4IDIA

Crystal structure of rurm1-related protein from plasmodium yoelii, py06420
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
122
structure length
119
Chain Sequence
MKVKIELKFLGGLESYLEDKSKNYVTLEIDSKELNFENLIAFIRDNIIEKKFVFSDYDIDEKLCKVMVDNKEYSNYNLKDKAKIKPGIIVLVNEYDWEILGTYSYQIKNDDKICFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Rurm1-related protein from Plasmodium Yoelii, PY06420
rcsb
source organism Plasmodium yoelii yoelii
molecule tags Protein binding
molecule keywords Oryza sativa Rurm1-related
total genus 32
structure length 119
sequence length 122
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09138 Urm1 Urm1 (Ubiquitin related modifier)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4idiA00
3DWMA 2M19A 1DGJA 2WDVB 3SFDB 3CIRB 1L5PA 3AE5B 3HUIA 3P1MA 3ABVB 3B9JA 1QT9A 3AH7A 4YTMB 2N0SB 1WXQA 2EKIA 3P63A 3VRBB 5EE1A 1FXIA 2W3SA 1JQ4A 1QOFA 3AEDB 2H88B 1FXAA 3VR8B 2WDQB 1QF6A 1DOYA 4YSXB 1TJEA 2MJEA 3AE7B 4N6EB 2LEKA 3SFEB 3NVYA 3NVWA 1E7PB 4C7YA 3NRZA 1ZP0B 3HVZA 3AE6B 3B2GA 1J7BA 1YJIA 3NS1A 4KX6B 1E6EB 4US9A 1YQ4B 2ACZB 1JROA 3WCQA 1ZXIA 2PKOA 1TKGA 1L6VA 1FRDA 3AE2B 1R7SA 2CU3A 2M56B 5EE3A 3W9CB 3NVZA 1AYFA 1V8CA 3AN1A 2G1EA 4JWUC 1WGKA 4ITKA 4JWSC 1RYJA 4YXDB 4ZHPA 3AE4B 3AEEB 3NVVA 1SB3C 4A9AA 2Y5CA 3AE1B 1E0ZA 1RWSA 2BS3B 2BS2B 2WLBA 3LB8C 1RM6C 1KF6B 1PFDA 1NVID 2KMMA 3L4PA 4WQMA 4N59A 3P4RB 2WU5B 1NYRA 3P4PB 5EE0A 1ZOYB 2WDRB 1XLOA 3FC4A 3AMZA 2L52A 3AE8B 4LTUA 4YSZB 4US8A 1NYQA 5MPOA 1L6UA 2W54A 2JQRB 3AEGB 1JW9D 1QOAA 1WWTA 3FAHA 1N5WA 5G5HA 1YJJA 2MJ3A 1RFKA 3AEAB 3W5VB 3W5UB 1E10A 2HTME 1FFUA 4HRSA 5H92C 2L83A 2OHFA 1SIJA 1UWMA 1FRRA 3VRAB 3AE9B 1N60A 1VJKA 3VR9B 4C80A 2Q5WD 1L0VB 2B76B 3EUB2 4JX1C 1FMAD 1XO3A 1ROEA 2CJOA 1FIQA 1JALA 1YQ3B 2PIAA 3AM9A 3ETRA 1I7HA 1NEKB 1QOGA 1CJEA 2AX5A 2DWQA 2QIEB 4N58A 1NENB 1QOBA 1ZUD2 2W3RA 2K22A 5C3JB 1XLQA 1F0ZA 1DOXA 2CJNA 3AB5A 1N62A 1TYGB 3AV8A 5C2TB 3CWIA 1TKEA 4YTPB 5AUIA 4ZHOA 1JWBD 1J7CA 1OQRA 5G5GA 1XLPA 1CZPA 2H89B 1PDXA 1WRIA 2WS3B 1AWDA 4YTNB 3AE3B 2W55A 3ZYYX 1E9MA 5GXGB 4HROA 1SF0A 1FM0D 1JRPA 1FO4A 1N61A 2MH7A 2JX5A 3P4QB 5H8YE 4YT0B 3PO0A 4FXCA 1OFFA 1FFVA 2QJLA 3AEBB 2WU2B 3B2FA 1DOIA 4C7ZA 1VLBA 1EWYC 1V97A 1T3QA 4ZOHC 1N63A 2KAJA 3AEFB 2K5PA 2E3TA 3RPFC 2PVOD 2MJDA 2WQYB 3BIID 1KFYB 4USAA 1KRHA 4WWMA 1J7AA 2K9XA 3DWGC 1XLNA 2BT6A 1WYGA 3AECB 3HRDD 1IUEA 1TKYA 4P6VF 3KWLA 2FBWB 1NI3A 2BS4B 2WP9B 4IDIA 1VDVA 1QLBB 5AUKA 1GPXA 1A70A 2PVGC 1JWAD 1PUTA 2DBYA 1N5XA 5EE9A 4YSYB 3SR6A 1B9RA 1OQQA 3LXFA 3P4SB 1GAQB
chains in the Genus database with same CATH superfamily
2DZJA 2RMMA 3P1MA 5DPTA 5D3DA 3FILB 3L10B 4MGIE 3L54A 5T8IA 4PK1A 5DPWA 2MA9B 2VH1A 3SDLC 1WX9A 2KZRA 2Y3AA 3B2GA 4DHZB 2PKOA 3DHIC 3M95A 3VTWA 3NVZA 2M0XA 1V8CA 4JWUC 2INPE 4GIVA 1GG3A 2I1KA 3ZIMA 2BS2B 3NOBA 4D2KA 2GBKA 5CHVC 3C8YA 4DHZE 4US8A 4HVBA 1E8XA 1E90A 3GB1A 4M0WB 3ZRCA 4UDUC 2CHWA 3ZNID 3VRAB 1K8RB 2N7JA 3AE9B 1YX6B 1U4AA 3EUB2 2GBNA 1WM3A 2IJ0A 3PS6A 4L1BA 3NHEB 3RI7C 4LNNA 5D2MB 1ET9A 4BKTA 1A5RA 4HEA1 5C3JB 4JIOU 1D5ZC 2E6XA 3BZDB 3H9DA 1HEZE 3JSVA 3DBLB 1R4MI 2WS3B 1AWDA 2KO3A 4YTNB 4HROA 1MHXA 1C79A 3LYYA 3Q3NC 1FCLA 4ICUA 3AEBB 1EWYC 4MGYE 2WXKA 3U2SC 2KLCA 3RPFC 3PREA 2RD0A 3QARA 3PZ8A 3DBHI 2BT6A 4AQ7A 2A5UA 1TTNA 3RZWC 3WALA 3H8HA 3VTUA 1IGDA 3Q8FA 4FJYA 3P4SB 3R2TA 4C00A 2REXA 5GMVA 4RGNA 3AH7A 2JY6A 4HPMB 3P63A 3U7ZA 4W9CA 5J2RA 1V80A 4G50A 2IPKD 3ECIA 2PE9A 3VAWA 3NRZA 1ZP0B 3JYUA 1WE7A 1CMXB 2M56B 4KIKB 3AN1A 1VZ7A 2QSDA 3QC8B 3WAMA 4YXDB 4XDCA 1SB3C 3VFKA 3TEWA 2N1VA 4REZA 2YEPF 3D32A 3L4PA 3DVNV 2JSVX 2L00B 3EGRA 4XGAB 2B3AA 4X57B 2KDBA 2D3BA 1KM7A 3IHPC 1YQBA 4OVUA 1LXDA 2DYMA 3ZGZA 2HTME 1FFUA 2WXGA 1WI0A 3QX1A 2WXJA 2G4DB 1L0VB 5G2NA 2AX5A 4MDKE 3AV8A 2WYQA 4LJPB 2PPHA 5C23A 2BYVE 2KDFB 4NJ6A 2H89B 4ZRKA 1E9MA 1JRPA 1IP9A 3H7PB 2WDTB 2Z59B 2V4LA 1KJTA 1KFYB 3DQVA 4TSSA 2LHEA 1WJ4A 2FIFA 2KJHB 2LD9A 2RSUA 2X38A 5AZFA 1OEYJ 1V6EA 4BVUC 1E5WA 3N32A 1D3ZA 4M8MA 1QLBB 3DVNU 5IN7A 4ZRJA 1XD3B 2MX2A 1N5XA 4EKUA 3AM9A 1WRDB 1E8WA 3AE5B 4LNIA 4Q2JA 4IG7B 2XEWA 3A33B 3DOWA 3RMKC 2N7DA 4MEMA 1QF6A 1QKZA 3I57A 4YSXB 5KHOA 5E6PA 2M1MA 1V9JA 1TIFA 5D6JB 3TBLD 4YL8A 1AYFA 4JWSC 4F8CB 2D5GA 4A9AA 2KDMA 1GJZA 1NVID 3KWVA 4NY0A 2L52A 3AE8B 2XK5B 1TGZB 4OVVA 2K39A 3N30A 1HTQA 2L83A 3Q3OC 2RDGA 3UINB 2CJOA 1I7HA 2M0AA 4EEWA 2Y5BB 2JRHA 4YTPB 1IGCA 1I4GA 1VR9A 3C0RB 3Q3MC 3NZUA 4F1SA 2BYTA 4IM0A 1AN8A 1N61A 2MH7A 3HIZA 4I6PA 3L13A 2QJLA 4CHKA 2LUEA 3QCAA 1I42A 1TS2A 4GB9A 2MJDA 3KVFB 3WAPA 2WX1A 1XLNA 1H8CA 1K53A 3BY4B 2KNBA 3E9SA 1GB1A 4MSQB 1C1YB 2N1WA 2JZPA 2V0GA 1WSPA 2C60A 5BO4B 5AEKB 4XE0A 3LJ3A 1TBEA 2KWDA 3RN9C 3V05A 5G55A 4M0WA 3ABVB 3VUXA 3H7SA 2ZJDA 4XC2A 4FULA 4H2AA 3K9PB 2O6VA 1TJEA 4RGMA 2MJEA 4EE2A 3QJZA 1YQ4B 2ZPNA 1R7SA 5HFYA 4CO7A 4RM9A 1KH0A 4EOYA 3UQBA 3I9V1 2LGDA 3P4PB 3UI3A 3A1QA 1ZOYB 2WDRB 2V4IB 1Y56A 2J7QB 3LDZE 3PLUA 2D11A 2L32A 4ARCA 1FXTB 1P7FA 2JQRB 3HK0A 2ZEQA 3FAHA 1WWTA 5LXIB 4GN1A 1V49A 3HM3A 3V60A 1PGAA 1H4RA 2Q5WD 2K3UA 3APFA 1WX7A 1QOGA 2DWQA 1ZUD2 4KSKC 4KGRA 2K22A 1C9FA 3VHTC 4KV2A 1F1HA 1T5XD 3ZYYX 2K6QA 2BPSA 1WYWB 4F7ZA 4B95A 3RD2A 2PLPA 2ICIA 3DBRB 1OEYA 2IDYA 3JW0X 4GSWA 3U4EG 1P3QU 2KMAA 4A20A 5E6NA 1FNUA 1KLUD 3N1XC 3NZSA 4YSYB 3SR6A 1OQQA 1QZEA 4P16A 3X0WA 4NAMA 3U30A 2WDQB 4K7WA 1DOYA 4C7YA 2BYEA 2O2VA 2FIDA 1WR1A 4ZYSA 2PJHA 4W9LA 1WGKA 1R4MB 5J18A 2KQSA 1WGRA 1TS3A 1WZ3A 5CHFA 4W9FA 2FNJB 1KF6B 4IWQA 2EMTA 4FADA 1WGGA 1C4AA 3N20C 3PHWB 1MG8A 3SHQA 3DBHB 1P7EA 2AQ3B 1EM7A 3MHSD 4IOIE 1ZPSA 1ROEA 4WH4A 2O2VB 1NENB 3RT3B 2IY0B 1ZDVA 