4IDLA

Low melting temperature anti-cholera toxin llama vhh domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
123
structure length
123
Chain Sequence
b'KVQLQQSGGGAVQTGGSLKLTCLASGNTASIRAMGWYRRAPGKQREWVASLTTTGTADYGDFVKGRFTISRDNANNAATLQMDSLKPEDTAVYYCNADGRRFDGARWREYESWGQGTQVTISS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single Domain Antibody VHH A9
publication title Structure of a low-melting-temperature anti-cholera toxin: llama V(H)H domain.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
total genus 33
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2012-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4idlA00
3ZYIA 3VGAB 5BXFA 3CVHL 2R2EB 4NRYA 4ONGH 3IVKB 4G6KH 4PJ7F 4FABH 3MLSH 4Z6AT 5E8OB 1TLKA 2OL3H 3L9RA 3MXVH 2NY0D 3SDXE 1JYVA 1ZS8B 1UWXK 1A9BA 1KLGA 1BOYA 5ETUA 4NO5B 1QSEE 2BVTA 3ALPA 1BJ8A 4OQTH 4GAYA 5MEQB 1QO3B 3SE3C 1UH2A 4TSBL 2CQVA 3GHEL 3P77B 3QEGH 2X4PA 5JNYB 3CSBA 4FQXA 4N9GB 1FL3A 4JJHA 4PJFF 4NN6B 5HBBA 1TJIL 3HE7B 3U7WH 4KK9C 1IT9L 3DYOA 2GTZA 3RWGB 4OLVH 3BGAA 4LAJH 4NJ9H 1Y6NR 1WAAE 2ESVE 1FYTB 1YEHH 1D5XA 3V6ZB 1N64L 2FNBA 4YAQB 4TULH 1NUGA 1S3KL 1K6QH 1F4XL 4OZHF 2ICEA 5C09B 1WZLA 1NH6A 4O4YH 5HGAB 5MEPB 2BNQE 3I6KA 4PJ9C 2NCMA 1JWMB 5CSZB 2V2XA 4GG6E 3O8XA 2CRMA 5EU6D 2C3HA 5FYKU 2WUCL 2HLFD 3D39A 4HUUA 4U1GC 4Z7UE 2NXYB 3VFWA 1E4WH 5TE6L 1IEHA 1IAKA 3EOBB 3CXHK 5TPWH 1EGJL 1CFQB 2O61B 4KHTH 4ESKA 2FD6L 3VXUA 1RIUL 1A1NB 3EDEA 1OAQL 4HLJA 1IQWH 4KPHL 1CBVL 1QQDB 3LV3B 1Q9KA 6FABL 2UWEB 4P48A 3QNZB 1UJ3A 3GSNB 2I9TB 3ZE0F 1F3RB 4UNTA 5HGDB 3P2TA 4M6OL 1S7SB 5F96L 1PLGL 1AD0A 4AEEA 3VXNA 4JZOA 5JHDB 4V1DB 5CD5D 1EVTC 1D5IL 4WI6A 4UBDD 4XCFL 1RIHH 4UUJA 3RWCA 2AQ2A 3VE0B 4YBHA 3FQUA 4LAQL 2O5ZH 1EBPA 4GRLB 4XXDB 2VLMD 4N90E 4KQ4L 2XOTA 4LLYB 4Y5VC 5JQ6L 2JB6B 2WWKT 4CU6A 3BGMB 4PJHE 2H2SD 4DKEH 4MQ7B 2OTPA 3PGDA 4FFZL 4F2MA 5A3IC 2CK0H 1N6VA 2X4RA 4G7VL 3QO0B 3SDAB 2J5LC 1UWEH 3RTQD 1E6OL 2AJVL 4BQ6A 4J7RA 4U6YB 2X05A 2YPLD 1T0MA 4RMWA 2XFXA 3ESUF 2P8PA 3MRKB 1A3RL 5IFHH 3FN0H 3MRLB 1KB5B 5IWLA 4O5LL 4FG6C 3QWQB 4AEIL 2AVGA 3FJTA 2WBKA 2AJUL 4NYLA 4ZS7H 1B4JH 4GW4A 4Z5RB 1RZ8A 1MEXH 5CIPH 3SCMA 2OTWA 4LDEB 4JEGB 4F7EA 5DJZA 5A2IH 1KUMA 4NIKB 5IEHB 4RFNC 3QA3B 2Y5EA 1WEJH 1D3CA 2ZUYA 1MCPL 5EZJA 4Y88A 4PP2B 4RRPG 3OR7A 1TJGH 2FJFA 4NZDA 1OW0C 2JIXA 2DKSA 3E6FB 5CEXB 2X41A 3MRPA 4UQ3A 4OD2A 3V52L 1CLOL 4KUCD 1UB5A 4DN3L 5IG7A 4GBXD 4FQHA 1FO0L 3EO0B 5KN5B 4MQTB 1I1YB 2AK4B 3VRLE 3HC3H 5GSVA 2O26U 2BVPA 4RMVA 1NLBH 2R39A 4DEPC 4JRXB 5JORA 3FO1A 4Y8DC 2MCPL 1NCTA 3CVHH 4D0DA 4APQD 3WFZA 4WU5A 3TH2T 4EI5A 2HTKC 4NO0A 1RUQL 4A6YB 1LILA 4HWZB 2XQYG 3OZ9L 3QQ9C 1E4XL 4P4KC 5AD0B 1QUNA 3QNYA 1YMMB 3ZE2E 4H88L 4TSBH 1OAXL 4ZPTB 1HHKA 4CN4A 5D5MA 3QUKB 3T3ME 3GHEH 3FKUS 3IKCA 4PRBB 1TJIH 1IT9H 4TSAL 5D1XC 1NAKL 2UUDH 1DVFD 5JLZA 4UI2A 4NFBA 1PY9A 3VXTB 1IEBA 4RIRB 2ZG1A 1KGCE 3FRUB 5FA4A 3HE6A 1WJ3A 4ZOAA 1ZT1B 3KLHD 3KJ4B 2YN3A 1N64H 4IRJD 4PJDA 1S3KH 2EECA 5JXEA 4TTGA 1F4XH 5GGSY 5H2BA 4DFIA 3D2UD 3GIZL 5HSFA 2EIDA 2A77L 4JZNB 3RX8A 4QYOB 3VFRB 5E70A 3M45A 3GHBL 1FZKB 5ID1A 3H42L 1ZANH 1J8KA 2WUCH 4NQSB 2FYYB 4S1DC 1YEFL 3VU2A 3GJEB 1R3JB 4OLUL 4PREB 4LVOB 5TE6H 2D7PA 1Z5LB 4IRSC 5GGRY 2P7TB 1N8ZB 2PO6B 4QCIB 3LS4H 4KXZH 2J8OA 4PRHB 3ZKMD 5KAQF 1EGJH 4PRNB 4D2NA 2VB5A 2FD6H 3HRPA 2VR5A 4MCZA 1RIUH 2J88L 3SKUD 3QULB 1EFXD 4OQ1A 3FB8B 1ORQA 1QA9B 1OAQH 5GS3A 4KPHH 1CBVH 3UBXI 3HC4L 1ZVHA 3MGTA 3HR6A 3STZB 3D18B 4JQXC 2P5EB 3OB0K 1RZIB 1DQQB 3DVFA 3RBSA 4M6OH 5F96H 3UTTE 1PLGH 4L9LA 4S1QL 5KSAA 4BSJA 2ARJA 1II4E 3U9UB 1G1CA 5B39G 1D5IH 4JM4L 2CDGB 2KZWA 4XCFH 3KPPB 4DCQA 4LAQH 4XNZC 1KYOK 1BIHA 4LQ1A 2MJWA 1R3IL 1J05B 4KQ4H 4FXKB 4WJ5A 5JQ6H 1ZLVH 1HYRC 2XZCL 3IDNB 3EYVB 4RQQB 2P46B 4X6DF 4KMQA 1CFNB 2QQQA 3QEQA 4FFZH 1AGEA 5GSRB 5E9DE 4AH2B 4G7VH 1GZPB 5DTFB 1E6OH 2ZNWA 2BSSB 1ORSA 3L5IA 5J8OA 4PRPB 3WLBB 4P57B 2AJVH 3U2SA 2WQ8A 2R1YA 1T2QL 5E03A 5J6HA 4OB5L 2H9GB 5DFVC 2VLRE 3C5ZA 3ARFD 1A3RH 2H3NB 2OI9B 4HK0A 2RGSA 4J1UA 3SKJL 4O5LH 2Q76B 4AEIH 2J12B 1G7JA 1AGCB 1A7NL 5I16A 3I6GA 1ZKAA 3TNNA 4PV9A 5DR5L 2WWKO 3O2VL 1VHPA 3HG1B 2V9QA 4QEGA 2XICA 3RVXD 2E9BA 4JN2A 1VFAB 4XHQA 2UVFA 3QXDA 1F6AA 1NFDA 2PYEE 1HHHA 1WF5A 1IILE 2VAAB 1MCPH 4Z7NF 5JIPA 2VE6A 3WHE1 4MDIA 1JGDB 1IAII 2HTLD 1BZ7B 4PJXF 3OJMB 1H0DA 3OXSB 1IJ9A 3T8XB 1NJ9B 4LLUA 3V52H 4NKDA 4ODXA 1CLOH 3DXAB 1BJ1H 4DN3H 1OB1A 3Q1SL 4WFHE 1FO0H 3BWAA 4JFFD 4KVNL 4KKAC 2NY4C 3GBNL 1JNLL 2DYPA 5J56B 4F7MB 1MUJA 4HLZG 1V7ML 3JBG7 2H32A 1F3DJ 5C9KA 2MCPH 3FTGA 1WVZA 1CICC 4ELKB 5DHVA 5BOZG 3U48A 2JB5L 4QOKE 1UG9A 5D70H 3CVIL 3F7RA 1RUQH 4U1SB 3WLWC 5IESL 3TBWB 3WFHB 5T3ZL 1QSFB 3OZ9H 2PUQT 2VZTA 3L7FB 1E4XH 4LFHD 2P4AB 1TVBB 1E4KA 5ID0B 1N3NA 1CDJA 4YDVB 3O4LB 1OAXH 3HI5L 4NN5B 1YJDL 1HYSD 3AGVA 3LQAC 4LSUL 4O00A 4ZOCA 1ZA3A 4TSAH 1NAKH 1NEZB 5JDJA 2YSSA 1MFAL 3EFFA 2IPTL 2HJKA 2XNAB 4HH8A 4HMDA 4XNQB 1DEEA 3DBXA 1QLEL 1YN7B 2HFFB 5FHBL 3S34H 1AFVL 3WJLC 1NGXA 2FECI 4F33B 1DQTA 1YY9D 3KLSA 4LFHG 4Y4FA 4HS3A 3GIZH 4X98B 5GGQL 4B0MM 2A77H 4CMHB 4B53A 