WH4 A;  4EZL A;  1AWD A;  4IWQ A;  4IOI E;  4XWT A;  1P1A A;  5CX3 A;  2C7N B;  2AWT A;  2V4L A;  1N60 A;  2G4S A;  4IM3 A;  4TSS A;  4KVG B;  3V61 A;  1YNT E;  3ZO5 B;  2KTF A;  2JPH A;  1XCT L;  2O6V D;  5FR6 A;  3RUI B;  2NCN A;  3AEA B;  3EC8 A;  2CR5 A;  1JWB D;  3KUD B;  3P4R B;  3ECI A;  2EKI A;  4NAW B;  2M19 A;  1A5R A;  2RR9 A;  1XLN A;  3ZGZ A;  3A1Q B;  4BOS C;  2HTH A;  1E8Y A;  2MX2 A;  2MRP A;  2V3S A;  3A4S C;  3R3M A;  1SJE D;  5DPR A;  1ZOY B;  4BVU C;  2IGG A;  1WM2 A;  1ET6 A;  3AE7 B;  4HRO A;  2JRH A;  4CYE A;  4AWJ A;  4K7U A;  3L17 A;  3I63 C;  2WDR B;  4ZRQ A;  2KZR A;  3MJ5 A;  4K3C A;  2N9K A;  4A90 A;  2WX0 A;  3RNF C;  3LXF A;  1EUV B;  4MGZ E;  2NBV B;  2A5U A;  2MBB B;  4NPN A;  4FAD A;  3OAW A;  2XK5 B;  4NAM A;  1TKE A;  2FNJ B;  2PE6 B;  1YX5 B;  2BYF A;  2C7M B;  1S3S G;  1E8W A;  4OZA A;  2I2Y A;  1P9D U;  1WM3 A;  5JH5 C;  2ZPN A;  3VXW A;  3VH3 B;  1E6E B;  4EKU A;  4WJP A;  1N5X A;  1L0Y B;  3BVG A;  2KMM A;  4II3 B;  1E7V A;  3GE3 C;  4GOC A;  1KLV A;  1F0Z A;  2V3P A;  1FXA A;  1MVK A;  3APD A;  3Q3J A;  3DVN V;  4WQO B;  3AEF B;  5JZE B;  2N0S B;  3PRZ A;  3H6N A;  4XC2 A;  3QC8 B;  4GGQ A;  4R3D A;  5IO9 A;  2NS5 A;  4F8C B;  2WQY B;  3PZ8 A;  1GNU A;  3W9C B;  3L54 A;  5G5G A;  5I4D A;  2KTR B;  3L4P A;  1WGK A;  2OJW A;  4IWP A;  1CJE A;  2GLS A;  4KX6 B;  2NPT B;  4HKZ E;  2KK8 A;  3AE2 B;  1PDX A;  2WS3 B;  1CQV A;  3N20 C;  3O13 A;  3C19 A;  3AN1 A;  3H9D A;  3RNG C;  1PGX A;  3C0R B;  4DHJ B;  4WJN A;  2I38 A;  2N9X A;  2EEL A;  3X23 A;  2SEB D;  1ZXH A;  1VZ8 A;  3JW0 X;  4LNI A;  2K1F A;  4AJW A;  5C23 A;  1BUI C;  1ZUD 2;  1GB4 A;  1J7B A;  3HUI A;  3ZIM A;  2LEK A;  2PE9 A;  1Q10 A;  4N58 A;  2I1K A;  1OQR A;  1STE A;  2CJO A;  5AZH A;  1VZ7 A;  1F2R I;  2DX5 B;  1I4H A;  5BMI A;  4YL8 A;  1OEY A;  2Y5B B;  3HM6 X;  1DGJ A;  3KVF B;  2DYO A;  3CWI A;  3V3X A;  1JRO A;  2J52 A;  1ZDX A;  1I4G A;  3H7P B;  4M02 A;  1UEL A;  3KW5 B;  4DDG D;  5KHQ A;  4XYC A;  2LGS A;  4HWI B;  1ZP0 B;  4BKT A;  4TV3 A;  5LXI B;  2R2Q A;  1QKZ A;  2PJH A;  5EE0 A;  1SSN A;  2WXO A;  3LDZ E;  2L76 A;  3EFU A;  4P6V F;  1UZX B;  2EKE C;  1JWU D;  1N61 A;  3UI3 A;  4RF0 A;  4MDK E;  2QHO A;  1RYJ A;  1RLF A;  2GB1 A;  3KQ4 A;  2W82 A;  3TEY A;  3ML8 A;  