4IDIA

Crystal structure of rurm1-related protein from plasmodium yoelii, py06420
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
122
structure length
119
Chain Sequence
b'MKVKIELKFLGGLESYLEDKSKNYVTLEIDSKELNFENLIAFIRDNIIEKKFVFSDYDIDEKLCKVMVDNKEYSNYNLKDKAKIKPGIIVLVNEYDWEILGTYSYQIKNDDKICFLSTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oryza sativa Rurm1-related
publication title Crystal Structure of Rurm1-related protein from Plasmodium Yoelii, PY06420
rcsb
source organism Plasmodium yoelii yoelii
molecule tags Protein binding
total genus 32
structure length 119
sequence length 122
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09138 Urm1 Urm1 (Ubiquitin related modifier)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4idiA00
4LTUA 1GPXA 1E10A 3HVZA 5GXGB 1WGKA 2H89B 2E3TA 1N62A 2PIAA 3AE5B 1J7CA 3AEFB 3CWIA 3HUIA 4N58A 5EE9A 4A9AA 2WLBA 2PKOA 2JX5A 5G5GA 1J7BA 4N6EB 2DWQA 3FC4A 3W5VB 1EWYC 2DBYA 5MPOA 1TKYA 2CJOA 1NYRA 3B2FA 1RYJA 2MJ3A 2W54A 2WDRB 1NVID 1QOFA 3NVWA 1N60A 4KX6B 1JQ4A 1TJEA 2BS3B 4C7ZA 1I7HA 1N63A 1PDXA 2B76B 3FAHA 1FM0D 3NRZA 5AUIA 4US8A 1OFFA 1SIJA 1J7AA 1SB3C 1N61A 2ACZB 2W55A 1YQ4B 1QT9A 2N0SB 1QOGA 3B9JA 3NVVA 2MH7A 4JWUC 3SR6A 5EE1A 5EE3A 1QOAA 2BS4B 4P6VF 1AYFA 1RWSA 1ROEA 3AE6B 1CJEA 3AE7B 2K5PA 4HROA 3ETRA 5C3JB 2K22A 1E0ZA 1FMAD 1WYGA 1UWMA 1PUTA 1JRPA 2EKIA 2G1EA 2WDQB 2Y5CA 3AEAB 3SFEB 2PVGC 3AE3B 1IUEA 1F0ZA 4HRSA 1FIQA 3P4QB 4ZOHC 4FXCA 5G5HA 3DWGC 1FFVA 1OQRA 3NVZA 1FFUA 1JALA 1XLQA 3CIRB 3DWMA 3KWLA 2PVOD 1WWTA 1SF0A 2WQYB 3L4PA 1QOBA 2CU3A 3AMZA 3W9CB 3AM9A 1YJIA 2QIEB 4JX1C 2WP9B 1L5PA 1V8CA 2W3RA 4YSZB 1KRHA 2M56B 2OHFA 3AB5A 1AWDA 3VRBB 1ZUD2 1JW9D 1FRDA 4N59A 3P4PB 1B9RA 1DOXA 3LXFA 1YJJA 1FO4A 1DOIA 4ZHOA 3AEBB 1XLOA 3AV8A 1JROA 1R7SA 2KAJA 3AE1B 4USAA 2WU2B 1TYGB 1QLBB 1ZP0B 1FXAA 2WDVB 1N5XA 3PO0A 1A70A 1XO3A 1WXQA 1L6UA 3SFDB 1TKEA 4YSXB 4ZHPA 5AUKA 3WCQA 3P4SB 4YT0B 4WQMA 5C2TB 1FXIA 3W5UB 1RM6C 1ZXIA 2LEKA 2CJNA 2HTME 4JWSC 2L52A 2K9XA 3VR9B 1E6EB 2H88B 2MJDA 3AE4B 3BIID 3NVYA 2Q5WD 1L0VB 1VJKA 2QJLA 1E7PB 1N5WA 4C80A 3AN1A 3AECB 4IDIA 1QF6A 3RPFC 1CZPA 2JQRB 2MJEA 1JWAD 1NYQA 4ITKA 1DOYA 1VDVA 1KF6B 3ABVB 3P1MA 4YTPB 1KFYB 1VLBA 4YTNB 1OQQA 3P63A 1FRRA 3LB8C 3HRDD 1TKGA 1V97A 1DGJA 1PFDA 2BS2B 3AEEB 2WS3B 3AE2B 1YQ3B 3AH7A 1L6VA 3AEGB 1NI3A 2AX5A 2FBWB 2M19A 3ZYYX 2L83A 3AE9B 1T3QA 2BT6A 3AE8B 3NS1A 3P4RB 3EUB2 2W3SA 3VR8B 3B2GA 1RFKA 5EE0A 3AEDB 1JWBD 1XLNA 5H8YE 1XLPA 1E9MA 4YSYB 4YXDB 1WRIA 2KMMA 3VRAB 2WU5B 4YTMB 1ZOYB 1NEKB 4US9A 1GAQB 1NENB 4C7YA 4WWMA 5H92C
chains in the Genus database with same CATH superfamily
3RNEC 2V9HA 3ZJVA 1J7CA 2WLBA 4REZA 4RGNA 3W5VB 4FA6A 4DHZE 2I1KA 2KFKB 2SAKA 2BPSA 3BK2A 2G4DB 1N60A 2KQ7A 1D5ZC 1MVKA 2O6VB 1FPYA 5BMGA 2WX1A 1TGZB 2K22A 1WYGA 3FILA 2WDQB 4HJGE 4HKZE 2I2YA 3DCGA 3ZXRA 2G3QB 1C4AA 1WXAA 2RDBC 2BYVE 4IWQA 2NTSA 2XK5B 3PTFC 3IAS1 1DYQA 2QIEB 2W3RA 4NNJB 2KWUB 5TSSA 4FJVB 3RN9C 4N59A 4BKSA 4A90A 3L10B 1K51A 2Z0EB 3Q3FA 3AV8A 1HTQA 2KWVB 3V3XA 1TS5A 1KH0A 2KMAA 1GC6A 2JZZA 1L6UA 1TKEA 3MHSD 5DPWA 4N9F4 1HQRD 4XDCA 1E90A 1V2YA 2LEKA 1E6EB 2QMTA 3EGRA 1QF6A 1P9DU 2JQRB 3T9LA 4YTNB 4J6IA 1WM3A 3NZSA 2MEKA 2DHZA 2WS3B 2HE7A 4W9CA 1J8CA 1AARA 3PHWB 4DDGD 2KDEB 2AX5A 4PYZA 2IGGA 3Q8EA 2K39A 1MFWA 1ZDXA 2JUOA 2DZJA 1YJ1A 4WWMA 1YMHE 2H89B 4S17A 1Z2MA 1UNSA 5I4DA 2LGXA 2DBYA 2DAFA 1B1ZA 1SIFA 3AXCA 3OJ3A 3GZNB 2WDRB 2K6QA 1QOFA 3IVFA 3UQBA 2L00B 5AUIA 2JXTA 1FM0D 3CSFA 1HXYD 4KIKA 2AEHA 4P6VF 2FCNA 3ETRA 1LGRA 1SJHD 4HEA1 4F7ZA 1C1YB 2WX0A 4ZOHC 2BYFA 2YEPF 3VAWA 3C0RB 1I4XA 3RNBC 1F77A 2PVOD 3AMZA 2CU1A 2GI9A 1Q5WB 2G45B 2NBWB 2KFKA 4DXAB 2MSED 3N20C 4KGTA 2V1YA 3MJWA 3A4RA 3AEBB 2AYOB 4RMAA 1EM7A 3N9YC 3KQ4A 1U4AA 2KAJA 4GXBA 4CO7A 1WI0A 1KLUD 3EHVA 1FXAA 4HDOA 4W9IA 1N5XA 1BMLC 4OZCA 1KOTA 4XGAB 2JWUA 3UIOB 5D94A 2LGSA 1OEYJ 2XK5A 2O2VA 2MJEA 2IY1B 3ML9A 2FCSA 4RNAA 1VLBA 1OQQA 1WIAA 2KDIA 4MGYE 2JRHA 1RAXA 3H1UA 1L6VA 4RCOA 5JH5C 2WXNA 2LHEA 1ACCA 3M3JA 1C4PA 2KQSA 4FLHA 2LRUA 2V4LA 4M0WB 3W2DA 3DVGX 2GBJA 3QC8B 1I42A 2N1WA 3AE5B 3V6CB 2K0PA 1ISNA 1ZE3D 1UH6A 4S0RA 1VZ7A 2FE8A 4EZLA 2N7JA 1LM8B 1RFAA 1RRBA 3L16A 3DHGC 5HI1A 4FJYA 3HVDA 4W9EA 4GDKA 1IUEA 2MRPA 1LQBA 2LI5A 4ANWA 1M4VA 2CU3A 3RI7C 4DBGA 2KDMA 1KRHA 5GMVA 1WGRA 4HWIB 2PE9A 3SD5A 2L0TA 1DOXA 1I35A 4ZHOA 5JHAA 4UDUC 3AE1B 4NAMA 3PSEB 1QLBB 3ONSA 2MA9B 2DX5B 4NAWB 3KVFB 4YSXB 1V1PB 2MP2B 4TQ1A 1F52A 2INDC 4ANVA 3GOEA 4YSZB 4II3B 2WYQA 3N1XC 3ZNID 3M63B 2Z8LA 5L95C 2O6VD 2RPVA 3PGEA 4IG7B 4M01A 1YX5B 3R3MA 1IYFA 2D10A 4LDTB 1TZOA 4MT5A 3ML8A 2KMCA 2KDBA 2M1MA 4ARCA 1S3SG 2TSSA 1XLNA 1UGJA 2WU5B 4YTMB 1NENB 3CWIA 4RH6A 3FKYA 4A55A 3PVLA 5HFYA 2DWQA 3ENEA 4TMAB 1R4NI 3RNAC 1YQBA 3I57A 2RSUA 3MC9A 3V62A 4TUUA 3AU4A 2KN5A 4G11A 5LXHA 2XBBC 3E9SA 2KJRA 4DQOC 2ACZB 4C7YA 1YQ4B 2CS4A 2GBMA 1E0ZA 3AEAB 2ZPYA 2K8BA 3AE3B 2AL6A 1FFVA 3NVZA 3J9CA 3KUZA 4F8CB 4ZRIA 3UF8A 3RFZB 3T3OA 3O65B 2ZW1A 4MM3A 2OEDA 3WAPA 3MJ5A 4K7UA 1XT9B 1UELA 5IN7A 2BKFA 2M4NA 4USAA 2ZCBA 2WXRA 2D3AA 2KWCA 4KKJA 4C00A 2MHJA 2GBRA 4AP4C 2CR5A 2L32A 3WIMA 4OW0A 1UWXA 1NBFC 5DCNA 5FK9C 1VZ8A 4DXFA 1JWAD 3DVGY 1XQQA 2ZW0A 3ZW3A 3KLSX 2DYBA 4HJKA 2YLMA 2C7NB 3OWEB 2BS2B 4O1NA 1KLGD 4RF0A 2MWSB 2AQ3B 4A3OA 3Q8BA 5AZFA 2IZVB 4M8NA 2N1VA 1T3QA 2REXA 3QK0A 3A1QB 2IGDA 1Q1OA 2ZJDA 2MX2A 2JVCA 2MLBA 4US9A 1A5RA 1MHXA 2E3TA 4HPPA 3VH3B 2DLBA 2IY0B 4L23A 1IP9A 1GOZA 2KOXA 1N61A 2FUHB 4DHZB 2FCMA 1V81A 5EE1A 5L83A 5D6JB 2DYMA 4HROA 2G9HD 1C76A 2Y5CA 2INPE 2FIDA 2KVRA 2J0JA 1OEYA 3TBLD 2INNE 2BTEA 3DWGC 2MBOA 1XLQA 1I4HA 1QOBA 