5ISZD 2FIKA 4HUWB 2IAND 3GHBH 1YQ2A 3GUTA 1RUML 3H42H 5EZLA 2FEEI 4AT6B 1KB9K 3IYLW 1YEFH 1JWUA 1J0YA 4U1MA 2CLRB 4Z78A 3U6RB 3RZCB 3FN9A 4OZGA 1T0PB 5SWZA 1FZOA 1G7QA 1U3ZA 4KRPD 1NCBH 1O7VA 1QRKA 2J88H 2EYRB 5HHMB 2A6DA 3FQRB 4PJEF 2P5WB 5FM4A 4UNUA 4P9HC 4LCUA 3HC4H 1JE6A 3EGSB 3ZE1E 2P47B 4L4TE 3SQBA 5EUOF 2FJHA 1H3GA 1H15A 1YMHB 4ONFL 3SO3B 1X44A 1XF3A 4JKMA 3MRHA 2M8XA 4LASL 1T4KA 3G5ZB 3NIFF 5A2FA 3NZ8A 2JJTA 3P4OA 4IJ3B 4S1QH 4Y2DC 3WO4C 2BSTB 5J7CC 3ZYZA 1EHAA 2DLHA 4EIGB 3TA3B 4EXKA 1SEBA 3L3OB 3H7BB 3RL1B 4HWUA 1JYNA 3P0VL 3BD5A 4G9FD 4JM4H 5CGTA 5DC4B 3ZDZF 4J4PC 4LLVB 3IVKA 4MLSA 3MRBB 3TNMA 1KJ3L 2O5YL 5E8OA 3BP7B 5JW4Q 4ODUB 4RMSA 2VLKE 1JZ4A 1R3IH 5DRNB 2MQ3A 3AU1B 5D72L 5L8JB 1ZS8A 2XZCH 1FFPB 1V3JA 3QDJA 5DFTA 1AO7B 1QO3A 2RJMA 1U8JA 3ULUL 3P77A 5JNYA 4N9GA 4M93C 2IFGA 1T2QH 4BZ1L 2Q7YB 4XB8A 4JFOA 3E8UH 4OB5H 1AD9B 3RWGA 3MGAA 4ZAKD 3N1PC 3EYQC 3NCCB 3SKJH 4KK9D 1RSFA 3QUZB 3L1OL 2ZSVB 1A7NH 3MREB 2KDGA 4ZTOL 5DR5H 5E2TL 1FYTA 4C56D 1WCQA 3CXDL 2FZ3B 3O2VH 3V6ZA 1H8NA 1TNNA 2BFVL 3C2SA 5F93C 3V5KA 5I19L 4YAQA 2X9YA 3ALXA 4I0CC 3W0WE 3GI8L 4KROB 3RGHA 3G5VB 5HGAA 2G2RB 3RWDA 1PKQB 1JWMA 5CSZA 3ESVF 4PJ9D 1MVUB 2E7BA 2O93L 2CDFA 3KR3L 3EOBA 5IKCB 3KS0J 5K9QI 1KG0A 4D9LL 4WHYH 3Q1SH 4Q9RH 2ZJSH 2E7MA 4PJCA 5BS0B 2JTDA 4YBLC 2X09A 4KVNH 1A1NA 3GBNH 3MLTA 1JNLH 4JPWL 5HGGS 1AP2B 1F8TL 5CP7A 2YBRB 3C6LC 1V7MH 3K4AA 3KDMB 4POZC 1F2XK 1QQDA 3LV3A 2UWEA 3QNZA 3BI9X 5HGDA 2JB5H 1J7VR 4OGZA 2E7LA 3CVIH 5D1ZB 1M71B 1S7SA 1CXIA 1PG7L 1OP5H 5IESH 5T3ZH 5JHDA 4V1DA 5EOTB 2I5YL 1UXWB 4NQVB 3OF6A 1A6AB 5DJYB 2HJLA 3LSOB 4E42A 1GGTA 2IBBA 2NY0B 1JVKA 3HI5H 1DFBL 3RY6A 3VE0A 3BMVA 1YJDH 3REWB 3ULUE 3MGOB 1JPSL 1AGBB 4GRLA 4XXDA 4LSUH 3HRZB 5E4IA 1AC0A 5CZXD 4LLYA 4QF1B 2JB6A 1MFAH 2AJYL 5E4EB 2IPTH 3PGFL 4MQ7A 5IVXE 1QLEH 5FHBH 3VWJB 4QRTB 3BEVB 1AFVH 4NKMA 1IVLA 3QO0A 3WNKA 2IALB 3V4PL 5A3ID 5IBUG 4JFHD 4S10A 4YO0A 3KPNA 5BW7C 2AV7B 4U6YA 5GGQH 1QBLL 2RFXA 1LEIB 4I4WB 5JHLL 4W68A 5FGSA 5KANI 3MRKA 2GSGB 3L3KB 3MRLA 1KB5A 5ECJE 1ZGLM 3WKNA 5C0DB 1RUMH 2D9QB 2JK5B 1CTOA 5I66B 3VFTB 1T5XB 4Z5RA 5C1MB 2MHAB 2EE2A 2HMIC 4YHYC 1J1PL 5IEHA 4JRYB 2XKUA 3JVGA 3SKOB 3QIBB 2ICWB 5GS1B 3LEXA 5EULV 4R4FL 2FO1A 1FZJB 3QR2A 1ZLUH 2Y36L 3V6BR 3E6FA 2W0LA 5CEXA 5EU3B 3ARBB 3NOIA 5FEBA 3DGGB 4GKNB 4YHPB 4HUKB 1G7LB 4ONFH 3UYRL 3ULVL 1C12B 4G8FB 4LASH 1I1YA 1A6ZB 5E8PB 3U4AA 1J12A 3KAAA 5I1AB 3AREC 3EDKA 3F58L 4D9QD 3ARYA 3LD8B 5B21A 1AHWB 3P0VH 1EEQA 1T2JA 1F3DH 3ZKQD 2AJSL 5IROC 4MCYB 1KJ3H 2O5YH 1HDMB 1YECL 4A6YA 4CVWA 2HTKD 3WMSA 5D72H 2G60L 5M95B 3NCEB 4HWZA 4XHJC 3AC0A 1DN0B 4YXLL 2AEWA 4U1HA 5DRWB 3VXQB 2DI8A 3H9SE 5FYLL 1UC6A 4P4KD 4ZPTA 5AG9A 4WO4B 5ICYB 32C2B 3EHBC 3QUKA 3QUXA 1CXKA 1IKNC 4BZ1H 3RI5K 2XT1B 4PRBA 4UV7L 4CVXA 3VXMD 3DX9A 1IRAY 3RTQB 1N6UA 1P4BH 1KXQE 1HILB 5T1LD 1J1OL 3VXTA 3L1OH 5D1XD 5IB5B 1NAMB 4ZTOH 4MS8C 5E2TH 1ZT1A 3CXDH 5KSBB 4M1DL 3SE8L 2BFVH 5I19H 2P24B 3BT2H 2BNRD 1XH3B 3EKCA 1V7NH 1PAMA 3ZT5A 3GI8H 4R0LB 4K94C 3QDMD 4L8BA 3SN6N 1KOAA 1DQLL 2AKRA 4JZNA 4LLDB 4QYOA 5JMOC 2RR3A 2YHGA 5D6CB 4DWHA 5IMOA 4EDWL 3BP6B 4YUEL 5KS9B 2FYYA 1FCCA 4LVNC 1R3JA 5IVNA 2CK2A 4YC2B 5FB8A 3KR3H 4HGWB 1EEYA 1HI6B 1Z5LA 2DLTA 4S1DD 4CMMB 1N8ZA 4D9LH 4PRHA 1KIQB 4HZAA 3ELAT 1A7PH 4PRNA 4IRSD 5JPMB 3MBXL 3ULVE 1OSZA 3ZSSA 2OSLB 3IXTB 4JPWH 4WRLA 1QA9A 4K3JL 4U3XA 4NGHL 1F8TH 2XN9A 2D9CA 2Z0BA 4BH7B 4J23A 4N0UE 12E8L 1LEGB 4YQXL 3E2HB 4WI8A 4QRUB 1KNOB 3FB7B 4F8QA 3STZA 3OJVC 2P5EA 4Z7QE 2YN5A 3VI3E 4JPVL 4Z7VF 1T89A 2HN7A 2I25N 3T0ED 4PRID 4YH6A 2NW2B 3BVNA 1DQQA 3BP5A 2XRAL 1UH3A 1BREA 2V6HA 1WICA 3F7QA 5CWSB 3O3EB 1H5BB 1PG7H 1K8IB 1U8HA 2ZCKL 4EBQL 2IBGA 1S5IL 4HH9B 3Q5OA 4APQB 1S8DA 4F7TB 2I5YH 4M00A 5L88L 3U9UA 4BFGA 5GGTA 4P5TB 4WV1C 1W72B 3K80A 3CLEL 3NCMA 3VXPB 1DFBH 3KPPA 1MLCB 2VZ3A 3PHQA 5DJ6B 5K33A 4JPIB 1O5DT 3P9MB 4WFFE 3IDNA 3Q0HA 2AJYH 1QLRA 1M7IB 4LKXB 1J88A 3PGFH 2FDBP 5GSRA 4AH2A 1GZPA 5DTFA 4I9WE 5HHPA 5KSVB 4LPXA 5D2NE 3BPLC 2BSSA 3OX8B 4J12A 4PY8J 2A74B 3V4PH 1DVFB 3CDGB 4P57A 3WLBA 4LPUA 2COQA 2MFNA 1OHQA 1FGNL 2DQFB 1QBLH 4ZNCD 5J06A 4FP8L 5JHLH 3RI5F 4DZ8B 2H3NA 5DFVD 2Q76A 2YMXL 2WIIB 2XPGB 1AGCA 4XNUL 5F72S 1JV5A 4M43L 3D2UB 3DPBA 3HMWL 3SHSA 4MD0B 4HS6B 3QISA 3WJJC 4ELMF 1VFAA 2DIBA 2X9WA 1J1PH 3ISWA 3T0AA 4G8EA 2QSQA 2MCG1 4P2RA 1S7XA 1N4XL 4BUGA 5JXAL 4L4VD 4R4FH 2Q1EA 4Y89A 1JGDA 4AEFA 1BVLB 4DKDC 5D5MF 5CBAB 3QQ3B 1A6UL 1BZ7A 1KJMB 3IFPB 1YN6B 3OXSA 2Y36H 5B39B 3T8XA 4ODBD 5CS7A 3DXAA 5I71B 3ET9F 3V7AE 4N90D 3UYRH 3ULVH 3KS0H 1U8NB 1T22B 1GC1L 3S3JA 4F7MA 3PHSA 4G6JL 3FT3B 4M7JL 4KKAD 2NY4D 4X6CF 3F58H 5L8LB 4PJDF 4N0RA 2BNUB 2G5RA 1R24B 1OGAD 2HVKB 1YYML 3GSUB 4WI5A 2AJSH 1PD6A 4ELKA 5EZIL 3S37X 3VGGA 3TYFB 1YECH 1CICD 4GKSA 4MD5B 1MHEA 4TSCL 4H1LG 4F57L 2G60H 3TBWA 4NQEA 3DI2B 3HCVA 3GRWL 4YXLH 2QSCL 3L7FA 3WLWD 1GGIL 3OBAA 3VI4F 1D6EA 1TVBA 4O02L 4PJ7E 2J4WL 3THML 1P4LB 5ID0A 4YDVA 5FYLH 3WYRA 1DJSA 2F53D 3CFIC 2FB4L 2X4NA 1DBAL 4PB0L 2FH8A 5BO1L 3WNLA 1TCRA 4Q2ZB 1P7QA 4KK8C 4UV7H 1BVKA 2GJZA 4LRIA 1ZHLB 3ZZ1A 