1IBXA 2V1YA 3VUYA 5FR3A 3GE3C 1JWBD 3IT4B 4HKQA 1M94A 3KUCB 2NVUI 3U7DA 1CZPA 1WRIA 3GS2A 2MWSB 1V5TA 4P1BC 4K81A 2D3CA 2L76A 2MQJA 3P4QB 3N1YC 3BK1A 4W9EA 1M4VA 3Q8CA 2IBIB 4RM8A 4WAAA 1NDDA 3P2BA 1V86A 2FBWB 4YWGG 3ZNHB 2KXJA 4BOZB 1ACCA 2WX0A 1GAQB 3Q3FA 1Q5WB 1SGHA 4ANWA 1FCCC 1SE4A 1JMLA 4MM3A 2V3PA 2X8XX 4LK0M 3VTVA 5AZGA 1K52A 4B0MA 3NS1A 1XXGA 4KX6B 3RNAC 1L0XB 1JROA 3P42A 1FRDA 2KQ7A 3Q3JA 1CK1A 2JXTA 1HE8A 4C4VA 1I4RA 2QHOA 2BWFA 2TSSA 3TL5A 2AL3A 3UGBB 4RGTA 2A4ZA 3ML9A 3IBEA 3MFGA 4DQOC 1WY8A 4WWNA 2KVRA 2MBEA 1ZW7A 5I4DA 2MJ3A 4LNKA 3IAM1 2LXAA 1E10A 3DVGY 4K7SA 3QQ8B 1VRAB 1SIJA 1FRRA 4NQLB 2RGFA 3RNBC 2MP2A 1FMAD 1XO3A 3Q8EA 2BYFA 1L0YB 5DCNA 2LVOA 1D6EC 1F0ZA 2LGIA 5D94A 2VZKD 4RH6A 1F9JA 1IBXB 4K3BA 2C7HA 4ZHOA 4MJSA 4KIKA 3WA0A 3T3NA 3AE3B 4LNFA 3BYYB 1GB4A 4FBJB 1YN3A 1N63A 4WJNA 2PVOD 1R4NB 1J7AA 2CR5A 1TY0A 1TKYA 1YD8U 1XT9B 4C56C 4XWTA 1JRUA 1YX5B 2KJ6A 2WP9B 4ANVA 2LMCA 1VCBA 2NBUA 4XDDA 1FNVA 3VH4B 4YTMB 2N0SB 4HXDA 1FXIA 1PGBA 1V2YA 2KMCA 1YNTE 3FILA 2VRRB 4BKGA 1C4PA 2NBWB 3KQ4A 2KDIA 3V61A 3OLMD 3SFEB 4ANXA 2DYBA 3HVDA 2ASQA 2DAJA 4ICVA 1EF5A 4HKZE 4ARIA 3ONSA 3UF8A 1RAXA 2JWUA 1UBQA 4LCDE 1VZ8A 3QIJA 2IO3B 3TEXA 3SU8X 1AARA 1RWSA 4NAWB 1HZ5A 2J52A 2KFKB 4BFRA 4LTUA 5IA7A 2IO2B 1HXYD 4K3CA 3S2AA 4IC7B 1N5WA 4W9IA 4PT5A 1HA5A 5AZHA 1UF0A 3TJPA 2N4FA 4W9KA 2ZCCA 4XX5A 5BYRA 2AQ1B 2IY1B 3ZXVA 3A9KA 4TKNA 1KLGD 1K50A 2WXMA 5HKHA 1TYGB 3KUDB 2GBRA 1IPGA 1PDXA 1DYQA 1LO5D 4C7ZA 2N9LA 1Q1OA 2E3TA 1TY2A 3OG5A 1B1ZA 4WWMA 2JYEA 3TIXA 3A9JA 3QAQA 3BK2A 1WYGA 3DBSA 4HDOA 4N9F4 1T0YA 1RLFA 3KLSX 3QK0A 2YLMA 4PS7A 1A70A 2LI5A 2DBYA 4JL9A 1Z5SB 1S1QB 4I6NB 4MH0E 3L08A 2M19A 1NI2A 2HJ1A 4XZ4A 1QT9A 1WM2A 4CQNA 5EE1A 1L4DB 5HI1A 1QOFA 3AEDB 2EKEC 2KT7A 3KYDD 2LGYA 4EZLA 5L95C 1WGDA 4I6LB 3ZJTA 4EUTA 4B0EA 1STEA 2ACZB 4BBNF 2O6VD 4M8NA 2W9NA 2NMQA 2HDEA 2JRIB 3AE1B 1E0ZA 2K6DB 3IAS1 2L3ZA 2D2QA 4N59A 2N9PC 5FR6A 4ACFA 2WXLA 5E6JA 4TMAB 3PZDA 1G6JA 4P7IA 4OZAA 3N1ZC 1RFKA 2OJRA 2WXOA 1ZDXA 2ZW1A 3Q8BA 1UWMA 1UD7A 2INCC 4JX1C 2OEDA 4KZCA 1NEKB 2N9XA 1XLQA 3GP7A 3VUWA 2L8JA 2FE8A 5J17A 2PMVA 3W1SA 4C4VB 4IM3A 2DZIA 4KGTA 3A1QB 2W55A 4PS8A 2I38A 4IWPA 3ZO5B 3PO0A 1OFFA 1MVKA 4S0RA 2K5PA 2WQYB 3BIID 2N7EA 2FCSA 1UELA 2VH2A 3TCAA 2MHJA 2J42A 2KN4A 2G9HD 4P6VF 3BVZA 3KYCD 4FHJA 5JHBA 2DHZA 3T8MA 1FPYA 1UUPA 2WXNA 1L2NA 2ON8A 2LVPA 4AWJA 3PRMB 2IZVB 4W9DA 4FHKA 2EKIA 1E7VA 4E74A 5TSSA 2INNE 2DLBA 4R3DA 3MJWA 1TZ1A 1E7PB 3PZ7A 3ZTCA 3HVZA 4NNJB 4KDIC 1QILA 1YJIA 4M02A 1ZE3D 1SEBD 4US9A 1ZXIA 1XEEA 4GLSC 3DHGC 3IXSA 1LGRA 2BKFA 4KGSA 1BXTA 5BMGA 4ITKA 4RCOA 5D7GA 2UU7A 3RCZA 5DPSA 3NZ3A 3MC8A 1NYRA 4HLEA 1SXTA 3T9LA 2OOBB 3AMZA 2XK5A 2DYOA 3N3KB 5MPOA 1GNUA 2JU6X 2KVZA 2Z8LA 4RGOS 4WAFA 4WJQA 3W5VB 4EFOA 2R2OA 3EC8A 1N60A 1P0RA 2QCZA 1Z2MA 2B76B 3KW5B 4A6QA 2JPHA 3ETRA 4FA6A 5IKCM 1HZ6A 3ZJUA 4N58A 2W3RA 1L4ZB 3AXCA 3T3OA 3CSFA 1TS4A 1DOXA 2LASA 4WJOA 1T6BX 2MEKA 1TKEA 5AUIA 1MG4A 2JVCA 4ZYNA 3APCA 1RFAA 4KVGB 4XYCA 2D3GA 2SAKA 2PW9A 2CHXA 3EFCA 1WJUA 4RF0A 1BUIC 1WXMA 2K1FA 5E6OA 1FO4A 1HTOA 3A4RA 2C9WB 4LNOA 2UYZB 5LNK1 3VVWB 2BB6A 2GI9A 4JLCA 3K9OB 3WAOA 2GBJA 1D5XC 1F2RC 3M62B 3RNGC 2MP2B 1WJ6A 1FEHA 4DDGD 3DDCB 4IDIA 1VD2A 2PVGC 1JWAD 4OHJA 4MGKE 4CYEA 2QMTA 4JQWC 1FD6A 2Y5PA 1GUAB 4KSLC 3Q2AC 3UIPB 2W3SA 4TQ1A 2ZCBA 3H1UA 2QDFA 1JWSD 1N6ZA 2O6VB 1F2RI 1NBFC 3JVZX 4DHJB 3BVGA 1AW7A 3Q6BA 2CU3A 1C4CA 2XNAC 4FJZA 5CTRC 3ZDMC 5HG2A 1C76A 2DNFA 3H6NA 2KMMA 1V1PA 3UQAA 1WGYA 1WIAA 1NYQA 1BMLC 3ZUNA 1X1MA 1P9DU 4IW0A 4KKIA 3NS8A 4HRSA 3ZLZA 3I5JC 4WURA 1FIQA 1YQ3B 2PIAA 1J8CA 4HJKA 4HPLB 3ZXRA 2CJNA 4HWIB 5C2TB 2YVCA 3BYTB 2FUHB 5G5GA 3R2IA 5LXHA 3NJTA 2MCNB 5EDSA 1C77A 2PE6B 2WWZA 2HE7A 2LRWA 1LFDA 1UBIA 2DZKA 2BW2A 1I4XA 1ISNA 2MLBA 1MPEA 2DENB 4DWFA 2J4XA 3RNCC 1T0SC 4BKSA 1WXSA 4LDTB 2NTSA 2WGSA 1E8YA 3DWGC 3AECB 1WR6E 2NS5A 1NI3A 5AUKA 2KACA 2V9HA 2CKHB 5EE9A 5BMIA 4HCPB 3SFDB 2KANA 2J0KA 1LQBA 3V6EB 1EU3A 4AUQC 2DX5B 2KN5A 4L2YA 3NY5A 3JSVB 1FXAA 2G45B 4WIPA 2PEAA 2NTTA 3ZNZB 3ZKJC 4A90A 2LFIA 3Q69A 1E6EB 4JGHB 2KLGA 1L6VA 5EE3A 3L16A 5JH5C 2GB1A 4HK2A 2K0PA 4XWWA 2KTFA 3NVVA 4IWOA 4ZRIA 1Q0WB 2D10A 2DZMA 3GZNI 2GRIA 1YMHE 3PSEB 1PFDA 2ZW0A 2WU5B 1PQSA 4URKA 3VXWA 2NPTB 2QILA 4BOSC 3AEGB 1SE9A 5H92C 4O1NA 3BINA 2M17A 1XCQL 2INDC 3A9KB 2QC8A 1E7UA 2KKCA 2MBQA 1WE6A 3CWIA 2WXFA 2UWQA 2IGHA 1KTKA 4B6WA 5GXGB 3W2DA 4DBGA 2WHIA 4RF1A 3TSSA 3C19A 5TR5A 2WXQA 1LM8B 3R7QA 2G4SA 4ANUA 5JHAA 5L83A 2NBVB 4E3CA 4A3OA 3O13A 2FCNA 2L7RA 3ZJVA 5HHDG 2KDEB 1I4HA 3N9YC 3KH0A 3Q14C 5C1ZA 2RR9A 1PUTA 2KHWB 4FLHA 2ZNVC 4K1RB 3EFUA 1DGJA 1MFWA 3L17A 1CQVA 4GDLB 2BGFA 4K7UA 3DBLI 3B9JA 4DXFA 4AJYB 2HJ8A 3HM6X 1RRBA 3B1LX 1D4BA 2KD0A 5CHWA 1V81A 4EZKA 2JYTA 2IGDA 4LDTD 2JZZA 2KOXA 3NVWA 3RYTA 4IUMB 2KC2A 3BVMA 1WGHA 2KK8A 3IT6B 3WCQA 2LGSA 4GOCA 3MTNB 2C7NB 1SJHD 3B0AA 3AE4B 4WJPA 2R61A 4JPSA 2D3AA 3QWZB 4W9JA 1UWXA 3PPAA 3I3TB 2CHZA 5G5HA 1TZOA 2LWPA 5BYSA 2KJRA 3VR9B 2C7MB 4KDLB 4S17A 1T0RC 1JALA 2ZZPB 2KYWA 4J3OD 4LLGM 3HHMA 1ZXHA 1UH6A 4OZBA 3MC0B 2QEJC 3O65B 1SJED 4WQOB 5LLIA 2J53A 4G11A 2JX5A 5H8YE 3UIOB 4FXCA 3DVGX 2WU2B 3B2FA 2KAJA 4USAA 1KRHA 3IVFA 3IG3A 1I4PA 2Z0DB 4MSMB 1S3SG 2HTHA 2Z0EB 1WH3A 2K25A 4G3XB 1T0QC 1BT0A 1ZGUB 3WIMA 2FUG1 2WXHA 4TQ0A 1TT5B 3HUIA 3DBRI 4TV3A 2NPTA 4OW0A 2BVCA 4A55A 4EZJA 3Q8AA 3X23A 1XQQA 2H88B 4MT5A 3ZVVA 4OVZA 4ZRPA 4N6EB 4HCNB 4AP4C 4LJOB 3ZDTA 3W9CB 1SBBB 4PS3A 2IYDB 3AI5A 2YEPB 1YJ1A 2MRPA 3PTFC 2WLBA 3QHTA 1UZXB 3WANA 3P4RB 1V1PB 4RNAA 5EE0A 4AS1A 3A4SC 2L1AA 3SD5A 2LGXA 2BTEA 2KWVB 3W5UB 4BBNC 2L05A 4QAYA 1VJKA 