2WX1 A;  4WWP A;  3WAO A;  2NPT A;  4AOF A;  1QOB A;  2M8S A;  1OTR B;  2M17 A;  3DBS A;  2L32 A;  2LMC A;  1XF5 L;  4A55 A;  5BMG A;  4M0W B;  4PS7 A;  1WJN A;  3V60 A;  4MEL A;  3A9K B;  2W9N A;  2V0G A;  3DPD A;  1MHH E;  2KAJ A;  2IZV B;  3DHH C;  4KZ0 A;  2FCQ A;  4P1C C;  4RGN A;  1I35 A;  1SE3 A;  2WWZ A;  2MP2 B;  3QAR A;  3PPA A;  4HJG E;  4HRS A;  2I1J A;  3ZNI D;  4MM3 B;  1TZ1 A;  2LI5 A;  3LJ3 A;  2G3Q B;  2MH7 A;  1WMH B;  3NS1 A;  1XLQ A;  4HCP B;  4E71 A;  1FEH A;  3C8Y A;  5HG2 A;  1HE8 A;  4NJC A;  2JF5 A;  4NJ6 A;  1K50 A;  4FXC A;  3WA0 A;  4RCO A;  1Z5S B;  3AU5 A;  2MBQ A;  1TS3 A;  3H7P A;  2MLB A;  4M8N A;  2MA9 B;  3EHV A;  1V6E A;  3N1Z C;  1YMH E;  4NJ7 A;  3NJT A;  2K39 A;  1DOX A;  3WCQ A;  1TJE A;  3AEE B;  4N59 A;  3H8H A;  1KRH A;  1NEN B;  4LTU A;  4K81 A;  1PYW D;  1MG4 A;  3ZYY X;  2GBN A;  3ZVV A;  3DBH I;  3APF A;  2IDY A;  4EUT A;  4AUQ C;  3DDC B;  3WAL A;  1QOF A;  1JAL A;  1VLB A;  3DVG X;  5EE1 A;  2B76 B;  3N30 A;  2KN5 A;  3DBL B;  2WGS A;  2WDV B;  4ANU A;  1HEZ E;  1WX9 A;  1GOZ A;  2N7E A;  2GOW A;  2UYZ B;  5D3D A;  2MWS B;  4ICU A;  4GDK B;  2INP E;  2TSS A;  4IDI A;  1WFY A;  2WXI A;  3VUX A;  4ZYN A;  2KFJ A;  2DBY A;  4URK A;  1GPX A;  5IAA C;  2ZEQ A;  1KLG D;  2HJ8 A;  2MP2 A;  4PYZ A;  3VQI A;  1J8C A;  3MC9 A;  4MM3 A;  1MHX A;  3GOE A;  2LVP A;  4MGY E;  1BML C;  1EWC A;  1WR6 E;  2K9X A;  4EZJ A;  1WZ3 A;  4RH6 A;  2XNA C;  1WMH A;  2L8J A;  4ITK A;  3KYC D;  3U8Z A;  2INN E;  3P4P B;  4M01 A;  3NG0 A;  4AP4 C;  2AEH A;  5EDS A;  5EE9 A;  2FAZ A;  4LCD E;  2LXC A;  1GC7 A;  4DWF A;  2JXT A;  1IUE A;  1ACC A;  3DVG Y;  4LK0 M;  2DYM A;  4KIK A;  1L6V A;  3TIX A;  3KUZ A;  2PVG C;  3W1S C;  4W9L A;  3ZJV A;  3LB8 C;  4YTN B;  3NHE B;  3GZN B;  5EE3 A;  4KDI C;  5FK9 C;  5LLI A;  5E6N A;  3ZDM C;  2KLG A;  1ISN A;  3UIO B;  2L0F A;  3GS2 A;  3WAN A;  4JGH B;  1FFU A;  2OOB B;  4GIV A;  1AYF A;  2NVU I;  5AEK B;  3QK0 A;  1LGR A;  3AH7 A;  2O6V B;  5BYS A;  4BZA A;  4YTP B;  3PT2 B;  1Q5W B;  1K53 A;  2DZI A;  2DYB A;  2LJ5 A;  1S1Q B;  1JW9 D;  4II2 B;  2MHJ A;  2K6D B;  2BS4 B;  5BMH A;  4HCN B;  3HM3 A;  4B6W A;  2W55 A;  1SEB D;  1K51 A;  1AW7 A;  2GRI A;  2JWZ A;  5BYR A;  2NTS A;  4WUR A;  4WAF A;  4GSW A;  3N1X C;  3I9V 