1XXGA 4XE0A 2FAZA 2LUEA 2WXFA 3LJ3A 3ZVVA 5BO4B 4YWGG 3QIJA 3TCAA 4G0NB 4KZ0A 1RLFA 1TYGB 4X57B 1EF5A 2MW5A 3ZKJC 3MHZA 1GJZA 2J42A 3WCQA 3RD2A 3B08A 4KV2A 1TBEA 4DK5A 3R2TA 1C78A 1ZKHA 1E8XA 2K9XA 3VTVA 5C23A 5DPRA 1E7PB 3AN1A 1CZPA 1NYQA 3A9JA 2ZCCA 3U2SC 4JQWC 3VUYA 3ZLZA 5LXIB 1MJDA 1HEZE 2K25A 1PGXA 3AH7A 3GB1A 4BBNC 1P1AA 2D3BA 3AEDB 1SGHA 3CSTA 4W9GA 4NQLB 1N6ZA 1E10A 1GPXA 3QAQA 1WGKA 3VXWA 2J7QB 1FNWA 5EE9A 1WR1A 3Q3NC 1TTNA 5G5GA 4EZJA 3FC4A 4RGTA 3RZWC 3TEZA 3NUHB 4GOCA 3LDZE 1I7HA 3GE8C 2JY6A 2X8XX 4JWUC 2WXIA 4WWOA 1WGHA 2DZMA 1JWMD 4C4VB 2JZPA 4IUMB 3N3KB 4G50A 4WQOB 3BINA 4WJQA 3NZUA 2KHWB 2W9NA 1Q10A 4ACFA 4RM9A 1SSNA 4MJSA 4HPLB 1WJ4A 1FNUA 4IWOA 1V8CA 4AOFA 4BAXA 2ZVOA 1AWDA 4EE2A 3EA6A 3UINB 4LDTD 1XLOA 3QWZB 1ZP0B 2LHDA 1I4PA 4JL9A 2XEWA 4IM2A 2KN4A 1JCKB 4I6PA 2GLSA 1ZXIA 3NVYA 3AE4B 3IT4B 1CK1A 1T0QC 4MACA 5BYSA 3DBSA 1SJED 5KHOA 1ZDVA 2R2OA 3U30A 4NQKE 3MFGA 2Z0DB 3DQVA 2KC1A 3NS8A 1DGJA 4IM0A 1YNTE 1F2RI 2R2QA 5E6NA 1E7VA 2KK8A 2ON8A 3B2GA 4K1RB 4J3OD 2R61A 2NPTA 3ZNHB 4K7WA 4YL8A 2EELA 3Q14C 3VHTC 3BYYB 2VZKB 2PKOA 3JYUA 2ZEQA 5MPOA 1NYRA 1RYJA 2MJ3A 1BXTA 2OJRA 4WH4A 3NRZA 2PTLA 2KKCA 1BT0A 3ZNGC 1RWSA 1PUTA 1IGCA 3ECIA 1F0ZA 1Z5SB 3P4QB 1HTOA 3AU5A 3CMMB 3O13A 3ZDTA 4W9FA 3QHTA 2VH1A 1L5PA 3P2BA 4LJOB 1JW9D 4PS8A 2FUG1 2WXLA 1D6EC 3UGBB 2GB1A 3ZIMA 4P7IA 4A3PA 2WDVB 1WH3A 4K3BA 4BOZB 2M0AA 3C8YA 1L4ZB 5JXVA 1I4GA 2AQ2B 1JWUD 4JGHB 3RZFA 4WAAA 2VH2A 2H88B 4IW0A 1YX6B 2Q5WD 4EEWA 1LO5D 3JSVB 4K81A 1R4NB 3R7QA 4B9KA 2O6VA 3P63A 3ZRFA 1G6JA 1ZPSA 2L05A 4AJYB 3BVGA 4BFRA 1NI3A 2KVZA 2QEJC 1WMHB 3GP7A 4TSSA 1P3QU 2PE6B 3H7SA 5E6JA 4ZRPA 4YXDB 2KMMA 3VRAB 4NJCA 2KLCA 3I9V1 2HDEA 4MSQB 2WHIA 2LXAA 2NR2A 3ZJTA 3ZXVA 3B2FA 4AS1A 1WZ0A 1JQ4A 4OVVA 3DHHC 1OFFA 1SIJA 2RDGA 2W55A 2EMSA 4F1SA 2MH7A 1Y56A 1AYFA 5C3JB 3AULA 1FMAD 5CHFA 5BYQA 2LFIA 3APFA 2YEPB 4BKTA 1QQRA 1KM7A 4W9LA 1FFUA 1JALA 3OLMD 4LK0M 3SHQA 3TUOA 1MI0A 2PMVA 1L0YB 1FNVA 5D3IB 3V6EB 4URKA 5J17A 3U7ZA 2M56B 3WALA 3VRBB 3DOWA 1E8ZA 3QX1A 3NOBA 2MBEA 1MHHE 1WX9A 5E6OA 1OGWA 1EUVB 2D5GA 3VTUA 4I6NB 3R7RA 3TSSA 4KDLB 3BK1A 1T0YA 4JWSC 1L4DB 1CMXB 2MJDA 2AL3A 4RFBA 1V1OA 2C9WB 4KDIC 1AW7A 4RGMA 5BMIA 2N9PC 1DOYA 1KF6B 4OVUA 3X0WA 1WFYA 3QCAA 1SE9A 5HHDG 1V97A 4M02A 4ZRQA 1KLVA 3U8ZA 1GUAB 1TY2A 3AEGB 1WXMA 1QZEA 3NY5A 2KXJA 2JWZA 3AE8B 3U4EG 4E3CA 1J19A 1E9MA 4YSYB 2N4FA 1PGBA 2L0FA 1TS2A 4E71A 1VRAB 2LXCA 2IO2B 4TKNA 3HK0A 3JSVA 2KT7A 2I38A 2KTRB 3IXSA 1HA5A 1K52A 3ZRCA 1JRUA 4WWPA 2J53A 4MDKE 1V49A 3IFWB 3NVWA 3U52E 4D2KA 1MG4A 3B0AA 3PLUA 4HDQA 2X38A 3NVVA 3Q6BA 3PPAA 3LYYA 4L1BA 2K5PA 1WX7A 3H7PB 1T0SC 4R3DA 2NVUI 4EKUA 2JU6X 3DBHI 1FIQA 1SBBB 4WAFA 1WX8A 2HTHA 1XCTL 5JHBA 3QA8A 1FCCC 4EUTA 1WYWB 1D3ZA 3LXFA 3L0WB 4WJNA 1K53A 3KW5B 4M0WA 4PT5A 4MGKE 3L54A 2CHWA 1ZGUB 3D32A 4P16A 3SFDB 2D3GA 4II2B 3P4SB 3Q3JA 1UF0A 1EU3A 2VZKD 4NY0A 2CHXA 2PLPA 4HCNB 3DHIC 1C4CA 3HRDD 1TKGA 5FR6A 1UGMA 2D3CA 3N30A 3WAMA 5C1ZA 4LNFA 2QSDA 3ZYYX 2JYEA 3VTWA 4WJOA 3V60A 1XLPA 3IT6B 2MBHA 1GAQB 2QJLA 3RPFC 2ZPNA 4AJWA 1TY0A 4W9JA 3HUIA 2FCQA 4AQ7A 4BZAA 1WE7A 2Y5BB 4EOYA 2KDFB 3ZDMC 3IBEA 2LJIA 3HM3A 2M8SA 4PS7A 2B76B 2IO3B 1TZ1A 1SB3C 4BKGA 2LWPA 3SR6A 4NAWA 1V1PA 2OOBB 2BWFA 2MP2A 5DPSA 3IHPC 1CJEA 1WGDA 2JF5A 5TR5A 1ET6A 1HZ5A 4MGZE 2EKIA 3A9KB 1WJ6A 4FXCA 1OQRA 2XNAC 3PZ7A 4FHJA 1WM2A 5IAAC 3PREA 4ZRJA 1R4MI 3RNFC 3KYDD 1D5MC 4FHKA 4OZAA 3AB5A 3P4PB 4QAYA 5E6PA 1FO4A 3KUCB 1ESFA 4P1BC 2BQQA 3UIPB 2K8HA 4RM8A 2D2QA 1XF5L 1XO3A 3KWVA 3RUIB 5IP4D 4ZHPA 2LRWA 2UWQA 4YT0B 4CQNA 1FXIA 2CJNA 3RYTA 3FILB 2KACA 2LASA 3OJ4B 2WXJA 4C80A 4ANUA 2GBNA 4W9KA 3APCA 1SE4A 2IYDB 2KJ6A 3Q8CA 4TV3A 3ZO5B 4DHJB 2BKRB 4ICVA 4ZYSA 3BY4B 2M19A 4L2YA 3SU8X 2PPHA 1JWBD 3A33B 3T8MA 2ZZPB 1ZOYB 3PZDA 1NEKB 4GSWA 3PRPB 3ZQ4A 2BW2A 4B0EA 2K1FA 4XDDA 4W9HA 4A8XC 1J7BA 4KSLC 1TKYA 3DPDA 2ONQA 2CJOA 1GG3A 1NVID 1N63A 1PDXA 4CHKA 1PQSA 1J7AA 1QOGA 4NJ7A 5EE3A 3QJZA 1JRPA 3PS6A 1IGDA 2PVGC 4PK1A 2HJ1A 1YN5A 4MH8A 3OG5A 3ZUNA 1CQVA 1YJIA 4XC2A 2OHFA 1SE2A 1ZUD2 3PZ8A 4G3XB 1B9RA 5D3DA 1P0RA 4W9DA 3A1QA 1Q0WB 4OVZA 1EU4A 4E74A 4GN1A 4B0MA 4ICUA 4RGOS 2MCNB 1WXQA 2GBKA 2JZ3B 2SEBD 3P42A 1GNUA 5C2TB 3V05A 1F2RC 4TQ0A 4BOSC 2LMCA 5FR3A 2KWDA 3Q8FA 1X1MA 2JT4B 1N5WA 2RDHA 4IDIA 2NS5A 2C5LC 2M17A 3VUWA 3WA0A 2BB5A 4JLCA 4NZLB 3ZJUA 2NCNA 4MSMB 3PRMB 2DENB 5IA7A 5EE0A 5J2RA 4M00A 3IG3A 4B6WA 2V4IB 2N7DA 1TS3A 5T8IA 4KZCA 4DWFA 1OQYA 2JX5A 2YVCA 5BYRA 4C56C 5HG2A 4MELA 4IM3A 2O2VB 2N9XA 4C7ZA 2L1AA 2JYTA 1OTRB 3NJTA 4OZBA 3WANA 1QOAA 4B95A 3AE6B 1ROEA 5AUKA 1UWMA 3B1LX 3CIRB 2HJ8A 2LGIA 2WQYB 3R66C 4IKGA 4WIPA 4XWTA 3DDCB 2WP9B 1WSPA 1UBIA 3EC8A 3MC0B 3RNCC 5G2NA 4GU2A 3BVMA 2WWZA 1XCQL 3OAWA 2L8JA 4GGQA 1WGYA 2BYEA 2KJHB 4MGIE 3W5UB 1RM6C 1SE3A 2HTME 2BB6A 2LD9A 1V9JA 2IO0B 4GDKB 3HHMA 5CTRC 1V80A 4JPSA 4FULA 4FBJB 1LXDA 4WURA 4ITKA 4XX5A 1T5XD 2C60A 1KFYB 2V3SA 3LB8C 2J4XA 3DBLI 1PFDA 4LLGM 4ZYNA 2KQ4X 4EZKA 3N32A 3AE2B 2IO1B 2N9LA 4C4VA 2WXGA 3CF6E 5D2MB 2WXPA 3TEXA 2KNBA 3VR8B 2J0MA 3RCZA 3DBHB 4LCDE 3A4SC 3RMKC 4MEMA 4GLSC 4RF1A 3GS2A 3JW0X 3ZTDA 4LTUA 2KX3A 5GXGB 3I3TB 2WDTB 2G4SA 3AEFB 2IJ0A 3IAM1 1WXSA 1E5WA 3DBRI 2DZKA 2FIFA 1WJNA 2B3AA 3ZNZB 1EWYC 1NDDA 1TT5B 3Q3OC 5D7GA 5IKCM 1TJEA 4KKIA 2KANA 3H8HA 4US8A 3EFCA 3Q8AA 1S1QB 4H2AA 1QT9A 4GMVA 4PYUA 3U7DA 3VFKA 2LJ5A 2J52A 1J0GA 4LJPB 4JE3B 4HRSA 3RT3B 4GB9A 3DWMA 2BYTA 3UQAA 1AN8A 3L4PA 5CX3A 2K8CA 3W9CB 3AM9A 4DHJD 1YN3A 1QILA 1WE6A 3SDLC 2WXHA 2C7HA 3K9OB 4BKSD 3L17A 1YJJA 1TS4A 2OJWA 2MBBB 4K3CA 4ZDVA 1JROA 2NBUA 3C19A 3H6NA 3DVNV 1MG8A 1E7UA 3X23A 2I1JA 4HLEA 