3QA8A 3PV1A 5KHQA 2KX0A 2L0FA 2QIEB 1QOBA 3GOEA 4MH8A 4BZAA 3AB5A 2KTRB 1ESFA 3ZW3A 4GDKB 2ZNVB 3A9JB 1XLPA 4ZRQA 3PT2B 4NJCA 4RMAA 5JXVA 4GMVA 4HPPA 3U8ZA 4DHJD 1SF0A 2ZPYA 4IKGA 4YT0B 1FFVA 3RUIB 1K51A 2MW5A 1EUVB 3URYA 2JT4B 2IO0B 4ZOHC 3TUOA 4HDQA 2LUMA 3KUZA 3ENEA 3HRDD 2AQ2B 1IUEA 3VH3B 1GC6A 5JZEB 4DDID 4A3PA 1WJNA 2JUOA 2WXIA 3PLVA 1YN5A 2AYOB 3AU5A 4NJ7A 2IGGA 3EA6A 2BBCA 1L5PA 3VDZA 1R4NI 1WXAA 1WXQA 4WWPA 4RFBA 3OAWA 2GMIC 3PVLA 2LJIA 5FK9C 2LXCA 4GU2A 2EELA 3DCGA 1ZKHA 3R3MA 1TKGA 1ENFA 1HQRD 3ZRFA 1RYJA 3AEEB 4BAXA 3E56A 4BKSD 2Y5CA 2LHDA 1QQRA 2AL6A 2LVQA 1YIWA 3MHZA 4YSZB 4GDLA 3J9CA 3RNEC 3H7PA 2RPQA 1L6UA 4A8XC 3DHHC 2W54A 2MBBB 1EWCA 1QOAA 2XBBC 3I63C 1SIFA 2OHFA 1MI0A 1JCKB 2W82A 2FAZA 5BYQA 2VZKB 4P1CC 2BQQA 4J6IA 4IM2A 3OWEB 4DK5A 2JXXA 2KTRA 1EO6A 2GLSA 4NPNA 2LRUA 1SE2A 1FNWA 1WMHA 2K8BA 4NZLB 3PHXB 2NCNA 2OJWA 3CSTA 3M63B 1UGMA 1L7YA 3MJ5A 4GGQA 4MGZE 2JZ3B 1DOIA 2KX3A 5D3IB 1V97A 4KZ0A 3TEZA 3AEFB 2SEBD 1Y8RC 4MJSB 3OJ3A 3FKYA 4NQKE 1I35A 1GC7A 5FKAC 3MP9A 5IP4D 1VDVA 1GPXA 3IFWB 3APDA 4FJVB 1IYFA 1KOTA 3ZNGC 3LXFA 4AOFA 2WDVB 3NUHB 3BWUD 2FCMA 2KC1A 2AEHA 2V3NA 2I2YA 2J0MA 2LZ6A 1YOVB 2KWUB 1GOZA 1J0GA 1JQ4A 4GDKA 3VR8B 1YN4A 3R66C 4PYZA 3M3JA 2LEKA 2GOWA 3NVYA 3EHVA 3PRPB 1J7BA 2BKRB 3AE2B 2AWTA 2M8SA 2C5LC 4ZHPA 1F77A 2NR2A 1D5MC 1C78A 2BS3B 3R8BA 5BMHA 2BB5A 1XLOA 3FC4A 4KKJA 2ZVOA 2WNMA 1UGJA 2KWCA 3MC9A 1MHHE 2K8HA 4M00A 1PYWD 2N9EB 1JW9D 4MELA 4II3B 3VQIA 3CMMB 3U52E 3W1SC 4C80A 1ET6A 4DXAB 4HJGE 2RDBC 4MACA 1CJEA 1TS5A 3RZFA 3PGEA 2MSED 3V6CB 1Q10A 5IO9A 1OTRB 2I1JA 1SE3A 4WWOA 2PTLA 1P1AA 1OQRA 4W9HA 1SSNA 1C3TA 1J19A 2MBOA 1JWUD 3NG0A 4FN2A 3TEYA 4JE3B 4TUUA 2N9KA 1VLBA 1JWMD 1XF5L 3OJ4B 2K9XA 3AU4A 4GXBA 3DPDA 2HD5B 5DPRA 3EECA 3KWLA 2MBHA 2BWES 2WXPA 4OZCA 4AJWA 1V5OA 1MJDA 1KLVA 2V3SA 1B9RA 3DWMA 3CIRB 1F52A 1XCTL 3VRBB 3CF6E 3RNFC 2CU1A 2WXRA 2KFJA 2XN9C 4MM3B 2JWZA 4E71A 4PYUA 1PGXA 3AE7B 4DXGA 2J0JA 5CX3A 2G3QB 2BF8B 3AE6B 5IOIA 1P98A 4M01A 4ASWC 3ZQ4A 2L0TA 2G1EA 2IO1B 4II2B 2FCQA 1I4QA 3RFZB 3AULA 4WQMA 3LB8C 1RM6C 4B9KA 3SEBA 4NAWA 1WXVA 2K8CA 2D07B 3RULA 2RPVA 4W9GA 1VZ6A 4G0NB 2LJ5A 2DAFA 1YJJA 3AEAB 3GE8C 2KQ4X 3ZTDA 2M4NA 3ALBA 2RDHA 1E8ZA 2CS4A 1EU4A 3V62A 1EF1A 1N62A 2JF5A 1J7CA 3ML8A 1WX8A 3PRZA 3L0WB 4L23A 2ZVNA 1WMHB 1FM0D 1UNSA 2GBMA 1WFYA 2EMSA 1T3QA 2KFKA 1OQYA 3TMPB 3V3XA 2ONQA 1V1OA 3W1YA 1WF9A 3R7RA 3B08A 2R2QA 2BS4B 3GZNB 5IAAC 1OGWA 4ZDVA 1WZ0A
chains in the Genus database with same CATH topology
2ON8A 4TQ0A 2RMMA 4P16A 3HUIA 3P1MA 5D3DA 2EKIA 4OW0A 3FILB 4A55A 3Q8AA 4NAMA 2H88B 4MT5A 5TSSA 4OVZA 4ZRPA 2WDQB 5T8IA 1DOYA 2INNE 2DLBA 4R3DA 4N6EB 1E7PB 3PZ7A 4C7YA 2Y3AA 3HVZA 3B2GA 1QILA 1YJIA 1ZE3D 1SEBD 4US9A 1ZXIA 2PKOA 1XEEA 4GLSC 4KGSA 3IXSA 3W9CB 3NVZA 1BXTA 1SBBB 1V8CA 4JWUC 2INPE 5BMGA 1WGKA 4ITKA 4RCOA 5D7GA 2YEPB 1TS3A 3NZ3A 2BS2B 2WLBA 1KF6B 4D2KA 3P4RB 1NYRA 1V1PB 4RNAA 5EE0A 1SXTA 4AS1A 1C4AA 3AMZA 3C8YA 2L1AA 2DYOA 4US8A 5MPOA 2JU6X 1P7EA 2Z8LA 2AQ3B 4RGOS 4WAFA 2BTEA 1EM7A 3W5VB 3W5UB 4IOIE 3GB1A 1ZPSA 4UDUC 3VRAB 2N7JA 1N60A 1VJKA 3AE9B 2B76B 3EUB2 4A6QA 1ROEA 3ETRA 2IJ0A 4L1BA 1HZ6A 4WH4A 2QIEB 3ZJUA 4N58A 1NENB 1QOBA 1ET9A 1L4ZB 2W3RA 4MH8A 4HEA1 5C3JB 3T3OA 1D5ZC 2E6XA 3BZDB 1ZDVA 1TS4A 1DOXA 3AB5A 1HEZE 1IBXA 1T6BX 1ESFA 2MEKA 5FR3A 1TKEA 5AUIA 4GDKB 1JWBD 3IT4B 4HKQA 1XLPA 4ZRQA 5JXVA 2SAKA 2PW9A 4NJCA 1CZPA 2WS3B 1WRIA 3GS2A 4RF0A 1AWDA 4YTNB 1BUIC 4HROA 1SF0A 1FO4A 1MHXA 1C79A 4IKGA 3P4QB 4YT0B 3LYYA 1FCLA 1FFVA 1K51A 3AEBB 3URYA 3BK1A 1EWYC 4ZOHC 2WXKA 5LNK1 3TUOA 1M4VA 3U2SC 2BB6A 2GI9A 3RPFC 2LUMA 3Q8CA 3PZ8A 1D5XC 1F2RC 3HRDD 2AQ2B 2BT6A 4AQ7A 1IUEA 1FEHA 2FBWB 4IDIA 4YWGG 3H8HA 2PVGC 1JWAD 4OHJA 1IGDA 2WXIA 3Q8FA 2QMTA 1FD6A 1YN5A 1ACCA 3P4SB 3R2TA 1GAQB 2IGGA 3EA6A 2BBCA 2Y5PA 1L5PA 1FCCC 4RGNA 3AH7A 1WXQA 3P63A 3U7ZA 1SE4A 1JMLA 4RFBA 2W3SA 4TQ1A 2V3PA 2IPKD 2LJIA 4LK0M 1JWSD 5FK9C 1F2RI 1K52A 4B0MA 3NRZA 1ZP0B 3NS1A 2EELA 1XXGA 4KX6B 1L0XB 3BVGA 1AW7A 1JROA 3P42A 1TKGA 1FRDA 1ENFA 2M56B 2CU3A 1C4CA 2XNAC 1HQRD 5HG2A 3AN1A 1VZ7A 2QSDA 1RYJA 1CK1A 1C76A 4XDCA 2JXTA 3AEEB 4YXDB 1SB3C 3E56A 2Y5CA 3TEWA 1I4RA 2LHDA 2TSSA 1QQRA 4REZA 2YEPF 4RGTA 2KMMA 3L4PA 1V1PA 4ZYSA 2JSVX 3EGRA 3MHZA 4YSZB 1NYQA 3J9CA 1BMLC 3MFGA 1L6UA 4A8XC 4DQOC 2W54A 2DYMA 1EWCA 1QOAA 5I4DA 3ZGZA 2MJ3A 3IAM1 1E10A 4KKIA 2HTME 1FFUA 4HRSA 2WXGA 4WURA 1VRAB 2OHFA 1SIJA 1FRRA 1MI0A 2WXJA 1JCKB 2W82A 1L0VB 1OQQA 1FMAD 1XO3A 5BYQA 1FIQA 1YQ3B 2VZKB 2PIAA 2AX5A 3Q8EA 1L0YB 1D6EC 1F0ZA 2LGIA 3OWEB 2CJNA 2VZKD 3AV8A 4RH6A 5C2TB 1IBXB 3BYTB 4ZHOA 5G5GA 1SE2A 3R2IA 1FNWA 2H89B 4NZLB 3T3NA 1C77A 3AE3B 1E9MA 1JRPA 3BYYB 1GB4A 3MJ5A 2BW2A 1DOIA 1I4XA 1YN3A 1V97A 1MPEA 5D3IB 3TEZA 1N63A 3AEFB 2SEBD 2J4XA 2PVOD 1KFYB 4TSSA 2LHEA 2NTSA 2X38A 1J7AA 3DWGC 3AECB 1TY0A 1TKYA 4C56C 5FKAC 3MP9A 1NI3A 4XWTA 2WP9B 1VDVA 1QLBB 5AUKA 1GPXA 2LMCA 2KACA 1N5XA 5EE9A 5BMIA 3LXFA 3AM9A 4XDDA 2WDVB 1FNVA 3SFDB 3NUHB 3AE5B 4Q2JA 3BWUD 4YTMB 1EU3A 2N0SB 2V3NA 2I2YA 4L2YA 1FXIA 1PGBA 3FILA 1YNTE 1GOZA 1JQ4A 1FXAA 3VR8B 1C4PA 1QF6A 3KQ4A 1QKZA 1YN4A 2NTTA 3I57A 4WIPA 4YSXB 2LEKA 3SFEB 3NVYA 4A90A 2LFIA 3Q69A 3HVDA 1J7BA 1E6EB 4HKZE 4ARIA 1L6VA 3AE2B 5EE3A 2JWUA 1AYFA 2GB1A 2K0PA 4JWSC 4XWWA 1VZ8A 2D5GA 4ZHPA 3NVVA 1F77A 4A9AA 2KDMA 1D5MC 3TEXA 1RWSA 2GRIA 1C78A 2BS3B 1YMHE 1PFDA 1NVID 2ZW0A 2WU5B 4NAWB 3R8BA 1HZ5A 2J52A 5BMHA 2BB5A 1XLOA 3FC4A 3KWVA 4KKJA 2WNMA 2L52A 3AE8B 4LTUA 1HXYD 1UGJA 1MHHE 2QILA 1PYWD 3AEGB 1JW9D 1N5WA 4PT5A 3VQIA 1HA5A 3U52E 5H92C 2L83A 2RDGA 4C80A 1ET6A 4O1NA 4HJGE 1XCQL 2CJOA 5BYRA 2AQ1B 4MACA 