3WE6B 4RBPK 1GGUA 1NEZA 4PJAB 1PG7W 2VOTA 2XNAA 1J1OH 4XNQA 4RAVB 5HYSA 1YN7A 2HFFA 3X3GL 2A6JB 4L8CB 5DJCB 4CN1A 4LCWE 3G08A 4PJFE 4F33A 4M1DH 1I1AC 2OCFD 3ARFB 3K2UL 3KG5A 3MZTA 3S35L 2MKWA 5EIVA 4QXGL 4PJIB 4X98A 5D1QC 5SWSE 1ZLSL 1DQLH 3A67L 4HUWA 3MV11 3TBSA 1JF1B 2XA8L 5FUOL 4EDWH 1D5ZB 4YUEH 4AT6A 2QHRL 1X7QA 1WT5C 1IM9B 3LQMA 4OZHE 2DMKA 3MUJA 3MCKA 4DVBB 2GK0A 2QJDA 4KUCF 4MA7L 1P5VA 3MBXH 5FA3B 4K71B 1MFNA 2EYRA 5L2JB 1CGVA 4YHNB 3G6DL 1FNAA 4K3JH 5E6YA 4NGHH 1OTSC 3FQRA 5FYJL 2P5WA 5C0BB 12E8H 4YQXH 1DLFL 3WCYA 3EGSA 1Z2KA 3NAAL 2ZZUT 3JUYA 4JFFB 3FT4B 1BFTA 4JPVH 3EO1B 1YMHA 1FSKC 2XRAH 5I74B 3VRJB 1YQVL 5ITBL 1I7ZA 2ZCKH 4EBQH 3IU3B 2MMXA 1S5IH 2BSTA 3D3VD 4HUNB 2CH8A 3TA3A 3B9VA 4Y2DD 5D71L 3ZE0E 5L88H 3HR5B 3MYJB 3RL1A 5EIIB 1S9XA 3O6KL 4MJ5A 3CLEH 4LLVA 5EOCJ 3PWPB 3MRBA 3UDWC 3BP7A 1CG9B 2E3VA 4J4PD 4NUGL 5C8JA 2FH6A 3CAFA 5DRNA 4G6AC 1GOFA 5DFWH 3RNKB 4G6FB 4MDJB 3R0MA 1S7TB 3WHXB 1RULL 1DN2A 1WFNA 1P6AB 2J6EA 2NMSA 1FL6B 4OV6F 2YKLL 4HS8L 4Y4HA 3QIUC 2FHFA 2F74B 1FGNH 3DI3B 2Q7YA 4DUXA 4FP8H 1AD9A 4PLNC 4B41A 4HMCA 2IJ0C 1FC1A 1NCCL 4NQDA 4X6BB 1TXKA 5I76B 2YMXH 5TH2B 4ZDHB 3BPNB 3QUZA 3S3SA 2ZSVA 4XNUH 3MREA 4M43H 3HMWH 3O3BB 2VLJA 3EYQD 3WL9B 4LBEB 3WEXA 4CVZB 5ISZB 2IANB 4OFYA 4UOW1 4JM2A 3G5VA 4W4NA 5FHAL 4HCRL 4LCCA 1N4XH 5JXAH 3H7LA 2G2RA 2HKHL 2P49B 1PKQA 5EO1B 3PHOB 3EOYG 4PB9H 1A6UH 4JQVC 4RDQF 5FYJE 4KKCD 2NW3A 1RJLB 5J11C 5K9KB 2H41A 5IKCA 3ZTJH 3WDJA 1X5LA 1RJYB 5BS0A 1GC1H 2NY5C 1J11A 4PJ5D 1AP2A 4G6JH 1WSST 5E9DD 5CJBA 2YBRA 4M7JH 1NANH 5JOPE 3KDMA 2WWMD 5E99L 2EDJA 2PTTB 1L0XA 3GSNL 4URTB 3BISA 1YYMH 3C6LD 3WHE0 5I17B 3KPSE 4POZD 3MNVB 4JN1L 5DHVH 5A16A 1BBJB 2EDDA 1QVOB 5EZIH 1HHIB 5IV2A 1F02I 2A83B 4FQPA 4TSCH 1M71A 4F57H 3MQIA 5FIEA 3WS6C 4G9FB 2JJWA 5DQ9B 5CBEB 3MA9L 5EC1B 4YX2L 4YHIB 3GRWH 2GIYA 2QSCH 5LGJA 3LEYL 1SHMA 4RMUA 4UDTB 4O02H 1QEWB 5IB1A 2J4WH 5DJYA 3LSOA 2PYED 2FB4H 1DBAH 5C0CE 4PB0H 4H5SB 4OCNC 3MBEC 4MMZC 4NHUB 5BO1H 5EOCL 4P2OB 2I07A 5C08D 4LLMB 1FG2B 3VFVB 3U30C 3BUTA 1R3LA 3E6HB 3UPRB 4MNQB 2Z31D 4Y19E 2R1WA 1WFOA 1CDCA 4MSWA 3D48R 1ZHKB 1YC8A 3X3GH 4YFLI 3VWJA 3CFJB 1U0QA 3BEVA 3Q5YA 5ANMA 2X1PA 4PJ8C 3O2DL 1IEAA 3K2UH 3BJLA 3S35H 3U0WL 4H26B 5MP6L 3GZKA 2AV7A 2VERN 4QXGH 4P23A 1ZLSH 1LEIA 1QBAA 4I4WA 1GGCH 3BPCB 3A67H 1KB5L 5DQJB 3O6FB 2D2OA 2GSGA 3L3KA 4KGJA 1Q1JL 1U41A 5FUOH 2QHRH 4XTRC 4P4RB 4ZPVB 3VFTA 1T5XA 4QOKD 1KN4L 1AC6A 2MHAA 4CBPA 4I8DA 2Y25A 5ITFA 4JRYA 4PJ9B 3VRIA 2HMID 3SKOA 5F88B 3QIBA 3MX0A 1U42A 2ICWA 5GS1A 4LRNL 1D5BA 4OFIA 4XP6L 5F70A 5F1SA 3G6DH 1MJJA 4GRWH 4U1GB 4BSVB 1FZJA 5FYJH 4DGVL 3N85L 4XXCC 5GGSB 4JY6B 4MXWL 1DLFH 1D7FA 2FO4B 4HKJA 5EU3A 3ARBA 3NAAH 2WM0A 3TVMB 3DGGA 4MHHI 4JFDB 4YHPA 1A1OB 1B0WA 1G7LA 4E9LA 3K8LA 4KKLC 1MCFA 1C12A 4G8FA 1YQVH 5ITBH 1A6ZA 5CJQL 1UZ8B 1I85C 4EVNB 1XR9A 5GGRB 5D71H 1CFTB 1MCJA 5I1AA 2YD9A 3F12B 1AHWA 2AEQL 3O6KH 5A2JH 3ARED 5E8EB 1FFQA 4X6FA 1NCDL 1ZV5A 4MCYA 1U93B 5J57B 2YUXA 5LGHL 5IBUB 3MNZB 1HDMA 4UIMB 4A6YL 4NUGH 3VH8A 4F7PA 4H25A 4JG1L 2AJXL 4CAGA 4YHKL 5ACLA 2CKBB 1DN0A 4W81A 3IB4A 2N7BA 5DRWA 4YGVA 4XHJD 4Y5YC 5LCVL 3VXQA 1CF8H 2XIDA 1RULH 4PJCF 2YKLH 4HS8H 4U6XB 4WO4A 5JIKA 5ICYA 32C2A 4R4BA 4U4BA 1QFWL 4X6DE 3EHBD 1KCLA 1X6NA 1JPFA 1NCCH 2RQ8A 3QB7C 1HILA 3QH3A 3JV0A 1ZLWK 4N9OB 5J12C 5IB5A 2J5LB 3HZMB 4FXGA 1NAMA 1HK6A 2IAMB 5KSBA 1TQBC 4KAQL 5AUMB 4MS8D 2ZUVA 5E95B 1DANT 5TQ0L 1E28B 2CUIA 2DRUA 4R0LA 3KPRA 4NOBA 5FHAH 4LGRB 4HCRH 3OKKB 4QHNA 2LE9A 2NZIA 2HKHH 2CR3A 1ZGLB 3PG2A 2XXMB 3MRFA 1FV1B 5KS9A 3TFKC 2GFBB 3IDGA 1PG7X 4HGWA 2VN4A 3LVEA 4RFNB 4CMMA 4Z7NE 3HA0A 1J8HB 3D0LB 1KIQA 5I1GL 4XB7A 3HN3A 4BK4A 1VEOA 2OSLA 4PJXE 2BRRL 4BYHA 4G8GD 1EAPA 4JVWA 3JWOC 2V5TA 3FFCD 5D7LE 3S4SG 4BH7A 3FFDA 2CDEB 5E99H 1VCAA 4LSPL 3GSNH 1KNOA 4V2BA 5C9JB 4JN1H 2B1HL 3B5HA 4M7ZC 4QTIL 1Y18B 4XMLL 3C8KA 5F7WC 2NW2A 1IE5A 5C6WH 5CWSA 3WN5B 3O3EA 3MA9H 4YX2H 3BYYA 4DEPB 3LEYH 1NLDL 4F7TA 3REVB 3QIWC 4PD4K 3G6JF 4P5TA 4DAGL 3MRDA 2H26A 2F5AH 4ZO8A 3CZJA 3MV01 4G8IB 3VXPA 3ROLB 1MLCA 1ETZB 2AERT 3T0BA 5EOCH 2NY6C 3KVQA 4OTXL 4TNWK 1TTFA 3VG9C 2R2BB 5DJ6A 1JN6B 4YK4C 4JPIA 5DLML 1G7HA 5E6IC 2FSEA 5E1AA 3P9MA 4NRZB 5I73C 1XGPB 1NSNL 1M7IA 1I9EA 1ZA6B 4LKXA 3QXWA 3UCRA 4L3EE 4XI5C 1FBIL 2K7PA 3O2DH 2KH2B 5KSVA 3VXMB 3OX8A 3RDTD 5FOBB 1TETL 2A74A 3U0WH 5JW5B 4KI5C 4JO4L 2VN7A 5MP6H 5T1LB 3SJVE 4JKKA 5HHQB 2J8UB 5D1XB 3MMEA 2DQFA 5J0BA 4P99A 1L9NA 3GMOB 2B1AL 1YY8B 5DMIL 1CYGA 4DUVA 4DZ8A 1KB5H 4MA1C 3GBML 1UJTA 2OXGA 4NNXB 3HPLA 1FQ9C 1Q1JH 2WIIA 2BNRB 1DBKL 2XPGA 3IETB 4J3OC 5ILTL 3D2UA 1FNSH 3ME0A 1W0YT 2YPKA 4MD0A 1KN4H 1B3JA 1PBYA 2IH3B 3WXWL 3DX8B 3TPUB 4WI4A 3N9GH 4LRNH 5FKPB 4XP6H 4FTVE 3OG4B 5DRZB 2VWEE 3ZHLA 1BVLA 5D6DC 3KPTA 4DGVH 2CIKB 5AG8A 3N85H 2EDBA 2R23B 5CILL 3WSQL 3SDXB 3IFPA 3IF1B 1YN6A 4MXWH 4YDJB 2CRZA 2AXGA 3PXJA 4LHUD 2RIKA 5CJXA 4I0PC 1QSEB 1NC2D 5GS0L 1OAYL 3EJZC 4HX1A 1U8NA 1T22A 3HUJF 1LP9F 5DD3L 2EICA 4YBQC 3T77B 2APVA 4F7CB 4N8VG 4HIEB 5CJQH 3AY4A 2EE6A 3T2QA 3FT3A 4QNPF 4C54A 2RBLA 5EUOE 2VXQL 3QZWA 5HD8C 2BNUA 