4IDLA

Low melting temperature anti-cholera toxin llama vhh domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
123
structure length
123
Chain Sequence
KVQLQQSGGGAVQTGGSLKLTCLASGNTASIRAMGWYRRAPGKQREWVASLTTTGTADYGDFVKGRFTISRDNANNAATLQMDSLKPEDTAVYYCNADGRRFDGARWREYESWGQGTQVTISS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a low-melting-temperature anti-cholera toxin: llama V(H)H domain.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
molecule keywords Single Domain Antibody VHH A9
total genus 33
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2012-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4idlA00
5I66B 4OLVH 2JJTC 2QKIB 4JPVL 3EYUL 1AGEA 5JIHA 1ZLWH 2F58H 2LU4A 2OL3A 2DI8A 4I3RH 4MA1B 1ZT4A 4ZMAT 1IBGH 3AAZB 5HVGB 2I07B 5E00A 3SKJL 1SEBB 3BP7B 3OAZK 2F58L 3CFEB 3FONA 3LEVL 4YWGL 3MUJA 5BZWA 5DJ6A 3ZDXE 1IBGL 1T1YA 3DSFL 3QCUL 1XGQB 2WAHA 4WW2C 4G6FB 5E08L 1GGYA 1VPOH 5I30H 5GGUA 3LEVH 3MBEB 4YWGH 4WFGD 2DLFH 1A5FL 4G9FA 4MQ7B 3DSFH 3QCUH 4WI3A 3HMWL 3K2MC 3MLVH 2FJFA 4HUMB 1FZMB 3OTTA 5J1AB 3G6AB 3JBG7 1JPTH 2DD8L 1U95B 5IESH 1WWBX 3GI8H 2PYFA 3L3GB 4AG4L 4FXLA 4KZDH 1IL1A 5IBLC 1KCUL 2ITDB 3LQZB 4J3UA 2H2PC 5IQ9A 1BOGA 4QRPD 3BDBA 3SDXA 5BV7B 5E99L 1TJGL 5BV7C 2HRLA 2AK1L 3BIBX 3NTCH 4LFHG 4EQ3A 3P73A 4Q2ZB 2H32B 1YZZA 2X4SA 5IMMA 5ILTL 4OZIE 4GLRH 4H20H 2R39A 1YC7A 4JO3H 4PJ5B 5C09E 5CHNA 3D2UD 5I1JH 1HH9B 4DKFH 4UB0H 3TBSB 1NJ9A 4G9FB 4WNQB 3VXNB 4Z7NF 4MQ7A 5AZ2L 2GFBA 4ZOAA 2ZPKH 1JRHI 5D1ZA 3ZE2F 1Q8MA 4ZAKC 4JFOB 3BAEL 4QTIH 1ZHBA 1P6FA 2EXWC 2IFGA 3ZKSD 5FYKH 3W9DA 5CEZH 3WCYA 2EYSA 1W0WB 3MCKB 2DQCH 4M7JL 1BREA 3BW9A 3BZFB 1JRHH 3KYAA 3QG7L 1D5MB 2RR3A 4I48B 4HWEL 1UM6L 3U2SA 4M7JH 4KV5F 3EKCA 2F54D 5GGVL 5FK9B 3DUHA 5JW5B 3WSQH 4OCYL 3AS3A 5KVEL 4BK4A 2X7LB 4HUXA 2EH8L 4JQIH 4KHTL 5CEXB 4LSTH 3TBSA 4L29B 4S11A 2ZJSL 2JB6B 4LKXB 5CEZE 4QLRA 4MXVE 1N5YL 5GGSA 2WZPD 2XZZA 4OV5A 4LSTL 4PJ9B 1AH1A 3PQYE 1TIUA 4P9HH 4PUBH 5JR1L 2DM2A 1EUTA 2QR0B 2VRAA 5DK3A 3W9DB 2VKXA 2EE3A 3KYKL 1M71A 1RUAH 4ZUVB 4R4FL 2XYCA 4LDOB 3LS4H 3P30L 1ZHNA 1U3HA 5T1DH 4ETYA 1FN4A 5IIEB 4MCYB 2H2SD 1G7PB 3L3HB 1RJLA 1INQA 4N68A 2NQCA 5FM4A 2F15A 2YPKB 5GZNC 4HXBH 1CR9H 3SKNA 2WBKA 3FT3A 4S1DD 3F7YA 4P2RD 1GZQB 4OF8A 4L29A 1B4JL 2YD3A 4F57L 4YEFA 2MQ3A 3DPBA 3L3JA 1CR9L 1U91A 1N6QH 3QT2A 1D5ZA 1FBIH 1OQXA 1UWXK 4PJ9A 3OF6A 4NIKB 1XR9A 1UEYA 2OZ4H 3O0RH 4D9LL 3AXLB 2MWCA 3ALWA 5BZDB 3WFEH 1IC1A 2ZP0T 3LV3B 3WL9A 1N4XL 2CLVB 3L3KA 3C09B 3SGJC 3DVGA 5D2LB 5GRZA 4OLZL 4O51A 5T33H 3BH8A 2AV7A 1WWCA 1EGJA 4KI5F 5DD1H 5EUKA 4KRPB 2YPLD 5DDHA 1A7PL 5ENWB 3SKOA 5GRYA 4HUVA 1MCCA 1P69B 2JCCF 3MLSL 3MGOB 4QWWC 4HIIA 5KVDH 1LK2B 2X6MA 3AREB 1F8TL 1MCQA 2DQJL 3D25B 4MQXC 4N0CD 4PJEA 1UB6B 1WAAF 5FDWA 5C07B 3CMOH 4LMQE 4G6JL 4O2CA 4E9LA 5EU3B 1C16A 4GJTB 1XR9B 2IALA 2XKSA 3CPLB 3TVMD 1BFTA 3MMEB 1P5VA 1XGPA 4BK5A 4I18B 3C60D 5EIIB 2IF7A 4X0KB 2X2YA 1NDMA 3BRFA 1UH3A 1S3KL 3WBDA 1KCSH 4M9OA 3PGCA 1JGDB 3G6JE 2AV7B 3SCMA 4FQXB 2BVQB 1FQ9C 3ULVF 1T7ZA 5IMLA 4OLYL 1GGBL 4DK3A 3DV6A 2Z35B 3T2OA 2R23B 3IDJA 3K0WA 5SV3A 5BRZE 5FGCB 1INDH 5KVMC 1JCKA 3DYOA 2VDRL 4OLYH 3V0VA 3HZVA 1Q9LA 1ACYL 4P57B 1CDGA 3UMTA 3D25A 4JY5L 4FQLH 1F6AA 2NXYB 5GGSY 1NEZB 1L0QA 1IM9B 4O2CB 4PJDE 1ACYH 5C71A 2WQ8A 3P9MA 1J10A 2ADGA 3OHXB 5L0QC 1NQBA 4WUUB 5LKNA 2JJSA 2DQIL 4PTTA 4YH6A 1U36A 4PB0L 4EIGB 1JNJA 4M8VA 2BP3A 2GUOA 3VD3A 4XWOC 1YEKH 1GGCH 5ID1B 4ODTH 1Y0LB 1DBML 1E6JL 1NBVL 2EDHA 1CDHA 1G9NH 4XBEL 2F8OA 3FQXA 4G8GE 1TZGL 1NFKA 5C0CA 1LO2L 2VISA 1G9NL 3W82A 3FFCA 4PGDA 3WFBL 3TBTA 3BGAA 3KPNB 1EEZA 5GISL 2IH1B 3GKWH 4U7MA 2ILLA 4KXZI 1ZT1A 3BKYL 3RVXD 4Y19A 4P23A 5KSUA 4GUPB 3WFBH 1CLOH 3BKYH 3OJVC 1VACB 2V2TA 4PGZA 3NAAH 5IOPB 4HG4J 4PRPE 2FIRT 3RDTB 3PF2A 4Z76A 3LKQB 2Q6WA 4CVWA 5HD8D 5DGRA 4Y5VB 3I6KA 4FQXC 4XVUC 1FNHA 1YNTA 2OTWB 3FQXB 1X44A 2DDQH 3NIGF 1LO0H 3OKNA 2DLTA 2NNAB 3M8OL 2R0ZH 3JTSA 1GC1C 1Z9SA 5HGDA 1T1WA 1JI1A 3DWTA 1T89C 5IROC 3T8XB 1X5IA 4NT6A 1FZKA 3VXQA 2F9BT 4ELMF 5SX5K 2IGFH 4PY8J 1ZVSA 2H3NA 1GIGL 5TFSH 5C09D 4UINL 1XF3B 1X6LA 3CFIC 2PO6D 1JJUA 6FABH 1QFOA 3IKCA 3NABH 1FFNA 3L95A 4XT1C 3BGMA 4FZEH 4DOHE 4P3DB 3EYVA 4EJ1C 1S7XB 4NOBA 3ZTJH 2OTWA 4RGOL 1DTUA 2G5BA 4OZIF 2HJKA 1V8HA 3SE8L 2NNAA 3VXTB 32C2B 5J0BA 1R3LB 1I1YB 3VW3H 4YHLL 4ZPTB 1UCBL 1T1WB 2BY3A 5FEBA 5JW4Q 5EO9A 2QJDA 5CD5C 3R06B 4HJJH 4XHJC 3T77B 4NN5B 5LXGH 1KJ2B 4MQXD 4NN5C 1H3UA 1Q0YH 2VLJB 4JN2B 5EU5A 1U8PA 4MVBD 3TV3H 4NUJA 5FCUL 4QGYA 2V2XA 3UTQA 4P2RE 1JWMB 4Y1AD 4U6XB 1LP9A 3MPCA 1BX2A 1T7VA 2BK8A 3KR3L 4L4VB 2IPTL 4O58H 1TZIA 2NW3B 5D2NE 4Q9QH 5DUPL 4XCNB 1HHJA 2PW2B 2X41A 4OM1H 4TVPD 3TN0D 4NRYA 3S37L 4HIEA 4QOKA 32C2A 2CLZB 3G08A 2ZSWB 