1I7HA 1CJEA 1TS5A 1KLGD 1K50A 2M0AA 2WXMA 1Q10A 1TYGB 1SE3A 3CWIA 4YTPB 1IGCA 2PTLA 2WXFA 1OQRA 1I4GA 1SSNA 2IGHA 1VR9A 1KTKA 1PDXA 2BYTA 1JWUD 5GXGB 1AN8A 3W2DA 1N61A 2MH7A 4RF1A 1DYQA 1LO5D 3TSSA 4JE3B 3TEYA 2WXQA 2QJLA 2N9KA 4C7ZA 1VLBA 2N9LA 1JWMD 1TS2A 2E3TA 1TY2A 2MJDA 1B1ZA 4WWMA 1XF5L 2JYEA 3BK2A 2K9XA 3O13A 1XLNA 1WYGA 1K53A 3ZJVA 5HHDG 3E9SA 1GB1A 3KWLA 3KLSX 1I4HA 3N9YC 2WXPA 2JZPA 2V0GA 1A70A 1WSPA 4OZCA 1PUTA 2DBYA 4XE0A 2KWDA 1B9RA 3DWMA 2M19A 1DGJA 3V05A 1CQVA 3CIRB 4GDLB 4M0WA 3ABVB 3B9JA 1QT9A 1XCTL 4DXFA 3VRBB 4CQNA 5EE1A 2WXRA 1L4DB 2XN9C 5HI1A 1D4BA 4MM3B 4H2AA 1QOFA 3AEDB 2JYTA 1TJEA 1PGXA 2IGDA 2MJEA 3AE7B 4RGMA 4DXGA 4EE2A 3NVWA 3ZJTA 3AE6B 3BVMA 4B0EA 1STEA 3IT6B 1YQ4B 2ACZB 3WCQA 3ZQ4A 1R7SA 5HFYA 2G1EA 2NMQA 1SJHD 2HDEA 3AE4B 1I4QA 3RFZB 3AE1B 1E0ZA 3IAS1 4WQMA 1KH0A 1RM6C 3LB8C 2R61A 3I9V1 4JPSA 4N59A 3SEBA 3P4PB 3UI3A 1ZOYB 2WDRB 2V4IB 2RPVA 1Y56A 2WXLA 5E6JA 1VZ6A 4TMAB 2L32A 4ARCA 1P7FA 2JQRB 1UWXA 3FAHA 1WWTA 5G5HA 1YJJA 4OZAA 1RFKA 2WXOA 1TZOA 3AEAB 5BYSA 1ZDXA 2KQ4X 2ZW1A 3Q8BA 1UWMA 1PGAA 3VR9B 2Q5WD 4JX1C 2OEDA 1JALA 2K3UA 1NEKB 2RDHA 1QOGA 2DWQA 1ZUD2 4KGRA 4J3OD 2K22A 4LLGM 1EU4A 1XLQA 1C9FA 3GP7A 1ZXHA 4OZBA 1N62A 2FE8A 2PMVA 3W1SA 3MC0B 1J7CA 2QEJC 1T5XD 4L23A 4KGTA 1SJED 2W55A 3ZYYX 2J53A 1FM0D 1UNSA 2I38A 2JX5A 5H8YE 3PO0A 4FXCA 1OFFA 1MVKA 2WU2B 3B2FA 1T3QA 2KAJA 2K5PA 2PLPA 2WQYB 3BIID 4USAA 2ICIA 3V3XA 1KRHA 2ONQA 1I4PA 2IDYA 1V1OA 3U4EG 2J42A 2KN4A 2G9HD 4P6VF 3BVZA 1FNUA 2BS4B 1KLUD 1UUPA 4YSYB 2WXNA 3SR6A 2FUG1 2WXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DWM A;  2M19 A;  1DGJ A;  2WDV B;  3SFD B;  3CIR B;  1L5P A;  3AE5 B;  3HUI A;  3P1M A;  3ABV B;  3B9J A;  1QT9 A;  3AH7 A;  4YTM B;  2N0S B;  1WXQ A;  2EKI A;  3P63 A;  3VRB B;  5EE1 A;  1FXI A;  2W3S A;  1JQ4 A;  1QOF A;  3AED B;  2H88 B;  1FXA A;  3VR8 B;  2WDQ B;  1QF6 A;  1DOY A;  4YSX B;  1TJE A;  2MJE A;  3AE7 B;  4N6E B;  2LEK A;  3SFE B;  3NVY A;  3NVW A;  1E7P B;  4C7Y A;  3NRZ A;  1ZP0 B;  3HVZ A;  3AE6 B;  3B2G A;  1J7B A;  1YJI A;  3NS1 A;  4KX6 B;  1E6E B;  4US9 A;  1YQ4 B;  2ACZ B;  1JRO A;  3WCQ A;  1ZXI A;  2PKO A;  1TKG A;  1L6V A;  1FRD A;  3AE2 B;  1R7S A;  2CU3 A;  2M56 B;  5EE3 A;  3W9C B;  3NVZ A;  1AYF A;  1V8C A;  3AN1 A;  2G1E A;  4JWU C;  1WGK A;  4ITK A;  4JWS C;  1RYJ A;  4YXD B;  4ZHP A;  3AE4 B;  3AEE B;  3NVV A;  1SB3 C;  4A9A A;  2Y5C A;  3AE1 B;  1E0Z A;  1RWS A;  2BS3 B;  2BS2 B;  2WLB A;  3LB8 C;  1RM6 C;  1KF6 B;  1PFD A;  1NVI D;  2KMM A;  3L4P A;  4WQM A;  4N59 A;  3P4R B;  2WU5 B;  1NYR A;  3P4P B;  5EE0 A;  1ZOY B;  2WDR B;  1XLO A;  3FC4 A;  3AMZ A;  2L52 A;  3AE8 B;  4LTU A;  4YSZ B;  4US8 A;  1NYQ A;  5MPO A;  1L6U A;  2W54 A;  2JQR B;  3AEG B;  1JW9 D;  1QOA A;  1WWT A;  3FAH A;  1N5W A;  5G5H A;  1YJJ A;  2MJ3 A;  1RFK A;  3AEA B;  3W5V B;  3W5U B;  1E10 A;  2HTM E;  1FFU A;  4HRS A;  5H92 C;  2L83 A;  2OHF A;  1SIJ A;  1UWM A;  1FRR A;  3VRA B;  3AE9 B;  1N60 A;  1VJK A;  3VR9 B;  4C80 A;  2Q5W D;  1L0V B;  2B76 B;  3EUB 2;  4JX1 C;  1FMA D;  1XO3 A;  1ROE A;  2CJO A;  1FIQ A;  1JAL A;  1YQ3 B;  2PIA A;  3AM9 A;  3ETR A;  1I7H A;  1NEK B;  1QOG A;  1CJE A;  2AX5 A;  2DWQ A;  2QIE B;  4N58 A;  1NEN B;  1QOB A;  1ZUD 2;  2W3R A;  2K22 A;  5C3J B;  1XLQ A;  1F0Z A;  1DOX A;  2CJN A;  3AB5 A;  1N62 A;  1TYG B;  3AV8 A;  5C2T B;  3CWI A;  1TKE A;  4YTP B;  5AUI A;  4ZHO A;  1JWB D;  1J7C A;  1OQR A;  5G5G A;  1XLP A;  1CZP A;  2H89 B;  1PDX A;  1WRI A;  2WS3 B;  1AWD A;  4YTN B;  3AE3 B;  2W55 A;  3ZYY X;  1E9M A;  5GXG B;  4HRO A;  1SF0 A;  1FM0 D;  1JRP A;  1FO4 A;  1N61 A;  2MH7 A;  2JX5 A;  3P4Q B;  5H8Y E;  4YT0 B;  3PO0 A;  4FXC A;  1OFF A;  1FFV A;  2QJL A;  3AEB B;  2WU2 B;  3B2F A;  1DOI A;  4C7Z A;  1VLB A;  1EWY C;  1V97 A;  1T3Q A;  4ZOH C;  1N63 A;  2KAJ A;  3AEF B;  2K5P A;  2E3T A;  3RPF C;  2PVO D;  2MJD A;  2WQY B;  3BII D;  1KFY B;  4USA A;  1KRH A;  4WWM A;  1J7A A;  2K9X A;  3DWG C;  1XLN A;  2BT6 A;  1WYG A;  3AEC B;  3HRD D;  1IUE A;  1TKY A;  4P6V F;  3KWL A;  2FBW B;  1NI3 A;  2BS4 B;  2WP9 B;  4IDI A;  1VDV A;  1QLB B;  5AUK A;  1GPX A;  1A70 A;  2PVG C;  1JWA D;  1PUT A;  2DBY A;  1N5X A;  5EE9 A;  4YSY B;  3SR6 A;  1B9R A;  1OQQ A;  3LXF A;  3P4S B;  1GAQ B; 
#chains in the Genus database with same CATH topology
 2DZJ A;  2RMM A;  3P1M A;  5DPT A;  5D3D A;  3FIL B;  3L10 B;  4MGI E;  3L54 A;  5T8I A;  4PK1 A;  5DPW A;  2MA9 B;  2VH1 A;  3SDL C;  1WX9 A;  2KZR A;  2Y3A A;  3B2G A;  4DHZ B;  2PKO A;  3DHI C;  3M95 A;  3VTW A;  3NVZ A;  2M0X A;  1V8C A;  4JWU C;  2INP E;  4GIV A;  1GG3 A;  2I1K A;  3ZIM A;  2BS2 B;  3NOB A;  4D2K A;  2GBK A;  5CHV C;  3C8Y A;  4DHZ E;  4US8 A;  4HVB A;  1E8X A;  1E90 A;  3GB1 A;  4M0W B;  3ZRC A;  4UDU C;  2CHW A;  3ZNI D;  3VRA B;  1K8R B;  2N7J A;  3AE9 B;  1YX6 B;  1U4A A;  3EUB 2;  2GBN A;  1WM3 A;  2IJ0 A;  3PS6 A;  4L1B A;  3NHE B;  3RI7 C;  4LNN A;  5D2M B;  1ET9 A;  4BKT A;  1A5R A;  4HEA 1;  5C3J B;  4JIO U;  1D5Z C;  2E6X A;  3BZD B;  3H9D A;  1HEZ E;  3JSV A;  3DBL B;  1R4M I;  2WS3 B;  1AWD A;  2KO3 A;  4YTN B;  4HRO A;  1MHX A;  1C79 A;  3LYY A;  3Q3N C;  1FCL A;  4ICU A;  3AEB B;  1EWY C;  4MGY E;  2WXK A;  3U2S C;  2KLC A;  3RPF C;  3PRE A;  2RD0 A;  3QAR A;  3PZ8 A;  3DBH I;  2BT6 A;  4AQ7 A;  2A5U A;  1TTN A;  3RZW C;  3WAL A;  3H8H A;  3VTU A;  1IGD A;  3Q8F A;  4FJY A;  3P4S B;  3R2T A;  4C00 A;  2REX A;  5GMV A;  4RGN A;  3AH7 A;  2JY6 A;  4HPM B;  3P63 A;  3U7Z A;  4W9C A;  5J2R A;  1V80 A;  4G50 A;  2IPK D;  