2W07A 2AEQH 4O2CB 5I15L 3GSUA 3I50L 4O2FA 4S11A 5FCSH 1NCDH 3NIFE 1FL5A 3LN4B 1U36A 2ESVB 3TYFA 2Z8SA 3BESR 3WFEL 5I1KL 1FVDB 4MD5A 4A6YH 4JG1H 5F3BB 2AJXH 1OVZA 3ZDZE 3GJFK 2BNQB 5LCVH 1GAFL 5F97E 3RWJB 1PX4A 3QWRD 5T3XE 4GG6B 2I27N 2RCSL 4XNZB 1B0RB 4Z7UB 1QFWH 3RKDC 3HKFA 1XR8B 4Q2ZA 3CC5B 5C07A 1FJ1B 1JUFA 1T7XA 1U3HC 1ZHLA 4TNWF 3WE6A 3QUMB 4PJAA 1XZ0A 4KK8D 5IHUL 2ORBL 3BDYL 5CFHA 4RAVA 4D0BA 2DLIA 3MRCA 3Q5TA 3W9EB 4L8CA 5DJCA 2OXHA 4KAQH 2P45B 4CJ1A 1P7KA 5TQ0H 1TIUA 4YPGA 1I1AD 4GQ9L 4LQFL 1OQXA 4PJIA 1KEGL 2AQ1A 5JDSB 1G1YA 4LF3B 3NPZB 5JW3L 2AXHA 2ZOKB 2ZUSA 1JF1A 4CKVX 3QCTL 1D5ZA 4QRRD 3TF7C 4FQQA 4IOSD 2VYRE 1IM9A 4OGAC 3K2MC 4FMKA 4YIQB 1EEZB 3DURB 5I1GH 3M1BB 3LMJL 4KGLA 1PEZA 5FA3A 4H1LB 2BRRH 4X7TB 4ZOBA 5L2JA 4X6EB 2MWCA 4MD4B 5IEKB 4H20L 5DJXB 4UT7L 5DUPL 4FHBD 3U46B 1CDHA 1XF1A 1IGJA 5C0BA 1CGWA 4LSPH 4P59L 1OTSD 3PP3H 4PJHB 1I8LC 3FT4A 5K9OB 4QTIH 2HT2C 4XMLH 4L3AA 4XCCL 2NY4B 5I18L 5CEYB 4TN9A 4KDTA 2X2YA 1NANI 1GZQB 1Y0LB 1QSFE 3I02A 4M48L 1NLDH 4OGYL 3HR5A 3MYJA 3K3QA 1VACB 5EIIA 5HYJE 2DIJA 1CICB 2LTQC 4DAGH 3DETC 1R5VA 2LAAA 2YD8A 1SYSB 1D9KB 1A1MB 3OQ3B 4WVRA 3PWPA 4ZYKB 3AS1A 3P9WB 1OGTB 4OTXH 1CG9A 4MA8L 1JNHB 3ZDXF 4JLRB 4PY7A 1AXSB 5DLMH 3L6FA 1IL1B 4W6WB 3UBXG 1NSNH 1TVHB 4G6AD 3G6AB 5DF0A 2X1WL 4HUXB 3FRPG 4LLWB 1S7TA 1FBIH 3WHXA 5C2BL 1FL6A 2WW8A 1TETH 4P0DA 4I77L 2W65B 3RU8H 4JO4H 1AQDB 2PNDA 1NMAL 2WIMA 3QIUD 2B1AH 5DMIH 5DVMA 3MV8E 3QJHB 4OFPA 3AVEA 1YZZA 5IJVB 3GBMH 1CGYA 4M8QB 4X6BA 5I76A 1X5HA 5FXCH 5TH2A 4NZTL 1DBKH 5ILTH 4JFPB 3U83A 3O3BA 5HHOD 4R3SB 4UTBL 4XGZB 4LBEA 3WL9A 4PY8I 3Q6GL 1MAJA 3N50A 5DZLA 5F6IC 3WXWH 1ZT7B 2ICWJ 1AI1L 4BZ2L 4CJ0A 2FRGP 3JWDC 1U8PB 1IAIM 1MH5B 3L3HA 3WFBL 4QHKJ 5EO1A 4HJ0C 3WSQH 3PHOA 5CILH 1RJLA 1MAML 2HFGL 5K9KA 4YFEA 2X89A 4WEMB 5IT2L 5GS0H 1OAYH 1RJYA 2NPLX 4NM4L 3V6FA 5DD3H 4WWID 3BKYL 4GH7B 5L2KE 5I9QC 1NQBA 2NYYC 2YD5A 5DK0A 2VXQH 1HEZB 4EEEA 4FQ1L 5I15H 5I17A 3I50H 4L1DA 3S97C 1B90A 3MV9D 4RMTA 1BBJA 2GJ6A 1QVOA 1HHIA 3LKPB 2VZUA 5M94B 3WFEH 2A83A 5I1KH 4U33A 3FOMB 1S9YB 2CUHA 3MROB 5DQ9A 5CBEA 5GGUB 1K5NB 4JKWA 4EQ3A 5HHVL 2C3VA 5GPRA 4PGZA 3FO9B 1GAFH 1KPVB 3CFBB 3TN0B 1GL4B 4TUOA 4TNVK 4XAKE 5CCKH 4OI7A 2RCSH 3BRDA 1MJ8L 2VWEC 5IB4B 1UWGL 3G9AB 5KW9L 4P2OA 1KCUL 2GW5A 4EJ1C 1CLYL 2PR4L 4GXUM 4O51B 3E6HA 4MNQA 4ODTL 5IHUH 3VXUE 2ORBH 3BDYH 1WZKA 1ZHKA 4PGCB 5DEGB 1CGXA 3SE3A 1EJ6A 3CFJA 1P5UA 1IC7H 3IJYA 5DURD 4AQ1B 3ARGA 1WWAX 3PV7A 4H26A 2ZG3A 4U6TA 3CJJA 1NPUA 4GQ9H 2NY1C 4LQFH 2KZ1B 1KEGH 1T20B 4K8RC 2ED9A 4AEHL 1L9MA 5JW3H 3DYMA 3O6FA 4HAGA 1G9NC 1C16A 1QACA 1MCBA 4TVSa 4IIQA 2VR9A 3UTTB 5DYOB 3QCTH 1T3FA 1JTTA 1OWWA 4P4RA 4RFEB 5DMKB 5IVOA 4OUUB 4LDOB 4XTRD 2VDRL 4I48B 4U1IA 5TF0A 5J9PB 3V7AG 5HYQB 5ESVB 3IRPX 1F4YH 3BN9C 3MOBL 2DM3A 2AV1B 1CVRA 4MJ6B 4H20H 4BSVA 5DUPH 5GGSA 5C0RL 1MJ7L 4HEME 4JY6A 5SX5K 4P59H 3UTZB 5C3LD 3TVMA 2IPUK 3U82B 5M7QA 5JQHC 4JFDA 3UPAA 1NC4B 4U0RB 1H8OA 1S78C 4JG0L 4YBLB 1ZK9A 2VAJA 4PGDB 5E9DB 3LS5H 4N1EA 4XCCH 3TCLB 5I18H 4JREC 3S36L 1KFAL 5E00B 2HFEB 3CCHB 1MNUL 4IMKC 4KKLD 5C0AA 2VXTH 3C6LB 4WHCA 4M48H 4EVNA 2ZUWA 4OGYH 1CFTA 2OK0L 2QKIB 2VLRB 3F12A 5CHNB 4Z7VE 3DLQR 4Z0XB 1HSBA 4S1RH 4JM2F 4O58L 1SEQL 5E8EA 1OP3K 1DANU 2QSVA 4YWGL 1Q9LB 3VWKC 2KPNA 4MA8H 3SQOL 3QHFL 4UIMA 4JDZB 4IMLB 3VGDA 1XT5A 4NC1C 3OAYK 2CXKA 2PYEB 3GNML 4GT7A 3LKOA 4NDMB 4UINL 3QFJA 1MHHB 4GMTL 2X4SA 2UVEA 5F1IB 1G84A 5C2BH 1U8KB 3V4UL 4U6XA 1FIGL 1U8LB 4I77H 2EIBA 3RPIA 1QKZL 1YYLL 4NRXB 1NMAH 1QLFB 1SJVA 1P7HL 1CDIA 3OV6A 3C5JB 4BM7A 4R26L 3RKPA 5D2LA 2V17L 4NZTH 1N2RB 3SGJC 5IBLC 3HZMA 1BOGB 1P2CB 4X9IA 1X9QA 2IAMA 1T1YA 3N1MC 4TQEL 4UTBH 3JUZA 3Q6GH 5AUMA 3KGRA 4BZ2H 1AI1H 1E28A 5DVOA 1J9CT 5EU6E 1T83C 3CD4A 5HJ3B 3VCLB 3ZTJG 4NSKA 4AM0B 4QOKB 3TBVB 5B38B 3O3AB 3WFBH 1QOKA 5BZDB 5ELIA 4R7NB 1W0VB 1ZGLA 4W6XB 4ELME 1FV1A 4HIXL 2FL5B 2GFBA 1MAMH 2HFGH 5C3TA 4YHYB 4CL7A 5IT2H 4OBSA 1J8HA 1S7RA 2IPKA 4X99B 3V0VB 4OQTA 4NM4H 1HN1A 5JMRA 2UV3A 5D5ME 1A64A 1YEEL 3BKYH 1YC7A 3QT2A 35C8L 4UOW0 1MRFL 2XZAL 3TP4A 3MNWB 5T5NF 2CDEA 3EAKA 4FQ1H 3KLAA 5C9JA 2Y72A 4MXVF 1Y18A 4P46C 3B2VH 4FQ2L 4X6CE 3WN5A 4PLJC 3ZYJA 3AREB 3IU4L 5F21B 4X9HA 1I7RB 4ZS6C 1EO5A 2VMFA 5HHVH 3RWFB 1RK1B 3ZKNC 4PR5B 4N5UA 3N1GC 3P4LA 5F8RC 1W72L 1RZGA 4P2YA 2APXA 2Z9TA 25C8H 2VLME 3O3UN 3GDBA 3QIWD 1MJ8H 2ZCHL 3MJ7B 1UWGH 3ROLA 3CSYB 1ETZA 5KW9H 5F89A 1G6VK 1HINL 1KCUH 2R2BA 1JN6A 4MWFB 1CLYH 2PR4H 3VGEA 3VI4E 4XZUB 2NY6D 2QEJA 4ZUSA 2UZIL 4NRZA 1XGPA 4ODTH 3O9WB 1FRGL 4PGBB 2IG2L 1ZA6A 1K8DB 3V8OA 3VFGL 2YPLE 3VXRD 4BJLA 1OL0A 3QNXA 4NHCL 2Q3AA 3CSGA 4FQXC 2ZUQC 4XI5D 5FOBA 4Y2OA 4V2CB 5F7UA 5JW5A 1K4DB 1WBYA 1SJEB 5HHQA 2J8UA 1SYVB 1T03L 5D1XA 1MFEL 4L4TB 3VDCA 3X14B 3HS0B 3GMOA 4AEHH 4KI5D 4NNXA 5DGRA 2BSRA 1FVEB 3KPSD 3IETA 3S4SB 2OM5A 5FFLA 3PL6C 4P2CG 1LMKA 4HZLB 2IH3A 3BQUA 5JO5B 3BKML 2C3XA 2EIZB 3DX8A 4OZFG 3TPUA 1ERNA 2VO5A 2B8OT 4PV8A 3LKRB 1OY3B 5IFJB 3MOBH 3O8XC 5FKPA 4XC1L 3RX7A 4RNRB 4GAGL 2VLKB 4LVNB 2CIKA 4OIAA 4BH8B 5EO0B 3IF1A 1MJ7H 4YDJA 5C0CD 1EAJA 5C0RH 1BIIB 