1A70A 5BMHA 3UI3A 2VRRB 1F1HA 1L7YA 1WF9A 2RMMA 2ZNVB 3BIID 3Q3MC 1VJKA 1IPGA 3TL5A 3EFUA 4ANXA 2ASQA 3T3NA 4DDID 3ABVB 1F9JA 2ICIA 4FN2A 3I63C 1FD6A 3PHXB 3VVWB 2EMTA 4MM3B 3ZTCA 4CYEA 5KHQA 1I4RA 1HZ6A 1WZ3A 3SEBA 4GIVA 2L83A 2IGHA 1GC7A 5HKHA 3AE9B 2BT6A 3EUB2 3M62B 2W3SA 1JWSD 3MP9A 2QHOA 1WRIA 2V3NA 2JSVX 5H92C 2EKEC 3BYTB 3K9PB 1VR9A 1N62A 4N58A 3VH4B 1PYWD 2GMIC 1R4MB 2WXMA 1QKZA 2L76A 3URYA 1E8WA 2BVCA 3BZDB 2Y5PA 1V6EA 3N1YC 2BS3B 2CKHB 1EF1A 2BWES 2MBQA 2N0SB 3BWUD 3EECA 2KX0A 3KH0A 2N9KA 2AQ1B 4NPNA 1FCLA 3B9JA 3MTNB 1V86A 1HE8A 1T6BX 3W1SC 3I5JC 2QILA 3HM6X 1WJUA 4HVBA 2RR9A 3KWLA 1SF0A 4HXDA 2AWTA 5AEKB 3QARA 4JX1C 3VUXA 1TIFA 3RULA 2J0KA 3M95A 2FNJB 3W1SA 1FRDA 1WGGA 3GZNI 4XWWA 3WAOA 1K50A 3VQIA 2D11A 2NBVB 5CHWA 1WMHA 1R7SA 4KGSA 4HPMB 2PEAA 1VD2A 2LZ6A 4XYCA 5LNK1 3VDZA 1L0VB 4LNOA 3R8BA 2V3PA 2BBCA 3ALBA 3PRZA 1UD7A 2GRIA 2KTFA 4Q2JA 4YTPB 1M94A 2KC2A 3APDA 4BBNF 1FRRA 5G55A 2ZVNA 2DNFA 1C3TA 3TEWA 3DVNU 3TMPB 2ZNVC 4ASWC 2CHZA 1YIWA 1YQ3B 4IC7B 3TJPA 2D07B 2NMQA 1L0XB 2Y3AA 3H9DA 1GB4A 4HK2A 2KO3A 4GDLB 4HKQA 1ENFA 5EDSA 3NG0A 1WY8A 1PGAA 1EO6A 2RGFA 1D5XC 4A9AA 1EWCA 4N6EB 1FEHA 2WXKA 2QCZA 2WXOA 3A9JB 1T0RC 2LVOA 1STEA 4HCPB 4BVUC 1K8RB 1VCBA 3AE7B 3PV1A 2G1EA 3SFEB 3BVZA 2IPKD 3R2IA 5G5HA 1UZXB 2PW9A 1C79A 2M0XA 5DPTA 4JIOU 2UU7A 2QC8A 2LUMA 2K6DB 2KD0A 5IO9A 1ZW7A 4WWNA 3MC8A 2W82A 4NJ6A 1XEEA 2XN9C 2IDYA 3Q69A 1JMLA 4LNKA 2WU2B 2INCC 1YN4A 3PO0A 2RD0A 4IOIE 4WQMA 5LLIA 2KTRA 1IBXB 3VR9B 4LNIA 2K3UA 5J18A 5AZGA 3AECB 1V5TA 3S2AA 1C77A 1ZXHA 3KYCD 1WRDB 3P1MA 2IBIB 1SXTA 2KLGA 4FJZA 4MJSB 5FKAC 2PJHA 1I4QA 2L7RA 2V0GA 3AEEB 3H7PA 4IWPA 5CHVC 2LVQA 1YOVB 1ET9A 1KTKA 1NI2A 4MH0E 1BUIC 4FADA 1LFDA 2E6XA 3P4RB 4OHJA 1YD8U 4KGRA 3TEYA 5H8YE 1Y8RC 2N9EB 1UUPA 3HVZA 2PIAA 2DZIA 2A4ZA 2GOWA 2NTTA 2JRIB 3RNGC 1WR6E 2W54A 4KX6B 3L13A 1V5OA 3FAHA 2C7MB 3HIZA 4I6LB 1E8YA 1UBQA 2WNMA 3NHEB 4EFOA 3PT2B 2BS4B 1WXVA 3PLVA 3NZ3A 1H4RA 5AZHA 4A20A 4GDLA 1GB1A 2UYZB 3Q2AC 3W1YA 2L3ZA 3QQ8B 2QDFA 3ZGZA 1WWTA 4LNNA 4ARIA 2JPHA 2NPTB 2Z59B 4XZ4A 1H8CA 4ZRKA 2KZRA 3N1ZC 3DBLB 1MPEA 2WXQA 4DXGA 1D4BA 1DOIA 3TIXA 2LGDA 1KJTA 2BGFA 2JXXA 1FXTB 4PS3A 2KFJA 2KYWA 3V61A 3GE3C 3JVZX 2BF8B 1SEBD 2DYOA 5JZEB 2HD5B 1P7FA 3E56A 1P7EA 2L52A 3DBRB 1C9FA 2WGSA 2LVPA 5IOIA 2RPQA 3KUDB 1VZ6A 4P1CC 1L2NA 1VDVA 4KSKC 2A5UA 4A6QA 4K7SA 3A9KA 4KIKB 2FBWB 2MQJA 4KVGB 3AI5A 3NS1A 4M8MA 3L08A 1RFKA 2LGYA 1XD3B 4AUQC 2N7EA 4WJPA 1P98A 4AWJA 2DAJA 1IBXA
chains in the Genus database with same CATH topology
4LTUA 1VRAB 5GXGB 3ZJVA 2E3TA 3AEFB 1J7CA 2DLBA 2IJ0A 3IAM1 2WLBA 4REZA 2I38A 4RGNA 3IXSA 1HA5A 3W5VB 1K52A 1EWYC 4L23A 2J53A 2SAKA 1GOZA 5D7GA 3BK2A 3NVWA 3U52E 1N60A 4D2KA 1TJEA 4KKIA 3H8HA 1D5ZC 1MVKA 4US8A 3Q8AA 5BMGA 1N61A 2X38A 4H2AA 1QT9A 3NVVA 5EE1A 2J52A 3LYYA 4L1BA 2DYMA 2K5PA 2G9HD 4HROA 2K22A 1C76A 1WYGA 3FILA 2WDQB 2INPE 2Y5CA 4HJGE 4HKZE 4R3DA 2I2YA 4JE3B 2JU6X 2INNE 4HRSA 2BTEA 1FIQA 1C4AA 3DWGC 1SBBB 1XLQA 3DWMA 4WAFA 2BYTA 2NTSA 1AN8A 3L4PA 1I4HA 1XCTL 1QOBA 1XXGA 4XE0A 3W9CB 3AM9A 3IAS1 1DYQA 1FCCC 2QIEB 1YN3A 1QILA 2W3RA 2WXHA 5TSSA 2WXFA 4N59A 4YWGG 4A90A 3LXFA 1K51A 1YJJA 1TS4A 1K53A 4M0WA 4PT5A 3AV8A 1JROA 3V3XA 1TS5A 1KH0A 1TYGB 3MHZA 5BMHA 1A70A 4P16A 1L6UA 3SFDB 3UI3A 1TKEA 2J42A 1HQRD 3P4SB 4XDCA 3WCQA 1EU3A 2LEKA 2VZKD 3R2TA 1C78A 2RMMA 2K9XA 1E6EB 2QMTA 3BIID 1VJKA 1E7PB 3AN1A 3EGRA 1QF6A 1CZPA 2JQRB 3T3NA 1NYQA 3U2SC 3ABVB 2PLPA 1C4CA 4YTNB 2ICIA 1FD6A 3HRDD 1TKGA 1HEZE 2MEKA 2WS3B 4MM3B 1PGXA 1I4RA 1HZ6A 3AH7A 3SEBA 3GB1A 2AX5A 2QSDA 3ZYYX 2L83A 2IGHA 2IGGA 3Q8EA 3AE9B 2BT6A 2JYEA 3EUB2 2W3SA 1JWSD 1ZDXA 3MP9A 3AEDB 1XLPA 3IT6B 1WRIA 2V3NA 1GAQB 2QJLA 3RPFC 2JSVX 4WWMA 1YMHE 5H92C 3BYTB 1GPXA 1E10A 1WGKA 2H89B 1TY0A 1N62A 1VR9A 4N58A 1FNWA 1PYWD 3HUIA 5EE9A 4AQ7A 2WXMA 1QKZA 3URYA 1UNSA 5G5GA 5I4DA 3FC4A 2DBYA 4RGTA 3BZDB 3TEZA 3NUHB 1B1ZA 2Y5PA 2LJIA 2WDRB 1QOFA 2BS3B 1I7HA 5AUIA 2B76B 2JXTA 1FM0D 1HXYD 1SB3C 4JWUC 2N0SB 3BWUD 3SR6A 2WXIA 1V1PA 4P6VF 2N9KA 2AQ1B 1CJEA 3ETRA 1FCLA 1ET6A 1HZ5A 1JWMD 2EKIA 3B9JA 2JZPA 1SJHD 1T6BX 4HEA1 4ZOHC 2QILA 4FXCA 1OQRA 2XNAC 2YEPF 3PZ7A 1I4XA 1F77A 1Q10A 2PVOD 3KWLA 1SF0A 1SSNA 3AMZA 1FNUA 2GI9A 4JX1C 1V8CA 1D5MC 4OZAA 3AB5A 1AWDA 4EE2A 3W1SA 4KGTA 1IBXA 1FRDA 3EA6A 3P4PB 4XWWA 1FO4A 1K50A 3VQIA 1ESFA 3AEBB 1XLOA 1EM7A 3N9YC 3KQ4A 1R7SA 2KAJA 4KGSA 1XF5L 1ZP0B 1KLUD 2LHDA 1FXAA 1I4PA 1N5XA 1BMLC 4OZCA 1XO3A 3KWVA 2JWUA 2KN4A 1JCKB 4ZHPA 4YT0B 5LNK1 4CQNA 1FXIA 1ZXIA 2CJNA 3FILB 2KACA 3NVYA 3AE4B 3IT4B 1L0VB 1CK1A 3R8BA 2WXJA 4C80A 2V3PA 2BBCA 4MACA 5BYSA 2MJEA 1SJED 1ZDVA 2GRIA 4Q2JA 4RNAA 4YTPB 1SE4A 1VLBA 1OQQA 1FRRA 3Q8CA 3MFGA 3TEWA 1DGJA 1YNTE 1F2RI 1YQ3B 1L6VA 4RCOA 4ZYSA 2WXNA 2M19A 2LHEA 4L2YA 1ACCA 2NMQA 1C4PA 2ON8A 1L0XB 2Y3AA 3B2GA 3W2DA 1GB4A 1JWBD 4J3OD 4GDLB 2R61A 1ZOYB 1NEKB 4HKQA 1ENFA 3ZQ4A 2BW2A 4B0EA 1PGAA 3AE5B 1D5XC 2EELA 2K0PA 4XDDA 1EWCA 4A9AA 1ZE3D 3BYYB 2VZKB 2PKOA 4A8XC 1J7BA 4N6EB 1FEHA 5MPOA 1TKYA 2WXKA 2ONQA 2CJOA 1NYRA 1VZ7A 2FE8A 1RYJA 2MJ3A 1NVID 1BXTA 2N7JA 2WXOA 4WH4A 1N63A 1PDXA 3NRZA 2PTLA 1STEA 1J7AA 1QOGA 5EE3A 5HI1A 1RWSA 3AE7B 3HVDA 2G1EA 1PUTA 1JRPA 1IGCA 3SFEB 1IGDA 2PVGC 3BVZA 2IPKD 1IUEA 1F0ZA 3P4QB 3R2IA 1YN5A 5G5HA 1M4VA 2PW9A 1C79A 3O13A 4MH8A 2CU3A 1CQVA 1YJIA 2KDMA 1L5PA 2LUMA 1KRHA 2OHFA 1SE2A 1ZUD2 1JW9D 3PZ8A 2FUG1 2W82A 5D3DA 1B9RA 1XEEA 1DOXA 2WXLA 2XN9C 4ZHOA 2IDYA 1D6EC 3Q69A 1JMLA 4UDUC 3AE1B 2GB1A 4NAMA 2WU2B 1EU4A 1QLBB 4OVZA 4B0MA 1YN4A 2WDVB 3PO0A 4RGOS 2M0AA 1WXQA 3C8YA 1L4ZB 4NAWB 5JXVA 2SEBD 3P42A 4YSXB 1V1PB 4IOIE 4TQ1A 4WQMA 1I4GA 2AQ2B 