1;  1PQS A;  1C76 A;  2N4F A;  1UNS A;  4L23 A;  1UD7 A;  4JWS C;  3A9J A;  3NVY A;  2V9H A;  3EA6 A;  2JWU A;  4C4V A;  2MQJ A;  1P98 A;  2HD5 B;  3R66 C;  2REX A;  1R4N I;  2JY6 A;  4OVU A;  1GG3 A;  1WI0 A;  3WAP A;  2N1V A;  1WH3 A;  4KDL B;  3DWG C;  3DCG A;  4HJK A;  3TJP A;  4LNO A;  3NVV A;  1WGR A;  1PFD A;  1HTQ A;  2M56 B;  1BT0 A;  3AEB B;  3JYU A;  2DAF A;  3VUW A;  4MJS B;  2CHX A;  2N9P C;  3EUB 2;  4GDL B;  4IKG A;  1G6J A;  1T0Y A;  2N9L A;  3A33 B;  4LDT B;  2PPH A;  4LNK A;  4E74 A;  2WXH A;  1WXS A;  2JYE A;  1EM7 A;  3ZRC A;  4F1S A;  4MSM B;  2KKC A;  4RM9 A;  5HFY A;  3RN9 C;  2DHZ A;  1WJ4 A;  1N5W A;  1IPG A;  2O6V A;  2WXP A;  2IO1 B;  1FCL A;  2KXJ A;  2KDF B;  2JRI B;  2QDF A;  4W9E A;  3BWU D;  1H4R A;  2BYT A;  2MJE A;  2Y3A A;  3P63 A;  1N63 A;  1D5M C;  1IGD A;  1SF0 A;  2DEN B;  5J18 A;  1WWT A;  4FBJ B;  2Z0D B;  1UWM A;  2AL6 A;  2Y5P A;  1F77 A;  2BYV E;  2AX5 A;  3UGB B;  1L5P A;  1ENF A;  4L2Y A;  1YD8 U;  3AM9 A;  1N62 A;  1MG8 A;  2R2O A;  3P42 A;  5IN7 A;  2MW5 A;  4HEA 1;  1ZGU B;  4BAX A;  3Q8E A;  4ICV A;  1VCB A;  2WLB A;  4MT5 A;  1F52 A;  1QZE A;  2ACZ B;  4ZOH C;  1K8R B;  1ET9 A;  3FIL B;  3OJ3 A;  4MH0 E;  5C3J B;  4B0M A;  1FCC C;  1GUA B;  5C2T B;  2INC C;  3GB1 A;  2Z59 B;  3TBL D;  4DDI D;  1EO6 A;  2K5P A;  5HKH A;  2PKO A;  2GMI C;  4P16 A;  4ZYS A;  4LLG M;  3IBE A;  1DYQ A;  4A6Q A;  1V5O A;  1E7P B;  3RT3 B;  4C00 A;  4GDL A;  4LDT D;  1WGG A;  1C78 A;  2DLB A;  4HPM B;  3T9L A;  3VR8 B;  1L2N A;  1HZ6 A;  1HQR D;  2K25 A;  3M62 B;  1YN5 A;  1YJ1 A;  2ZW1 A;  2BB5 A;  1TS5 A;  1R7S A;  3SHQ A;  5J2R A;  4ZHP A;  1UGJ A;  3M63 B;  2H88 B;  1IBX B;  5H8Y E;  2QJL A;  4WWM A;  3U2S C;  3QA8 A;  2E6X A;  1V49 A;  4ZRJ A;  4A20 A;  4WQM A;  3Q8A A;  4NAW A;  4TMA B;  2WXL A;  3M95 A;  1WGY A;  3VH4 B;  3A1Q A;  3NS8 A;  3ALB A;  3L10 B;  1UH6 A;  2HTM E;  3APC A;  5CTR C;  4W9I A;  3N9Y C;  1EU3 A;  2CS4 A;  3GP7 A;  4FHJ A;  2KDE B;  2IO3 B;  4E3C A;  2J0K A;  2BF8 B;  1V5T A;  3SFD B;  3SU8 X;  3K9P B;  4HLE A;  1YQB A;  1WXA A;  4L1B A;  1HZ5 A;  2C60 A;  2JZZ A;  2XK5 A;  2LUE A;  3QJZ A;  3ZLZ A;  4PT5 A;  2KDI A;  4MEM A;  1I4R A;  1NVI D;  4BBN F;  1BXT A;  3SR6 A;  2WHI A;  1ESF A;  1NYR A;  3R8B A;  3U7D A;  3I5J C;  3Q3M