4JREC 5MP6H 5I8EB 4YR6A 5BW7A 5HDOA 2F5AL 3I9GL 5L2KD 3KXFE 4CVUA 3GSXB 4RAHA 1A9EB 1OAYL 3GMNB 5CILH 5L7XH 4MWFB 3QUYC 4JM2C 4JAMA 3DXAA 1I8LA 4X7CC 5I17B 2NXYD 4G8IA 1ZLUH 2X4TA 3IGAB 1Z9MA 1XGQA 2AK4E 3OAYH 3WHE1 4BZ2L 3FQRB 1T5WA 1ORSA 4QXUL 3F7VA 3OR6A 2FB4L 1T1ZA 4L4VA 4D94A 1FFOB 1RU9L 4DVBB 4L8SC 5D1XA 2GKIA 2XTLA 5HYSG 4F58L 4NRYB 5T3XD 1QACA 5KS9A 4RFEB 5FUZH 3TJEL 1NMAL 5HHOA 3L5WA 5ISZB 1FAIH 3ARFD 4YC2B 1MIMH 3MRCA 3VXRD 4DEPB 1KGCE 2NYYD 4DGYL 3FZUD 5FYJL 2CXKA 3HE6A 1XR8A 4X8XA 5EBMA 1NLBH 4CL7A 5TPWL 1F90H 2GFBB 2X4RB 4X8JA 4DGYH 4XCEB 1GGTA 1HEZA 4HJGA 1T1ZB 3BD4A 4K3EL 4XCFH 4PJCA 5J1SC 1CFSA 5TQ2H 1TNMA 3UPRB 4YHIA 5FXCH 4QXWA 4AENA 3REWA 2W60B 5F3BA 1BAFL 5GS2D 3WO4B 35C8L 4P49A 4PRHB 2CSPA 3MODL 4FFZH 3GK8H 2R2EA 4N1EA 1J86A 4F7EA 2I5YL 3I85A 1D9KB 2FATH 1SBBA 3SPVB 2Z31C 2A77L 2FZ3A 3MYJB 2IPUK 1SVCP 5DA4A 3RZWA 3VWJB 2ICWA 2FGZA 3Q5TA 1TVBB 3OAUH 1NMBH 2QQLL 3GM8A 1X4YA 4POUB 4IOIB 5DMKA 3QEGL 3MUY1 1UG9A 1Q9WB 4JO3L 1J1PH 4I2XE 5CMAB 2WBWB 2NXZD 4HPOH 4PJCB 4EXPX 3ARDB 3V6ZA 1BGXL 2Y36L 4NN7B 3LKPB 2VR9A 3REWB 2VLKE 5KN5B 3BT2L 4OCXH 3VFWB 1H0DA 2NZIA 1IGFL 2VXVH 3FB7A 1I3UA 3X14A 4ZYKB 2IANE 4ZS6D 4FHBD 4QXGL 2NY5L 3LIZL 5GRJH 3QDAA 2ZZUT 3RY6A 2ZNXA 1S7TB 2FR4B 4EDXA 3G5VB 1JRHL 5DMGD 1QFWL 1BZ9B 5J7CC 1VFBB 1WFNA 3ALPA 2Y07H 2XWTB 1ZANH 4NHUA 1AD0B 5GGQH 1NCDH 5JHDE 1Q9WA 3S35L 4R8WH 4GAJH 1D5ZB 1CXIA 1EHXA 5D1QD 4J3WA 3QWRD 4J6RH 3BP6A 1MSPA 3HZMB 1HILA 1ZTXH 6CGTA 1KYOJ 3UJTH 2APTA 3LKPA 5BJTA 1A2YB 4KDTC 4Y5XC 1T0NB 3GSNH 1FYTB 1NFDE 2E7MA 1RUQH 1OAKL 3VDBA 1UWXH 1NAKL 1N5AB 4HFUL 4XXCC 2V9TA 4LPTA 3T3ME 2IQAB 2XZCH 2IFFH 4K94H 1WWWX 3VFMB 3RZCA 4P59L 4KMLB 5CSBA 4LPWA 4EDXB 4X80L 5ENWA 4GMSH 4PJFF 4K94L 3SKOB 4HUVB 4Q9RL 1MFDH 4ZFZA 3EFDH 3ME0A 2GSGA 2WSKA 1VFBA 3C5ZA 1LK2A 2ICCA 1F45A 3RWIA 2ZKHH 1NMCC 1KJMB 1MFDL 5L8LB 3ESUF 1L0YA 4LHUD 1NL0H 4GKZB 5IFAH 2KPNA 1A8JH 1JUFB 3ES6B 1OARL 2AKRB 3BP6B 4HD9A 4P2RA 2VO5A 4QRPE 2OQJA 1RURH 5HVFB 5K9KA 1CFTB 1PG7X 1CGSH 4LAQH 1KCKA 1XGPB 5DRWB 1NL0L 5IFAL 5EU4A 5EIIA 5CJXA 1U8HA 3WFEL 3KHOA 3MFFA 1YYMH 5BVJA 5JA8B 4G8GB 1MNUL 5ELIA 4Y2DD 4HF5H 3UBXA 2G9HA 3ZKMD 1QBAA 5A40E 1G9MC 5T33L 3OKOA 1MNUH 2UYLA 1WFTA 2PETA 5DD1L 2CDFB 4BZ1H 4NCC1 5D8JL 4G5ZH 3JWDH 3C5ZD 1SBSH 5C08A 2XWBB 3MLSH 1DR9A 3PWUB 4R4BB 3ARGA 4WUUE 1KPUA 1UJ3C 2HRPL 4F7PA 1IM9A 4WO4C 4LCWB 3UBXG 3MCLL 4LSPH 1DE4B 2AKRA 5MENA 2P42B 4MNHA 4G80A 4GBXD 5C08D 4L3CB 4GW1A 5E8PB 5I75B 3MA9L 4LRNL 3ZE1E 1AR2A 1RUMH 1AGCA 3DJ9A 3V52L 2CJUL 4BSWB 1IAOB 3EO0A 4LCIL 1Y0LA 1G84A 1ORQA 3V4UH 4ZUWA 3MLTA 1FLRH 4LSSH 4MJ6A 5E94B 4JKPH 4KJPC 4WO4B 3RVTD 3NFSH 3GEWB 3NFNA 1MAMH 3V4UL 4L8BB 4ZOBA 2XQBL 4AZ8A 2JLLA 1N59A 4LRIA 2XWBA 3PWUA 1Z3GL 1NEUA 1FORL 5JW4M 1C5DB 3EYSH 5SWQA 4JHWH 4PLKD 1OTTD 2PN5A 3QXUA 2C3XA 2JIXA 1DQMH 4UZGA 1DE4A 3U30B 4IMLB 3EO1A 2HTLC 5E8PA 3IRPX 3O2VH 4J1UB 1I9JL 4APQC 4Z76B 4LU5H 4XHQA 1P9MC 1MLBB 2DN7A 2E5EA 2R0LH 4R96B 2AEQH 2CDGA 1NFIA 3MGAA 4LLDA 1RZ7H 1KJ2H 4LU5L 5DJ0B 4HG4K 2AEQL 3QO1B 4RAUA 4W6WB 1IEAA 3H9HA 5TGBB 2E7CA 1WAAE 4W6YB 3VRJA 5KW9H 2WBJD 4X4XA 2QQNL 1HHIB 5HDBF 1CT8A 3O6LL 4Y4KD 2CD0A 4A6YA 2HKHL 4WCYH 2JIXB 5GISH 5C0EB 2DI9A 3WJLC 5HYJA 1RZFL 2ZCKL 4QRRB 4X4MA 3BPOB 2Q8AL 4C59B 4JZJC 5D1QC 1UCTA 5TF0A 4R96A 1W0VB 1R24A 1U8NB 1TVHA 4PY7B 4X7SH 2EDYA 4NYLA 4KJYA 2R9HC 2W65B 3B2VH 4JDVB 3NZHH 3GMQB 3QIWA 1KULA 3I3EA 5FDYA 2K3TA 4UV7L 1XIWC 3NPZB 4WHTA 5IEHB 2P49B 3AUVA 2BSTA 3D3VA 3V95A 1FC1A 5I71B 2NY3B 4XX1E 4OF3A 1FO0B 3TYGH 2P8MA 3DMMB 4N90E 4JM2D 1A64A 2B1AH 5I1IH 4KQ4L 4ODVH 3OQ3B 4ZUUA 3BPLC 3G6JA 2UWEB 4Z8FH 2DS4A 1AP2B 1SY6A 4N8CL 3T1FA 2B8OT 5F7LB 4KQ4H 5EU5B 2CUHA 4NUJB 4K2UL 5JOPE 1QSFA 1IC7L 1TTGA 3SKMA 1M6OA 1OAUH 3TZVC 3DURA 2HTKD 3D0LA 1CIUA 3D18B 4IRJD 4K8RC 1U93A 2HWZL 3NN8A 4HEPG 4X5XB 5SWZD 3W81A 3FFDB 2VAAA 5FKPB 2YBRA 1VADB 4PP2A 1L9NA 4FZEL 1HDMA 3ROLA 1JPGA 1MHPH 2EYTB 4MA8L 1YPZE 4YR6B 3QEQE 4KGJA 1V05A 5I8EA 4E0RB 3O6MH 4H8WL 5JXAH 2BXZA 3L1OH 3RL1A 3GSXA 1BM3L 5I19H 3SDYL 4WU5B 3GMNA 5DEFA 4MA8H 2L7UA 4QGTA 2XNAA 1P4IH 1D6VL 2QBWA 1BVLA 3HMXL 4OZGF 4R2GD 2AAVA 1HXYA 4HS3B 3K4AA 4XB8A 3IDNB 1A1NB 4JFYB 2Q8BH 1QSFB 1MFEL 4P4KB 3HNTL 3MRPA 4O02L 5FA3A 5FCUH 3UTPD 4NO2B 3IFOA 2LAGB 3GSOB 3L7FA 2VABB 5DRNB 1T7YA 4I13B 1D6EB 1OSPH 4FABL 2H2PD 1A4JA 1F13A 2UZIL 3SDDA 4N0UB 1RIVH 4L3EA 5EU7C 2X9WA 5KTEH 3D6GA 2VLLA 4ZQKA 2DQHL 4NKMB 3X17A 4IRJB 4UV4H 2X4QA 1WJ3A 2VDQH 2UZIH 2D31B 2RGSA 3GBNH 5C08E 3WKMH 4P2YA 5KZCB 3LSOB 2DQHH 2N7AA 3RVWD 1IQDB 4AIOA 4K55A 3VMPA 3OGOE 5AWNH 7FABL 3L5XL 2G75A 1XGRA 1XR8B 1NGPH 4RBPH 1OGAD 5DMJB 5FHAH 3ZHKA 3NACL 1BBJA 3PQYA 1QSEA 2X4RA 4L5FL 4X8JB 5T3ZD 1I1AA 1YA5A 4OF7A 4U4BA 1R5VB 2XN9A 