5C2TB 3V05A 1JWUD 1F2RC 4TQ0A 1IBXB 2LMCA 3VR9B 2H88B 4YSZB 5FR3A 2KWDA 3Q8FA 2Q5WD 2K3UA 1N5WA 2RDHA 1LO5D 3AECB 4IDIA 1C77A 1ZXHA 2Z8LA 3P1MA 1SXTA 3P63A 5FKAC 2RPVA 1ZPSA 1I4QA 2V0GA 3AEEB 2BB5A 3BVGA 4NZLB 1NI3A 3ZJUA 2QEJC 1TZOA 1ET9A 1KTKA 1BUIC 4MT5A 2E6XA 3P4RB 4OHJA 4KGRA 4ARCA 5EE0A 3GP7A 2TSSA 4TSSA 3TEYA 1XLNA 1UGJA 5H8YE 4ZRPA 5E6JA 4YXDB 2KMMA 3VRAB 2WU5B 4NJCA 4YTMB 2V4IB 3I9V1 2HDEA 1NENB 1UUPA 3HVZA 1TS3A 2PIAA 5T8IA 3CWIA 4RH6A 4A55A 2JX5A 5HFYA 2DWQA 4TMAB 2NTTA 5BYRA 3ZJTA 4C56C 3I57A 5HG2A 3B2FA 4AS1A 2W54A 4KX6B 1JQ4A 4C7ZA 3E9SA 3FAHA 2L1AA 2JYTA 4DQOC 1OFFA 1SIJA 2ACZB 2RDGA 2W55A 4C7YA 1YQ4B 4OZBA 2MH7A 2WNMA 1Y56A 1QOAA 2BS4B 3ZGZA 1AYFA 3AE6B 1ROEA 1E0ZA 5C3JB 3NZ3A 1FMAD 5AUKA 1UWMA 3AEAB 5BYQA 2LFIA 3AE3B 1GB1A 2YEPB 1QQRA 1FFVA 3NVZA 3J9CA 1FFUA 1JALA 3CIRB 4LK0M 3TUOA 1MI0A 2LGIA 1WWTA 2PMVA 1L0YB 1FNVA 2WQYB 3RFZB 4IKGA 4WIPA 5D3IB 4XWTA 4ARIA 3T3OA 2WP9B 3U7ZA 2ZW1A 2M56B 1WSPA 2OEDA 3MJ5A 3VRBB 1MPEA 2WXQA 3MC0B 4DXGA 1D4BA 1DOIA 1MHHE 3BVMA 4USAA 2WXRA 2D5GA 1XCQL 4KKJA 1SEBD 2DYOA 3TSSA 3BK1A 1P7FA 3W5UB 1RM6C 3E56A 1SE3A 1P7EA 2HTME 4JWSC 1L4DB 2L32A 2L52A 2MJDA 2BB6A 4OW0A 1UWXA 4RFBA 1V1OA 4GDKB 1C9FA 1AW7A 5FK9C 4RGMA 4JPSA 1VZ8A 5BMIA 4WURA 1VZ6A 4DXFA 1JWAD 4ITKA 2ZW0A 1DOYA 1VDVA 1KF6B 1T5XD 3KLSX 1KFYB 5HHDG 4A6QA 3LB8C 2J4XA 1V97A 1PFDA 2BS2B 3OWEB 4LLGM 2KQ4X 1KLGD 4O1NA 4ZRQA 3AE2B 4RF0A 1TY2A 2AQ3B 2N9LA 3AEGB 2WXGA 3Q8BA 2FBWB 2WXPA 1T3QA 3NS1A 3AE8B 3TEXA 3U4EG 3VR8B 1RFKA 2IGDA 1E9MA 4YSYB 1PGBA 4GLSC 4RF1A 3GS2A 4US9A 1TS2A 1MHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LTU A;  1GPX A;  1E10 A;  3HVZ A;  5GXG B;  1WGK A;  2H89 B;  2E3T A;  1N62 A;  2PIA A;  3AE5 B;  1J7C A;  3AEF B;  3CWI A;  3HUI A;  4N58 A;  5EE9 A;  4A9A A;  2WLB A;  2PKO A;  2JX5 A;  5G5G A;  1J7B A;  4N6E B;  2DWQ A;  3FC4 A;  3W5V B;  1EWY C;  2DBY A;  5MPO A;  1TKY A;  2CJO A;  1NYR A;  3B2F A;  1RYJ A;  2MJ3 A;  2W54 A;  2WDR B;  1NVI D;  1QOF A;  3NVW A;  1N60 A;  4KX6 B;  1JQ4 A;  1TJE A;  2BS3 B;  4C7Z A;  1I7H A;  1N63 A;  1PDX A;  2B76 B;  3FAH A;  1FM0 D;  3NRZ A;  5AUI A;  4US8 A;  1OFF A;  1SIJ A;  1J7A A;  1SB3 C;  1N61 A;  2ACZ B;  2W55 A;  1YQ4 B;  1QT9 A;  2N0S B;  1QOG A;  3B9J A;  3NVV A;  2MH7 A;  4JWU C;  3SR6 A;  5EE1 A;  5EE3 A;  1QOA A;  2BS4 B;  4P6V F;  1AYF A;  1RWS A;  1ROE A;  3AE6 B;  1CJE A;  3AE7 B;  2K5P A;  4HRO A;  3ETR A;  5C3J B;  2K22 A;  1E0Z A;  1FMA D;  1WYG A;  1UWM A;  1PUT A;  1JRP A;  2EKI A;  2G1E A;  2WDQ B;  2Y5C A;  3AEA B;  3SFE B;  2PVG C;  3AE3 B;  1IUE A;  1F0Z A;  4HRS A;  1FIQ A;  3P4Q B;  4ZOH C;  4FXC A;  5G5H A;  3DWG C;  1FFV A;  1OQR A;  3NVZ A;  1FFU A;  1JAL A;  1XLQ A;  3CIR B;  3DWM A;  3KWL A;  2PVO D;  1WWT A;  1SF0 A;  2WQY B;  3L4P A;  1QOB A;  2CU3 A;  3AMZ A;  3W9C B;  3AM9 A;  1YJI A;  2QIE B;  4JX1 C;  2WP9 B;  1L5P A;  1V8C A;  2W3R A;  4YSZ B;  1KRH A;  2M56 B;  2OHF A;  3AB5 A;  1AWD A;  3VRB B;  1ZUD 2;  1JW9 D;  1FRD A;  4N59 A;  3P4P B;  1B9R A;  1DOX A;  3LXF A;  1YJJ A;  1FO4 A;  1DOI A;  4ZHO A;  3AEB B;  1XLO A;  3AV8 A;  1JRO A;  1R7S A;  2KAJ A;  3AE1 B;  4USA A;  2WU2 B;  1TYG B;  1QLB B;  1ZP0 B;  1FXA A;  2WDV B;  1N5X A;  3PO0 A;  1A70 A;  1XO3 A;  1WXQ A;  1L6U A;  3SFD B;  1TKE A;  4YSX B;  4ZHP A;  5AUK A;  3WCQ A;  3P4S B;  4YT0 B;  4WQM A;  5C2T B;  1FXI A;  3W5U B;  1RM6 C;  1ZXI A;  2LEK A;  2CJN A;  2HTM E;  4JWS C;  2L52 A;  2K9X A;  3VR9 B;  1E6E B;  2H88 B;  2MJD A;  3AE4 B;  3BII D;  3NVY A;  2Q5W D;  1L0V B;  1VJK A;  2QJL A;  1E7P B;  1N5W A;  4C80 A;  3AN1 A;  3AEC B;  4IDI A;  1QF6 A;  3RPF C;  1CZP A;  2JQR B;  2MJE A;  1JWA D;  1NYQ A;  4ITK A;  1DOY A;  1VDV A;  1KF6 B;  3ABV B;  3P1M A;  4YTP B;  1KFY B;  1VLB A;  4YTN B;  1OQQ A;  3P63 A;  1FRR A;  3LB8 C;  3HRD D;  1TKG A;  1V97 A;  1DGJ A;  1PFD A;  2BS2 B;  3AEE B;  2WS3 B;  3AE2 B;  1YQ3 B;  3AH7 A;  1L6V A;  3AEG B;  1NI3 A;  2AX5 A;  2FBW B;  2M19 A;  3ZYY X;  2L83 A;  3AE9 B;  1T3Q A;  2BT6 A;  3AE8 B;  3NS1 A;  3P4R B;  3EUB 2;  2W3S A;  3VR8 B;  3B2G A;  1RFK A;  5EE0 A;  3AED B;  1JWB D;  1XLN A;  5H8Y E;  1XLP A;  1E9M A;  4YSY B;  4YXD B;  1WRI A;  2KMM A;  3VRA B;  2WU5 B;  4YTM B;  1ZOY B;  1NEK B;  4US9 A;  1GAQ B;  1NEN B;  4C7Y A;  4WWM A;  5H92 C; 
#chains in the Genus database with same CATH topology
 3RNE C;  2V9H A;  3ZJV A;  1J7C A;  2WLB A;  4REZ A;  4RGN A;  3W5V B;  4FA6 A;  4DHZ E;  2I1K A;  2KFK B;  2SAK A;  2BPS A;  3BK2 A;  2G4D B;  1N60 A;  2KQ7 A;  1D5Z C;  1MVK A;  2O6V B;  1FPY A;  5BMG A;  2WX1 A;  1TGZ B;  2K22 A;  1WYG A;  3FIL A;  2WDQ B;  4HJG E;  4HKZ E;  2I2Y A;  3DCG A;  3ZXR A;  2G3Q B;  1C4A A;  1WXA A;  2RDB C;  2BYV E;  4IWQ A;  2NTS A;  2XK5 B;  3PTF C;  3IAS 1;  1DYQ A;  2QIE B;  2W3R A;  4NNJ B;  2KWU B;  5TSS A;  4FJV B;  3RN9 C;  4N59 A;  4BKS A;  4A90 A;  3L10 B;  1K51 A;  2Z0E B;  3Q3F A;  3AV8 A;  1HTQ A;  2KWV B;  3V3X A;  1TS5 A;  1KH0 A;  2KMA A;  1GC6 A;  2JZZ A;  1L6U A;  1TKE A;  3MHS D;  5DPW A;  4N9F 4;  1HQR D;  4XDC A;  1E90 A;  1V2Y A;  2LEK A;  1E6E B;  2QMT A;  3EGR A;  1QF6 A;  1P9D U;  2JQR B;  3T9L A;  4YTN B;  4J6I A;  1WM3 A;  3NZS A;  2MEK A;  2DHZ A;  2WS3 B;  2HE7 A;  4W9C A;  1J8C A;  1AAR A;  3PHW B;  4DDG D;  2KDE B;  2AX5 A;  4PYZ A;  2IGG A;  3Q8E A;  2K39 A;  1MFW A;  1ZDX A;  2JUO A;  2DZJ A;  1YJ1 A;  4WWM A;  1YMH E;  2H89 B;  4S17 A;  1Z2M A;  1UNS A;  5I4D A;  2LGX A;  2DBY A;  2DAF A;  1B1Z A;  1SIF A;  3AXC A;  3OJ3 A;  3GZN B;  2WDR B;  2K6Q A;  1QOF A;  3IVF A;  3UQB A;  