C;  1SIJ A;  4FN2 A;  4J3O D;  2N7J A;  4FJV B;  5JHB A;  2KX0 A;  1WIA A;  2QIL A;  2DZM A;  3P4Q B;  2M0A A;  2PTL A;  1JWA D;  1NBF C;  3ZDT A;  4NZL B;  1UUP A;  2KFK B;  2NTT A;  2JXX A;  1A70 A;  1WX7 A;  5HI1 A;  3Q14 C;  2BYE A;  3A4R A;  4RM8 A;  4J6I A;  1Q1O A;  4PS3 A;  1TS2 A;  4RGO S;  1EU4 A;  1TYG B;  1MI0 A;  3T3O A;  5AUI A;  3ZW3 A;  1WR1 A;  2D3C A;  3V6E B;  1K52 A;  1F9J A;  3ZXR A;  2C7H A;  1OFF A;  2KTR A;  5LXH A;  3AE1 B;  2C5L C;  3P4S B;  4G3X B;  4GMV A;  4LJO B;  3K9O B;  2E3T A;  1V8C A;  2KAN A;  2VH2 A;  3TL5 A;  1EF1 A;  4BBN C;  2R61 A;  2ASQ A;  1HXY D;  1FIQ A;  1T5X D;  2GI9 A;  5CHV C;  2RDG A;  3SD5 A;  3W1Y A;  4WAA A;  1KLU D;  5BO4 B;  1PUT A;  2IY0 B;  2BS3 B;  3PS6 A;  2KLC A;  2IO2 B;  3BY4 B;  4BKG A;  3B0A A;  2WNM A;  3R7R A;  1T3Q A;  1JWM D;  3RNB C;  3DOW A;  2WXM A;  1Q0W B;  3IHP C;  2LJI A;  2XEW A;  1V1O A;  2IYD B;  3IFW B;  3RMK C;  1TKY A;  3H1U A;  2QIE B;  4M8M A;  4Q2J A;  3FKY A;  2LGD A;  3L0W B;  3WAM A;  4YTM B;  3NZU A;  3QQ8 B;  1FFV A;  1U4A A;  3NZ3 A;  3HK0 A;  1FM0 D;  1SIF A;  1I42 A;  1XLO A;  2BVC A;  1WF9 A;  2ICI A;  1V9J A;  3NZS A;  2EMS A;  3VVW B;  3KWL A;  2L52 A;  5LNK 1;  1FXI A;  4WJQ A;  1QT9 A;  1P7E A;  1C4C A;  2XN9 C;  4FJY A;  2IGH A;  3RYT A;  4W9D A;  3ZKJ C;  2KFK A;  2FUG 1;  2GBR A;  5KHO A;  1RRB A;  2ON8 A;  4KKJ A;  2MBE A;  2M0X A;  4AS1 A;  4MGK E;  4KGT A;  3AE8 B;  5E6O A;  1FXT B;  1D5X C;  4UDU C;  3NRZ A;  3P2B A;  4ARI A;  4G0N B;  4RGT A;  2ZCC A;  2DAJ A;  1C4P A;  4WJO A;  2BBC A;  4MAC A;  1E9M A;  2AYO B;  4OZB A;  3DWM A;  1VJK A;  1XD3 B;  3W1S A;  1SE9 A;  3AB5 A;  3QHT A;  3BK2 A;  2G1E A;  1ZPS A;  1M94 A;  2RMM A;  3IAM 1;  5D3I B;  5G2N A;  2ZNV B;  4W9J A;  3VR9 B;  3NY5 A;  3GE8 C;  4FUL A;  4M0W A;  3CF6 E;  3AXC A;  1SGH A;  2IJ0 A;  1P0R A;  4BKS D;  5E6P A;  3A9K A;  2KOX A;  3PZD A;  2B3A A;  1QIL A;  3Q69 A;  1Z2M A;  2J42 A;  2JX5 A;  2G4D B;  4ANX A;  3VRA B;  3ZXV A;  1KH0 A;  1IYF A;  3ZJT A;  3MFG A;  3PGE A;  3RUL A;  4EZK A;  3PHW B;  3ZUN A;  2KQS A;  3PVL A;  1SB3 C;  4MH8 A;  3AI5 A;  3AE4 B;  2KVR A;  3OWE B;  1CMX B;  2WP9 B;  2OJR A;  4PS8 A;  4ZRP A;  5AUK A;  4M00 A;  3RZF A;  3R2T A;  3X0W A;  3BIN A;  1C77 A;  3IT6 B;  2LD9 A;  2HE7 A;  2L83 