2LFGA 2X7LB 5I30L 4WUUD 4Z95L 5F7HA 3KYKL 1QSEA 4IOFC 1FFNB 4JG0H 4WU7A 4K9EC 4I0PD 4Y19D 4YNYA 3S36H 1KFAH 3T77A 1MNUH 4F7CA 3CUPB 4HIEA 3EJZD 4MX7B 3KLDA 1MCSA 3EYSL 4LLQB 1K9TA 4YBQD 1X5AA 2OK0H 4PYGA 4JQXA 4O2CA 3HZYB 4O58H 1SEQH 5HD8D 3BX7C 3X12B 2DM7A 4JCMA 4YWGH 1WAAA 2ESVA 5IIEB 3T0VA 5IMLB 1T04B 3SQOH 1CL7L 3QHFH 4XAWL 3STLB 1DQML 5CIPA 5MI0C 3U9PL 3GNMH 3W0WB 4ZUWB 5GIRB 4UINH 4KZDL 3VDBA 4GMTH 5E2WL 4WV1B 2BNQA 3J8F7 3RWJA 3MUZ1 5BJTA 3T65A 2FCBA 3V4UH 4GG6A 5DS8B 1FIGH 4Z7UA 2YA0A 2C1PB 1QKZH 1XR8A 1YYLH 3CC5A 3Q3GB 2DQHL 1PKOA 1DR9A 1FJ1A 3C9NA 3MRIA 3RKDD 1CLCA 2C7UA 2YOCA 2NLJB 4R26H 4X7DC 2V5YA 5BRZD 1U3HD 4CU7A 2V17H 4L3CB 5DA0B 2W59A 4HG4K 3BPLB 4TQEH 5EFIB 2DJUA 2VDOL 5DMGC 3GSQB 4R8WL 3VD4A 1LD9B 2IADA 4CU8A 5JDSA 5IWLC 4EQ2A 4LF3A 3CVHA 1JZ5A 1X4ZA 4LL9A 1K3ZA 4N8VB 1XGUB 4ODHL 3AROA 1N59B 4FQCL 4HIXH 1INQA 1F90L 5ADPL 4DFHA 3Q48A 3LPGA 4OD1L 2R4SL 5DHYB 2MOVA 5KAQG 3GMMB 2Y5TB 4OGAD 2VITB 1EJOL 3H9YA 4X9BA 3M1BA 5I1JL 4LHQB 1XGQB 3W39B 1QRNA 1YEEH 2CRIA 3UTSA 4X7TA 2EDLA 4X6EA 3FO0L 2UZYB 4MD4A 4M1CC 35C8H 1L4IA 2AK1L 1MRFH 2XZAH 3U46A 4Y1AA 1RUAL 2Q7NA 3WIIL 1MCHA 2EXWD 1NL0L 4PJHA 2X1XR 4YJZL 5K9OA 5IVXB 4OLYL 4J2XA 5C0EA 3OB8A 5JW4M 3GSWB 2BVUA 4QXWA 4FQ2H 5CEYA 2HT2D 3NFSL 4OCYH 4ZFFA 3IJSB 3IU4H 5L6YL 1GZQA 2QQKL 1S7VB 3UPCA 3O11A 1I9JH 5DZNA 5D7IF 1W72H 3V6OA 1KJ2B 3GB7B 2Z93B 1SYSA 3KYAA 1D9KA 2ZCHH 5ERWA 4LNVA 5FM5O 4FZ8H 3DETD 4ZYKA 1OGTA 1CQYA 3TO2B 1HINH 3NFPB 4JLRA 2VZVA 1TMCB 2VR4A 4HGKC 2B5IC 1Y6KR 1ZOXA 3JWNC 3UC0L 2UZIH 1IL1A 1C8PA 3BIBX 1FRGH 1EO8L 1TVHA 2YUWA 2IG2H 4MNGE 1ZWIA 4NP4L 4ZO7A 4NHCH 4U05A 2BC4A 2G9HB 4DKFH 4GLRI 4K23L 3UTQB 2W65A 4JANB 3X13A 1AQDA 4F3FB 3A6BL 4AL8L 1T03H 1MFEH 3KXFA 3BRFA 5D7LD 1Q0XL 2JELL 3QJHA 4LPYA 5H35B 5FO7A 4M8QA 4JGUA 3HE6C 2D0GA 4MAUL 1I1AB 1HHGA 4P3WA 1FLRL 5JXEC 1IFHL 3PGCB 4UBDC 2X44D 3AMLA 5D1QB 3BKMH 3ILPB 3MRNB 1JGVL 2OZ4L 1ED3B 1FNHA 1FFOB 3U4EA 1QHOA 4XC1H 1MH5A 1QFWM 2BMKA 3SGDI 4GAGH 4KJPC 5F7NC 3OR6B 2H2SC 3P0YL 5DD6A 2R69L 1FE8H 1ITBB 1SJHB 3QI9D 3QDJE 5I30H 4HJ0D 3VXOA 5I1EL 4Z95H 3KYKH 2UYLB 2JE8A 1KCKA 2R56L 4HIHB 3H9SB 1M05A 4P5KB 1NEUA 5D7JB 5HVGB 2LABA 1FZMA 5LVEA 1C5DB 1B6UA 3A0OA 3EYSH 4G9DA 3UBXB 4OCXL 4MA3A 5A2LH 1U91B 3L7EB 2V2TA 3P4NA 5TJWK 3SJVD 1FSKB 3AM8A 4A2MA 5GJSL 1JNNL 4UDUB 3OMZA 1TPXB 7FABH 4LDLB 1CL7H 4XAWH 3FOMA 1S9YA 4DTGL 1QYGL 3MROA 1DQMH 4UOJA 3ARRA 5GGUA 3MJ6A 3U9PH 3L5WB 1R3HB 1K5NA 2APWA 4RFOL 4YEEA 2DAVA 4KZDH 3V8CA 1XIWA 5DO2C 5E2WH 5F9AC 3FO9A 2BDNL 3CFBA 3TN0A 3BN3B 1T0NB 5IB4A 2Z92B 1CFSB 5D96C 1DLHA 4L8SC 2AAVA 1LDPL 2PXYD 4FTVD 3R8QA 2DQHH 3O45B 5FKAB 2DWEB 4FRWA 4O51A 4GJTB 4EN3A 4JY5L 3MA7A 3PDDA 3UP1A 5DEGA 3O41B 3QXUA 5E5MB 8CGTA 1X5KA 5F1OB 4ZFOB 4YDLB 4HQQL 2CXGA 2VDOH 3KPMB 4NM8L 1MFCL 4N0UB 1HSAA 1RU9L 4R8WH 2AW2A 3D9AL 1S7QA 1T20A 1WIOA 1AXTL 5CUSL 4EIZC 2CO6B 1RIVL 2NY1D 1HH6A 3U0PB 2HKFL 4ODHH 3UTTA 3BZ4B 4FQCH 5DYOA 1VPOL 1F90H 5ADPH 1NMCC 5DMKA 4OD1H 2R4SH 4OUUA 4JDTL 4I48A 1EJOH 3W82A 4M1GL 1TJHL 5GRVL 5I1JH 4LSRL 2EO9A 4NC0B 4WFGD 2KL6A 5HYQA 1LE5B 5ESVA 2WANA 4C57C 3FO0H 2A6KA 2AV1A 1JNJA 1JF6A 1TVDA 2AK1H 3ROOB 5T3XD 3BN9D 1RUAH 3DARA 3WIIH 1NL0H 2Y07L 3LB6C 5D93C 5I1DB 1NC4A 1FP5A 3F6LA 2UZXB 4P3DB 3MV7D 4OLYH 4PGDA 4LKCB 3MJGX 3TCLA 4WWKA 4O2EB 5D2NB 1S9WB 2KKQA 3NFSH 5KJRL 3C8HA 4R90L 4FQLL 3CCHA 4C4KO 2WLZA 5L6YH 2QQKH 4KJQD 4Y16B 4GFTB 4U1KB 1IGFL 2YD4A 4OCWL 2QKIA 2VLRA 3GMPB 5CHNA 4Z0XA 3VFNB 4OZIA 5EH1A 3LDBB 3RGVB 4JFEA 1A9EA 4JO2L 4OF0A 2IQAB 4JDZA 4IMLA 4LCYB 1MCWW 3VWKD 5CEZH 5T1KD 2CKBL 5E2UL 3UC0H 3IAGC 3G6JE 5EC2B 3FB6B 3AAZA 1EO8H 1E4KC 1H3UA 5SX4H 3OKNB 2QLVB 4I5BB 4MB3A 2ZUUA 3VXSA 4EOWL 4NP4H 5F1IA 4LSQL 3MBEB 3HNTL 1U8KA 4NNPL 4J3VA 4K23H 1U8LA 3L3IB 4QRPA 3U30B 3TT3L 3A6BH 3S6CA 3CK0L 4NRXA 4AL8H 3IDMB 1QLFA 1FNEA 2QADC 3HI6L 1Q0XH 2JELH 3C5JA 4XX1E 4C56E 1YEIL 4MAUH 4PJ8B 3ZTNL 4XBEL 1BOGA 4IDJL 1P2CA 1FLRH 4PUBL 1IFHH 1JZ7A 4Y4FC 3WO3B 1LO0L 2VH5L 1JBJA 1N26A 1JGVH 2OZ4H 5DK3A 5I6XC 1JHTA 5HJ3A 4RSVA 5C71A 4AM0A 4WDIB 3GSXB 5B38A 3P0GB 5HYJD 5IMMB 4FFYL 1FNLA 5DJAB 5DEFA 5ICZB 1M7XA 4R7NA 6CGTA 4D94A 5I75C 3P0YH 2FL5A 3B6SA 1CFVL 2R69H 1TENA 5I1EH 3G5YB 3UJTL 2VISB 3NGBB 2R56H 4PJ7B 2ICWI 4HKXB 4X99A 3V0VA 1T1XB 1HQRA 4QLRA 1H3PL 1U92B 2H6PB 4OF3A 4QHKI 5FM5M 3D69B 4OCXH 1J0IA 1EBAA 3MNWA 1T66D 3SGEH 5H37H 2NXZD 4K3EL 4MAYB 4XPTL 3HUJE 3BW9B 1FH5L 1LP9E 5GJSH 1JNNH 1P1ZB 5EBLA 1DTUA 3ULSB 2JJTC 4K3HA 3MV8D 4LCWB 3U0TB 1JF5A 4PJFB 4DTGH 4QNPE 1QYGH 3HZVB 5FUCE 4P46D 4GW5B 4YGAB 3ZT6A 5FF6B 1YNTA 4RFOH 1I7RA 4NKOA 1MRDL 3FMGL 5IMKB 5SWSB 3F62A 3VD7A 4PTUB 4PLJD 3RWFA 1RK1A 4IHOB 1CIUA 2BDNH 2HTLC 2YZ1A 4U6VL 3F5WB 4DKAA 3ZKND 3MJ7A 4JRWA 3JXAA 3ZLQC 5BV7C 4OZHB 4ETQB 1EA9C 5DUBA 3GSVA 1LDPH 4GAFB 1L6ZA 2A73A 4MWFA 3GSOB 1J0HA 4XZUA 5JA9A 4X8JA 3TIEB 3VD9A 4LLAA 3O9WA 4JY5H 1AKJD 3AS0A 4Y5YB 3D85A 4PJBF 3CU1A 4PGBA 3CX5K 4X9GA 4Z76B 1MWAB 1T21B 1K8DA 4JFHE 4HQQH 4X9FA 2VZ1A 3DRTB 2XN9E 4XH2A 1RJZB 4JFXB 4WW2B 4UIKL 1IKNA 4NM8H 1MFCH 5HDOA 2C3WA 4NN6C 3JTTB 1RU9H 1INDL 1I7UA 1SJEA 