5DXWA 4NHCH 4QXUH 1YPZA 3B9VA 5FYKE 4L9LB 1JYXA 4P3CL 1OW0C 3OX8B 4Z7OF 2XOTA 4ONGH 1WTGT 5CBEA 1UA6H 3OKYA 2A0LD 2E6PA 5JDJA 2VOTA 5AYQA 1D9KA 1DFBL 1BMGA 1FNSL 3VFVB 1M05B 1FL3A 3CX5K 3MRIB 4NQVA 4GAGL 4YFLF 4RA0C 4GKSA 2XG5A 5C0ND 1C5CH 2BNQA 1OTSD 5GGTA 4I5BB 5GS0H 2OL3B 5HHNA 1X9QA 1LDPL 4IOIA 5DMKB 4CRPA 1AI1H 4YFDB 1PKQB 4HWNA 2VQTA 3WIFB 3PQYB 1U6AH 4M8QB 3E6FA 2Q86A 4ODUB 1NLDH 5E4IA 3RUGB 4JHAH 1JTOA 1N8ZB 4BFIA 1A3QA 5TPWH 4Y16D 1A7QH 3CDYA 4M6NL 3CX5J 1S8DA 4LSVL 4UT9H 5HY9A 4BELD 3KLAA 4JVUA 4KKAD 4OSUH 4NRXA 4OZIA 3CFKB 1DDHB 1KIRB 1K5NB 1PG7H 2BVOA 3O2WH 1EV2E 1U8LB 3PV6A 4WTXA 4UT9L 4WI7A 4P4RB 5GRUH 3VMNA 2IEPA 4M48H 3C9NA 5E9DA 4U6TA 1M05A 1U95A 1W72H 3QHFH 2CK0L 3MV8D 3EHBC 4QRPA 1NAML 5INCB 4Z7OE 2B2XL 4MSWA 3OJDB 3WUWA 1IEBB 1QEWB 1TPXB 4TSBH 4UOJA 1Z0NA 2GAZB 1EUUA 4OD2B 3WIFA 4Y16C 3V8CA 1NMBL 5CBAA 2ESVE 3QEGH 1N8ZA 5T3ZE 1D7FA 4HKZB 5H35A 3CCHB 2MPAL 3P77A 5EU6A 4D3CL 1DBAH 1NC4B 5EO0A 1J1PL 1CWVA 2A6DB 3I50L 2P8PA 3CFKA 2SEBB 3S36X 4YPGB 3MBED 4RGND 3O2DH 5D7LB 1FCGA 3BUYB 2GJ6B 2Y36H 4P4KC 4P5TD 2Y72A 1X5AA 1IGFH 3TBWB 4CN1A 3V6FA 5F89A 3CVHA 1P84K 3CFDA 1PSKH 3BW9B 1PZ5A 1PEWA 1W72A 2PYED 1DQLL 2GHWB 3HI6H 1OSZB 3VJ6A 3CZJA 4KDTA 3QDJD 2LAAA 1VCAA 3O3UN 1HZHL 3NCBB 1LE9B 1CFBA 4UT6L 3T08A 1BQHB 4WHDA 5DJ8B 5T1LA 3KPRB 4HKZA 5K9KB 2D7OA 5JHDA 2P8PB 1QBML 1RJYA 3BQUA 5D5MB 1T21A 1U8HB 4R9HA 3LD8C 1VESA 2IAMA 2GJ6A 3KPSE 3I6GA 5CEYB 2J6EL 1KLFA 3ZTNL 4OLEA 1DEEB 3TBWA 5J13C 1WBZB 1NAMA 4TVPL 4ZG1A 1UXSB 2HFGH 2YD5A 5C2BH 1AXTH 1Q1JL 3MV7A 4TVSa 2HT3D 2R0WL 2A9ML 4N0FA 1DLFL 4LBEB 3PWLA 4ZS7L 4Q9CA 3IFPA 3VG9C 2DQDH 1KPUB 1JNHB 1NGXA 4X99A 3D39D 4UDTA 1NCWH 1ZLSH 2XY2A 4V1DD 3A6BH 3KPRA 3C2AH 2HVKB 2W9DL 3DX8A 2O61A 1MEXL 4U0RB 2AXJA 3HAEA 3CZFB 4KKLD 1A6TB 1G6VK 3U0PB 3VFTA 3A6BL 4JO1H 5IF0B 1GOGA 3RWHB 2IAMB 1A3LL 5E5UB 3HE7C 2V5RA 4M7KH 5M7QA 4NCC2 3L6FA 1A6UH 1CICA 4MJ6B 3T1WA 5F9AC 4WO4A 5ESQB 1ZA3B 5DVKA 4O51B 4TULH 4WI6A 4P2QE 4KDVA 1HKLL 4GXUM 3AS1A 3LDBC 4GRWF 2BCKB 1AHWB 1WIUA 5EUKB 3QXWA 3V5KA 1J12A 5JXEA 3PWNA 5SWSD 1AGBB 4OF0A 3EYOA 3LHPH 1T83C 1JHTB 1IKFL 3NCFB 1YPZF 4LCYA 2VDPL 2CKBL 3LRHA 4LLUA 1BQLL 3EFFB 4R6UA 5D7SH 1YMHA 3HAEB 4YHYC 2NPLX 2UUDK 1IQWL 4PJEB 2VH5H 4QRRE 5DJ2A 1T6VN 2BC4B 3V5DB 4M1DH 4JB9H 3RWHA 1J5OL 1BIIA 1V7ML 5SWSA 2P5WD 3WNNA 5I15H 1B88A 5EC1A 5CD5D 5CKAA 4LPCA 4LLDB 5C8JA 3OSKA 4FXKA 2YA2A 4P2OC 1A6WL 1IEAB 3U0WL 2XFXA 4WO4D 1MVUA 3SDCD 4U1NB 1NCNA 3GMRA 5EZIH 4G43B 1F3DH 4P3WA 4Y8DC 3CC5A 4YFLI 1AJ7H 2JE8A 5JXED 1G7LA 3CFBB 3QIUA 1EO5A 4LCYB 3TWCL 3RNKA 3BVNA 5BRZA 1MCFA 2BNUA 4L1HA 4YDIL 4ODWB 5F9OL 3PABB 4NWUL 2AVGA 1YMHB 5IHLB 1OT2A 3QIBB 5IG7A 5KSVB 4YDIH 1P53A 2EDLA 4YAQA 5MEQB 2UVFA 5SWSB 3MRQB 3ZE1F 1LQSR 4U1JB 3WEXB 4XNYL 1GPOL 4NYLB 2PXYD 1R0AL 1L7TH 1ETZA 1FGVH 2Y5TB 3WS3B 4P99A 4P5TB 1T3FB 4WFHD 4XH2B 4U1NA 2AERT 1MCPL 3LDBB 3ZYJA 5J6HA 2XTJD 3D0VA 1S5IL 2GK0B 3GI9H 4NQTA 4NKOA 2DMCA 2Z8VC 3KLDA 2M2DA 2H26B 4NGHL 2JIXD 2P7TB 5C0JA 1NH6A 1IVLA 4JM4H 1KGCD 4JFXB 5I1EL 4KHXL 5CJOH 4MA3A 3HE6D 3LB6D 1T7XA 2H1PL 4YDKH 1MJ8H 3D0LB 3D18A 1IEHA 4TSAL 5A2LH 4WUUD 5GS1A 2VAAB 4I77H 1FG2B 4JHBA 4K3JL 1UM4L 4Y5VA 1CGTA 2AQ2A 3ROLB 3V79C 4OGAC 4PJIA 4WWKA 3EOAA 4I77L 5L6YL 1WGOA 3FB8B 4JY4A 3FCTA 3IVKB 2NTSP 4JFHD 4R26L 3S8WA 3DMMD 4FQ1H 4ERSL 4ZTPL 1FZOB 1WC7A 1WQVT 5DVNA 5D6CA 1DQQA 5DSCA 5I1IL 3SO5A 2R29L 4JFXA 3MACL 1MWAB 3B9KD 3IDNA 3K4DA 1DUZB 1O7SA 4HJ0C 4M93C 3TIDB 1JE6A 1IC5L 3O4LD 3MRPB 4JFEB 3DX7B 4OIIL 3MROA 1PW3A 5JMOC 4AM0B 5AYUH 4J3VA 4WTZG 1RHHA 3GSOA 5F88B 2VABA 3MFGB 1SYSA 4XPTH 2GW5A 3HC4L 4YXLL 4MS8C 3VXUA 2P24A 1KLUA 3UTZB 4E41E 1HQ4B 4LIQH 3F6IA 3FB8A 4JY4B 3IVKA 4NKMA 3AB0C 4NRZB 5DWUH 2ESVD 5GZOC 4GXUN 3MNVA 5FB8B 1A6VL 4H8WH 3O6ML 1E6OH 2WUCL 5HI5D 5JMRA 3ORJA 4Y4HB 4JZNA 5DWUL 5DSCB 3TVMC 4RISL 3O6KH 4TRPL 1XGRB 1RZJH 2F54A 3RDTD 4PBWD 4I0PA 2EYRA 3DIFA 2VN7A 1QSEB 2R4SL 3RWDB 4JN2A 1MPAH 1UB5B 3H3PH 3MGTA 4K07A 25C8H 3VXUE 2D7NA 4RNRA 2A2QT 4WEMB 1QLEL 4RRPG 4PRDA 4HKJA 2NY5C 5EH1A 3QDGB 5CIPB 3VDAA 2GI7A 5AZEH 3GMPA 2HTKC 4F3FA 1UT9A 3WE6B 3ZT7A 2ARJB 1G6RB 4KUZH 3Q3GA 1J0KA 5J9PA 2HFTA 2FX7H 2HT3C 4CW1A 4G6KL 2UVEA 4FTVA 2CLZA 4LVOB 1AKJA 2R4RH 1L7IL 5HGBB 2BNQB 3SBWC 1XF5B 3T3PE 3VFPB 4XNQA 5HDQL 3CLEL 1IAMA 2UWEE 3ILPB 1MJJA 4M7LL 5KG9B 4DKDC 5AWNL 4KKLC 4Z7QE 2BZDA 1MUJB 2W38A 4PD4J 4ENEC 1I3RA 3ZKNC 2X4TB 1T04B 2XY1A 1TQCC 1CDJA 1D9KC 1MJ7L 1QRNA 1ORSB 1WZ1H 3ULSB 3UTTA 2L4OA 1NEZG 1I8MB 1DDHA 2C5DC 4Z77B 1OP5H 1DQTA 1KCVL 3OXRA 4ZFOL 4F3FB 3QFJA 4PJBB 2XXCB 2W0FA 1FVDA 4X6DB 4GG6E 2NY7L 4CW1B 2RQ8A 1I9RH 4F37F 4IMKA 4FNLH 2JF1A 5D96B 1XGUB 5KS9F 2P8LB 1XF5A 2DM3A 3BX7C 3THML 1TNNA 3H3KA 2ADJA 2Y7QA 3OJDA 4M43L 