A;  3VTU A;  2PIA A;  3DQV A;  1Y56 A;  1UGM A;  3VFK A;  3DVN U;  2A4Z A;  3V6C B;  1B9R A;  4JPS A;  4GLS C;  1VZ6 A;  4C80 A;  3ZTD A;  2W3S A;  1RWS A;  2D3B A;  2KX3 A;  4C56 C;  2W54 A;  2XBB C;  5FKA C;  1OQY A;  2K8B A;  4ANV A;  2PLP A;  4YSX B;  3RI7 C;  2G45 B;  1J19 A;  2IPK D;  2JSV X;  3TEZ A;  3TCA A;  3I3T B;  2J7Q B;  3O65 B;  3PHX B;  1C9F A;  1L6U A;  1WSP A;  2VRR B;  5CHW A;  1OQQ A;  3CMM B;  1TIF A;  4GDK A;  1T6B X;  1LO5 D;  4US9 A;  2LZ6 A;  2AQ2 B;  2OHF A;  2L05 A;  3U52 E;  1FD6 A;  1YQ3 B;  1J7C A;  2YEP B;  3TMP B;  5E6J A;  2MJ3 A;  1JWS D;  3DBR I;  4CQN A;  4RNA A;  1KM7 A;  3MC8 A;  1D5Z C;  2J53 A;  5AZF A;  3RNE C;  2WYQ A;  4O1N A;  3FC4 A;  1V81 A;  1YOV B;  2MBH A;  2K22 A;  4YSZ B;  2IO0 B;  2KWD A;  4QAY A;  5DPW A;  4K7W A;  4F7Z A;  1C1Y B;  2KJ6 A;  1TGZ B;  1WY8 A;  1GAQ B;  2KNB A;  4NQK E;  2N9E B;  2PVO D;  1WRD B;  4P7I A;  4BOZ B;  1EWY C;  4KSL C;  2BTE A;  2WXG A;  4HXD A;  3S2A A;  3UF8 A;  4TKN A;  1H8C A;  2DNF A;  4B0E A;  3B08 A;  1XEE A;  2RDH A;  4DXG A;  3JVZ X;  1UWX A;  4XDD A;  1CZP A;  1VDV A;  3DHG C;  5H92 C;  3RFZ B;  3KWV A;  2BB6 A;  1JML A;  1XT9 B;  3DHI C;  3ONS A;  4KZC A;  3BYY B;  1J0G A;  3KLS X;  2ZNV C;  2WXJ A;  2L7R A;  4JQW C;  2WU2 B;  2WXQ A;  4H2A A;  4OVZ A;  4IWO A;  2SAK A;  3HIZ A;  3PO0 A;  2BQQ A;  1QOA A;  3R7Q A;  1YN4 A;  4JIO U;  2FIF A;  2GBM A;  4I6N B;  2IY1 B;  4W9K A;  4WWO A;  4US8 A;  1AN8 A;  4AQ7 A;  3H7S A;  4REZ A;  4CHK A;  3IXS A;  3TEW A;  4A8X C;  2IGD A;  1LM8 B;  5GMV A;  3QCA A;  4W9H A;  5GXG B;  3W2D A;  1ZXI A;  4HPP A;  1MFW A;  3DBH B;  1LQB A;  3ZRF A;  2JZP A;  5L83 A;  1TZO A;  4IM2 A;  5L95 C;  1AAR A;  2LRW A;  4ZDV A;  4K1R B;  4PYU A;  1JRU A;  2JYT A;  4N6E B;  2NMQ A;  2BW2 A;  2KJH B;  3RNA C;  4LNF A;  2MBO A;  3CSF A;  3EEC A;  4RMA A;  2J0J A;  2FCS A;  3MP9 A;  1R4M I;  1C4A A;  4RFB A;  2YEP F;  4JE3 B;  2LAS A;  2ZVO A;  4IW0 A;  4P1B C;  2KVZ A;  3V62 A;  3UQB A;  1LFD A;  3U30 A;  4KSK C;  3TSS A;  3Q3N C;  3VRB B;  2RGF A;  2AQ1 B;  4TQ0 A;  1TTN A;  1F2R C;  5AZG A;  2KD0 A;  2KWV B;  1E5W A;  3J9C A;  3Q3O C;  5D7G A;  4OW0 A;  4S17 A;  4S0R A;  3OJ4 B;  3AE6 B; 
#chains in the Genus database with same CATH homology