2L00 B;  5AUI A;  2JXT A;  1FM0 D;  3CSF A;  1HXY D;  4KIK A;  2AEH A;  4P6V F;  2FCN A;  3ETR A;  1LGR A;  1SJH D;  4HEA 1;  4F7Z A;  1C1Y B;  2WX0 A;  4ZOH C;  2BYF A;  2YEP F;  3VAW A;  3C0R B;  1I4X A;  3RNB C;  1F77 A;  2PVO D;  3AMZ A;  2CU1 A;  2GI9 A;  1Q5W B;  2G45 B;  2NBW B;  2KFK A;  4DXA B;  2MSE D;  3N20 C;  4KGT A;  2V1Y A;  3MJW A;  3A4R A;  3AEB B;  2AYO B;  4RMA A;  1EM7 A;  3N9Y C;  3KQ4 A;  1U4A A;  2KAJ A;  4GXB A;  4CO7 A;  1WI0 A;  1KLU D;  3EHV A;  1FXA A;  4HDO A;  4W9I A;  1N5X A;  1BML C;  4OZC A;  1KOT A;  4XGA B;  2JWU A;  3UIO B;  5D94 A;  2LGS A;  1OEY J;  2XK5 A;  2O2V A;  2MJE A;  2IY1 B;  3ML9 A;  2FCS A;  4RNA A;  1VLB A;  1OQQ A;  1WIA A;  2KDI A;  4MGY E;  2JRH A;  1RAX A;  3H1U A;  1L6V A;  4RCO A;  5JH5 C;  2WXN A;  2LHE A;  1ACC A;  3M3J A;  1C4P A;  2KQS A;  4FLH A;  2LRU A;  2V4L A;  4M0W B;  3W2D A;  3DVG X;  2GBJ A;  3QC8 B;  1I42 A;  2N1W A;  3AE5 B;  3V6C B;  2K0P A;  1ISN A;  1ZE3 D;  1UH6 A;  4S0R A;  1VZ7 A;  2FE8 A;  4EZL A;  2N7J A;  1LM8 B;  1RFA A;  1RRB A;  3L16 A;  3DHG C;  5HI1 A;  4FJY A;  3HVD A;  4W9E A;  4GDK A;  1IUE A;  2MRP A;  1LQB A;  2LI5 A;  4ANW A;  1M4V A;  2CU3 A;  3RI7 C;  4DBG A;  2KDM A;  1KRH A;  5GMV A;  1WGR A;  4HWI B;  2PE9 A;  3SD5 A;  2L0T A;  1DOX A;  1I35 A;  4ZHO A;  5JHA A;  4UDU C;  3AE1 B;  4NAM A;  3PSE B;  1QLB B;  3ONS A;  2MA9 B;  2DX5 B;  4NAW B;  3KVF B;  4YSX B;  1V1P B;  2MP2 B;  4TQ1 A;  1F52 A;  2IND C;  4ANV A;  3GOE A;  4YSZ B;  4II3 B;  2WYQ A;  3N1X C;  3ZNI D;  3M63 B;  2Z8L A;  5L95 C;  2O6V D;  2RPV A;  3PGE A;  4IG7 B;  4M01 A;  1YX5 B;  3R3M A;  1IYF A;  2D10 A;  4LDT B;  1TZO A;  4MT5 A;  3ML8 A;  2KMC A;  2KDB A;  2M1M A;  4ARC A;  1S3S G;  2TSS A;  1XLN A;  1UGJ A;  2WU5 B;  4YTM B;  1NEN B;  3CWI A;  4RH6 A;  3FKY A;  4A55 A;  3PVL A;  5HFY A;  2DWQ A;  3ENE A;  4TMA B;  1R4N I;  3RNA C;  1YQB A;  3I57 A;  2RSU A;  3MC9 A;  3V62 A;  4TUU A;  3AU4 A;  2KN5 A;  4G11 A;  5LXH A;  2XBB C;  3E9S A;  2KJR A;  4DQO C;  2ACZ B;  4C7Y A;  1YQ4 B;  2CS4 A;  2GBM A;  1E0Z A;  3AEA B;  2ZPY A;  2K8B A;  3AE3 B;  2AL6 A;  1FFV A;  3NVZ A;  3J9C A;  3KUZ A;  4F8C B;  4ZRI A;  3UF8 A;  3RFZ B;  3T3O A;  3O65 B;  2ZW1 A;  4MM3 A;  2OED A;  3WAP A;  3MJ5 A;  4K7U A;  1XT9 B;  1UEL A;  5IN7 A;  2BKF A;  2M4N A;  4USA A;  2ZCB A;  2WXR A;  2D3A A;  2KWC A;  4KKJ A;  4C00 A;  2MHJ A;  2GBR A;  4AP4 C;  2CR5 A;  2L32 A;  3WIM A;  4OW0 A;  1UWX A;  1NBF C;  5DCN A;  5FK9 C;  1VZ8 A;  4DXF A;  1JWA D;  3DVG Y;  1XQQ A;  2ZW0 A;  3ZW3 A;  3KLS X;  2DYB A;  4HJK A;  2YLM A;  2C7N B;  3OWE B;  2BS2 B;  4O1N A;  1KLG D;  4RF0 A;  2MWS B;  2AQ3 B;  4A3O A;  3Q8B A;  5AZF A;  2IZV B;  4M8N A;  2N1V A;  1T3Q A;  2REX A;  3QK0 A;  3A1Q B;  2IGD A;  1Q1O A;  2ZJD A;  2MX2 A;  2JVC A;  2MLB A;  4US9 A;  1A5R A;  1MHX A;  2E3T A;  4HPP A;  3VH3 B;  2DLB A;  2IY0 B;  4L23 A;  1IP9 A;  1GOZ A;  2KOX A;  1N61 A;  2FUH B;  4DHZ B;  2FCM A;  1V81 A;  5EE1 A;  5L83 A;  5D6J B;  2DYM A;  4HRO A;  2G9H D;  1C76 A;  2Y5C A;  2INP E;  2FID A;  2KVR A;  2J0J A;  1OEY A;  3TBL D;  2INN E;  2BTE A;  3DWG C;  2MBO A;  1XLQ A;  1I4H A;  1QOB A;  1XXG A;  4XE0 A;  2FAZ A;  2LUE A;  2WXF A;  3LJ3 A;  3ZVV A;  5BO4 B;  4YWG G;  3QIJ A;  3TCA A;  4G0N B;  4KZ0 A;  1RLF A;  1TYG B;  4X57 B;  1EF5 A;  2MW5 A;  3ZKJ C;  3MHZ A;  1GJZ A;  2J42 A;  3WCQ A;  3RD2 A;  3B08 A;  4KV2 A;  1TBE A;  4DK5 A;  3R2T A;  1C78 A;  1ZKH A;  1E8X A;  2K9X A;  3VTV A;  5C23 A;  5DPR A;  1E7P B;  3AN1 A;  1CZP A;  1NYQ A;  3A9J A;  2ZCC A;  3U2S C;  4JQW C;  3VUY A;  3ZLZ A;  5LXI B;  1MJD A;  1HEZ E;  2K25 A;  1PGX A;  3AH7 A;  3GB1 A;  4BBN C;  1P1A A;  2D3B A;  3AED B;  1SGH A;  3CST A;  4W9G A;  4NQL B;  1N6Z A;  1E10 A;  1GPX A;  3QAQ A;  1WGK A;  3VXW A;  2J7Q B;  1FNW A;  5EE9 A;  1WR1 A;  3Q3N C;  1TTN A;  5G5G A;  4EZJ A;  3FC4 A;  4RGT A;  3RZW C;  3TEZ A;  3NUH B;  4GOC A;  3LDZ E;  1I7H A;  3GE8 C;  2JY6 A;  2X8X X;  4JWU C;  2WXI A;  4WWO A;  1WGH A;  2DZM A;  1JWM D;  4C4V B;  2JZP A;  4IUM B;  3N3K B;  4G50 A;  4WQO B;  3BIN A;  4WJQ A;  3NZU A;  2KHW B;  2W9N A;  1Q10 A;  4ACF A;  4RM9 A;  1SSN A;  4MJS A;  4HPL B;  1WJ4 A;  1FNU A;  4IWO A;  1V8C A;  4AOF A;  4BAX A;  2ZVO A;  1AWD A;  4EE2 A;  3EA6 A;  3UIN B;  4LDT D;  1XLO A;  3QWZ B;  1ZP0 B;  2LHD A;  1I4P A;  4JL9 A;  2XEW A;  4IM2 A;  2KN4 A;  1JCK B;  4I6P A;  2GLS A;  1ZXI A;  3NVY A;  3AE4 B;  3IT4 B;  1CK1 A;  1T0Q C;  4MAC A;  5BYS A;  3DBS A;  1SJE D;  5KHO A;  1ZDV A;  2R2O A;  3U30 A;  4NQK E;  3MFG A;  2Z0D B;  3DQV A;  2KC1 A;  3NS8 A;  1DGJ A;  4IM0 A;  1YNT E;  1F2R I;  2R2Q A;  5E6N A;  1E7V A;  2KK8 A;  2ON8 A;  3B2G A;  4K1R B;  4J3O D;  2R61 A;  2NPT A;  3ZNH B;  4K7W A;  4YL8 A;  2EEL A;  3Q14 C;  3VHT C;  3BYY B;  2VZK B;  2PKO A;  3JYU A;  2ZEQ A;  5MPO A;  1NYR A;  1RYJ A;  2MJ3 A;  1BXT A;  2OJR A;  4WH4 A;  3NRZ A;  2PTL A;  2KKC A;  1BT0 A;  3ZNG C;  1RWS A;  1PUT A;  1IGC A;  3ECI A;  1F0Z A;  1Z5S B;  3P4Q B;  1HTO A;  3AU5 A;  3CMM B;  3O13 A;  3ZDT A;  4W9F A;  3QHT A;  2VH1 A;  1L5P A;  3P2B A;  4LJO B;  1JW9 D;  4PS8 A;  2FUG 1;  2WXL A;  1D6E C;  3UGB B;  2GB1 A;  3ZIM A;  4P7I A;  4A3P A;  2WDV B;  1WH3 A;  4K3B A;  4BOZ B;  2M0A A;  3C8Y A;  1L4Z B;  5JXV A;  1I4G A;  2AQ2 B;  1JWU D;  4JGH B;  3RZF A;  4WAA A;  2VH2 A;  2H88 B;  4IW0 A;  1YX6 B;  2Q5W D;  4EEW A;  1LO5 D;  3JSV B;  4K81 A;  1R4N B;  3R7Q A;  4B9K A;  2O6V A;  3P63 A;  3ZRF A;  1G6J A;  1ZPS A;  2L05 A;  4AJY B;  3BVG A;  4BFR A;  1NI3 