3WUWB 3SOBL 3RGVD 2MTPA 1TENA 3GSWA 3TP4A 1AE6L 2FHCA 1J88A 3PQYD 4U1IA 3WHXB 5C2UB 4IOSD 3IU3A 5H35B 5SX5H 1DVFD 4Z78B 4OD3H 5GGUB 1KNOB 4PBVC 3VFSB 4LNVA 1NLDL 4G6ML 3A67L 1RK0B 1HIML 1KFAL 4DAGL 4UIMA 5LGHL 5IHZA 4HJGB 4NQDB 4KGLA 4NFCA 3TZVD 4F2MB 4ZFGL 3O4OC 2VZTA 4U1GB 1FVDB 1I3VA 3EW3B 1A14H 3NBNA 4ZDHA 3VRIA 2P8LA 2AI0L 2ICES 3S34H 2AJVH 2R2EB 4KVNH 3SDXB 2RHEA 4KRPD 1A1MB 1OSZA 3QEQD 4UTAL 3SPVA 1HQRA 3ARFB 1A7NH 4ODHL 2IANA 5CGTA 1P84J 1WCQA 4EN3C 5A2IH 3FO1B 1CU4L 3FN0L 5CHNB 1HH9A 4NOFA 3P0GB 4JDZB 3KDMB 4PLNC 4XTRD 1RK0A 4MVBC 1RJYB 3BQUB 2P43B 4HC1H 1UEMA 2ZUXA 4MXQD 5DR5H 4NQDA 1KTKE 2IAND 4XGZB 2WP3T 1MH5B 4RFNC 5CP3H 1W0WA 1BEYL 1CXLA 1KC5L 1UXSA 5AUMA 3B4NA 5IW1A 3C5SB 4XMPH 2X1WL 4XP1L 3HB3C 1GH7A 3MLYL 4U6VL 4FFVD 2C4FT 2VQ1B 4XMPL 1F5WA 1MFBH 1JNHA 2BY1A 3HG1E 4X99B 1BBDL 4L1DA 3KJ4B 1PYWB 4L8DA 4ONOA 4Y1AE 2O61B 2RCSL 3IF1B 1AD0A 3DNKA 4QEGA 5EORL 3VFTB 2C4FU 3RL2B 2XPGB 4ORGB 1FE8L 1D5BB 1JPSH 1C12A 1MAJA 4C56B 5I8OH 2A9NL 3DI2B 1CQYA 1QO3B 5E2WH 1AR1D 2I9TB 2X4OA 3DHMA 2O5YH 4ZUVA 3RNQA 3W39B 3VRLE 5I8OL 4X7DC 3QXTA 3RUGE 1FN4B 4YIQA 1P7KB 3Q0HA 3ARSA 5MENE 5F7FA 3WXVL 5IJKC 5EOQL 1MVFA 3WIIL 4PJ8A 3SY0A 3HE7A 5EOCJ 3QH3A 3MX0A 2D03H 4HLZH 5EOQH 2XZAH 3SJVA 3ULUE 2FECI 1F3JB 4PJIF 2LTQB 5A2JH 2YWZA 1U91B 3C2AL 4PJ8D 1HH6B 4DGIH 4LSDA 5IVZA 1C12B 3QULB 4Q0XL 1HN1A 1KB9K 5T5FH 4LLYA 2FX9L 3AXLA 2E8YA 1KF9B 4JFPA 3T0VA 3U46B 5IFHL 1SY6L 3MTRA 4OM0H 5EU4B 3ZT5A 1RZ8B 1T83A 4RX4D 5CP7B 3OB0H 1HINH 3MFFB 3MXWL 4XI5C 3QJHB 4FTVD 5HVHC 4IOFC 5D6DC 4CJ0A 3S3PA 3CC5B 1XH3B 5HHQA 1MCSA 1VERA 5EDXA 3PP4H 4JLRB 2CDFA 4WV1A 2B5IC 4AEHL 2AJSH 1JP5A 2BNUB 4Z7WA 2XZQH 9CGTA 2KQMA 2RIKA 1BLNA 3GBMH 4J4PA 43CAA 3UAJD 5FECA 1EBPA 5FDWB 5IVZB 1DP0A 4XI5D 4Y8AA 5EZOH 5MENB 3MRHA 3CPLA 4R7DB 1BPVA 5JIIA 3RBGA 3P4LA 2B4CH 4OFYA 1KT2A 1EEYB 4M1DL 1G9NC 2EDNA 4NZRH 3HRZA 3E0GA 3WS3A 5EZOL 1WTLA 3QEUB 3P4OA 2AS5M 5TE6L 3KPPB 4HGKC 1I4FA 1RULL 4M5YL 5L9DH 3T2NH 3SDDD 5DRXB 2AEWA 2FX8H 1A6AB 2Q7YB 5MEPA 3VI3F 2DQTL 2B7DT 2HJLA 2JK5B 3QNYB 4YHPB 5F1NA 4OZGE 4L8BA 2FHBA 2Q1EA 3MA7A 3VWKA 5IUSA 1DQJB 1R3JB 1KPVB 4FQQB 4HK0A 1NEZA 4PJGE 2IPKB 5GQBA 4LCCB 2UZXB 3VFRB 1LHZA 4B41A 1HNGA 1S7WA 4HCRL 5EC2B 1KT2B 4Y2DB 3P0YH 5J6GB 5E99H 4PGBA 3VCLA 1N3NB 3MRKA 2NY2B 4NQEE 4XNYH 5GRXG 3TYFA 1OP3K 1JN6A 2NY4C 4PJIB 2N1KA 4WWKB 1ND0A 5I8KL 3L7EB 1FIEA 3DVNB 1D5IL 5I1LB 5DRXA 4YDJA 2NY1C 4UB0L 5A16B 5I2IB 5HHOD 1XIWD 5TGBA 2CO7B 4JVWA 5FGSA 3BPNC 5HJ3B 3O3AA 1D5IH 4XTRC 3TBTB 3QG6A 2N7BA 4GBXB 4FQPA 3GO1L 3MR9A 3FAXA 3H9SB 1DUZA 5CEZL 4MNGA 4YHNB 3RA7H 3VE0A 1CFNB 3MJ7A 4Q6IB 5I1EH 1G7MA 3S88H 3MROB 5FF6B 2WWKO 3FMGH 3GMLA 2E8ZA 2O5ZH 4S1SL 5DRZA 3EDFA 1FPTH 2YA0A 2D0HA 2OM5A 1ES0A 4HH8A 4TSAH 2P24B 3VXUB 2NCMA 2CK2A 3FQNB 5GHWL 4OCRL 1BHGA 3QUKA 1BD2A 1BQSA 1U8KB 3I02B 4M1CD 4JRYD 4OCMC 3WXWL 4OCRH 3QIWD 3U7WL 4CU7A 3MV01 3WIHH 4BH7A 5FB8A 1Q38A 3TF7C 1F6LL 4KROC 4OD1L 1QLRA 1UKTA 3PDOB 2HH0L 1RIUL 3O4LE 4JQVC 2PTVA 5FYLH 1FZKB 2IC2A 1EX0A 1P4LB 3B9KB 4X4ME 3KYKH 1NC4D 4ZUUB 2OTUA 4CN4A 3KXFB 4NQCA 2QADB 5FYLL 1GHFL 5I1GL 1YEFL 5BOZG 4N5UA 1XF3A 3EUUA 4M1GH 2EH7H 2IG2L 5J3HD 2GJ6E 1GAFH 1KBGH 4PRDB 2AK4B 4PJBE 3QDGA 3KYNA 5CIPA 4LL9A 1U93B 2IG2H 5D2LF 4F15B 5E70A 4X5XA 4OCWL 5DD5H 3WE6A 2BNQE 4YQXH 4PS4L 4PP2B 2ESVB 5FIEA 3QHTC 1IT9L 1R3LA 5GJSH 1BVKA 1OAQL 1FBIL 4D0DB 2PO6C 4ZPTA 4MZ3A 1QLRB 3PDOA 3UJJH 5FA4B 1UXWB 1UC6A 2R2BB 1RK1B 3VFUA 3TCLB 4ZXBC 2EKSB 3DBXA 4MJIA 5J89A 3KYOB 1AXSB 4OZ4A 3L9RB 3B8SA 4G9DA 1U92A 4HX1B 2FJGA 1CXHA 1HSAA 2V2XB 3QQ3A 2IH3A 3PWJA 4KK8D 2DWDB 4HDIA 4K71B 4HWBH 2YRPA 2EDRA 4N9GB 4NSKB 2ATPA 5GZND 1AGEB 5ALBH 1F2XK 3CFCL 1LK3L 4DJMA 3O6FB 2PW2A 3CNKA 3GJEB 5BVPH 1W0YT 5E00B 2F19H 3F5WB 3W11D 3UO1H 5I75C 2ZSWA 3U6RA 5HD8C 5I1AA 3IRZA 2AXFA 1QKZH 4ZFOB 3MV9B 5IW6A 1BWWA 3D39B 2AK4D 2ZCHH 5HHPB 1PAMA 1K4DA 4Z7WE 4UTBH 1WBXA 4YHKH 2NY6D 1MFNA 4JGJA 3DXAB 1HE7A 2ADIA 1U92B 4HX1A 1ITBB 1EA9C 1BFVH 4DEPC 4X9IA 1FIGL 5ACMA 3CDCA 3MV11 4M7LH 4KK9D 4KTDL 4Z78A 2AJXH 3UTSA 1BBJB 2DWDA 3V6OE 5T3XE 4YXHL 2R1YB 1ZA6B 1HI6A 4U31A 5I1DA 2QHRL 2ITDA 3LQZA 2W9EL 3OKLB 4XB7A 3OGCA 1T66D 1CD0A 4FQLL 3EZJB 3MZTA 2QHRH 4RMSA 1MRFL 4RFEA 2YC1B 3NH7L 3DETC 1Y6KR 4XXDB 4GXVH 3L5WB 5ISZA 4LCCC 1WFOA 3QEQA 1I1RA 4KV5E 2CUMA 4ODXB 4OT1H 2YXFA 4BJLA 4X9GA 5B4MC 3NPSB 3MRCB 3THMH 2H8PA 3UROR 3OMZA 1VDGA 4KTYA 2I26N 5HPMB 4CMHC 1WFUA 2EE2A 2BNRD 5EBMB 4G9FD 4Z7UF 2FEEI 5I8CA 2EYSB 3MJ9A 3O9WB 4ODBD 4K94C 4C56E 1FSKB 3RUGA 4WY7L 5I1DB 3KS0J 1H3PH 3P2TA 2BOBB 4XWOD 4AG4H 2VDNL 1EJOH 3QA3B 2K7QA 5CJ5A 4PRHA 5AUMB 1QYGH 1TJGH 2X7LA 4IDLA 3UPCA 1IGCL 3S97C 3NCMA 2X4UA 3I3DA 1FNLA 1RSFA 4CNIA 4HIJA 4K3GA 3DUSA 5D7IB 5ETUB 1J8HD 