 1TS2 A;  4RGO S;  1EU4 A;  1HEZ E;  1TYG B;  3SEB A;  1MI0 A;  1GOZ A;  3T3O A;  1RM6 C;  5AUI A;  1SE4 A;  3W5U B;  4OHJ A;  5D3D A;  4RF1 A;  3LYY A;  1K52 A;  1ZE3 D;  3AEG B;  4GDK B;  1OFF A;  1XLP A;  2INP E;  2TSS A;  4IDI A;  3AE1 B;  3P4S B;  1I4X A;  2E3T A;  1V8C A;  2WXI A;  3ZJU A;  3E9S A;  1L4D B;  2R61 A;  1SJH D;  2JU6 X;  3W5V B;  1HXY D;  1FIQ A;  1T5X D;  2DBY A;  2GI9 A;  1GPX A;  2WXR A;  2RDG A;  3R2I A;  1KLG D;  1E0Z A;  2KDM A;  1KLU D;  1PUT A;  3VQI A;  2BS3 B;  3AV8 A;  4YSY B;  2L1A A;  1MHX A;  2Q5W D;  3FAH A;  2OED A;  4TQ1 A;  2DWQ A;  1PGB A;  1BML C;  2WNM A;  1EWC A;  1GB1 A;  2K9X A;  4KGS A;  1FNV A;  1T3Q A;  1C79 A;  2MEK A;  1JWM D;  2XNA C;  4RH6 A;  5HHD G;  4ITK A;  2WXM A;  2LJI A;  1V1O A;  3P1M A;  2INN E;  1NYQ A;  2JQR B;  4USA A;  2WU5 B;  2G9H D;  1TKY A;  3U4E G;  2QIE B;  1XCQ L;  3ETR A;  1DOI A;  3P4P B;  5T8I A;  1FMA D;  3BYT B;  4Q2J A;  2KQ4 X;  5TSS A;  2H89 B;  1WRI A;  2LHE A;  3T3N A;  3Q8B A;  5EE9 A;  4JWU C;  2WXN A;  3IAS 1;  4YTM B;  4WH4 A;  1AWD A;  4IOI E;  4XWT A;  1FFV A;  1FNU A;  2JXT A;  4D2K A;  1DOY A;  3NZ3 A;  1FM0 D;  1IUE A;  1XLO A;  1N60 A;  4RGM A;  1HA5 A;  1ACC A;  2ICI A;  4LK0 M;  2KAC A;  4TSS A;  3CIR B;  1YNT E;  2DYM A;  1L6V A;  1FRR A;  1XCT L;  3AEA B;  3KWL A;  2L52 A;  2PVG C;  1I4Q A;  3ZJV A;  5LNK 1;  1V97 A;  2FE8 A;  3AE3 B;  1JWB D;  3LB8 C;  4YTN B;  1FXI A;  5EE3 A;  5FK9 C;  1QT9 A;  1P7E A;  3P4R B;  1C4C A;  2XN9 C;  2EKI A;  4NAW B;  1KFY B;  3BK1 A;  2M19 A;  2IGH A;  1ROE A;  1XLN A;  3GS2 A;  3FIL A;  3ZGZ A;  1FFU A;  2FUG 1;  1AYF A;  2ON8 A;  4KKJ A;  1SJE D;  1ZOY B;  3AH7 A;  2IGG A;  5BYS A;  1D6E C;  1ET6 A;  1YJJ A;  1TS4 A;  3URY A;  4AS1 A;  2MJD A;  3AE7 B;  2PW9 A;  4HRO A;  4KGT A;  3MC0 B;  3AE8 B;  4YTP B;  1D5X C;  5BYQ A;  4UDU C;  3NRZ A;  1K53 A;  2WDR B;  4ARI A;  4ZRQ A;  4RGT A;  1FNW A;  3MJ5 A;  1ZDV A;  1SBB B;  2N9K A;  4A90 A;  3Q8C A;  3LXF A;  1C4P A;  4ARC A;  1JW9 D;  2BBC A;  4MAC A;  1V1P B;  2BS4 B;  1E9M A;  4OZB A;  3DWM A;  1VJK A;  5BMH A;  3W1S A;  2WXK A;  2W55 A;  1SEB D;  1K51 A;  1AW7 A;  3AB5 A;  3U7Z A;  4NAM A;  3BK2 A;  3AMZ A;  2GRI A;  5BYR A;  1TKE A;  2G1E A;  1ZPS A;  2NTS A;  1IBX A;  2RMM A;  4WUR A;  3IAM 1;  5D3I B;  2D5G A;  3VR9 B;  4WAF A;  