3K1KC 3O0RL 4FQXD 4L4TA 3D9AH 2EKSB 3X14A 1AXTH 5CUSH 4JKPL 1RIVH 5FDWA 3EYFA 4OKVA 4HXAL 2H2PC 3ARUA 2HKFH 3PWJB 4CADB 1QFPA 1TQBB 1LQSR 1NUDA 1RHHA 1VPOH 4YXHL 1UEMA 4U1JB 3WS3B 4HZLA 4JDTH 4HJJL 3PL6D 3TESA 5FECB 5JO5A 1C08B 1OLZA 4M1GH 1TJHH 5F7LB 1CN4A 4LSRH 4LVHC 3LKRA 4JVPA 5IFJA 2XG5A 3FOLB 3BEWB 4RNRA 2VLKA 4XVJL 4BH8A 3O8XD 1NBZA 5EO0A 4F58L 1BIIA 3D39D 3MCG1 2X7LA 1LNUA 5F1NB 2Y07H 2G5BA 1CWVA 5E08L 2K9UA 3W2DH 5D2LF 4IOFD 1LO4H 4D9QE 1NKRA 3VXUD 3C6SA 5KJRH 4R90H 4FQLH 4RMQA 2WAHA 3CUPA 4MX7A 4FA8A 4LLQA 3IKKA 1IGFH 4OCWH 5JUEL 2V7NA 5IB2A 2VJXA 3HZYA 3X12A 3T2OA 1WTLA 2JF1A 4Y0GA 2E7LC 3T1FB 5IB3B 4JFYB 4NKQB 5IIEA 3UXFA 4JO2H 5IMLA 1T04A 1E27A 1U6AL 4NT6A 1YEJL 3BUYA 4OAWA 2CKBH 2H1PH 5E2UH 3W0WA 3SE4C 3QIWB 4ZUWA 5GIRA 3QUYB 1EFQA 1G9MC 4P2RE 4EOWH 4LSQH 2DQCL 3BH9A 3ZDXE 3HNTH 4NNPH 4HWNA 5DS8A 4B5EA 1F45A 3VG9B 4GRLC 4YK4B 5TE4L 5KVEL 1AE6L 2P48B 2C1PA 5E6IB 4GW1B 3CK0H 3Q3GA 4ONOA 1IGYA 3RWHB 3QUML 3HI6H 1VENA 1EVUA 2W38A 1UQSB 1MY5A 2Z8WC 2NLJA 3CFCL 3RQ3A 1YEIH 5T5FL 2R8SL 3ZTNH 4XBEH 3Q2CA 1X6LA 5I8EB 4IDJH 1X5FA 3B9KA 2W60B 3X11A 1K2DB 3QDME 4PUBH 5EFIA 3TH4T 2AJZB 3GSQA 4LMQI 2DLGA 1LO0H 3NCBB 2VH5H 5DMGD 3KPSB 1LD9A 5IF0B 2PN5A 4JR9L 4ZD3L 2KUTA 4N8VA 1XGUA 4FFYH 4C59B 1DQDL 3DO7B 3PE9A 5DUML 1CFVH 5TFSL 3UJTH 5J1SC 4BZYA 3JVGC 2Y5TA 2DLEA 4ZFZB 2VITA 5HYFA 2JCCF 1RI8A 2NNAB 4KK5C 5GGVY 1A47A 3G5XB 1XGQA 3W39A 1P84K 5C0CB 1A22B 4QY8B 5EBGA 1H3PH 1WFUA 2EH8L 3PJSB 4ZAKC 3T0EE 4PRIE 3N1QC 4M1CD 4I0PB 4Y19B 2JIXD 1DBJL 4XPTH 1FIEA 4YHML 1FH5H 4KMTL 3QXAB 3BO8B 3LRHA 2FHBA 3GSWA 2BY0A 2F54A 3NPSC 3IJSA 1S7VA 1MRDH 2VLLB 3FMGH 3NFNA 4D9RE 3WUZA 2VKXA 4N0CC 3TEUA 5CZKA 3MR9B 3FQXB 1KJ2A 3GB7A 4U6VH 2Z93A 3BPOB 43C9B 4TTDC 2VDPL 3BFOA 4FFVD 1I3GL 2EDKA 3VJ6B 4NO0D 3NFPA 5ENWB 5EIQA 3CH1B 3KYMB 1BJ1J 1U8MB 2UUDK 1OPGL 4PIRF 1WLHA 2H8PA 1FN4B 4DGYL 3WNPA 1XCTB 1BEYL 1UCBL 3O81A 4GUPB 2W0FB 4R6UA 3CX2A 3QUXC 1TQCB 2D7NA 4UIKH 2G9HA 3LQAL 2ATKA 5FYLD 2DI9A 4TUKL 3UTQA 3TZVA 4JANA 1INDH 4F3FA 3O0RH 3BYTA 3PDOB 4OCLC 4M9OA 3PWVB 4JKPH 5E1HB 5HDQL 5H35A 1IZJA 4HXAH 3W11C 1YNKL 4QHLB 4TVPH 3L5JA 2YEZA 3I6LE 2VSCA 3LKNB 5FUCC 4YXHH 1JGLL 3HE6D 3H9HA 3PGCA 1KEML 4HJJH 4L4VE 1FNGB 5D1QA 1WWCA 5JXED 5EBWB 3ILPA 3MRNA 3WUWG 1ED3A 3K0WA 3B9AA 4RX4D 1FFOA 2DWDB 1EXUB 5CZXC 1MHCB 1WT5A 4XVJH 3HB3C 4Q6IC 4HD9A 4F58H 4Z7UF 2BXZA 1HXMB 4KJPD 4DOHE 2WINB 4KTYA 3GK8L 5E08H 4XMPL 4Z7WF 3AB0B 4HIHA 3H9SA 4BFBD 4K3GA 4P5KA 3GEWB 4IBLT 5D7JA 1YA5A 1BAFL 2DN7A 2Z91A 3KHQA 1OGAE 4P9HL 1C5DA 4X6DB 1KPUA 1U91A 5JUEH 3L7EA 3FRPA 4NQDE 1C5CL 3B8YA 5HI5C 1LK2A 3QG6B 1JYWA 2B4CC 2OS7A 2GI7A 4P9ML 5A43C 1U6AH 3QWOB 3S5LB 1YEJH 1ZLVK 3ARDB 3O3DB 3ZKSD 4XP9L 5KSAD 3L5WA 3J7HA 2F53E 1R3HA 1RY7B 2ZKHL 4OFKA 3BIKB 2LTQB 5FGRA 5F7FA 3O2WL 4C55A 1VFMA 2GHWB 2BOCB 2DQCH 1T0NA 5DO2D 3UDWA 2F9BT 5TQ2L 2Z92A 2EXYC 5TE4H 5KVEH 1AE6H 2KQMA 4M5YL 4GKZB 4KI5F 5FKAA 3QUMH 5DZOA 5SX4I 3CFCH 4LNRB 4OF5A 4Y4KC 5T5FH 1HZHL 1ITCA 3F7VB 2R8SH 3OKOB 4PJXB 5E5MA 4QRQB 5HHNB 3QEQD 2X4TA 3MUY1 3KPMA 5D7LB 3SEPA 2HP4A 4KV5E 4N0UA 4HBQA 2BRQA 2X4OB 4Y5XA 1IGTB 2OI9C 3RVWC 2HLAA 2WUBL 4JR9H 4ZD3H 4XPAL 3C5ZD 3CMOL 1QPPA 1BBDL 5CJ8A 2HH0L 1DQDH 3BZ4A 2YS4A 2RHEA 5DUMH 4ZXBA 2YD6A 4GOSA 5TFSH 2OR7A 2EDQA 4RWHA 4JPKL 4XCNB 3DSFL 4H1LH 3BE1L 5IVZB 1UACL 5F6HJ 1LE5A 1CD0A 4XBGB 2EH8H 4JQVA 2W0PA 1EMTL 4UB0L 5IHBA 5IR1B 1DBJH 1U58B 3S37L 3K8MA 2E9WA 4YHMH 3BDBA 5FV1L 5F7EL 4L3EB 5DK2B 3D3VE 2ATPB 3LB6D 4LKCA 2VXUL 3SDCA 4O2EA 5D2NA 5F7DA 1S9WA 5FOJA 1WC7B 2DYPD 4HV8A 3SJVB 1AGFB 3FHAA 4Y16A 3BRGC 1XF2B 1RZJC 4U1KA 3SGEI 3GMPA 3B3IA 3VFNA 4GRMB 1ZT4B 2VDPH 3RGVA 3VMOA 4OLZL 4RAUB 1I3GH 1KT2B 1OCWL 2IQAA 1KN2L 1X5JA 4LCYA 1FGVL 4DZBB 1OPGH 5EC2A 1MCWM 3FB6A 5KG9B 4ZQKB 4DGYH 1DUZA 3BKJL 5BQ7B 1BEYH 1S7UB 3OKNA 4MXQC 1UCBH 4I5BA 4FTVB 3ECBB 2OYPA 3MBEA 2XTJE 5TDOA 3LQAH 2Z8VC 2EDYA 4TUKH 4U3CA 3GGWB 3OJDA 3L3IA 4Z7OF 4ACPA 6FABH 3T0EC 4HHAA 3PNWB 1EK3A 4RZCB 1SBSL 1D5MA 1M4KA 3FONB 3UJJL 5HDQH 3SPVB 4KI1A 1S9VB 1SVZA 1YNKH 2QADD 5B4MC 2Y7QB 4PJ8A 5I1LB 2AS5M 5FO9A 1JGLH 3SOBL 5MHSD 3M17A 1KEMH 2OQJB 5EUOB 4H0GA 2NY1B 5C0JA 4N0FA 4P5MB 4CMHC 4Y4FD 4D8PB 4HULB 4UTAL 2OJEA 4G42B 4PGEB 4WDIA 3GSXA 1AJ7L 5IMMA 5DJAA 4H8WC 3R0NA 4RDQG 5T1MB 4HJGA 2IBZY 3B4NA 3G5YA 3GK8H 3K74B 3MACL 4XMPH 5SWZD 4PJ5E 4HKXA 2VQ1A 1BGXL 3EBAA 4GSDL 5FYKE 1T1XA 2QL1A 5DRXB 3PDGA 1BAFH 3I2CL 5C70A 2H6PA 4P9HH 4W70A 1P6FA 3OKEB 5HYIA 3SDDA 5HGHB 5GS2D 3KWWB 5C0GB 1V3KA 2UY6A 3SO3C 4NO2B 4MAYA 1C5CH 4M7KL 3CDCA 1M7DB 3FT2A 1KBGL 2E8ZA 3ULSA 4EI6B 2AJUH 4P9MH 5F9OL 4LCWA 3U0TA 3WD5L 5EPMA 3QPXL 1I85A 3LN5B 4XP9H 1G7PB 1X5XA 5IMKA 3KPRE 5SWSA 1F4AA 3O2WH 5C08E 3P40A 4JY4B 3F5WA 5T1KB 2C1OB 5TQ2H 4ZNEE 3RY4A 4OZHA 4M5YH 4ETQA 2R2HB 3R06B 5E5UB 3IFLL 1QNZL 3L5XL 5I8CB 3OHXA 2MSPA 5CKGA 3TIEA 4PLKC 3T4AB 4E5XA 1HZHH 4Z76A 3QDJD 1A6WL 4Y4HC 1T21A 2BCKB 4WHTB 3DRTA 3DV4A 1AXIB 1RJZA 3DV6B 4JFXA 4WW2A 3OXRA 1F58L 3JTTA 2EKSA 4K7PY 1XF5A 2WUBH 1CK0L 3CPLB 5JTWA 4XPAH 3CMOH 2FLBT 4XCYB 3PQYE 1BBDH 4OZIF 5IHLB 2HH0H 3PWJA 2NX5A 3WIFB 