5IB5A 4TOYH 3ZYIA 4DKFL 1XCTA 4HC1A 4LASL 2DJ4A 2CRYA 3MQIA 1FRGL 3TA3D 2FYYB 3ZDYF 1QNZL 5BRZD 3MYZA 3KAAA 3CGTA 4FP8L 5LAXB 2AJUH 4OD2A 3IAPA 5DO2D 3RL2A 4Z7VB 3BKML 1LO0L 1TCMA 4KK6C 1U8JB 4JG1L 2HT4C 1U3HB 1BQUA 1RV6X 4P5MA 3V6ZB 3U4EA 1KTDA 1JNLH 2VIRA 1VHPA 4Y4FA 3BZ4A 4K23H 1EMTL 1H0DB 4J8RA 5CS7A 2IGFL 1UQSA 5ESAA 3ARPA 3BE1H 4H0IA 1LE5B 5FOBA 1Y18A 2WW8A 4R97B 1ZHLB 5GGVH 4X6DF 1WLHA 1SM3H 3GMOA 3I75A 5FKAA 3AMLA 3LQAC 2R1XA 4CNIB 3SGKA 4KC3B 3VXSD 1T0PB 6FABL 4NO0D 3MLYH 2VL4A 1PJ9A 4JZJB 5D1QB 2ITCB 4OGXH 1S9WB 3MV8B 2FIKA 5F44A 4KRMB 4NHUB 4F7MA 1ED3B 2CLVA 3L3KB 2NX5A 4RGOH 1T22B 4X6DE 3ILQC 3RWCB 5IM7A 4GG6B 5IR1B 5HGGS 2MJWA 2WBJC 3SE8H 5IROA 4H8WC 1OP9A 4LLYB 4Z7WF 1C5BH 2BOCB 1UKSA 3WUWG 1HYRC 5E8DL 3R1GL 5DT1H 2YD8A 3G04B 5IJKA 4HJJL 3TNNA 3SDCC 5IB2B 1IGTB 3CAFA 5E6IA 2OP4H 4M7LT 2ARWA 5KVGH 4HZLB 5K9QI 3VD7A 3RVVD 1CTNA 3I75B 5GGTL 1C08A 2E7BA 1NAMB 1UB6A 1XH3A 4PJEE 1JPFA 3FQWB 1LEGA 3GRWA 3WXVH 4QHKJ 1NKOA 2IPTH 2NXZC 3AY4A 3DGGA 4O58L 1H3WM 2EIZB 3PWLB 5IM7B 3RWCA 3SKUD 4U49A 4GG6A 5E95B 1K2DA 1JZ6A 1HHHB 4C58B 2XZAL 3GDBA 1NBZB 4H26B 3LEXA 5EWIH 2OQJB 2EECA 5TDOB 4NO0B 2Z92B 4QOKD 5C7XH 1S7QA 2R56L 3U0PA 3EJYD 3BHBA 2DYPB 4OV6F 4KKBC 1J8KA 4XNXH 5GS0D 1YJDH 1I4FB 5C0AD 5EO1B 3VXMA 1WISA 1UH4A 4BQ9A 3RWEB 3KYMB 4BZ2H 2BDNH 1I7TB 4N8VB 5EOCL 3HKFA 3AMKA 1ZA3A 4LCUB 1T0MB 3MA7B 3DECA 5DLMH 4NUGL 1AY1L 5JW4R 4LVOC 3LKOA 1HHGB 3TNMB 4OLVL 3BJLA 5E0QA 1AY1H 5DURD 3LEXB 4JFDD 4D9QE 2LE9A 3AGVA 2C7UA 5FUZL 5IMOB 2NLJA 4GW1B 5EC2A 1N2RA 1S7QB 2Q20A 4M6ML 4U1LB 3MRKB 2UUDH 4XCCH 2DYPA 4ODSL 4JR9L 4P0DA 3EO0B 1GGBH 3VWKC 3IDIA 3EOBB 2P5WA 1I7UA 4P23D 3RWGB 1ZT1B 1CL7L 4CVZB 3QXDB 4X5LA 2VDML 3T09A 5IMKA 4NN6C 1KB5L 2RJMA 3TT1L 2D2OA 4JY5H 5HJ3A 3ZHDA 3O3AB 5K9OA 4KKAC 4H1LB 2C1PA 3FQTA 2YXMA 1N26A 4M6AA 1LP9F 1XCQB 2MSPA 3ZYZA 5I76B 1ZOXA 2DD8H 1YEJL 5JA9A 2Q6WB 3KWWB 4LP5A 3PIQA 1KSRA 1DVFA 1A0QH 4IMLA 4FS0A 5F7DB 4G7VL 1YEDB 3IJHB 1Z5LB 3VFGH 4U1HB 1VGEH 5D1ZC 5GRWA 2AK1H 3CMGA 1DBMH 1E6JH 5KSAB 3H42L 3MRQA 4TUOA 2DMKA 3ARQA 3HE6C 3LB6C 4U2YA 3P0YL 3FQNA 1IGYA 3D1MC 4XPBL 4HUUA 1GXEA 4LLQA 3H9HB 4IJ3C 1T3FA 2P1YA 2J4WL 1ZVSB 4XH2A 4TTDC 4BH7B 1NC2B 4JPIA 3FRPA 2Z8RA 1KIUA 1IM3A 1VB9A 1XCQA 1YEGH 2CKBB 3BAEH 4QTIL 1T5XB 1CT8B 1G7HA 3BT2H 1DVFB 2X9YA 2NY4D 2Y25A 1YEGL 4QXTB 2ED8A 4G7YH 2IQ9H 4XRCA 4Y5YC 1YC8A 4U1HA 1LO4H 2FH8A 1GC1L 3C6LD 3G5ZA 4PJAA 2YD2A 2AXGB 3JSSA 2ZOKA 1YJDC 3QUXA 4KMTL 2YKLL 2AQ1A 3KYNB 4XVJL 4OZHA 4KUCF 2J3SA 4PRIA 3AVEA 2O5ZL 4GBXC 3WIHA 4BQ6A 4AH2B 3BH9B 4PRBB 3U36A 5JW4N 1G7QA 2HMID 1LD9A 5GHWH 3T77A 5F97E 1KN4H 3ARUA 4X6CA 1JWUB 3V4PH 1ZTXL 5FA4A 3U7WH 5FHBH 3DXAE 4HMDA 3UTQB 1G7HB 4OD1H 2DQUL 4KTEH 3MRMA 5SWZE 1RIUH 1AP2A 3V4PL 5IGXH 3MCG1 3LS4L 3T1FB 3P30H 4LVHB 3INUH 3EOTH 1P7QD 3F7RA 1KENH 1WITA 1QR4A 3T0ED 1R3IH 4OFPA 3FOMB 4QOKB 1DBBH 1RZKL 2PO6A 1FVCB 4N9GA 4AM0A 4DKEH 1RHHB 5DHVH 3NCYP 2XTJB 3MC0A 1HSBB 1UCBH 5H2BA 2R8SH 3O45A 1HQ4A 4Y5XA 1LEIA 4G8IB 5I1HH 1QD0A 1EO8H 4X4YB 4IIQB 2OI9B 3HPJA 4WU5A 2GK2A 3O8XC 5GSVB 1CLCA 1AFVL 5ADPH 2B0SH 1QBLL 3E8UL 3Q5OA 1YEHL 3RP1A 5DQ9B 3JTTB 1ZT7A 1QBLH 3ULVE 4I0PB 4F9PC 2NY6C 3DIFB 3UDWC 2XACC 4HPYL 1ZA6A 4JKLA 4OM1L 3ARBD 1Z6JT 1M7DB 5D7IF 3WFHA 1EZVX 3OKLA 5B8CA 3QWOA 3AAZA 2R2CA 1F4YH 2XA8L 1A4KA 1FAKT 2F5AH 3T0EB 4KKCD 3MCLH 5T1KB 1T20A 1WV7T 4YBLC 4IRJA 1U8OA 2DOCA 3UO1L 2XWJA 1LP9E 1DANT 1NCCL 2X4QB 5CD3A 5BQ7B 2C1OB 1OAZL 4LRNH 4BM7A 3G5XA 3LSOA 3ULVH 3NA9H 3VD5A 1FGNH 3O4LB 2LTQC 2OXHA 3V0AC 4YX2H 4XC1L 3VFPA 3QRGL 1OAZH 4UTBL 4YHKL 4LSUL 4GAYB 4JN1L 4PRNA 4GT7A 3RWFA 4JGUA 4JKPL 2JJSC 4OFYD 5EZJA 4LSUH 5JLZB 4P2QB 3ARGC 1T04A 2J12B 3LPWA 2VDKL 3MLRL 1PBYA 2FCBA 3OR7B 3GB7B 4OLWL 4MLIA 1QSZA 4JPVH 1QA9B 3EYUH 1TLKA 1XT5A 3M1BB 3QA3A 2R1WA 3WO4C 3GFUA 1JK8B 5ECJE 3BYYA 2E9IA 1F3RB 3C08L 3HUJE 3HG1A 4PJ5A 5INDB 4EIZC 5BQ7A 1OHQA 3IFLH 4JDTH 4OUUB 3R0NA 4KMQA 3G5XB 5FCSH 4GKSB 4P23C 4U1SA 2MCG1 5ETUA 3SQOL 3IDXL 3MV7E 1UVQA 4XP6H 3VGAC 4KVCL 3RWJB 4NN6B 2ADJB 2Y7QB 3HNSL 5E1HB 2FYYA 3RU8L 2BNRB 3HMWH 3GSWB 4U0QB 3HRPA 4GLRI 5I18H 3S7GA 5ACZB 5KN5A 3TN0B 4K3EH 4XCFL 1MCWW 1A7BA 5CJ8A 3T3MF 1A1OA 4X6FB 4U1IB 2J7LA 4KAQL 3U1SL 4JKWA 3RU8H 2EEDA 1G7JA 5C0CD 2CRZA 5FUCC 2FO4A 4GS7C 4PV8B 3WLWC 5HY9B 5J1TC 1KNOA 4DZ8A 4XP9L 1II4E 3ZKQD 2CIIA 1UWGL 1YY9D 4MJIE 5KVFL 1MCKA 3H7BA 2FATL 5F3HA 1JK8A 1BZ9A 2APXA 3MXVL 1NGYA 2X70A 2YZ8A 5CEXA 5DYOA 3GMOB 3PNWA 4LEOB 4OUUA 1WIOA 3TLRA 3U0TA 1JWSA 1CYGA 1KELH 3MXVH 2E9JA 1ZHKA 4X9HA 5I1JL 4XAKE 3EDJA 2QR0A 1BJMA 2ITCA 5HGHA 3ULUH 4N0CC 2FIKB 4OFIA 1OAXL 4QF1B 1MLCA 3EO9H 2LVEA 1A2YA 1MREH 2Y9RT 3GNML 3IYLW 4G3YL 4I4WA 3DI3B 3RZCD 3P4NB 1TCRB 4FP8H 1B3JA 2Z91A 1G7PA 2VXUH 3V4VL 1C7TA 