3Q8F A;  3I9V 1;  4M0W A;  3B2F A;  1C76 A;  4HKQ A;  2Y5C A;  4OZA A;  3AED B;  2IJ0 A;  2I2Y A;  1UNS A;  4L23 A;  4JWS C;  3NVY A;  3EA6 A;  1MPE A;  1E6E B;  1QIL A;  3Q69 A;  1N5X A;  2JWU A;  1L0Y B;  3BVG A;  2KMM A;  2J42 A;  2JX5 A;  3AE5 B;  1F0Z A;  2V3P A;  1FXA A;  4DQO C;  3VRA B;  1KH0 A;  3ZJT A;  1MVK A;  3MFG A;  2Z8L A;  3AEF B;  3HRD D;  2N0S B;  1SB3 C;  3DWG C;  4JX1 C;  4MH8 A;  2ZW0 A;  3AE4 B;  3NVV A;  3OWE B;  1PFD A;  2WP9 B;  3I57 A;  4R3D A;  2M56 B;  1SXT A;  1M4V A;  3AEB B;  2WQY B;  4ZRP A;  5AUK A;  1PGA A;  3TEX A;  3PZ8 A;  3R2T A;  1C77 A;  4GDL B;  3EUB 2;  4IKG A;  3W9C B;  4EE2 A;  3IT6 B;  5G5G A;  5I4D A;  2N9L A;  3ABV B;  2L83 A;  3L4P A;  1WGK A;  2PIA A;  1CJE A;  2WXH A;  4KX6 B;  1JQ4 A;  1IGC A;  1Y56 A;  4HKZ E;  3AE2 B;  2JYE A;  1EM7 A;  3HVZ A;  1PDX A;  2WS3 B;  3ZQ4 A;  3B2G A;  1TY2 A;  1B9R A;  1CQV A;  4DXF A;  1D4B A;  3O13 A;  3BVM A;  5HFY A;  4WIP A;  4JPS A;  4GLS C;  1NEK B;  3AN1 A;  3BII D;  1N5W A;  1VZ6 A;  4C80 A;  1L0X B;  1PGX A;  2QEJ C;  2WXP A;  2W3S A;  2I38 A;  1RWS A;  2EEL A;  2SEB D;  1ZXH A;  1VZ8 A;  1FCL A;  1XXG A;  4C56 C;  2W54 A;  2QMT A;  5FKA C;  1BUI C;  1ZUD 2;  3BWU D;  2PLP A;  4YSX B;  2BYT A;  1J7B A;  3HUI A;  1GB4 A;  2MJE A;  3MHZ A;  2LEK A;  2Y3A A;  3P63 A;  1QOG A;  1V1P A;  1WXQ A;  1N63 A;  1D5M C;  1Q10 A;  2IPK D;  4OZC A;  1IGD A;  2JSV X;  1SF0 A;  4N58 A;  3TEZ A;  2V3N A;  1WWT A;  1I7H A;  1OQR A;  4KKI A;  1UWM A;  5MPO A;  2Y5P A;  1F77 A;  2K3U A;  1STE A;  2AX5 A;  2CJO A;  4XWW A;  1C9F A;  1L5P A;  1VZ7 A;  1L6U A;  1F2R I;  1ENF A;  1I4H A;  1WSP A;  4L2Y A;  3AM9 A;  1OQQ A;  5BMI A;  3AE9 B;  1T6B X;  2WDQ B;  1N62 A;  1LO5 D;  4US9 A;  4XE0 A;  3SFE B;  3P42 A;  2AQ2 B;  1DGJ A;  2OHF A;  4HEA 1;  2DYO A;  3CWI A;  3V3X A;  2V4I B;  1JRO A;  3U52 E;  3Q8E A;  1FD6 A;  2J52 A;  3BVZ A;  1YQ3 B;  1J7C A;  2WLB A;  1ZDX A;  1I4G A;  2MJ3 A;  2YEP B;  1JWS D;  5E6J A;  4MT5 A;  2ACZ B;  2LHD A;  2QSD A;  4CQN A;  4ZOH C;  1VRA B;  4RNA A;  3TUO A;  4C7Y A;  1ET9 A;  3FIL B;  1D5Z C;  1ZP0 B;  2J53 A;  4B0M A;  5C3J B;  3BZD B;  1FCC C;  3RPF C;  1QKZ A;  5C2T B;  3GB1 A;  5EE0 A;  1SSN A;  2K5P A;  4O1N A;  2PKO A;  2WXO A;  3FC4 A;  4P16 A;  4ZYS A;  4LLG M;  2X38 A;  