A;  2KVZ A;  2QEJ C;  1WMH B;  3GP7 A;  4TSS A;  1P3Q U;  2PE6 B;  3H7S A;  5E6J A;  4ZRP A;  4YXD B;  2KMM A;  3VRA B;  4NJC A;  2KLC A;  3I9V 1;  2HDE A;  4MSQ B;  2WHI A;  2LXA A;  2NR2 A;  3ZJT A;  3ZXV A;  3B2F A;  4AS1 A;  1WZ0 A;  1JQ4 A;  4OVV A;  3DHH C;  1OFF A;  1SIJ A;  2RDG A;  2W55 A;  2EMS A;  4F1S A;  2MH7 A;  1Y56 A;  1AYF A;  5C3J B;  3AUL A;  1FMA D;  5CHF A;  5BYQ A;  2LFI A;  3APF A;  2YEP B;  4BKT A;  1QQR A;  1KM7 A;  4W9L A;  1FFU A;  1JAL A;  3OLM D;  4LK0 M;  3SHQ A;  3TUO A;  1MI0 A;  2PMV A;  1L0Y B;  1FNV A;  5D3I B;  3V6E B;  4URK A;  5J17 A;  3U7Z A;  2M56 B;  3WAL A;  3VRB B;  3DOW A;  1E8Z A;  3QX1 A;  3NOB A;  2MBE A;  1MHH E;  1WX9 A;  5E6O A;  1OGW A;  1EUV B;  2D5G A;  3VTU A;  4I6N B;  3R7R A;  3TSS A;  4KDL B;  3BK1 A;  1T0Y A;  4JWS C;  1L4D B;  1CMX B;  2MJD A;  2AL3 A;  4RFB A;  1V1O A;  2C9W B;  4KDI C;  1AW7 A;  4RGM A;  5BMI A;  2N9P C;  1DOY A;  1KF6 B;  4OVU A;  3X0W A;  1WFY A;  3QCA A;  1SE9 A;  5HHD G;  1V97 A;  4M02 A;  4ZRQ A;  1KLV A;  3U8Z A;  1GUA B;  1TY2 A;  3AEG B;  1WXM A;  1QZE A;  3NY5 A;  2KXJ A;  2JWZ A;  3AE8 B;  3U4E G;  4E3C A;  1J19 A;  1E9M A;  4YSY B;  2N4F A;  1PGB A;  2L0F A;  1TS2 A;  4E71 A;  1VRA B;  2LXC A;  2IO2 B;  4TKN A;  3HK0 A;  3JSV A;  2KT7 A;  2I38 A;  2KTR B;  3IXS A;  1HA5 A;  1K52 A;  3ZRC A;  1JRU A;  4WWP A;  2J53 A;  4MDK E;  1V49 A;  3IFW B;  3NVW A;  3U52 E;  4D2K A;  1MG4 A;  3B0A A;  3PLU A;  4HDQ A;  2X38 A;  3NVV A;  3Q6B A;  3PPA A;  3LYY A;  4L1B A;  2K5P A;  1WX7 A;  3H7P B;  1T0S C;  4R3D A;  2NVU I;  4EKU A;  2JU6 X;  3DBH I;  1FIQ A;  1SBB B;  4WAF A;  1WX8 A;  2HTH A;  1XCT L;  5JHB A;  3QA8 A;  1FCC C;  4EUT A;  1WYW B;  1D3Z A;  3LXF A;  3L0W B;  4WJN A;  1K53 A;  3KW5 B;  4M0W A;  4PT5 A;  4MGK E;  3L54 A;  2CHW A;  1ZGU B;  3D32 A;  4P16 A;  3SFD B;  2D3G A;  4II2 B;  3P4S B;  3Q3J A;  1UF0 A;  1EU3 A;  2VZK D;  4NY0 A;  2CHX A;  2PLP A;  4HCN B;  3DHI C;  1C4C A;  3HRD D;  1TKG A;  5FR6 A;  1UGM A;  2D3C A;  3N30 A;  3WAM A;  5C1Z A;  4LNF A;  2QSD A;  3ZYY X;  2JYE A;  3VTW A;  4WJO A;  3V60 A;  1XLP A;  3IT6 B;  2MBH A;  1GAQ B;  2QJL A;  3RPF C;  2ZPN A;  4AJW A;  1TY0 A;  4W9J A;  3HUI A;  2FCQ A;  4AQ7 A;  4BZA A;  1WE7 A;  2Y5B B;  4EOY A;  2KDF B;  3ZDM C;  3IBE A;  2LJI A;  3HM3 A;  2M8S A;  4PS7 A;  2B76 B;  2IO3 B;  1TZ1 A;  1SB3 C;  4BKG A;  2LWP A;  3SR6 A;  4NAW A;  1V1P A;  2OOB B;  2BWF A;  2MP2 A;  5DPS A;  3IHP C;  1CJE A;  1WGD A;  2JF5 A;  5TR5 A;  1ET6 A;  1HZ5 A;  4MGZ E;  2EKI A;  3A9K B;  1WJ6 A;  4FXC A;  1OQR A;  2XNA C;  3PZ7 A;  4FHJ A;  1WM2 A;  5IAA C;  3PRE A;  4ZRJ A;  1R4M I;  3RNF C;  3KYD D;  1D5M C;  4FHK A;  4OZA A;  3AB5 A;  3P4P B;  4QAY A;  5E6P A;  1FO4 A;  3KUC B;  1ESF A;  4P1B C;  2BQQ A;  3UIP B;  2K8H A;  4RM8 A;  2D2Q A;  1XF5 L;  1XO3 A;  3KWV A;  3RUI B;  5IP4 D;  4ZHP A;  2LRW A;  2UWQ A;  4YT0 B;  4CQN A;  1FXI A;  2CJN A;  3RYT A;  3FIL B;  2KAC A;  2LAS A;  3OJ4 B;  2WXJ A;  4C80 A;  4ANU A;  2GBN A;  4W9K A;  3APC A;  1SE4 A;  2IYD B;  2KJ6 A;  3Q8C A;  4TV3 A;  3ZO5 B;  4DHJ B;  2BKR B;  4ICV A;  4ZYS A;  3BY4 B;  2M19 A;  4L2Y A;  3SU8 X;  2PPH A;  1JWB D;  3A33 B;  3T8M A;  2ZZP B;  1ZOY B;  3PZD A;  1NEK B;  4GSW A;  3PRP B;  3ZQ4 A;  2BW2 A;  4B0E A;  2K1F A;  4XDD A;  4W9H A;  4A8X C;  1J7B A;  4KSL C;  1TKY A;  3DPD A;  2ONQ A;  2CJO A;  1GG3 A;  1NVI D;  1N63 A;  1PDX A;  4CHK A;  1PQS A;  1J7A A;  1QOG A;  4NJ7 A;  5EE3 A;  3QJZ A;  1JRP A;  3PS6 A;  1IGD A;  2PVG C;  4PK1 A;  2HJ1 A;  1YN5 A;  4MH8 A;  3OG5 A;  3ZUN A;  1CQV A;  1YJI A;  4XC2 A;  2OHF A;  1SE2 A;  1ZUD 2;  3PZ8 A;  4G3X B;  1B9R A;  5D3D A;  1P0R A;  4W9D A;  3A1Q A;  1Q0W B;  4OVZ A;  1EU4 A;  4E74 A;  4GN1 A;  4B0M A;  4ICU A;  4RGO S;  2MCN B;  1WXQ A;  2GBK A;  2JZ3 B;  2SEB D;  3P42 A;  1GNU A;  5C2T B;  3V05 A;  1F2R C;  4TQ0 A;  4BOS C;  2LMC A;  5FR3 A;  2KWD A;  3Q8F A;  1X1M A;  2JT4 B;  1N5W A;  2RDH A;  4IDI A;  2NS5 A;  2C5L C;  2M17 A;  3VUW A;  3WA0 A;  2BB5 A;  4JLC A;  4NZL B;  3ZJU A;  2NCN A;  4MSM B;  3PRM B;  2DEN B;  5IA7 A;  5EE0 A;  5J2R A;  4M00 A;  3IG3 A;  4B6W A;  2V4I B;  2N7D A;  1TS3 A;  5T8I A;  4KZC A;  4DWF A;  1OQY A;  2JX5 A;  2YVC A;  5BYR A;  4C56 C;  5HG2 A;  4MEL A;  4IM3 A;  2O2V B;  2N9X A;  4C7Z A;  2L1A A;  2JYT A;  1OTR B;  3NJT A;  4OZB A;  3WAN A;  1QOA A;  4B95 A;  3AE6 B;  1ROE A;  5AUK A;  1UWM A;  3B1L X;  3CIR B;  2HJ8 A;  2LGI A;  2WQY B;  3R66 C;  4IKG A;  4WIP A;  4XWT A;  3DDC B;  2WP9 B;  1WSP A;  1UBI A;  3EC8 A;  3MC0 B;  3RNC C;  5G2N A;  4GU2 A;  3BVM A;  2WWZ A;  1XCQ L;  3OAW A;  2L8J A;  4GGQ A;  1WGY A;  2BYE A;  2KJH B;  4MGI E;  3W5U B;  1RM6 C;  1SE3 A;  2HTM E;  2BB6 A;  2LD9 A;  1V9J A;  2IO0 B;  4GDK B;  3HHM A;  5CTR C;  1V80 A;  4JPS A;  4FUL A;  4FBJ B;  1LXD A;  4WUR A;  4ITK A;  4XX5 A;  1T5X D;  2C60 A;  1KFY B;  2V3S A;  3LB8 C;  2J4X A;  3DBL I;  1PFD A;  4LLG M;  4ZYN A;  2KQ4 X;  4EZK A;  3N32 A;  3AE2 B;  2IO1 B;  2N9L A;  4C4V A;  2WXG A;  3CF6 E;  5D2M B;  2WXP A;  3TEX A;  2KNB A;  3VR8 B;  2J0M A;  3RCZ A;  3DBH B;  4LCD E;  3A4S C;  3RMK C;  4MEM A;  4GLS C;  4RF1 A;  3GS2 A;  3JW0 X;  3ZTD A;  4LTU A;  2KX3 A;  5GXG B;  3I3T B;  2WDT B;  2G4S A;  3AEF B;  2IJ0 A;  3IAM 1;  1WXS A;  1E5W A;  3DBR I;  2DZK A;  2FIF A;  1WJN A;  2B3A A;  3ZNZ B;  1EWY C;  1NDD A;  1TT5 B;  3Q3O C;  5D7G A;  5IKC M;  1TJE A;  4KKI A;  2KAN A;  3H8H A;  4US8 A;  3EFC A;  3Q8A A;  1S1Q B;  4H2A A;  1QT9 A;  4GMV A;  4PYU A;  3U7D A;  3VFK A;  