4CADA 1BFOB 2H2PD 5JPNB 2DS4A 3GRWA 5DD0L 4ZUUB 4KROC 2ITCB 4K94L 4JM2C 5HYJB 4JPKH 1C08A 4LCCC 2JJVA 3DSFH 4NQXA 4G5ZL 1MCNA 4L5FL 3U1SL 3BE1H 4HSQA 4H88H 4L29A 1UACH 1JZ8A 5FDYA 3RNQB 3FOLA 1NCNA 3T0WA 3BEWA 3E0GA 1FNFA 1EMTH 4WENB 3KPQB 4R7DB 4UB0H 5HGBB 5EN2A 3S37H 5F1NA 1OD7A 3VFUA 4E41A 5F7EH 4EUPG 3T4YB 3VDAA 5DJ8A 1CDYA 4U6HB 2VXUH 5CMAB 1OP5K 3VFSB 5JIHA 1JJUA 4FZEL 3IRZA 4IDLA 4OZ4B 4WFED 3MV8B 2A2QT 2BY1A 1CD8A 1UM5L 3NA4A 1FLTX 3S96B 3T1FA 3ES6A 4OLZH 5HDLA 3ZL4L 5IB3A 3T0DA 3S9DB 1OCWH 4OLUH 1KN2H 3EIFA 1FGVH 4M8VA 4HDIA 3V5HA 1UGNA 5D7IE 4WTXA 1CFBA 5GJTL 3QUYA 2BHYA 3BKJH 5BXFB 5JHDD 4V1DD 3CH8A 4YHOL 1BJMA 3TYGL 1BPVA 3OF6D 3M8OL 1GSMA 1T1ZA 4IS6A 4QWWC 5ALCL 4NQTA 1KLGB 1AKJB 2BY3A 3HZKA 5ETUB 2CGRL 5E6IA 4GW1A 3MRRB 3K7UA 1TTGA 1SBSH 3RWHA 3IDIB 3PXHA 4GRLD 5E4EC 3UJJH 1HWGB 1Q72L 4ZSOE 4N1HB 2NY3B 3I3DA 3ORJA 1QP1A 3LRGA 3G04B 4ZG1A 5I8EA 3KNBB 4FQXB 3SOBH 3OTTA 2W60A 5L2KB 1K2DA 4N8PA 5LAXA 1SMOA 2NR6C 2Q86B 4P23C 2GTZB 5IFAL 1GRWA 4LP5A 4UTAH 5IF0A 2R2EA 3OAZH 2DKMA 4Q9BA 5DC0A 2CJUL 4UAOC 1ZLUK 3PL6B 3RUGF 3DO7A 5IQ7L 3GKWL 1BMGA 5EBMB 4QHMB 4NO5A 5FM8A 3MACH 5IM7B 5CLWA 4ZFZA 3QIBC 4G8GE 1BGXH 2VQUA 4GSDH 3CNKA 2NNAA 4L8DB 3FFCE 5H37G 3TT1L 3O8XB 5MEQA 2VL5B 2WSKA 1QSZA 4QY8A 4HUUB 1T1WB 5D6DA 2XTJC 3I2CH 5F7YC 2OTUB 4KK5D 3VFWB 4BUHA 4JHWL 1MCLA 4NQCE 1IAKB 3GMRB 3PJSA 5C07E 1YPZF 3HE7A 3PWLB 1HCVA 4Y19A 3VXUB 4X8XA 4M7KH 1CZ8L 4K7PX 3QXAA 4P2QE 3BO8A 1KBGH 4NN7C 4AZ8A 5F9OH 5DDHB 3WD5H 1MFDL 1MREL 2VC2L 3BZEB 3QPXH 3DVIA 2VLLA 5C09A 3TC9A 1OOAA 2DL9A 5MEPA 3E3QC 1KJ2L 3H3KA 4HCRA 3FQXA 2XZZA 4KKCC 3HLAB 4J3SA 4N0CD 2YPVL 43C9A 1ULVA 3VJ6A 5MI0B 4NUJB 5ENWA 3IFLH 4TTDD 1HE7A 1QNZH 3L5XH 5I1CL 1T80A 4KY1L 1CFQA 2O61A 1XCTA 4UUJB 4PJGF 1A6WH 5EWIL 4XX1G 3QQ4B 2WWMC 1WV7T 1WFTA 1J1XL 1F58H 4KJWC 2AEPL 2XG4A 4ERSL 1B4RA 2VZOA 3QUXD 4E0RB 1UYWL 3GSNA 2F58L 2I9TA 1CK0H 3LRSB 3PWVA 3R8BB 1MSPA 1J18A 2ZOLB 4J6RL 1OD9A 4UNVA 1T5WB 3MZGB 3LKNA 3W11D 2XFXB 5C7XL 5DD0H 4R0LC 4ZTPL 4K94H 4X4MA 4Z7VB 1FNGA 3VFOB 1WGOA 4G5ZH 4L5FH 3U1SH 5EG6C 5KOVC 1MPAL 1G6RB 3IT8D 2DWDA 1MHCA 2FBOJ 2Z31C 4F7EB 4OD3L 5DJZB 3FL7A 1HXMA 2WINA 3HB3D 5SV3A 3BGMA 2FIRT 2EDWA 1X5GA 4K2UL 1OT1A 2VXSL 4PRHD 5TF1L 1VESA 3TO4C 3SDAA 2CRYA 3G9VA 3N06B 3O2DA 5EZOL 5LWYL 2JIXB 4GS7B 3KYOB 4PS4L 4FZEH 4HPOL 1I7TB 2XN9D 1UB5B 2Y06L 2D4FA 5IG7B 3OL2A 2L7UA 4AYFA 1UM5H 1MELA 2P5ED 1M6OB 3STBA 2BVPB 3ZL4H 1HWHB 4M7LL 5IGXL 1BQSA 5HI5D 3QWOA 2VDKL 3S5LA 3ARDA 5JORB 3O3DA 1BF2A 1YEDB 5J6GB 5GJTH 1EDQA 3QA3A 4P5TC 4WU5B 4YHOH 5EU6B 2X70B 3TYGH 2F19L 4NO0B 2BOCA 3M8OH 4PP2A 4PYHA 1LO3L 4YFLF 4ELMB 5AAMA 3EOAB 5ALCH 1LEKB 3GIVB 1AR1C 2B5IB 2CGRH 3WIHA 4GKZA 2WBJC 4KXZI 3WUWB 2EXYD 3RIFK 4LNRA 1WISA 2EDEA 2LV4A 1HHKB 2BVOB 3EO0A 5KN5A 5D5MB 3QEHB 4ZFOL 2AK4A 3L3JB 3OKOA 4QRQA 3V7MA 5JA8B 5HHNA 4Y4KD 3IKCB 1X4XA 5D7LA 4HAFA 5IFAH 1JGUL 4JRXA 5JLZB 1IEBB 2GJ6E 4JAMB 4QRRE 4UT9L 4HWBL 1K4CB 5FA4B 3HE6B 1AH1A 2YRPA 3RVWD 1F5WA 4X6CB 4PJDB 5IQ7H 3GKWH 3UZEA 3MFGB 4R97C 3QFDB 1R5WB 2DBLL 2FJGB 3SE9L 5AD0A 4XCNA 1L0QA 1YMMA 3TT1H 3DHJA 1MCQA 3VA6A 2HG5B 2I60L 5IVZA 1IAIL 3I9GL 5GXBB 4P2RD 3ULUH 3MTRA 4JHWH 3KYNB 5A40E 1VGKB 4ONHB 4NZUL 4W4OC 4HBCL 1RJCA 5C0IB 1RMFL 4MCZB 1CZ8H 3WNOA 5GISL 4L3EA 5DK2A 3DXAD 4RIRA 2YPLB 3FRUA 2NY5L 1MFDH 1MREH 3VG0L 2VC2H 4ETYA 3AY4C 4F9PA 4EDXB 1WC7A 3MGTB 1MCKA 1EHNA 1TZHB 1XF2A 4PBVC 1QR1B 1UM4L 1CD9B 1KJ2H 3V4VL 4LGPB 3VFRA 1INEL 1DCLA 1MJUL 1ZT4A 1FZKA 2YPVH 2DBJA 4NQSA 3BAEL 4RAUA 3SDYL 2C9AA 3GJEA 4PREA 4NCC2 5I1CH 3DWTA 2P7TA 4I18C 2PO6A 4QCIA 1NCWL 4NQED 4FQIL 4KY1H 4NZRL 5BQ7A 1S7UA 2K7QA 5EWIH 3MLSL 3QULA 4PFEA 3FB8A 4MXQD 1A14L 4L8SB 1J1XH 5L9DL 4PTTB 2OR8A 3GGWA 2AEPH 4GBXB 5INDB 2D03L 1UYWH 3D18A 1U8QB 4PJBE 2F58H 1P7QD 3FONA 2GITB 5HHOE 2OP4L 1RZIA 3SPVA 3S7GA 5DJ0B 2B7DT 3CSPA 4J6RH 2P42B 2Y7QA 3RIFF 5I1LA 5C0AE 5AYUL 1RUPL 5B4MD 5C7XH 2OQJA 4ZTPH 5E2VL 4XNYL 1AR2A 4J1UB 2CDGA 4D8PA 2AABL 5E94B 2BERA 1G7JB 2YWZA 4D9RD 5I16B 3I6GB 3TNNB 2CKNA 1MPAH 3C60C 4PV9B 2FEEL 1RZKC 1QBML 2VKWA 1JPSH 2R0LL 1NMCB 1J05A 3QXDB 4FXKA 1E4XI 2PYFB 3QFJE 4I13B 3EYVA 4BK5A 2BX5A 4RQQA 4NWUL 4K2UH 1CFNA 2VXSH 3RDTC 4K71C 5TF1H 2XY1A 4MDIB 5HYSG 3PV6B 1CDBA 5EZOH 3ZMRA 5LWYH 4OT1L 4PRPA 5BCAA 3MJ9L 5HHMD 4PS4H 1J86A 2J2ZA 3OKEA 4HPOH 4LLUB 3MV9E 5DXWA 2Y06H 4KC3B 5BOPA 1KULA 3OSKA 2ZUTA 2H9GA 3KWWA 1OB1B 1GOGA 2P5WD 5D93B 1MI5E 5C0GA 5D2LE 1PGRB 5DSCB 4NO2A 1W8OA 4IRJB 2VDLL 1M7DA 2B20A 2AI0L 1LDSA 4M7LH 4EI6A 5IGXH 4KDTC 4IMKA 2IMNA 2VDKH 3B2UC 3PWUB 2H32B 3HG1A 3A6OA 4I3SL 3LN5A 1IKFL 3I6LD 1G7PA 3TA3D 2VAAA 5K59F 4L1HA 4MVBC 1TTUA 2F19H 2CO7B 4U1LB 4JY4A 5HDBE 1MCIA 3R06A 2Z35B 1NJ9A 5KVDL 5EDXA 4AQOA 4HW6A 1EFXB 1BECA 1HQ4B 4WIQA 5LJYH 1MIEL 3QDGE 5B8CB 2GYSA 1MWAL 4R9HA 4PLKD 2BCKA 5F1KC 4WHTA 3DV6A 4Y4HD 1AY1L 1LWRA 1ZA3B 3CXHJ 3CFDB 1JGUH 3NIGF 2QADB 4KHXL 3WXVL 4XP4L 5JW4N 3DBXB 3EUUA 4UT9H 4HWBH 3BPNC 1BWWA 1ZTXL 3IAQA 4XCYA 3SGJA 4WHDA 4TYUA 4NQDD 4WW1B 3BXNB 4IRZL 4U1SA 1BFOA 3QUZD 1J10A 4Y4FB 3WFHA 4HS3B 1QSFA 2VLJD 3QDHA 2X10A 2FIKB 4U7KA 2DBLH 