3ECI A;  2PE9 A;  3VAW A;  3NRZ A;  1ZP0 B;  3JYU A;  1WE7 A;  1CMX B;  2M56 B;  4KIK B;  3AN1 A;  1VZ7 A;  2QSD A;  3QC8 B;  3WAM A;  4YXD B;  4XDC A;  1SB3 C;  3VFK A;  3TEW A;  2N1V A;  4REZ A;  2YEP F;  3D32 A;  3L4P A;  3DVN V;  2JSV X;  2L00 B;  3EGR A;  4XGA B;  2B3A A;  4X57 B;  2KDB A;  2D3B A;  1KM7 A;  3IHP C;  1YQB A;  4OVU A;  1LXD A;  2DYM A;  3ZGZ A;  2HTM E;  1FFU A;  2WXG A;  1WI0 A;  3QX1 A;  2WXJ A;  2G4D B;  1L0V B;  5G2N A;  2AX5 A;  4MDK E;  3AV8 A;  2WYQ A;  4LJP B;  2PPH A;  5C23 A;  2BYV E;  2KDF B;  4NJ6 A;  2H89 B;  4ZRK A;  1E9M A;  1JRP A;  1IP9 A;  3H7P B;  2WDT B;  2Z59 B;  2V4L A;  1KJT A;  1KFY B;  3DQV A;  4TSS A;  2LHE A;  1WJ4 A;  2FIF A;  2KJH B;  2LD9 A;  2RSU A;  2X38 A;  5AZF A;  1OEY J;  1V6E A;  4BVU C;  1E5W A;  3N32 A;  1D3Z A;  4M8M A;  1QLB B;  3DVN U;  5IN7 A;  4ZRJ A;  1XD3 B;  2MX2 A;  1N5X A;  4EKU A;  3AM9 A;  1WRD B;  1E8W A;  3AE5 B;  4LNI A;  4Q2J A;  4IG7 B;  2XEW A;  3A33 B;  3DOW A;  3RMK C;  2N7D A;  4MEM A;  1QF6 A;  1QKZ A;  3I57 A;  4YSX B;  5KHO A;  5E6P A;  2M1M A;  1V9J A;  1TIF A;  5D6J B;  3TBL D;  4YL8 A;  1AYF A;  4JWS C;  4F8C B;  2D5G A;  4A9A A;  2KDM A;  1GJZ A;  1NVI D;  3KWV A;  4NY0 A;  2L52 A;  3AE8 B;  2XK5 B;  1TGZ B;  4OVV A;  2K39 A;  3N30 A;  1HTQ A;  2L83 A;  3Q3O C;  2RDG A;  3UIN B;  2CJO A;  1I7H A;  2M0A A;  4EEW A;  2Y5B B;  2JRH A;  4YTP B;  1IGC A;  1I4G A;  1VR9 A;  3C0R B;  3Q3M C;  3NZU A;  4F1S A;  2BYT A;  4IM0 A;  1AN8 A;  1N61 A;  2MH7 A;  3HIZ A;  4I6P A;  3L13 A;  2QJL A;  4CHK A;  2LUE A;  3QCA A;  1I42 A;  1TS2 A;  4GB9 A;  2MJD A;  3KVF B;  3WAP A;  2WX1 A;  1XLN A;  1H8C A;  1K53 A;  3BY4 B;  2KNB A;  3E9S A;  1GB1 A;  4MSQ B;  1C1Y B;  2N1W A;  2JZP A;  2V0G A;  1WSP A;  2C60 A;  5BO4 B;  5AEK B;  4XE0 A;  3LJ3 A;  1TBE A;  2KWD A;  3RN9 C;  3V05 A;  5G55 A;  4M0W A;  3ABV B;  3VUX A;  3H7S A;  2ZJD A;  4XC2 A;  4FUL A;  4H2A A;  3K9P B;  2O6V A;  1TJE A;  4RGM A;  2MJE A;  4EE2 A;  3QJZ A;  1YQ4 B;  2ZPN A;  1R7S A;  5HFY A;  4CO7 A;  4RM9 A;  1KH0 A;  4EOY A;  3UQB A;  3I9V 1;  2LGD A;  3P4P B;  3UI3 A;  3A1Q A;  1ZOY B;  2WDR B;  2V4I B;  1Y56 A;  2J7Q B;  3LDZ E;  3PLU A;  2D11 A;  2L32 A;  4ARC A;  1FXT B;  1P7F A;  2JQR B;  3HK0 A;  2ZEQ A;  3FAH A;  1WWT A;  5LXI B;  4GN1 A;  1V49 A;  3HM3 A;  3V60 A;  1PGA A;  1H4R A;  2Q5W D;  2K3U A;  3APF A;  1WX7 A;  1QOG A;  2DWQ A;  1ZUD 2;  4KSK C;  4KGR A;  2K22 A;  1C9F A;  3VHT C;  4KV2 A;  1F1H A;  1T5X D;  3ZYY X;  2K6Q A;  2BPS A;  1WYW B;  4F7Z A;  4B95 A;  3RD2 A;  2PLP A;  2ICI A;  3DBR B;  1OEY A;  2IDY A;  3JW0 X;  4GSW A;  3U4E G;  1P3Q U;  2KMA A;  4A20 A;  5E6N A;  1FNU A;  1KLU D;  3N1X C;  3NZS A;  4YSY B;  3SR6 A;  1OQQ A;  1QZE A;  4P16 A;  3X0W A;  4NAM A;  3U30 A;  2WDQ B;  4K7W A;  1DOY A;  4C7Y A;  2BYE A;  2O2V A;  2FID A;  1WR1 A;  4ZYS A;  2PJH A;  4W9L A;  1WGK A;  1R4M B;  5J18 A;  2KQS A;  1WGR A;  1TS3 A;  1WZ3 A;  5CHF A;  4W9F A;  2FNJ B;  1KF6 B;  4IWQ A;  2EMT A;  4FAD A;  1WGG A;  1C4A A;  3N20 C;  3PHW B;  1MG8 A;  3SHQ A;  3DBH B;  1P7E A;  2AQ3 B;  1EM7 A;  3MHS D;  4IOI E;  1ZPS A;  1ROE A;  4WH4 A;  2O2V B;  1NEN B;  3RT3 B;  2IY0 B;  1ZDV A;  1IBX A;  2V1Y A;  3VUY A;  5FR3 A;  3GE3 C;  1JWB D;  3IT4 B;  4HKQ A;  1M94 A;  3KUC B;  2NVU I;  3U7D A;  1CZP A;  1WRI A;  3GS2 A;  2MWS B;  1V5T A;  4P1B C;  4K81 A;  2D3C A;  2L76 A;  2MQJ A;  3P4Q B;  3N1Y C;  3BK1 A;  4W9E A;  1M4V A;  3Q8C A;  2IBI B;  4RM8 A;  4WAA A;  1NDD A;  3P2B A;  1V86 A;  2FBW B;  4YWG G;  3ZNH B;  2KXJ A;  4BOZ B;  1ACC A;  2WX0 A;  1GAQ B;  3Q3F A;  1Q5W B;  1SGH A;  4ANW A;  1FCC C;  1SE4 A;  1JML A;  4MM3 A;  2V3P A;  2X8X X;  4LK0 M;  3VTV A;  5AZG A;  1K52 A;  4B0M A;  3NS1 A;  1XXG A;  4KX6 B;  3RNA C;  1L0X B;  1JRO A;  3P42 A;  1FRD A;  2KQ7 A;  3Q3J A;  1CK1 A;  2JXT A;  1HE8 A;  4C4V A;  1I4R A;  2QHO A;  2BWF A;  2TSS A;  3TL5 A;  2AL3 A;  3UGB B;  4RGT A;  2A4Z A;  3ML9 A;  3IBE A;  3MFG A;  4DQO C;  1WY8 A;  4WWN A;  2KVR A;  2MBE A;  1ZW7 A;  5I4D A;  2MJ3 A;  4LNK A;  3IAM 1;  2LXA A;  1E10 A;  3DVG Y;  4K7S A;  3QQ8 B;  1VRA B;  1SIJ A;  1FRR A;  4NQL B;  2RGF A;  3RNB C;  2MP2 A;  1FMA D;  1XO3 A;  3Q8E A;  2BYF A;  1L0Y B;  5DCN A;  2LVO A;  1D6E C;  1F0Z A;  2LGI A;  5D94 A;  2VZK D;  4RH6 A;  1F9J A;  1IBX B;  4K3B A;  2C7H A;  4ZHO A;  4MJS A;  4KIK A;  3WA0 A;  3T3N A;  3AE3 B;  4LNF A;  3BYY B;  1GB4 A;  4FBJ B;  1YN3 A;  1N63 A;  4WJN A;  2PVO D;  1R4N B;  1J7A A;  2CR5 A;  1TY0 A;  1TKY A;  1YD8 U;  1XT9 B;  4C56 C;  4XWT A;  1JRU A;  1YX5 B;  2KJ6 A;  2WP9 B;  4ANV A;  2LMC A;  1VCB A;  2NBU A;  4XDD A;  1FNV A;  3VH4 B;  4YTM B;  2N0S B;  4HXD A;  1FXI A;  1PGB A;  1V2Y A;  2KMC A;  1YNT E;  3FIL A;  2VRR B;  4BKG A;  1C4P A;  2NBW B;  3KQ4 A;  2KDI A;  3V61 A;  3OLM D;  3SFE B;  4ANX A;  2DYB A;  3HVD A;  2ASQ A;  2DAJ A;  4ICV A;  1EF5 A;  4HKZ E;  4ARI A;  3ONS A;  3UF8 A;  1RAX A;  2JWU A;  1UBQ A;  4LCD E;  1VZ8 A;  3QIJ A;  2IO3 B;  3TEX A;  3SU8 X;  1AAR A;  1RWS A;  4NAW B;  1HZ5 A;  2J52 A;  2KFK B;  4BFR A;  4LTU A;  5IA7 A;  2IO2 B;  1HXY D;  4K3C A;  3S2A A;  4IC7 B;  1N5W A;  4W9I A;  4PT5 A;  1HA5 A;  5AZH A;  1UF0 A;  3TJP A;  2N4F A;  4W9K A;  2ZCC A;  4XX5 A;  5BYR A;  2AQ1 B;  2IY1 B;  3ZXV A;  3A9K A;  4TKN A;  1KLG D;  1K50 A;  2WXM A;  5HKH A;  1TYG B;  3KUD B;  2GBR A;  1IPG A;  1PDX A;  1DYQ A;  1LO5 D;  4C7Z A;  2N9L A;  1Q1O A;  2E3T A;  1TY2 A;  3OG5 A;  1B1Z A;  4WWM A;  2JYE A;  3TIX A;  3A9J A;  3QAQ A;  3BK2 A;  1WYG A;  3DBS