2LJ5 A;  2J52 A;  1J0G A;  4LJP B;  4JE3 B;  4HRS A;  3RT3 B;  4GB9 A;  3DWM A;  2BYT A;  3UQA A;  1AN8 A;  3L4P A;  5CX3 A;  2K8C A;  3W9C B;  3AM9 A;  4DHJ D;  1YN3 A;  1QIL A;  1WE6 A;  3SDL C;  2WXH A;  2C7H A;  3K9O B;  4BKS D;  3L17 A;  1YJJ A;  1TS4 A;  2OJW A;  2MBB B;  4K3C A;  4ZDV A;  1JRO A;  2NBU A;  3C19 A;  3H6N A;  3DVN V;  1MG8 A;  1E7U A;  3X23 A;  2I1J A;  4HLE A;  1A70 A;  5BMH A;  3UI3 A;  2VRR B;  1F1H A;  1L7Y A;  1WF9 A;  2RMM A;  2ZNV B;  3BII D;  3Q3M C;  1VJK A;  1IPG A;  3TL5 A;  3EFU A;  4ANX A;  2ASQ A;  3T3N A;  4DDI D;  3ABV B;  1F9J A;  2ICI A;  4FN2 A;  3I63 C;  1FD6 A;  3PHX B;  3VVW B;  2EMT A;  4MM3 B;  3ZTC A;  4CYE A;  5KHQ A;  1I4R A;  1HZ6 A;  1WZ3 A;  3SEB A;  4GIV A;  2L83 A;  2IGH A;  1GC7 A;  5HKH A;  3AE9 B;  2BT6 A;  3EUB 2;  3M62 B;  2W3S A;  1JWS D;  3MP9 A;  2QHO A;  1WRI A;  2V3N A;  2JSV X;  5H92 C;  2EKE C;  3BYT B;  3K9P B;  1VR9 A;  1N62 A;  4N58 A;  3VH4 B;  1PYW D;  2GMI C;  1R4M B;  2WXM A;  1QKZ A;  2L76 A;  3URY A;  1E8W A;  2BVC A;  3BZD B;  2Y5P A;  1V6E A;  3N1Y C;  2BS3 B;  2CKH B;  1EF1 A;  2BWE S;  2MBQ A;  2N0S B;  3BWU D;  3EEC A;  2KX0 A;  3KH0 A;  2N9K A;  2AQ1 B;  4NPN A;  1FCL A;  3B9J A;  3MTN B;  1V86 A;  1HE8 A;  1T6B X;  3W1S C;  3I5J C;  2QIL A;  3HM6 X;  1WJU A;  4HVB A;  2RR9 A;  3KWL A;  1SF0 A;  4HXD A;  2AWT A;  5AEK B;  3QAR A;  4JX1 C;  3VUX A;  1TIF A;  3RUL A;  2J0K A;  3M95 A;  2FNJ B;  3W1S A;  1FRD A;  1WGG A;  3GZN I;  4XWW A;  3WAO A;  1K50 A;  3VQI A;  2D11 A;  2NBV B;  5CHW A;  1WMH A;  1R7S A;  4KGS A;  4HPM B;  2PEA A;  1VD2 A;  2LZ6 A;  4XYC A;  5LNK 1;  3VDZ A;  1L0V B;  4LNO A;  3R8B A;  2V3P A;  2BBC A;  3ALB A;  3PRZ A;  1UD7 A;  2GRI A;  2KTF A;  4Q2J A;  4YTP B;  1M94 A;  2KC2 A;  3APD A;  4BBN F;  1FRR A;  5G55 A;  2ZVN A;  2DNF A;  1C3T A;  3TEW A;  3DVN U;  3TMP B;  2ZNV C;  4ASW C;  2CHZ A;  1YIW A;  1YQ3 B;  4IC7 B;  3TJP A;  2D07 B;  2NMQ A;  1L0X B;  2Y3A A;  3H9D A;  1GB4 A;  4HK2 A;  2KO3 A;  4GDL B;  4HKQ A;  1ENF A;  5EDS A;  3NG0 A;  1WY8 A;  1PGA A;  1EO6 A;  2RGF A;  1D5X C;  4A9A A;  1EWC A;  4N6E B;  1FEH A;  2WXK A;  2QCZ A;  2WXO A;  3A9J B;  1T0R C;  2LVO A;  1STE A;  4HCP B;  4BVU C;  1K8R B;  1VCB A;  3AE7 B;  3PV1 A;  2G1E A;  3SFE B;  3BVZ A;  2IPK D;  3R2I A;  5G5H A;  1UZX B;  2PW9 A;  1C79 A;  2M0X A;  5DPT A;  4JIO U;  2UU7 A;  2QC8 A;  2LUM A;  2K6D B;  2KD0 A;  5IO9 A;  1ZW7 A;  4WWN A;  3MC8 A;  2W82 A;  4NJ6 A;  1XEE A;  2XN9 C;  2IDY A;  3Q69 A;  1JML A;  4LNK A;  2WU2 B;  2INC C;  1YN4 A;  3PO0 A;  2RD0 A;  4IOI E;  4WQM A;  5LLI A;  2KTR A;  1IBX B;  3VR9 B;  4LNI A;  2K3U A;  5J18 A;  5AZG A;  3AEC B;  1V5T A;  3S2A A;  1C77 A;  1ZXH A;  3KYC D;  1WRD B;  3P1M A;  2IBI B;  1SXT A;  2KLG A;  4FJZ A;  4MJS B;  5FKA C;  2PJH A;  1I4Q A;  2L7R A;  2V0G A;  3AEE B;  3H7P A;  4IWP A;  5CHV C;  2LVQ A;  1YOV B;  1ET9 A;  1KTK A;  1NI2 A;  4MH0 E;  1BUI C;  4FAD A;  1LFD A;  2E6X A;  3P4R B;  4OHJ A;  1YD8 U;  4KGR A;  3TEY A;  5H8Y E;  1Y8R C;  2N9E B;  1UUP A;  3HVZ A;  2PIA A;  2DZI A;  2A4Z A;  2GOW A;  2NTT A;  2JRI B;  3RNG C;  1WR6 E;  2W54 A;  4KX6 B;  3L13 A;  1V5O A;  3FAH A;  2C7M B;  3HIZ A;  4I6L B;  1E8Y A;  1UBQ A;  2WNM A;  3NHE B;  4EFO A;  3PT2 B;  2BS4 B;  1WXV A;  3PLV A;  3NZ3 A;  1H4R A;  5AZH A;  4A20 A;  4GDL A;  1GB1 A;  2UYZ B;  3Q2A C;  3W1Y A;  2L3Z A;  3QQ8 B;  2QDF A;  3ZGZ A;  1WWT A;  4LNN A;  4ARI A;  2JPH A;  2NPT B;  2Z59 B;  4XZ4 A;  1H8C A;  4ZRK A;  2KZR A;  3N1Z C;  3DBL B;  1MPE A;  2WXQ A;  4DXG A;  1D4B A;  1DOI A;  3TIX A;  2LGD A;  1KJT A;  2BGF A;  2JXX A;  1FXT B;  4PS3 A;  2KFJ A;  2KYW A;  3V61 A;  3GE3 C;  3JVZ X;  2BF8 B;  1SEB D;  2DYO A;  5JZE B;  2HD5 B;  1P7F A;  3E56 A;  1P7E A;  2L52 A;  3DBR B;  1C9F A;  2WGS A;  2LVP A;  5IOI A;  2RPQ A;  3KUD B;  1VZ6 A;  4P1C C;  1L2N A;  1VDV A;  4KSK C;  2A5U A;  4A6Q A;  4K7S A;  3A9K A;  4KIK B;  2FBW B;  2MQJ A;  4KVG B;  3AI5 A;  3NS1 A;  4M8M A;  3L08 A;  1RFK A;  2LGY A;  1XD3 B;  4AUQ C;  2N7E A;  4WJP A;  1P98 A;  4AWJ A;  2DAJ A;  1IBX A; 
#chains in the Genus database with same CATH homology
 4LTU A;  1VRA B;  5GXG B;  3ZJV A;  2E3T A;  3AEF B;  1J7C A;  2DLB A;  2IJ0 A;  3IAM 1;  2WLB A;  4REZ A;  2I38 A;  4RGN A;  3IXS A;  1HA5 A;  3W5V B;  1K52 A;  1EWY C;  4L23 A;  2J53 A;  2SAK A;  1GOZ A;  5D7G A;  3BK2 A;  3NVW A;  3U52 E;  1N60 A;  4D2K A;  1TJE A;  4KKI A;  3H8H A;  1D5Z C;  1MVK A;  4US8 A;  3Q8A A;  5BMG A;  1N61 A;  2X38 A;  4H2A A;  1QT9 A;  3NVV A;  5EE1 A;  2J52 A;  3LYY A;  4L1B A;  2DYM A;  2K5P A;  2G9H D;  4HRO A;  2K22 A;  1C76 A;  1WYG A;  3FIL A;  2WDQ B;  2INP E;  2Y5C A;  4HJG E;  4HKZ E;  4R3D A;  2I2Y A;  4JE3 B;  2JU6 X;  2INN E;  4HRS A;  2BTE A;  1FIQ A;  1C4A A;  3DWG C;  1SBB B;  1XLQ A;  3DWM A;  4WAF A;  2BYT A;  2NTS A;  1AN8 A;  3L4P A;  1I4H A;  1XCT L;  1QOB A;  1XXG A;  4XE0 A;  3W9C B;  3AM9 A;  3IAS 1;  1DYQ A;  1FCC C;  2QIE B;  1YN3 A;  1QIL A;  2W3R A;  2WXH A;  5TSS A;  2WXF A;  4N59 A;  4YWG G;  4A90 A;  3LXF A;  1K51 A;  1YJJ A;  1TS4 A;  1K53 A;  4M0W A;  4PT5 A;  3AV8 A;  1JRO A;  3V3X A;  1TS5 A;  1KH0 A;  1TYG B;  3MHZ A;  5BMH A;  1A70 A;  4P16 A;  1L6U A;  3SFD B;  3UI3 A;  1TKE A;  2J42 A;  1HQR D;  3P4S B;  4XDC A;  3WCQ A;  1EU3 A;  2LEK A;  2VZK D;  3R2T A;  1C78 A;  2RMM A;  2K9X A;  1E6E B;  2QMT A;  3BII D;  1VJK A;  1E7P B;  3AN1 A;  3EGR A;  1QF6 A;  1CZP A;  2JQR B;  3T3N A;  1NYQ A;  3U2S C;  3ABV B;  2PLP A;  1C4C A;  4YTN B;  2ICI A;  1FD6 A;  3HRD D;  