3SE9H 1AQKL 5I6XB 4M9PA 4OFYD 4KROD 1NGPL 1Z3GL 3AUVA 4JM2D 4YLQT 2GT9B 2FHCA 2I60H 5EZLB 3O4LA 5I1HL 1IAIH 1NKOA 3I9GH 1JWUB 4Z78B 3RNQA 4U7SA 2W0KA 3P3YA 3I75B 2OX5A 2DD8L 4NZUH 3D0VB 4HBCH 4R7DA 5HGBA 2JCCE 1RMFH 1IGIL 4MNGB 4YDIL 4XPGL 4WTZG 3T4YA 1G0XA 1BQHG 2LU7A 4U1NB 4U6HA 4N5EC 2NY5H 5AZ2L 3VG0H 5DMYA 3VFSA 5F6HI 5BS0D 3SE8H 3JWOL 1E6JL 1JTPA 3ARTA 4LSTL 1H15B 4DK3A 1UM4H 3RZWA 3V4VH 1XF3B 3MRHB 1INEH 1MJUH 4WGVB 3S96A 3RVVC 3P4OB 2PTVA 1JPST 1Z9MA 3BAEH 3SDYH 4YXKL 1SEBB 2CLRA 4M4PA 3U6RA 3RZCA 4NJAL 4P49A 1RQ5A 1A6PA 4WI2A 1NCWH 3V0WL 4FQIH 4NZRH 1QHPA 2WK2A 2ZSWB 3TNMB 1H3TA 4KVCL 5EB9A 3CFEB 2ADJB 5BV7B 1A14H 4P2OC 5L9DH 3ZDYF 2P8MB 3MLXL 1AKJA 2D03H 2DM4A 3QDJB 5DMJB 3MRRA 4QWWD 4BFEA 3IDIA 4XRCB 5DHXB 2OP4H 2P8LB 4M7LT 1U8JB 4Q58C 3GMNB 2H45A 3G5ZA 3G04A 3ARGC 1MVFA 5AYUH 1JZ6A 3KNBA 2VUOA 5INCB 3VWJD 5L2KA 2R2CA 1RUPH 2X1QA 4JFOB 3TBYB 2Q86A 5EU5B 4ZUVB 2AXFB 5KVGL 5E2VH 3L3OA 3H7BA 4XNYH 4EUPB 1NFDF 1DSFL 2NR6D 2W1NA 1OM3L 1W2KT 2AABH 3U36B 1D6VL 3O6FC 4P23D 3ETBF 3RAJL 4IIQC 2DQEL 1QBMH 1PZ5B 4KDWA 4K07A 4ODUA 3MRQB 3V5KB 2R0LH 5BVPL 3PL6A 3U79A 5EOQL 3AU1A 5EBMA 1FFPA 2XWJB 4QHMA 3HMXL 5CGMA 4NWUH 2QTEA 5IM7A 2YA2A 4LVHB 1HNGA 3RWDB 1AO7A 4L8DA 4JRYD 2VL5A 4KFZC 1ZANL 3TJHC 3QIBD 4OI9A 1T1WA 4OT1H 1UZ6F 1H8SA 2CDFB 2OTUA 1WUNT 3MJ9H 4WW2F 1RUKL 3GMRA 1GJIA 5T5NG 2XTJD 1KG0B 3LS4L 3TVMC 5EU7E 3PWLA 4Z7WE 4EKXA 5E6ZA 5F9WB 4OUOA 1SY6A 4PJCB 4X4YB 5D7SL 1UFUA 3ARBD 2X4UB 1EZVY 3MLTB 2VDLH 1QD0A 2IPUG 3INUL 4RGNE 2AI0H 3DUSB 2QQLL 2D0HA 5CP7B 5DDHA 4WY7L 1QPXA 2FZ3A 3BZEA 4I3SH 2SEBB 1IKFH 3OG6B 2BVEA 4I2XE 3EYUL 5L0QB 3T09A 3PUCA 4CGTA 3HLAA 1UH4A 4KRPB 5KOMC 4M6NL 1MVUA 3EW3B 3I84A 4NUJA 1CT8B 5KVDH 1DZBA 1TZIB 3VXRE 2HJLB 2LAGB 4E42B 5DJ2B 1MIEH 3BHBB 1MWAH 1QRNE 4NBXB 3UTSE 2XZQL 4DGIL 3QQ4A 2EYTB 5FYKD 1A3LL 1AY1H 1P9MA 3L3DB 4KI5E 4Y1AE 4WO4D 1QZ1A 5BMFL 4KHXH 3WXVH 4E0RA 4XP4H 2ENSA 2B0SL 4KJWD 3LRSA 4M02A 4NKMB 1ZTXH 3DECA 3CDFA 1BX2B 2ZOLA 5D1ZA 2IAMC 4IRZH 1T5WA 4YO0B 3KPNB 2MPAL 2XACC 3VH8G 2RFXB 1X3DA 1EPFA 4OZGF 5EOTA 1GGIH 1UXWA 4Z7VA 4NQVA 2VZSA 1AQKH 3VFOA 1A6AA 3V6OE 1JZ2A 3THMH 3IDXL 4XCEB 1NGPH 1Z3GH 5I1HH 3KPRD 1G6RA 4WUUE 1BM3L 2ARJQ 4X7SL 3REWA 3MGOA 1NGYB 3P11L 5GRXG 4GRWF 4JZJC 1AGBA 2APFA 2DD8H 2BVQB 3HRZA 3B9EA 3DGCR 3G6JB 1BZQK 2YD7A 4QF1A 3RP1A 1IGIH 1SBBA 4YDIH 4XPGH 5A1AA 3MUGB 3P30L 3MODL 3LEXB 4FQJL 4QRTA 5AZ2H 2PETA 1KYOJ 3JWOH 2HRPL 4ODWB 2IALA 1RVFL 4ZAKB 3TO4D 3ZHDA 3KYOA 1KTLB 1E6JH 4LSTH 5EUKB 1UWXH 3KXFE 1I7TA 4R2GC 2F5BL 4C56B 1B0GB 5MENE 3ZO0A 5C0DA 1M6OA 4HKBB 2XA8H 2JK5A 3WN5C 1I1FB 4YXKH 5I66A 2D3VA 3NPSB 3PQYD 4NJAH 3BGFC 5HHXL 4PG9B 2D31B 4MA7H 3V0WH 1SMAA 4NOFA 1YEDA 5J6GA 1R5IB 5EU6A 2X70A 3GBLA 4KVCH 4P5TD 5D70L 4Y7MA 4ELMA 3EOAA 3MLXH 3GIVA 1LEKA 3WIHL 4R4NC 5BRZE 4OZFH 4U1HB 4GKNA 4X5WB 3WUWA 1AR1D 4FXLA 4LGSB 2WBJD 2YA1A 2ITDB 2BVOA 3QEHA 1EZVX 3L3JA 3QUXB 4Z7OE 5E8PA 5ACZB 2M1KA 4CVXB 5KVGH 3DX9B 2IH1B 1I3RB 3EOTL 2DTSA 1DSFH 3SY0B 1OM3H 1D6VH 3HUJB 1LP9B 3FQWB 4JAMA 2EE3A 4AJ0A 3S34L 3RAJH 1K4CA 2F8OA 2DQEH 2HT3D 4X6CA 5BVPH 3C08L 5EOQH 4JE4B 3JV4B 5I2IB 2IMMA 3BQUC 4RX4A 5JZ7D 3QFDA 1R5WA 3HMXH 4L8BB 4UILL 3JWDL 2AKRB 1OF2B 1JL8A 2FJGA 4XP1L 1A6VL 3QRGL 3IGAB 5IMOB 2HG5A 4JVUA 4Q6IB 5FB8B 4POUB 1RUKH 1I8MB 1EEYB 3KYNA 4Y5VB 4MNHB 1VGKA 4ONHA 2XV6B 1G0DA 3DVNB 1NCBL 2UWEF 5KSUB 5C0IA 5D7SH 1KF9B 3RTQA 1OSZB 4RRPA 4B50A 3INUH 2YPLA 3MCLL 2QQLH 2XN9B 4MJIE 3Q6FB 4WY7H 1I8KB 1JPGB 4EDXA 3HAEH 3HPJB 2P24A 1XH3A 1TZHA 2FATL 1W8NA 1QR1A 2HN7B 3EYUH 4LOUD 2Y1VA 3BP5B 3BVNB 3IXAB 3I3EA 4LLDA 1CVSC 4QGTA 5D6CA 1U8HB 4BELD 3BP6A 4M6NH 4PLOB 1S8DB 5T1DL 2VDML 5C0NC 5C6TL 1HI6A 1CIDA 2YD3A 5JPMA 2XZQH 4DGIH 4R96B 1KB9J 3IXTA 4PBWD 1ACZA 3FQTB 3PHQB 4Z18A 4L8SA 1A3LH 3EJYC 2DM2A 4WTWA 3S3PA 1VERA 3MRMB 2QHLA 4PTTA 1A5FL 3VD3A 4GBXA 1LEGA 5INDA 5BMFH 1QLRB 3FB7A 3QZWG 4QRUA 5EU7C 1U8QA 2B0SH 4NQCD 4Y4KB 5C07D 2GITA 5HHPB 4RGNC 5DJ0A 1H5BA 1K8IA 1JRHL 2MPAH 4P2QD 4HH9A 4APQA 3E8UL 2EDNA 2F8XC 1Y6MR 1ADQL 4K8RL 1Q0YL 2DIAA 3IDXH 4OF8A 4OZIE 1W72A 1G9NL 5E94A 4U0QB 1JV5B 1G7MB 4JFEE 1ZE3C 1BM3H 3DROB 4X7SH 3P11H 1FORL 2DKUA 2VABB 4ENEC 3C60D 4WEUD 2W9EL 3CFKB 3PP3K 4CRPA 1JYXA 2O5XL 1IM9D 2PYFA 4P4KB 4G8EB 4P2RB 1S7XB 3RX5A 3MODH 3P30H 3VXSE 5JOFB 4FQJH 5T3XL 5D9SB 1YNLL 3MRJB 4I0KA 3PV6A 2HRPH 2VDNL 2D7MA 2ZWLT 5I1IL 3RIAK 1DVFA 4QRPE 1RVFH 3CDGA 3V9FA 2QV2A 3BH8B 2F5BH 2DJSA 4Q9RL 2ZJSL 5C0BD 3GJFB 4J3XA 2DB8A 4N1CA 5DSCA 1A7OL 4IRJA 1DQJB 4Z77B 1DBML 3MLRL 1OLLA 3QDMB 3B43A 3PWUA 4HS6A 5HHXH 2NY7L 5DA4A 3B2UD 1ND0B 3V6OC 1UKSA 1D9KC 1IBGL 4U1LA 4GKSB 3BD4A 1MHEB 4JDVB 2KBGA 4MVBD 1MFBL 2DQGL 5CBAA 1KLUB 4NQEB 3QQ3A 4PG2A 3HCVB 3RWIB 1KJMA 3PWPD 4JFQB 3WIHH 4IRSB 2VNCA 2NTFB 5B39A 2Z35A 4ODSL 1D6EB 2VL4A 1EFXA 1HQ4A 5CEZD 5B8CA 2X4NB 4K55A 5HVHC 2YXMA 1RAMA 4PJEE 1VADB 1TCRB 2BHUA 1KIPB 2K1MA 2OR9L 4G6FD 1P7QB 1BVKB 2GJZB 4EZMA 3LKQB 3T0EB 4PRIB 3CFDA 4RGMC 3EOTH 1R3KB 3BZDA 5CD3B 1R24A 2HVKA 5HYSB 2ICES 3LKSB 3T04D 4LSDA 5FGBA 1CE1L 5LGHH 4U7MA 3G08B 1QFOA 3B5TA 3LZFL 4WW1A 3BXNA 3C08H