5EO0B 3S3SA 3SO3B 5MEOA 2YD7A 3WD5L 1MRDL 1BF8A 3CIQA 2VITA 4QXGH 2AGJL 5GRJL 4G8EB 4Z8FL 1OF2B 1GIGH 5E8NB 1MRDH 3FT3B 2R15A 3F7YB 4U1GC 4LEOA 2WWKT 4K23L 4OGYL 1A7OL 1IC7H 1R6VA 1OB1B 2N4IA 1B6DA 2X5PA 3C5SA 4OZFH 5D1ZD 1XIWA 1QSVA 2D4FA 4IS6A 4F9LA 1MLCB 1SYVA 3K3QA 4K7PY 1JF6A 4F80A 2JB5L 4JRXE 3QHZH 3TN0C 3UX9B 3SHSA 3L3OB 1MHPL 1PYWA 1TCRA 3CFJA 4OZFA 1EFXB 5BV7L 4NO0A 4U1KA 1ZSDB 1I7ZA 2GJZA 2H9GB 3LZFL 4I0CC 3UBXB 4JZOA 3VXUD 3MZGB 3FO0L 1DBJL 2CPCA 2VITB 2XZCL 5T1DL 3QPXL 1VFMA 4QTHB 1T21B 4NBZB 2BSRA 2UYLB 3BQUD 5LXGL 4ONFL 4HWZB 4JRYB 3VXMB 3O3DA 2R0KL 3ARGB 4MB3A 4HXBL 5IVXB 2D0FA 2WLZA 2ZKHL 4J12A 1ZMYA 1E4WL 4RQQB 1MJUH 4JJHA 1T0MA 5F9WB 1DQDL 3STBA 3ULVD 1I8LC 5HI5C 1QZ1A 3C5JA 3IU4H 3RPIB 3TNMA 4HK3N 1MJUL 2FNBA 1NBYB 2FSEA 3O3EB 1AGCB 2E7HA 3BKCL 3L5JA 3QUZC 3NPSC 1UYWH 3KJ6H 3GJFK 3MLTB 4QKXB 1JZ2A 3HC3H 4L9DA 5JHLL 4P2QD 1LMKA 5L7XL 4AJ0A 4L4TB 5F9WC 4LPUA 4OCSH 3HC3L 2Y06H 3G9VA 3NIGE 1CDCA 2J8UB 1MF2H 1J1XH 3EOBA 4OKVA 5FGBA 3L5XH 1GGIH 1A5FH 4ORZC 4Z18A 2CDEB 1F11A 1J1OL 1YECL 3WS6C 4A2MA 4TSCL 1CLYL 3REVA 1GGIL 2FB4H 4H1LA 4HEME 4IRZL 4ZODA 3HPLB 1W2KT 3TEUA 5HPOA 2ORBH 5CJQL 2VKWA 5IESL 2RAMA 5I76A 4IRZH 3D39E 4XNUL 5FOJA 4D9RD 3QRFM 2BERA 2ORBL 1MCOL 4LLMA 5HGAA 3TH4T 4X4ZA 5BOPA 5DJ2B 3V5DA 2BC4A 3VGBA 4OB5L 5C0CB 3D69A 3QNZB 1IGJA 5ILTH 2ZUQB 1F4HA 3EYQD 4X6EA 2Z31D 3KPNA 3MOBH 5BO1L 3CU7A 1IC4H 2EC9T 3X3GH 4P23B 4PP1D 3BISA 5AZ2H 2NW2B 5FO7B 4QHNA 2AXHA 5MHSE 1F11B 3P4OB 2C3HA 5B21A 3EIFA 2Z31A 2APFA 4HMEA 2PTTA 1J0YA 2CQVA 3MRLB 1AKJD 1X6NA 1LVEA 3DXAD 5FYLE 2ZG1A 3TT1H 4NO3B 3QIUD 1ZLUK 2P47B 4HQQH 5F1NB 1R24B 1U8NA 4B7IA 1IZKA 4N0RA 1M1SA 3BWUC 4HWEH 1UM6H 2W65A 3FT4A 2I5YH 2F54E 1A0QL 3HTLX 5CINH 2P5EA 1ODAA 5KSVA 4ODTL 5IEHA 2OJEA 5GIRA 4FQJL 1VGKA 4U1JA 3JTSB 3ABZA 5D7JA 3QB7C 4K8RL 1QFWI 2ZJSH 5LWYH 1G7QB 1N64H 1LD9B 3IAQA 4CMMA 3DO3A 1A6ZB 1O0VA 1DCLA 4MX7A 2F53E 4OFKA 4EEEA 4G6AC 5AAMA 4P9HL 4B0MM 2QADC 1AQDB 5DFVC 4X6CB 4Y5YA 3SDXF 3MLWL 5I1LA 3J8F7 1J9CT 4RFOL 4UU9B 3B9DA 1V3JA 1Q0XH 4TPRH 1N7ML 5E2TH 4H0GA 4U6HB 1M6OB 1TQBC 3LKSA 4OCXL 4XAWL 1VFUA 4EUPA 2ED9A 1FHGA 2NY4B 2XKNB 1CL7I 4P3DA 4GBXA 4TPRL 2XG4A 5I73B 4X6BB 1E0OB 2V7HB 4KK8C 2DBJA 3JV5A 3BFOA 2IBZY 1CFNA 4P2OD 3UBXI 4PJDF 4PJ7B 4PTUA 5EU7E 5ITBL 2DDQL 3H8NA 4Y16A 3VWKD 3R06A 4KQ3L 2R0ZL 2DLHA 4Y19D 4MXWL 4XP4L 2FLRT 2FRGP 2GTWB 2VC2H 1HZHH 1JGEB 3E3QE 4P5TC 4XPGH 2XNAB 2X89D 4GAJL 4M3KB 1P7HL 3O0RL 4D9LH 2FJHB 3EJYC 3T65B 1CE6B 1ERNA 3JV0A 4KY1H 1HXYB 4HS3A 1BD2B 4X4YA 3HPJB 5EB9A 1GZPA 2HLFC 4KU1A 4P4KA 1EHLL 4BKLA 4E5XA 5D6CB 3P0VL 2ZCLH 5IB3A 4X98B 4K2UH 4PJBF 4KJPD 2W91A 3DRQA 4LARH 4XCNA 1U3HD 3LN4A 4KFZC 5MHSD 2V5YA 3GZKA 5DRNA 1U8QB 1IRAY 4I8DA 1OT1A 3S5LA 5D7LE 5HHME 2CR6A 3IETB 3TJHD 2X4NB 2FD6H 2QSTA 3QWOB 4RMQA 2BY0A 2GTWA 1BZ7B 3GSVB 2F74A 2JKXA 4JAMB 1KTLA 3PWPA 1A4KB 2X89A 4B53A 4NQDD 3L1OL 4Y4FD 4YGAB 4C54A 4M4PA 1VFOA 4LCWE 1Q9KB 2YPLE 3QPQC 2A6IA 5DC9B 3WNMA 1D6VH 4F9PA 1BP3B 2I25N 3PWVB 2HLAB 3UDWA 2KDGA 4C83A 5IKCB 1MAKA 4G8FA 4UDUB 2ZWLT 4I18C 1UJ3A 1PLGH 3B6SB 4FXGA 1YEIL 3MRFA 4MAYA 5C0IB 1FFOA 4DVBA 1OWWA 1BFSA 3F58H 2B0SL 2VLME 2ZUUA 4GRLA 3SQBA 4MDJA 2RBLA 1YEHH 3GSQB 4S10A 2ERJB 3JWDL 2BRRH 4OZGA 3KXFD 5HYQB 4DOHB 4FABH 3GB7A 5C6TL 1DLHA 1FL3B 2ADFH 2IH3B 3PWJB 3SE3A 1YMMD 3N1MC 1A02N 2BRRL 2EIBA 1JHLL 3ARBA 1KEGL 4UV4L 4NSKA 2ATPB 1OAYH 1BQLH 4NO5B 5JOFB 2P45B 2DQIH 2VQUA 3WKML 3MOQA 5INDA 1G6RA 1RVFH 3HZYB 4GKOA 3F5WA 4UQ2A 2HLAA 3BSZL 1AKJB 1URLA 4JB9L 1J5OH 5HGBA 3V52H 4ZFOA 3ARDD 1NGPL 5FHAL 5GS2H 4FXGB 4YK4C 4LCIH 4ZSOB 2VLJE 1RJCA 4LAJH 4NZJA 3UPRA 5EFIB 5A2KH 5EBWA 3VI4F 4IRSD 1JV5B 4NHCL 4APQA 1G9ML 1MAML 4LKCB 4HT1H 5JNYB 4Z9KB 3HHRB 4PV8A 5HHMD 2DQFB 1DLHB 3UTSB 5I66A 4BQ8A 1MQKH 3EYSL 4H25B 2BJMH 3QDHA 4EOWH 5HVHB 3HLAB 4JGMA 3TWCH 1DQML 4OLWH 1HI6B 1UACH 4QRPB 4NCDA 5INCA 2VAJA 4NO5A 5JOFA 2VE6A 1EGJL 3LY6A 2GAZA 3VXOA 4HGWB 4LNRB 1E4XL 2VLRA 1AI1L 2R69L 1NLBL 1H5BB 1A3RH 3FRUB 1K4CB 1PY9A 5DURB 3WDJA 5EBWB 2OR9H 4GRWE 1IMHC 5GS0C 1U9KA 3M8OH 4I4WB 1R5WA 5CGYD 4EN3B 2D9QB 2BHYA 5HPMA 1BAFH 5IBTL 1YYLL 4CBPA 1PG7L 3GI9L 1QFUH 3N06B 5AAWA 4JJ5B 3RJDA 4AT6B 2K7PA 3QIWC 4ELKA 4IDJL 5IBTH 1PZ5B 1W72B 4HULB 2YD9A 2IADA 5LCVL 1TTUA 2A77H 5TFSL 1VEPA 2ID5A 1QFUL 5JPNA 1CE1L 4LHUB 2R2HB 1W72L 2W59A 3VXOB 1KLGB 2EZ0D 4PJ7F 5B39G 4WI2A 4ZDHB 3HS0A 5DJCA 1H5BA 5KSBA 3FRUA 3DOSA 2HAZA 5CGYC 5IB1B 3S4SG 2DBLL 1X5YA 4HIJB 1O7VA 4WNQA 3VXNA 5C0RH 4OZHF 1DSFH 1TZHB 1KCLA 2IPUG 3KJ4C 5K9JL 4FOMA 3I6GB 4PB9H 5EA0H 3RZCB 3VFMA 4U1KB 5L6YH 1AGDB 1E4KA 3T2QA 3EYFA 4NKDA 3OV6A 3KPLB 1IAKA 5DQJA 1WBZA 4EI6B 4L4VD 3EOYG 3GMMA 43C9A 2IBGA 2Z93A 1U8JA 4WUKH 3T2PA 2DI7A 2YS4A 4XNMB 5DUML 3MO1B 