A;  4HDO A;  4N9F 4;  1T0Y A;  1RLF A;  3KLS X;  3QK0 A;  2YLM A;  4PS7 A;  1A70 A;  2LI5 A;  2DBY A;  4JL9 A;  1Z5S B;  1S1Q B;  4I6N B;  4MH0 E;  3L08 A;  2M19 A;  1NI2 A;  2HJ1 A;  4XZ4 A;  1QT9 A;  1WM2 A;  4CQN A;  5EE1 A;  1L4D B;  5HI1 A;  1QOF A;  3AED B;  2EKE C;  2KT7 A;  3KYD D;  2LGY A;  4EZL A;  5L95 C;  1WGD A;  4I6L B;  3ZJT A;  4EUT A;  4B0E A;  1STE A;  2ACZ B;  4BBN F;  2O6V D;  4M8N A;  2W9N A;  2NMQ A;  2HDE A;  2JRI B;  3AE1 B;  1E0Z A;  2K6D B;  3IAS 1;  2L3Z A;  2D2Q A;  4N59 A;  2N9P C;  5FR6 A;  4ACF A;  2WXL A;  5E6J A;  4TMA B;  3PZD A;  1G6J A;  4P7I A;  4OZA A;  3N1Z C;  1RFK A;  2OJR A;  2WXO A;  1ZDX A;  2ZW1 A;  3Q8B A;  1UWM A;  1UD7 A;  2INC C;  4JX1 C;  2OED A;  4KZC A;  1NEK B;  2N9X A;  1XLQ A;  3GP7 A;  3VUW A;  2L8J A;  2FE8 A;  5J17 A;  2PMV A;  3W1S A;  4C4V B;  4IM3 A;  2DZI A;  4KGT A;  3A1Q B;  2W55 A;  4PS8 A;  2I38 A;  4IWP A;  3ZO5 B;  3PO0 A;  1OFF A;  1MVK A;  4S0R A;  2K5P A;  2WQY B;  3BII D;  2N7E A;  2FCS A;  1UEL A;  2VH2 A;  3TCA A;  2MHJ A;  2J42 A;  2KN4 A;  2G9H D;  4P6V F;  3BVZ A;  3KYC D;  4FHJ A;  5JHB A;  2DHZ A;  3T8M A;  1FPY A;  1UUP A;  2WXN A;  1L2N A;  2ON8 A;  2LVP A;  4AWJ A;  3PRM B;  2IZV B;  4W9D A;  4FHK A;  2EKI A;  1E7V A;  4E74 A;  5TSS A;  2INN E;  2DLB A;  4R3D A;  3MJW A;  1TZ1 A;  1E7P B;  3PZ7 A;  3ZTC A;  3HVZ A;  4NNJ B;  4KDI C;  1QIL A;  1YJI A;  4M02 A;  1ZE3 D;  1SEB D;  4US9 A;  1ZXI A;  1XEE A;  4GLS C;  3DHG C;  3IXS A;  1LGR A;  2BKF A;  4KGS A;  1BXT A;  5BMG A;  4ITK A;  4RCO A;  5D7G A;  2UU7 A;  3RCZ A;  5DPS A;  3NZ3 A;  3MC8 A;  1NYR A;  4HLE A;  1SXT A;  3T9L A;  2OOB B;  3AMZ A;  2XK5 A;  2DYO A;  3N3K B;  5MPO A;  1GNU A;  2JU6 X;  2KVZ A;  2Z8L A;  4RGO S;  4WAF A;  4WJQ A;  3W5V B;  4EFO A;  2R2O A;  3EC8 A;  1N60 A;  1P0R A;  2QCZ A;  1Z2M A;  2B76 B;  3KW5 B;  4A6Q A;  2JPH A;  3ETR A;  4FA6 A;  5IKC M;  1HZ6 A;  3ZJU A;  4N58 A;  2W3R A;  1L4Z B;  3AXC A;  3T3O A;  3CSF A;  1TS4 A;  1DOX A;  2LAS A;  4WJO A;  1T6B X;  2MEK A;  1TKE A;  5AUI A;  1MG4 A;  2JVC A;  4ZYN A;  3APC A;  1RFA A;  4KVG B;  4XYC A;  2D3G A;  2SAK A;  2PW9 A;  2CHX A;  3EFC A;  1WJU A;  4RF0 A;  1BUI C;  1WXM A;  2K1F A;  5E6O A;  1FO4 A;  1HTO A;  3A4R A;  2C9W B;  4LNO A;  2UYZ B;  5LNK 1;  3VVW B;  2BB6 A;  2GI9 A;  4JLC A;  3K9O B;  3WAO A;  2GBJ A;  1D5X C;  1F2R C;  3M62 B;  3RNG C;  2MP2 B;  1WJ6 A;  1FEH A;  4DDG D;  3DDC B;  4IDI A;  1VD2 A;  2PVG C;  1JWA D;  4OHJ A;  4MGK E;  4CYE A;  2QMT A;  4JQW C;  1FD6 A;  2Y5P A;  1GUA B;  4KSL C;  3Q2A C;  3UIP B;  2W3S A;  4TQ1 A;  2ZCB A;  3H1U A;  2QDF A;  1JWS D;  1N6Z A;  2O6V B;  1F2R I;  1NBF C;  3JVZ X;  4DHJ B;  3BVG A;  1AW7 A;  3Q6B A;  2CU3 A;  1C4C A;  2XNA C;  4FJZ A;  5CTR C;  3ZDM C;  5HG2 A;  1C76 A;  2DNF A;  3H6N A;  2KMM A;  1V1P A;  3UQA A;  1WGY A;  1WIA A;  1NYQ A;  1BML C;  3ZUN A;  1X1M A;  1P9D U;  4IW0 A;  4KKI A;  3NS8 A;  4HRS A;  3ZLZ A;  3I5J C;  4WUR A;  1FIQ A;  1YQ3 B;  2PIA A;  1J8C A;  4HJK A;  4HPL B;  3ZXR A;  2CJN A;  4HWI B;  5C2T B;  2YVC A;  3BYT B;  2FUH B;  5G5G A;  3R2I A;  5LXH A;  3NJT A;  2MCN B;  5EDS A;  1C77 A;  2PE6 B;  2WWZ A;  2HE7 A;  2LRW A;  1LFD A;  1UBI A;  2DZK A;  2BW2 A;  1I4X A;  1ISN A;  2MLB A;  1MPE A;  2DEN B;  4DWF A;  2J4X A;  3RNC C;  1T0S C;  4BKS A;  1WXS A;  4LDT B;  2NTS A;  2WGS A;  1E8Y A;  3DWG C;  3AEC B;  1WR6 E;  2NS5 A;  1NI3 A;  5AUK A;  2KAC A;  2V9H A;  2CKH B;  5EE9 A;  5BMI A;  4HCP B;  3SFD B;  2KAN A;  2J0K A;  1LQB A;  3V6E B;  1EU3 A;  4AUQ C;  2DX5 B;  2KN5 A;  4L2Y A;  3NY5 A;  3JSV B;  1FXA A;  2G45 B;  4WIP A;  2PEA A;  2NTT A;  3ZNZ B;  3ZKJ C;  4A90 A;  2LFI A;  3Q69 A;  1E6E B;  4JGH B;  2KLG A;  1L6V A;  5EE3 A;  3L16 A;  5JH5 C;  2GB1 A;  4HK2 A;  2K0P A;  4XWW A;  2KTF A;  3NVV A;  4IWO A;  4ZRI A;  1Q0W B;  2D10 A;  2DZM A;  3GZN I;  2GRI A;  1YMH E;  3PSE B;  1PFD A;  2ZW0 A;  2WU5 B;  1PQS A;  4URK A;  3VXW A;  2NPT B;  2QIL A;  4BOS C;  3AEG B;  1SE9 A;  5H92 C;  4O1N A;  3BIN A;  2M17 A;  1XCQ L;  2IND C;  3A9K B;  2QC8 A;  1E7U A;  2KKC A;  2MBQ A;  1WE6 A;  3CWI A;  2WXF A;  2UWQ A;  2IGH A;  1KTK A;  4B6W A;  5GXG B;  3W2D A;  4DBG A;  2WHI A;  4RF1 A;  3TSS A;  3C19 A;  5TR5 A;  2WXQ A;  1LM8 B;  3R7Q A;  2G4S A;  4ANU A;  5JHA A;  5L83 A;  2NBV B;  4E3C A;  4A3O A;  3O13 A;  2FCN A;  2L7R A;  3ZJV A;  5HHD G;  2KDE B;  1I4H A;  3N9Y C;  3KH0 A;  3Q14 C;  5C1Z A;  2RR9 A;  1PUT A;  2KHW B;  4FLH A;  2ZNV C;  4K1R B;  3EFU A;  1DGJ A;  1MFW A;  3L17 A;  1CQV A;  4GDL B;  2BGF A;  4K7U A;  3DBL I;  3B9J A;  4DXF A;  4AJY B;  2HJ8 A;  3HM6 X;  1RRB A;  3B1L X;  1D4B A;  2KD0 A;  5CHW A;  1V81 A;  4EZK A;  2JYT A;  2IGD A;  4LDT D;  2JZZ A;  2KOX A;  3NVW A;  3RYT A;  4IUM B;  2KC2 A;  3BVM A;  1WGH A;  2KK8 A;  3IT6 B;  3WCQ A;  2LGS A;  4GOC A;  3MTN B;  2C7N B;  1SJH D;  3B0A A;  3AE4 B;  4WJP A;  2R61 A;  4JPS A;  2D3A A;  3QWZ B;  4W9J A;  1UWX A;  3PPA A;  3I3T B;  2CHZ A;  5G5H A;  1TZO A;  2LWP A;  5BYS A;  2KJR A;  3VR9 B;  2C7M B;  4KDL B;  4S17 A;  1T0R C;  1JAL A;  2ZZP B;  2KYW A;  4J3O D;  4LLG M;  3HHM A;  1ZXH A;  1UH6 A;  4OZB A;  3MC0 B;  2QEJ C;  3O65 B;  1SJE D;  4WQO B;  5LLI A;  2J53 A;  4G11 A;  2JX5 A;  5H8Y E;  3UIO B;  4FXC A;  3DVG X;  2WU2 B;  3B2F A;  2KAJ A;  4USA A;  1KRH A;  3IVF A;  3IG3 A;  1I4P A;  2Z0D B;  4MSM B;  1S3S G;  2HTH A;  2Z0E B;  1WH3 A;  2K25 A;  4G3X B;  1T0Q C;  1BT0 A;  1ZGU B;  3WIM A;  2FUG 1;  2WXH A;  4TQ0 A;  1TT5 B;  3HUI A;  3DBR I;  4TV3 A;  2NPT A;  