1JRP A;  1L0V B;  2K22 A;  1DYQ A;  4P6V F;  4A6Q A;  1B1Z A;  4YSZ B;  3EGR A;  1JWU D;  1N61 A;  3UI3 A;  1E7P B;  4RF0 A;  1WYG A;  2KWD A;  1CK1 A;  3NUH B;  1RYJ A;  2BT6 A;  2GB1 A;  3KQ4 A;  1C78 A;  1GAQ B;  2DLB A;  2W82 A;  3VR8 B;  3TEY A;  2CJN A;  1HZ6 A;  2PVO D;  1HQR D;  1J7A A;  1P7F A;  2W3R A;  2AQ3 B;  1EWY C;  1YN5 A;  2BTE A;  2ZW1 A;  1FO4 A;  4KGR A;  2BB5 A;  2WXG A;  1TS5 A;  1QOB A;  2LUM A;  3IT4 B;  1R7S A;  2VZK B;  4B0E A;  1I4P A;  1UGJ A;  4ZHP A;  1XEE A;  2L32 A;  1TY0 A;  2RDH A;  2H88 B;  2LMC A;  4DXG A;  1IBX B;  2KN4 A;  5H8Y E;  2QJL A;  4WWM A;  1UWX A;  1KF6 B;  1XF5 L;  1CZP A;  1VDV A;  4XDD A;  5H92 C;  3U2S C;  5BMG A;  4A55 A;  3RFZ B;  2E6X A;  3KWV A;  2BB6 A;  1JML A;  2FBW B;  4WQM A;  2K0P A;  3BYY B;  5FR3 A;  3Q8A A;  2V0G A;  4TMA B;  2WXL A;  1MHH E;  3KLS X;  2KAJ A;  2WXJ A;  1QQR A;  1SE2 A;  4RGN A;  1SE3 A;  3AEC B;  2WU2 B;  2WXQ A;  1RFK A;  4H2A A;  4HJG E;  4HRS A;  4OVZ A;  1L4Z B;  5G5H A;  2HTM E;  4MM3 B;  1JCK B;  2SAK A;  3PO0 A;  3V05 A;  3N9Y C;  1EU3 A;  1QOA A;  1YN4 A;  3GP7 A;  2WXF A;  4YT0 B;  2MH7 A;  3NS1 A;  1XLQ A;  4US8 A;  1AN8 A;  4AQ7 A;  4REZ A;  3SFD B;  1FEH A;  1YQ4 B;  2LGI A;  3C8Y A;  5HG2 A;  3IXS A;  3TEW A;  4A8X C;  2IGD A;  2BS2 B;  3E56 A;  1TKG A;  4NJC A;  3W2D A;  5GXG B;  2ONQ A;  1ZXI A;  1K50 A;  4FXC A;  1HZ5 A;  4L1B A;  4RCO A;  2JZP A;  1TZO A;  1TS3 A;  4PT5 A;  1VR9 A;  1I4R A;  2JYT A;  4N6E B;  1YMH E;  1NVI D;  2NMQ A;  1BXT A;  3SR6 A;  2BW2 A;  1DOX A;  3WCQ A;  5JXV A;  4ZHO A;  2CU3 A;  1ESF A;  1TJE A;  1NYR A;  3AEE B;  3R8B A;  4N59 A;  3H8H A;  1KRH A;  3B9J A;  2HDE A;  1NEN B;  1SIJ A;  4LTU A;  1KTK A;  2PMV A;  2N7J A;  4J3O D;  2LFI A;  1PYW D;  1FRD A;  3MP9 A;  3ZYY X;  4YXD B;  1C4A A;  1QLB B;  1NI3 A;  1YJI A;  2QIL A;  3HVD A;  3P4Q B;  4RFB A;  2J4X A;  2YEP F;  2M0A A;  4JE3 B;  2PTL A;  2IDY A;  4YWG G;  1JWA D;  3NVW A;  1QF6 A;  4NZL B;  1UUP A;  3NVZ A;  3TSS A;  1E10 A;  2NTT A;  3VRB B;  4XDC A;  1A70 A;  2AQ1 B;  4TQ0 A;  1QOF A;  1JAL A;  1VLB A;  5EE1 A;  5HI1 A;  1F2R C;  1YN3 A;  3PZ7 A;  2RPV A;  2VZK D;  2B76 B;  1XO3 A;  3J9C A;  5D7G A;  4A9A A;  4OW0 A;  4C7Z A;  2WDV B;  3AE6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...