3EAKA 4N1CA 3FZUC 4URTB 5FK9A 1OTUC 3B9AA 4GKZA 3W2DH 5C09A 1EZVY 1QSFE 1OAUL 5KSBB 4NKQB 4OGYH 2QEJA 1CFTA 5CCKL 5IB1A 4UT6H 5JQ6L 2R1XB 5DEGA 4PD4K 3VFOB 3UCRA 3NCYS 1JVKA 3S37X 2LV4A 3ARXA 4OV5B 5E8EB 3C6LB 4JFQA 1HYSD 4WEBH 3IF1A 4YO0B 4JY6A 1V7NH 2Z4QA 2J2ZA 1T22A 4JRXA 3W11C 1TDQA 4HW6A 1D5BA 3ULUC 5LBSL 2RFXA 2O5XL 5DD3L 3FOLB 4PV9A 5TH2A 2FECL 4NZTH 4JVPA 4HUWB 4NNXB 1INQB 4X7FC 2O5XH 5DD3H 1MFEH 3RBSA 4WTZA 2R0WH 4HZLA 2R4SH 3BWAA 3HNTH 5I1KL 3LEYH 1DUYA 4M03A 3HPLA 1AGFA 3DVIA 3U7YH 3VXRB 4HKBB 4QRTB 5DJDA 1DQDH 1FFPA 5E8EA 1CGSL 4LAQL 2GEEA 5D7LD 1IAOA 3PHOA 1XF2A 3NCCB 2GITB 3FAWA 4ZUWB 1H8NA 1XAUA 2OYPA 3KLSA 4FXKB 4POYA 3BKCH 5GGRB 5JORA 4XBGB 3NFNB 4NQXA 5IJVA 3WS6A 1I7RB 1TPXC 3BH8B 3DHJA 2RFXB 3K2UH 4JFEE 2WINB 1A6UL 4JFPB 1I9IH 2HLFD 4HUWA 4NNXA 3FQUB 1OPGH 2VWEC 3X3FH 2QSQA 3LQMA 4MAUL 1G7LB 3CFBA 2AJYH 3CH1B 1TQCB 2PR4H 2ICEB 3BVNB 3FN3A 5F8QC 4M6OL 3U79A 3PL6D 4JM2B 3IB4A 5HTSA 3KS0H 4YXKL 3RWEA 3CK0H 3W5NA 2CKBH 1DN0A 1CLYH 3STLA 2Z8WC 3ZMRA 1C16B 4YAQB 4LCUA 3OJMB 4NJ9L 5TDPB 1LWRA 3CK0L 4HBCH 4QWWD 4RAVB 1CGXA 1RUML 1FSKC 4XNZC 3SN6N 2Y5TA 4OBSA 3SBWA 43CAB 4E42B 3MJ8A 4U1MA 4OF5A 1IAIL 2NY7H 4GKNA 5D2NA 4PGCB 1I7RA 12E8L 3D85D 1NCAL 5C3LD 3MRHB 2DB8A 4R7DA 4X4XB 5BMFL 2VXTH 5D7JB 3NFSL 5CGMA 3FQUA 4ZTOL 4EVNA 1TMCB 2EEBA 1HHIA 2XQBH 3P4MB 4CMMB 2J8HA 3N9GH 5BMFH 3B3IA 1Q94A 3HUJF 4ELMA 4QRRA 3HUJA 2V7NB 5C0AB 1A7QL 1MI5E 5DFTA 2FBJH 4Y4KC 5IMKB 3RAJH 2VXVL 1L4IA 3JWOC 3TO2B 1I9JH 3O2WL 1FL6B 4JFDA 1RAMA 3RIFK 1NANH 3HZKA 4D0CB 3PL6B 3PJSB 3DX6A 5I6XC 1JNNL 2BX5A 3L3DA 4KKCC 5ESVA 3WFDL 4PGCA 3BPLB 3X12A 3FN9A 2DYPD 2H45A 1QVOB 4GSDH 1FO0A 2AI0H 5SX4H 4PTUB 2B2XH 3N1PC 1NCDL 2AABL 5EUOF 3J7HA 4TUOB 4WTWA 4PUBL 5JR1H 2GTZB 4LVNB 2ATKA 3DYPA 4GO6B 2AQ3A 3E3QC 4P46B 2D7QA 3FN0H 2OSLA 4HUUB 3HI1A 1X5JA 1HXMB 1NAKH 3S4SA 3KPTA 3TA3A 1FL5A 4RGMB 2J6EA 4PJHB 3SE4C 5DHVB 5DR5L 3QQ4B 2ZOLA 2PXYA 2J5LB 2NTFA 1KYOK 2A6KB 5CUSL 1MCLA 1S7RA 2PNDA 3H9SA 1VADA 4TUKL 3QUMA 3X12B 3B2VL 5BS0B 4Q6IA 5J4MA 5C9JB 5CZVL 4ZPVB 4E0RA 2ERJC 2RB8A 1YNTB 3VI4E 2HN7B 4MMZC 3WLBB 3GMLB 1P2CB 5JPMA 3OKNB 3K74B 1MFBL 3QUXB 4KPHH 1QRNE 3LKRB 2KBGA 4R26H 2OZ4L 2MMXA 2KZWA 5HGDB 4F15C 1N4XH 4WW2F 1MFCH 2A6JA 2JJVA 1KXQE 4DTGL 1ZEAH 3JV4B 4HFWB 3RVUD 2A6IB 5GZOD 4BSJA 1MHCB 3UZEA 1BJ1H 5IKCA 1NDGB 4UMGA 3RTQD 3MGTB 1JWUA 2PXYB 3DMMC 2I9LA 1IARB 1U58A 1IC5H 3SGDI 1KPRB 3QUMB 3U7AA 3IKCB 4BZ1L 1JIBA 5KVDL 4G5ZL 4NQCB 4N0UA 5GGRY 4BUHA 4R0LC 5E2VH 4FMKA 3S3JA 1YUHA 4JE4B 5M95B 2N56A 1B0WA 3BGFB 5JPMB 3ULVC 3CMOL 4K7FA 5D5MF 2DQDL 3AREC 4UT7H 4UUJA 1U2CA 3QCVL 4RWHA 4NWTH 1W8NA 1C7SA 4HS8L 1DBKL 1UWEH 1HNFA 4M4RA 4WW1A 3O3BA 3HZYA 5DA0B 4WRLA 3ILPA 3HMXH 3A6CL 2Q87A 1MHCA 1OD9A 2ENYA 3BZEA 5F1IB 3UTPE 2DQGH 4Y5XB 4GW5A 1J05B 1U58B 2HVJB 3MJ9L 2FDBP 4QRSA 5E9DE 1UXWA 5D93B 5EZLA 5IEKB 1YPZB 2XTJC 3VFUB 4JFFB 4O02H 3ULSA 2D0GA 1M7XA 2GSIB 1MI5D 3PHQA 1YEIH 3CXDL 5DUBB 4DN3L 5CBEB 1WT5C 3RX7A 3TFKD 1FO0H 1TZIB 1HKLH 2NW3A 1CBVH 1QLEH 5L2KE 1OSPL 2V6HA 3WNLA 4R4ND 2DQFA 3B9EA 4TUJB 4Y0GA 3MREB 4K7FB 4PRAA 4HDIB 4RZCB 3GHEL 4BA8A 1IKFH 3HLAA 2PYFB 1EERB 2A0LC 2FHFA 3RJQB 1C8PA 1M7DA 1BOGB 3ZDZE 1PKQA 4ZO6A 1JHLH 4CGTA 3NFPA 1LO3H 3P73B 3KLHD 1JMXA 7FABH 2H32A 4HAFA 2W0LA 4ODUA 4KZEL 2AXFB 5T1KA 1NBVH 3QNXA 1PQZA 3IU3B 5EBLA 3DO7B 3QIUC 1J05A 2HVJA 4QRSB 5EZLB 1K4CA 5DO2C 4N0UE 1LEKB 2OI9C 1S8DB 3RTQC 1YN6A 5CD3B 1TFHA 3FB6A 4KZEH 4IHOB 2GSIA 1K5NA 1QPPA 5E6YA 1FC2D 1CG9B 3C60C 2YPVL 1F58H 4F2MA 1MIEH 1ZHBB 3C9NB 3D85A 3GGWB 4KUCD 4Z5RA 4M5YH 3HC0B 2NX5E 2BHZA 1G9MH 2YSSA 4RCAA 4DW2H 1QRND 1NGQL 1DFBH 5JLZA 1FNSH 4YGVB 1U41A 3NAAL 2CLRA 1D5MA 1ZT4B 2OL3H 4LHUA 1MHHB 3NA4A 2DRUA 1IKNC 3LRGA 1NGQH 1QA9A 1HQRB 1FNFA 3K8MA 4XCYA 5CBAB 3RPKA 2AV1A 4M62L 1AE6H 3QEQB 1R0AH 2XTJE 3FB6B 4NC2B 1E4XH 3F7QA 2ZG2A 2SEBA 5C0CE 4YPGA 2VLRD 2NY1B 1HEZB 4M6NH 4OD3L 1CF8L 1NPUA 2OR9L 2F53D 5J1AA 1AGDA 2BXYA 2B5IB 2EXWD 3HC0A 4AENB 2YSSB 5ACZA 2VMFA 4KH2A 2MKLC 4D8PB 3V6FB 1M71B 5HSFA 3GMMB 4M7ZC 4NGHH 1N0XH 5IW1B 3IJYB 1G7JB 3VI3E 4MJ2A 4V1DE 4OLUH 4DZ8B 2MCPH 2CIIB 1EXUA 3RGVA 2F53A 1NAMH 3FHQA 5ALCL 5IWLC 4FQ2H 1CE1H 5F3HB 1MHEA 2VUYA 5C6WH 1E4KC 1REIA 4FQCL 2VXQL 3RGHA 4FQ2L 3U0TB 3D2UA 4MNQD 3T0XA 5HHXL 4XPHH 4H5SA 5ANMA 4OI7A 3MBXL 3LRSB 4IRSC 2ZUWA 1OM3H 1IZJA 2XN9D 4RFNB 1NMCB 5BZDA 3ARTA 4ZAKA 4K7PX 2M8XA 4OJFH 5EUOE 3SGJA 1I1AD 2W9LA 3SDYH 1QO3A 1E4XI 1B6UA 1A9BA 3TPUA 4AIZA 4JRXB 3DVGB 3ZHLA 4GRWH 4JPKL 1F4WL 3FB7B 2Z9TA 3P4NA 4OLXH 5LVEA 3FOLA 3SGDH 2M26A 1EXUB 5TF1L 3C09C 3RGVB 2FR4A 5DI8A 2F53B 5JW5A 3R8BB 1NUNB 1V3KA 3ULUD 3SY0B 4G8EA 5IVNA 2I60H 2XI9A 2VYRE 1RY7B 4NNYA 1GHFH 3WNPA 5AYUL 1YY8A 1X5XA 4NQCE 2I60L 5F8RC 4EBQL 5IF0A 