4OW0 A;  2BVC A;  4A55 A;  4EZJ A;  3Q8A A;  3X23 A;  1XQQ A;  2H88 B;  4MT5 A;  3ZVV A;  4OVZ A;  4ZRP A;  4N6E B;  4HCN B;  4AP4 C;  4LJO B;  3ZDT A;  3W9C B;  1SBB B;  4PS3 A;  2IYD B;  3AI5 A;  2YEP B;  1YJ1 A;  2MRP A;  3PTF C;  2WLB A;  3QHT A;  1UZX B;  3WAN A;  3P4R B;  1V1P B;  4RNA A;  5EE0 A;  4AS1 A;  3A4S C;  2L1A A;  3SD5 A;  2LGX A;  2BTE A;  2KWV B;  3W5U B;  4BBN C;  2L05 A;  4QAY A;  1VJK A;  3QA8 A;  3PV1 A;  5KHQ A;  2KX0 A;  2L0F A;  2QIE B;  1QOB A;  3GOE A;  4MH8 A;  4BZA A;  3AB5 A;  2KTR B;  1ESF A;  3ZW3 A;  4GDK B;  2ZNV B;  3A9J B;  1XLP A;  4ZRQ A;  3PT2 B;  4NJC A;  4RMA A;  5JXV A;  4GMV A;  4HPP A;  3U8Z A;  4DHJ D;  1SF0 A;  2ZPY A;  4IKG A;  4YT0 B;  1FFV A;  3RUI B;  1K51 A;  2MW5 A;  1EUV B;  3URY A;  2JT4 B;  2IO0 B;  4ZOH C;  3TUO A;  4HDQ A;  2LUM A;  3KUZ A;  3ENE A;  3HRD D;  2AQ2 B;  1IUE A;  3VH3 B;  1GC6 A;  5JZE B;  4DDI D;  4A3P A;  1WJN A;  2JUO A;  2WXI A;  3PLV A;  1YN5 A;  2AYO B;  3AU5 A;  4NJ7 A;  2IGG A;  3EA6 A;  2BBC A;  1L5P A;  3VDZ A;  1R4N I;  1WXA A;  1WXQ A;  4WWP A;  4RFB A;  3OAW A;  2GMI C;  3PVL A;  2LJI A;  5FK9 C;  2LXC A;  4GU2 A;  2EEL A;  3DCG A;  1ZKH A;  3R3M A;  1TKG A;  1ENF A;  1HQR D;  3ZRF A;  1RYJ A;  3AEE B;  4BAX A;  3E56 A;  4BKS D;  2Y5C A;  2LHD A;  1QQR A;  2AL6 A;  2LVQ A;  1YIW A;  3MHZ A;  4YSZ B;  4GDL A;  3J9C A;  3RNE C;  3H7P A;  2RPQ A;  1L6U A;  4A8X C;  3DHH C;  2W54 A;  2MBB B;  1EWC A;  1QOA A;  2XBB C;  3I63 C;  1SIF A;  2OHF A;  1MI0 A;  1JCK B;  2W82 A;  2FAZ A;  5BYQ A;  2VZK B;  4P1C C;  2BQQ A;  4J6I A;  4IM2 A;  3OWE B;  4DK5 A;  2JXX A;  2KTR A;  1EO6 A;  2GLS A;  4NPN A;  2LRU A;  1SE2 A;  1FNW A;  1WMH A;  2K8B A;  4NZL B;  3PHX B;  2NCN A;  2OJW A;  3CST A;  3M63 B;  1UGM A;  1L7Y A;  3MJ5 A;  4GGQ A;  4MGZ E;  2JZ3 B;  1DOI A;  2KX3 A;  5D3I B;  1V97 A;  4KZ0 A;  3TEZ A;  3AEF B;  2SEB D;  1Y8R C;  4MJS B;  3OJ3 A;  3FKY A;  4NQK E;  1I35 A;  1GC7 A;  5FKA C;  3MP9 A;  5IP4 D;  1VDV A;  1GPX A;  3IFW B;  3APD A;  4FJV B;  1IYF A;  1KOT A;  3ZNG C;  3LXF A;  4AOF A;  2WDV B;  3NUH B;  3BWU D;  2FCM A;  2KC1 A;  2AEH A;  2V3N A;  2I2Y A;  2J0M A;  2LZ6 A;  1YOV B;  2KWU B;  1GOZ A;  1J0G A;  1JQ4 A;  4GDK A;  3VR8 B;  1YN4 A;  3R66 C;  4PYZ A;  3M3J A;  2LEK A;  2GOW A;  3NVY A;  3EHV A;  3PRP B;  1J7B A;  2BKR B;  3AE2 B;  2AWT A;  2M8S A;  2C5L C;  4ZHP A;  1F77 A;  2NR2 A;  1D5M C;  1C78 A;  2BS3 B;  3R8B A;  5BMH A;  2BB5 A;  1XLO A;  3FC4 A;  4KKJ A;  2ZVO A;  2WNM A;  1UGJ A;  2KWC A;  3MC9 A;  1MHH E;  2K8H A;  4M00 A;  1PYW D;  2N9E B;  1JW9 D;  4MEL A;  4II3 B;  3VQI A;  3CMM B;  3U52 E;  3W1S C;  4C80 A;  1ET6 A;  4DXA B;  4HJG E;  2RDB C;  4MAC A;  1CJE A;  1TS5 A;  3RZF A;  3PGE A;  2MSE D;  3V6C B;  1Q10 A;  5IO9 A;  1OTR B;  2I1J A;  1SE3 A;  4WWO A;  2PTL A;  1P1A A;  1OQR A;  4W9H A;  1SSN A;  1C3T A;  1J19 A;  2MBO A;  1JWU D;  3NG0 A;  4FN2 A;  3TEY A;  4JE3 B;  4TUU A;  2N9K A;  1VLB A;  1JWM D;  1XF5 L;  3OJ4 B;  2K9X A;  3AU4 A;  4GXB A;  3DPD A;  2HD5 B;  5DPR A;  3EEC A;  3KWL A;  2MBH A;  2BWE S;  2WXP A;  4OZC A;  4AJW A;  1V5O A;  1MJD A;  1KLV A;  2V3S A;  1B9R A;  3DWM A;  3CIR B;  1F52 A;  1XCT L;  3VRB B;  3CF6 E;  3RNF C;  2CU1 A;  2WXR A;  2KFJ A;  2XN9 C;  4MM3 B;  2JWZ A;  4E71 A;  4PYU A;  1PGX A;  3AE7 B;  4DXG A;  2J0J A;  5CX3 A;  2G3Q B;  2BF8 B;  3AE6 B;  5IOI A;  1P98 A;  4M01 A;  4ASW C;  3ZQ4 A;  2L0T A;  2G1E A;  2IO1 B;  4II2 B;  2FCQ A;  1I4Q A;  3RFZ B;  3AUL A;  4WQM A;  3LB8 C;  1RM6 C;  4B9K A;  3SEB A;  4NAW A;  1WXV A;  2K8C A;  2D07 B;  3RUL A;  2RPV A;  4W9G A;  1VZ6 A;  4G0N B;  2LJ5 A;  2DAF A;  1YJJ A;  3AEA B;  3GE8 C;  2KQ4 X;  3ZTD A;  2M4N A;  3ALB A;  2RDH A;  1E8Z A;  2CS4 A;  1EU4 A;  3V62 A;  1EF1 A;  1N62 A;  2JF5 A;  1J7C A;  3ML8 A;  1WX8 A;  3PRZ A;  3L0W B;  4L23 A;  2ZVN A;  1WMH B;  1FM0 D;  1UNS A;  2GBM A;  1WFY A;  2EMS A;  1T3Q A;  2KFK A;  1OQY A;  3TMP B;  3V3X A;  2ONQ A;  1V1O A;  3W1Y A;  1WF9 A;  3R7R A;  3B08 A;  2R2Q A;  2BS4 B;  3GZN B;  5IAA C;  1OGW A;  4ZDV A;  1WZ0 A; 
#chains in the Genus database with same CATH homology
 2ON8 A;  4TQ0 A;  2RMM A;  4P16 A;  3HUI A;  3P1M A;  5D3D A;  2EKI A;  4OW0 A;  3FIL B;  4A55 A;  3Q8A A;  4NAM A;  2H88 B;  4MT5 A;  5TSS A;  4OVZ A;  4ZRP A;  2WDQ B;  5T8I A;  1DOY A;  2INN E;  2DLB A;  4R3D A;  4N6E B;  1E7P B;  3PZ7 A;  4C7Y A;  2Y3A A;  3HVZ A;  3B2G A;  1QIL A;  1YJI A;  1ZE3 D;  1SEB D;  4US9 A;  1ZXI A;  2PKO A;  1XEE A;  4GLS C;  4KGS A;  3IXS A;  3W9C B;  3NVZ A;  1BXT A;  1SBB B;  1V8C A;  4JWU C;  2INP E;  5BMG A;  1WGK A;  4ITK A;  4RCO A;  5D7G A;  2YEP B;  1TS3 A;  3NZ3 A;  2BS2 B;  2WLB A;  1KF6 B;  4D2K A;  3P4R B;  1NYR A;  1V1P B;  4RNA A;  5EE0 A;  1SXT A;  4AS1 A;  1C4A A;  3AMZ A;  3C8Y A;  2L1A A;  2DYO A;  4US8 A;  5MPO A;  2JU6 X;  1P7E A;  2Z8L A;  2AQ3 B;  4RGO S;  4WAF A;  2BTE A;  1EM7 A;  3W5V B;  3W5U B;  4IOI E;  3GB1 A;  1ZPS A;  4UDU C;  3VRA B;  2N7J A;  1N60 A;  1VJK A;  3AE9 B;  2B76 B;  3EUB 2;  4A6Q A;  1ROE A;  3ETR A;  2IJ0 A;  4L1B A;  1HZ6 A;  4WH4 A;  2QIE B;  3ZJU A;  4N58 A;  1NEN B;  1QOB A;  1ET9 A;  1L4Z B;  2W3R A;  4MH8 A;  4HEA 1;  5C3J B;  3T3O A;  1D5Z C;  2E6X A;  3BZD B;  1ZDV A;  1TS4 A;  1DOX A;  3AB5 A;  1HEZ E;  1IBX A;  1T6B X;  1ESF A;  2MEK A;  5FR3 A;  1TKE A;  5AUI A;  4GDK B;  1JWB D;  3IT4 B;  4HKQ A;  1XLP A;  4ZRQ A;  5JXV A;  2SAK A;  2PW9 A;  4NJC A;  1CZP A;  2WS3 B;  1WRI A;  3GS2 A;  4RF0 A;  1AWD A;  4YTN B;  1BUI C;  4HRO A;  1SF0 A;  