1TKG A;  1HEZ E;  2MEK A;  2WS3 B;  4MM3 B;  1PGX A;  1I4R A;  1HZ6 A;  3AH7 A;  3SEB A;  3GB1 A;  2AX5 A;  2QSD A;  3ZYY X;  2L83 A;  2IGH A;  2IGG A;  3Q8E A;  3AE9 B;  2BT6 A;  2JYE A;  3EUB 2;  2W3S A;  1JWS D;  1ZDX A;  3MP9 A;  3AED B;  1XLP A;  3IT6 B;  1WRI A;  2V3N A;  1GAQ B;  2QJL A;  3RPF C;  2JSV X;  4WWM A;  1YMH E;  5H92 C;  3BYT B;  1GPX A;  1E10 A;  1WGK A;  2H89 B;  1TY0 A;  1N62 A;  1VR9 A;  4N58 A;  1FNW A;  1PYW D;  3HUI A;  5EE9 A;  4AQ7 A;  2WXM A;  1QKZ A;  3URY A;  1UNS A;  5G5G A;  5I4D A;  3FC4 A;  2DBY A;  4RGT A;  3BZD B;  3TEZ A;  3NUH B;  1B1Z A;  2Y5P A;  2LJI A;  2WDR B;  1QOF A;  2BS3 B;  1I7H A;  5AUI A;  2B76 B;  2JXT A;  1FM0 D;  1HXY D;  1SB3 C;  4JWU C;  2N0S B;  3BWU D;  3SR6 A;  2WXI A;  1V1P A;  4P6V F;  2N9K A;  2AQ1 B;  1CJE A;  3ETR A;  1FCL A;  1ET6 A;  1HZ5 A;  1JWM D;  2EKI A;  3B9J A;  2JZP A;  1SJH D;  1T6B X;  4HEA 1;  4ZOH C;  2QIL A;  4FXC A;  1OQR A;  2XNA C;  2YEP F;  3PZ7 A;  1I4X A;  1F77 A;  1Q10 A;  2PVO D;  3KWL A;  1SF0 A;  1SSN A;  3AMZ A;  1FNU A;  2GI9 A;  4JX1 C;  1V8C A;  1D5M C;  4OZA A;  3AB5 A;  1AWD A;  4EE2 A;  3W1S A;  4KGT A;  1IBX A;  1FRD A;  3EA6 A;  3P4P B;  4XWW A;  1FO4 A;  1K50 A;  3VQI A;  1ESF A;  3AEB B;  1XLO A;  1EM7 A;  3N9Y C;  3KQ4 A;  1R7S A;  2KAJ A;  4KGS A;  1XF5 L;  1ZP0 B;  1KLU D;  2LHD A;  1FXA A;  1I4P A;  1N5X A;  1BML C;  4OZC A;  1XO3 A;  3KWV A;  2JWU A;  2KN4 A;  1JCK B;  4ZHP A;  4YT0 B;  5LNK 1;  4CQN A;  1FXI A;  1ZXI A;  2CJN A;  3FIL B;  2KAC A;  3NVY A;  3AE4 B;  3IT4 B;  1L0V B;  1CK1 A;  3R8B A;  2WXJ A;  4C80 A;  2V3P A;  2BBC A;  4MAC A;  5BYS A;  2MJE A;  1SJE D;  1ZDV A;  2GRI A;  4Q2J A;  4RNA A;  4YTP B;  1SE4 A;  1VLB A;  1OQQ A;  1FRR A;  3Q8C A;  3MFG A;  3TEW A;  1DGJ A;  1YNT E;  1F2R I;  1YQ3 B;  1L6V A;  4RCO A;  4ZYS A;  2WXN A;  2M19 A;  2LHE A;  4L2Y A;  1ACC A;  2NMQ A;  1C4P A;  2ON8 A;  1L0X B;  2Y3A A;  3B2G A;  3W2D A;  1GB4 A;  1JWB D;  4J3O D;  4GDL B;  2R61 A;  1ZOY B;  1NEK B;  4HKQ A;  1ENF A;  3ZQ4 A;  2BW2 A;  4B0E A;  1PGA A;  3AE5 B;  1D5X C;  2EEL A;  2K0P A;  4XDD A;  1EWC A;  4A9A A;  1ZE3 D;  3BYY B;  2VZK B;  2PKO A;  4A8X C;  1J7B A;  4N6E B;  1FEH A;  5MPO A;  1TKY A;  2WXK A;  2ONQ A;  2CJO A;  1NYR A;  1VZ7 A;  2FE8 A;  1RYJ A;  2MJ3 A;  1NVI D;  1BXT A;  2N7J A;  2WXO A;  4WH4 A;  1N63 A;  1PDX A;  3NRZ A;  2PTL A;  1STE A;  1J7A A;  1QOG A;  5EE3 A;  5HI1 A;  1RWS A;  3AE7 B;  3HVD A;  2G1E A;  1PUT A;  1JRP A;  1IGC A;  3SFE B;  1IGD A;  2PVG C;  3BVZ A;  2IPK D;  1IUE A;  1F0Z A;  3P4Q B;  3R2I A;  1YN5 A;  5G5H A;  1M4V A;  2PW9 A;  1C79 A;  3O13 A;  4MH8 A;  2CU3 A;  1CQV A;  1YJI A;  2KDM A;  1L5P A;  2LUM A;  1KRH A;  2OHF A;  1SE2 A;  1ZUD 2;  1JW9 D;  3PZ8 A;  2FUG 1;  2W82 A;  5D3D A;  1B9R A;  1XEE A;  1DOX A;  2WXL A;  2XN9 C;  4ZHO A;  2IDY A;  1D6E C;  3Q69 A;  1JML A;  4UDU C;  3AE1 B;  2GB1 A;  4NAM A;  2WU2 B;  1EU4 A;  1QLB B;  4OVZ A;  4B0M A;  1YN4 A;  2WDV B;  3PO0 A;  4RGO S;  2M0A A;  1WXQ A;  3C8Y A;  1L4Z B;  4NAW B;  5JXV A;  2SEB D;  3P42 A;  4YSX B;  1V1P B;  4IOI E;  4TQ1 A;  4WQM A;  1I4G A;  2AQ2 B;  5C2T B;  3V05 A;  1JWU D;  1F2R C;  4TQ0 A;  1IBX B;  2LMC A;  3VR9 B;  2H88 B;  4YSZ B;  5FR3 A;  2KWD A;  3Q8F A;  2Q5W D;  2K3U A;  1N5W A;  2RDH A;  1LO5 D;  3AEC B;  4IDI A;  1C77 A;  1ZXH A;  2Z8L A;  3P1M A;  1SXT A;  3P63 A;  5FKA C;  2RPV A;  1ZPS A;  1I4Q A;  2V0G A;  3AEE B;  2BB5 A;  3BVG A;  4NZL B;  1NI3 A;  3ZJU A;  2QEJ C;  1TZO A;  1ET9 A;  1KTK A;  1BUI C;  4MT5 A;  2E6X A;  3P4R B;  4OHJ A;  4KGR A;  4ARC A;  5EE0 A;  3GP7 A;  2TSS A;  4TSS A;  3TEY A;  1XLN A;  1UGJ A;  5H8Y E;  4ZRP A;  5E6J A;  4YXD B;  2KMM A;  3VRA B;  2WU5 B;  4NJC A;  4YTM B;  2V4I B;  3I9V 1;  2HDE A;  1NEN B;  1UUP A;  3HVZ A;  1TS3 A;  2PIA A;  5T8I A;  3CWI A;  4RH6 A;  4A55 A;  2JX5 A;  5HFY A;  2DWQ A;  4TMA B;  2NTT A;  5BYR A;  3ZJT A;  4C56 C;  3I57 A;  5HG2 A;  3B2F A;  4AS1 A;  2W54 A;  4KX6 B;  1JQ4 A;  4C7Z A;  3E9S A;  3FAH A;  2L1A A;  2JYT A;  4DQO C;  1OFF A;  1SIJ A;  2ACZ B;  2RDG A;  2W55 A;  4C7Y A;  1YQ4 B;  4OZB A;  2MH7 A;  2WNM A;  1Y56 A;  1QOA A;  2BS4 B;  3ZGZ A;  1AYF A;  3AE6 B;  1ROE A;  1E0Z A;  5C3J B;  3NZ3 A;  1FMA D;  5AUK A;  1UWM A;  3AEA B;  5BYQ A;  2LFI A;  3AE3 B;  1GB1 A;  2YEP B;  1QQR A;  1FFV A;  3NVZ A;  3J9C A;  1FFU A;  1JAL A;  3CIR B;  4LK0 M;  3TUO A;  1MI0 A;  2LGI A;  1WWT A;  2PMV A;  1L0Y B;  1FNV A;  2WQY B;  3RFZ B;  4IKG A;  4WIP A;  5D3I B;  4XWT A;  4ARI A;  3T3O A;  2WP9 B;  3U7Z A;  2ZW1 A;  2M56 B;  1WSP A;  2OED A;  3MJ5 A;  3VRB B;  1MPE A;  2WXQ A;  3MC0 B;  4DXG A;  1D4B A;  1DOI A;  1MHH E;  3BVM A;  4USA A;  2WXR A;  2D5G A;  1XCQ L;  4KKJ A;  1SEB D;  2DYO A;  3TSS A;  3BK1 A;  1P7F A;  3W5U B;  1RM6 C;  3E56 A;  1SE3 A;  1P7E A;  2HTM E;  4JWS C;  1L4D B;  2L32 A;  2L52 A;  2MJD A;  2BB6 A;  4OW0 A;  1UWX A;  4RFB A;  1V1O A;  4GDK B;  1C9F A;  1AW7 A;  5FK9 C;  4RGM A;  4JPS A;  1VZ8 A;  5BMI A;  4WUR A;  1VZ6 A;  4DXF A;  1JWA D;  4ITK A;  2ZW0 A;  1DOY A;  1VDV A;  1KF6 B;  1T5X D;  3KLS X;  1KFY B;  5HHD G;  4A6Q A;  3LB8 C;  2J4X A;  1V97 A;  1PFD A;  2BS2 B;  3OWE B;  4LLG M;  2KQ4 X;  1KLG D;  4O1N A;  4ZRQ A;  3AE2 B;  4RF0 A;  1TY2 A;  2AQ3 B;  2N9L A;  3AEG B;  2WXG A;  3Q8B A;  2FBW B;  2WXP A;  1T3Q A;  3NS1 A;  3AE8 B;  3TEX A;  3U4E G;  3VR8 B;  1RFK A;  2IGD A;  1E9M A;  4YSY B;  1PGB A;  4GLS C;  4RF1 A;  3GS2 A;  4US9 A;  1TS2 A;  1MHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...