1FO4 A;  1MHX A;  1C79 A;  4IKG A;  3P4Q B;  4YT0 B;  3LYY A;  1FCL A;  1FFV A;  1K51 A;  3AEB B;  3URY A;  3BK1 A;  1EWY C;  4ZOH C;  2WXK A;  5LNK 1;  3TUO A;  1M4V A;  3U2S C;  2BB6 A;  2GI9 A;  3RPF C;  2LUM A;  3Q8C A;  3PZ8 A;  1D5X C;  1F2R C;  3HRD D;  2AQ2 B;  2BT6 A;  4AQ7 A;  1IUE A;  1FEH A;  2FBW B;  4IDI A;  4YWG G;  3H8H A;  2PVG C;  1JWA D;  4OHJ A;  1IGD A;  2WXI A;  3Q8F A;  2QMT A;  1FD6 A;  1YN5 A;  1ACC A;  3P4S B;  3R2T A;  1GAQ B;  2IGG A;  3EA6 A;  2BBC A;  2Y5P A;  1L5P A;  1FCC C;  4RGN A;  3AH7 A;  1WXQ A;  3P63 A;  3U7Z A;  1SE4 A;  1JML A;  4RFB A;  2W3S A;  4TQ1 A;  2V3P A;  2IPK D;  2LJI A;  4LK0 M;  1JWS D;  5FK9 C;  1F2R I;  1K52 A;  4B0M A;  3NRZ A;  1ZP0 B;  3NS1 A;  2EEL A;  1XXG A;  4KX6 B;  1L0X B;  3BVG A;  1AW7 A;  1JRO A;  3P42 A;  1TKG A;  1FRD A;  1ENF A;  2M56 B;  2CU3 A;  1C4C A;  2XNA C;  1HQR D;  5HG2 A;  3AN1 A;  1VZ7 A;  2QSD A;  1RYJ A;  1CK1 A;  1C76 A;  4XDC A;  2JXT A;  3AEE B;  4YXD B;  1SB3 C;  3E56 A;  2Y5C A;  3TEW A;  1I4R A;  2LHD A;  2TSS A;  1QQR A;  4REZ A;  2YEP F;  4RGT A;  2KMM A;  3L4P A;  1V1P A;  4ZYS A;  2JSV X;  3EGR A;  3MHZ A;  4YSZ B;  1NYQ A;  3J9C A;  1BML C;  3MFG A;  1L6U A;  4A8X C;  4DQO C;  2W54 A;  2DYM A;  1EWC A;  1QOA A;  5I4D A;  3ZGZ A;  2MJ3 A;  3IAM 1;  1E10 A;  4KKI A;  2HTM E;  1FFU A;  4HRS A;  2WXG A;  4WUR A;  1VRA B;  2OHF A;  1SIJ A;  1FRR A;  1MI0 A;  2WXJ A;  1JCK B;  2W82 A;  1L0V B;  1OQQ A;  1FMA D;  1XO3 A;  5BYQ A;  1FIQ A;  1YQ3 B;  2VZK B;  2PIA A;  2AX5 A;  3Q8E A;  1L0Y B;  1D6E C;  1F0Z A;  2LGI A;  3OWE B;  2CJN A;  2VZK D;  3AV8 A;  4RH6 A;  5C2T B;  1IBX B;  3BYT B;  4ZHO A;  5G5G A;  1SE2 A;  3R2I A;  1FNW A;  2H89 B;  4NZL B;  3T3N A;  1C77 A;  3AE3 B;  1E9M A;  1JRP A;  3BYY B;  1GB4 A;  3MJ5 A;  2BW2 A;  1DOI A;  1I4X A;  1YN3 A;  1V97 A;  1MPE A;  5D3I B;  3TEZ A;  1N63 A;  3AEF B;  2SEB D;  2J4X A;  2PVO D;  1KFY B;  4TSS A;  2LHE A;  2NTS A;  2X38 A;  1J7A A;  3DWG C;  3AEC B;  1TY0 A;  1TKY A;  4C56 C;  5FKA C;  3MP9 A;  1NI3 A;  4XWT A;  2WP9 B;  1VDV A;  1QLB B;  5AUK A;  1GPX A;  2LMC A;  2KAC A;  1N5X A;  5EE9 A;  5BMI A;  3LXF A;  3AM9 A;  4XDD A;  2WDV B;  1FNV A;  3SFD B;  3NUH B;  3AE5 B;  4Q2J A;  3BWU D;  4YTM B;  1EU3 A;  2N0S B;  2V3N A;  2I2Y A;  4L2Y A;  1FXI A;  1PGB A;  3FIL A;  1YNT E;  1GOZ A;  1JQ4 A;  1FXA A;  3VR8 B;  1C4P A;  1QF6 A;  3KQ4 A;  1QKZ A;  1YN4 A;  2NTT A;  3I57 A;  4WIP A;  4YSX B;  2LEK A;  3SFE B;  3NVY A;  4A90 A;  2LFI A;  3Q69 A;  3HVD A;  1J7B A;  1E6E B;  4HKZ E;  4ARI A;  1L6V A;  3AE2 B;  5EE3 A;  2JWU A;  1AYF A;  2GB1 A;  2K0P A;  4JWS C;  4XWW A;  1VZ8 A;  2D5G A;  4ZHP A;  3NVV A;  1F77 A;  4A9A A;  2KDM A;  1D5M C;  3TEX A;  1RWS A;  2GRI A;  1C78 A;  2BS3 B;  1YMH E;  1PFD A;  1NVI D;  2ZW0 A;  2WU5 B;  4NAW B;  3R8B A;  1HZ5 A;  2J52 A;  5BMH A;  2BB5 A;  1XLO A;  3FC4 A;  3KWV A;  4KKJ A;  2WNM A;  2L52 A;  3AE8 B;  4LTU A;  1HXY D;  1UGJ A;  1MHH E;  2QIL A;  1PYW D;  3AEG B;  1JW9 D;  1N5W A;  4PT5 A;  3VQI A;  1HA5 A;  3U52 E;  5H92 C;  2L83 A;  2RDG A;  4C80 A;  1ET6 A;  4O1N A;  4HJG E;  1XCQ L;  2CJO A;  5BYR A;  2AQ1 B;  4MAC A;  1I7H A;  1CJE A;  1TS5 A;  1KLG D;  1K50 A;  2M0A A;  2WXM A;  1Q10 A;  1TYG B;  1SE3 A;  3CWI A;  4YTP B;  1IGC A;  2PTL A;  2WXF A;  1OQR A;  1I4G A;  1SSN A;  2IGH A;  1VR9 A;  1KTK A;  1PDX A;  2BYT A;  1JWU D;  5GXG B;  1AN8 A;  3W2D A;  1N61 A;  2MH7 A;  4RF1 A;  1DYQ A;  1LO5 D;  3TSS A;  4JE3 B;  3TEY A;  2WXQ A;  2QJL A;  2N9K A;  4C7Z A;  1VLB A;  2N9L A;  1JWM D;  1TS2 A;  2E3T A;  1TY2 A;  2MJD A;  1B1Z A;  4WWM A;  1XF5 L;  2JYE A;  3BK2 A;  2K9X A;  3O13 A;  1XLN A;  1WYG A;  1K53 A;  3ZJV A;  5HHD G;  3E9S A;  1GB1 A;  3KWL A;  3KLS X;  1I4H A;  3N9Y C;  2WXP A;  2JZP A;  2V0G A;  1A70 A;  1WSP A;  4OZC A;  1PUT A;  2DBY A;  4XE0 A;  2KWD A;  1B9R A;  3DWM A;  2M19 A;  1DGJ A;  3V05 A;  1CQV A;  3CIR B;  4GDL B;  4M0W A;  3ABV B;  3B9J A;  1QT9 A;  1XCT L;  4DXF A;  3VRB B;  4CQN A;  5EE1 A;  2WXR A;  1L4D B;  2XN9 C;  5HI1 A;  1D4B A;  4MM3 B;  4H2A A;  1QOF A;  3AED B;  2JYT A;  1TJE A;  1PGX A;  2IGD A;  2MJE A;  3AE7 B;  4RGM A;  4DXG A;  4EE2 A;  3NVW A;  3ZJT A;  3AE6 B;  3BVM A;  4B0E A;  1STE A;  3IT6 B;  1YQ4 B;  2ACZ B;  3WCQ A;  3ZQ4 A;  1R7S A;  5HFY A;  2G1E A;  2NMQ A;  1SJH D;  2HDE A;  3AE4 B;  1I4Q A;  3RFZ B;  3AE1 B;  1E0Z A;  3IAS 1;  4WQM A;  1KH0 A;  1RM6 C;  3LB8 C;  2R61 A;  3I9V 1;  4JPS A;  4N59 A;  3SEB A;  3P4P B;  3UI3 A;  1ZOY B;  2WDR B;  2V4I B;  2RPV A;  1Y56 A;  2WXL A;  5E6J A;  1VZ6 A;  4TMA B;  2L32 A;  4ARC A;  1P7F A;  2JQR B;  1UWX A;  3FAH A;  1WWT A;  5G5H A;  1YJJ A;  4OZA A;  1RFK A;  2WXO A;  1TZO A;  3AEA B;  5BYS A;  1ZDX A;  2KQ4 X;  2ZW1 A;  3Q8B A;  1UWM A;  1PGA A;  3VR9 B;  2Q5W D;  4JX1 C;  2OED A;  1JAL A;  2K3U A;  1NEK B;  2RDH A;  1QOG A;  2DWQ A;  1ZUD 2;  4KGR A;  4J3O D;  2K22 A;  4LLG M;  1EU4 A;  1XLQ A;  1C9F A;  3GP7 A;  1ZXH A;  4OZB A;  1N62 A;  2FE8 A;  2PMV A;  3W1S A;  3MC0 B;  1J7C A;  2QEJ C;  1T5X D;  4L23 A;  4KGT A;  1SJE D;  2W55 A;  3ZYY X;  2J53 A;  1FM0 D;  1UNS A;  2I38 A;  2JX5 A;  5H8Y E;  3PO0 A;  4FXC A;  1OFF A;  1MVK A;  2WU2 B;  3B2F A;  1T3Q A;  2KAJ A;  2K5P A;  2PLP A;  2WQY B;  3BII D;  4USA A;  2ICI A;  3V3X A;  1KRH A;  2ONQ A;  1I4P A;  2IDY A;  1V1O A;  3U4E G;  2J42 A;  2KN4 A;  2G9H D;  4P6V F;  3BVZ A;  1FNU A;  2BS4 B;  1KLU D;  1UUP A;  4YSY B;  2WXN A;  3SR6 A;  2FUG 1;  2WXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...