5GGSB 5T1LD 5CCKH 3PHSA 4HXAH 1JTPA 5D70H 1CZ8L 5KTEL 1QBMH 4LIQL 4PG2C 2NX5D 1JPSL 5J13B 1U3JA 3BMVA 3SDAC 5GGRA 4LSQH 4BFEA 3OKMA 5BS0E 3L3OA 2JJUA 1A6VH 4MXQC 5E2WL 3D87B 3VXME 5IIEA 2J88H 4JPWL 2BVQA 1AHWA 3BEVA 3D3VD 4Z7VF 1S7UA 4GG8A 5ID0A 4TRPH 3QXAA 5DI8B 5C2BL 2MFNA 1OOAA 2Z35A 5IB2A 1IGTA 1QQDA 5T3XL 1BD2D 1JHTA 4JRXD 1IE5A 3C5ZB 2APWA 2J8UE 1ONQA 4P57A 1KJMA 3CH8A 4XVTL 1QPXA 3O3DB 3STLB 4UAOC 1JUFA 2EDQA 1WCBA 4PJXA 5EC1B 4UOW0 3WN5B 3WL9B 3LV3A 2EE6A 2ENSA 1SJVA 3C5JB 4KROD 1C5CL 3O3EA 4QNPF 2R4RL 3ECBB 4YZFF 2Z92A 1HK6A 3OBAA 4JG0H 3DYMA 1KIPA 4QY8A 1Y6NR 2HYMA 5EIVA 3QXAB 4RX4A 1UGNA 2D7TL 2DTML 4HLZG 1F90L 4N8VG 1T2XA 1I9IL 1S9XA 3JV6A 1OPGL 3QDJE 2QV2A 2G2RB 3C6SA 2QLVB 5GS3A 1T2QH 3GRWH 4OSUL 1NGWB 2AJXL 5KSUB 2NR6D 3MODH 4FFZL 4LCWA 5F70A 4YXKH 5GRUL 1FL6A 4JFDB 3PXJA 3GSRA 3QDMD 5DJYB 5C0AE 1AD9A 4Y2DA 5J6GA 4K3DL 3HZKB 4D0CA 1NDMB 4OGZA 3TIEB 2A74B 4V2CB 3QHFL 4TN9A 5F96H 4QHUA 3TYFB 3T3PF 4FQXA 3F7PC 1QVOA 2FEEL 4NZRL 3I6KB 2HFFB 2FEDC 3L7EA 1IAIH 3CSPA 5F21B 4PYGA 4IEFB 3DVNA 3VXMD 1OWRM 2Q76A 1VPOL 2CUIA 2GJ6D 3BN9D 4MA7H 1NCAH 2NY2D 4S2SA 2GCYA 4GW4A 1S9XB 3F12B 3JV6B 4PLOB 2X4PA 2P7TA 2Y5EA 4ZTOH 4HCRA 3UYRL 3O9WC 3AROA 3M17B 2ARJQ 3I50H 3QXDA 1CXEA 2DLEA 4NT6B 4PJXF 3BDXA 1HXMA 1IILE 3LPGA 3N85L 4R3SA 3VE0B 3MJ7B 5K9OB 4PJHA 2FBJL 3PG2A 4MDIB 4Z7UE 1H3PL 5F7YC 3O8XD 1S7RB 4F7CB 3GHBL 4NM8H 1H3XA 2CKNA 1FYTE 1NFDB 1X3DA 5HHMB 1NFIB 1FFNB 4PBXA 1FGVL 4OZHE 5F7DA 3BGMB 4F33A 1YEDA 3IJHA 1VKXB 3FO2A 1FG9C 1ZANL 3GHBH 4MD4A 4NM8L 2YUWA 3DTXB 5GGQL 3WLBA 1RUPL 1P2CA 4GW4B 5CKGA 3TA3C 3F12A 5L88L 3IDMB 4ZUTB 4PJ7E 2KH2B 5DTFA 4LASH 3U4AA 4PJAE 4A6YB 2QTEA 4MX7B 5C0EA 5DMIL 4HC1L 4L4JA 4EQ2A 1VACA 4OQTL 4GMTL 2C4XA 3AU1A 3LKNB 4LLVA 4XWGL 4NQEA 5C0DA 3RA7L 2YN3A 3SGEI 3BZDA 5FO8B 2O93L 4GMTH 3S88L 4U6HA 2KZ1B 4Y2OA 1AXTL 1Q1JH 1OL0A 3FMGL 5L2KB 1MFAH 3UZVB 4CUCA 1QR1B 2OR7A 4K3JH 4O00A 4X5WB 5CWSB 1AQKL 4ZS7H 1FPTL 2AXGA 2PYEA 5KSBF 4PR5B 3AS0A 5CZVH 1SVZA 2BSTB 3D3VB 2DQEL 5J3HC 5TDNA 4UNUA 4LPVA 3DMMA 1F3DJ 2YRLA 4WW1B 1A9EA 3B5GA 3VXQB 2LU7A 1JGEA 1RUAL 3DBXB 1YYML 4YBHA 5F1IA 5DMYA 1CE6A 4N0YL 1H3VA 4G9DB 3IS1X 4PJ8C 5C07D 4Z0BH 2K1MA 5H37H 1QSFD 4ZO9A 3FQRA 4QOKE 3QUZD 2O5YL 3LN9A 3UZQA 3PHQB 1YEFH 5D7IE 4R90L 5F6IB 5TE7L 4ELME 5KVGL 4E41D 3C60B 3FB5B 4XPTL 1SBSL 4X5WA 4JCMA 1OLLA 2ARJA 2EC9U 4NM4H 1KN2H 3Q3GB 1Y6MR 5J9PB 1EHNA 1A7RH 4PR5A 4R90H 5TE7H 5ADOH 1HDMB 1N6QL 3EGSA 3MRJA 2PO6B 2AJZA 1WAAA 3G6DH 3D39A 2X4NA 1WZLA 4XNQB 4UT7L 4GAFB 3S98A 2I07A 1CXFA 1K4DB 4LLAA 5JUEH 1KB5B 1WBXB 1F42A 2DKUA 1WT5A 3LMJH 1KJ2A 1DZBA 2V2WA 2ADIB 1RZJL 1OQOA 2AJ3A 2C3GA 4POZD 2EO1A 5JUEL 5E6IC 4A6YH 3CSYA 4DUXA 2NY6B 3PWVA 4Q7DA 1XF4B 3TZVB 4P2OB 3QZWG 5DD6B 2OJZL 3OXRB 4J4PC 1RFDH 3KPMA 3QIBD 4HUKB 2VZVA 3ZSTA 5A43C 1S7VB 4YDLC 1UZ6E 2P44B 1D6EA 2MQ0A 4ESKA 1INEH 1V3MA 3PP4L 2AJZB 4L3EB 1IL1B 1ULVA 2VLLB 5L8JB 2V5TA 4OZGB 1FDLH 5DEZA 4F7EB 4E41B 1MHHA 2DJUA 2DL9A 3OZ9L 4NC1E 4AMKH 4XCYB 1TJHL 3S5LG 2ICWB 5I17A 3TFKC 3QIBC 4NZUH 2VSCA 1NUFA 4GRWB 4YDLB 1U8OB 5BCAA 2YRZA 3QXVA 2F8XC 5I8CB 3BP4A 5GJTH 4BFBD 2EDOA 3F7VB 3OR6B 2X09A 4BSVA 2NXYC 5I6XB 1G1CA 5D1ZB 1K6QL 4JR9H 2OK0L 1RULH 4DWHA 1F2QA 4GAYA 4L8SA 5D1XC 3WHE0 3BDYH 5B3JF 4AIXA 1F58L 4JFZL 4NZDA 4LKCA 4LQFL 2QQQA 4W68A 1I9RL 5C0GB 1YN7A 4DQOL 3FTGA 3NH7H 4WVRA 4PB0H 3G5VA 4LQFH 4OTXL 4KDWA 5IB5B 1GGCL 1XCTB 1MHEB 3U82B 3NZHL 1NBQA 4F8TA 1FYTD 5EN2B 3VFGL 4FQHA 1UJTA 5DGQA 3BP4B 5LAXA 1L6ZA 1PX4A 2JB6A 3ZL4H 2CMRL 2Z0BA 4UIKL 4HIXH 2VLRB 2HT2D 4C56D 3K1KC 3TYGL 2BVTA 4BFIB 4FFYH 1MH5A 3A67H 1KJVA 1R3HA 3GKWL 4HIXL 3KLAB 3I2CL 3UTOA 5C1MB 2M1KA 4IIQC 3JZ7A 4N8CH 1U8LA 4KRLB 4P4RA 3NMEA 1LE5A 1YNLH 4UILH 5FOBB 2R29H 1GOHA 3HA0A 3MACH 4U3XA 1EJOL 4YHOL 1VEMA 5ACLA 5LGJA 4UILL 2BRQA 3VWJA 4TYUA 4ZFZB 4OIIH 4XMKH 1B0RA 3OKEB 5H94B 5ICZB 5DYOB 1NUGA 1D9KD 1JWSB 4OCLC 5GSRA 1ZHKB 3SDXE 5J56B 4S1SH 2EXYD 2X1XR 3LH2L 3MLPA 15C8H 2YKLH 3BUTA 3VGHA 2X42A 8FABA 5HGHB 4HS6A 1MY5A 2Q7NA 5I19L 1JYVA 2X4OB 5E6ZA 3OKMB 3WXWH 1P4IL 3Q48A 3KVQA 4EDWH 4P5KA 4YIQB 4RWYH 3K81A 3BEVB 4PREB 4K9EL 2WIIA 1IAKB 4KI5E 5DQJB 5DDHB 4FN0A 1GOFA 3OKOB 1WEJL 5F9JB 1K3ZA 5H94A 1JPFB 3FQWA 5TF1H 2XWTA 4PG2A 5I1GH 3SJVB 3DGGB 2EIZA 5TJWK 3QUXC 5F6IC 1DEDA 1HH6A 4PPTA 5EU3A 5T1LB 2IALB 5AEAA 3LVEA 1G6RL 1CDIA 1AHWC 1RD6A 2NY0B 3U46A 1FE8H 1QFHA 2VDQL 4LHQB 5DEGB 1LNUB 2XQYG 1JGUH 2DF3A 1N5AA 5DFWH 3C6LA 2YEZA 3PDGA 1IT9H 4U6YA 3MBEC 1ADQH 4XXCA 3QCTL 4YZFE 5GJSL 3T4YA 3Q6GL 1PFCA 3EJZD 1QSEE 3K46A 3QUYB 1DEEA 1BD2E 1JGUL 2QQKL 3SO3C 3UTTE 3AS2A 4PJIE 4X9FA 2C3WA 5CIPH 3VG0H 3MV7B 4WWKD 2NY0C 4HWZA 1N59B 4JRYA 1C1EL 3WIIH 3O41B 5IK3B 3LKOB 2OR8A 4LBEA 3IFPB 3QBTB 5A2FA 1GYAA 5FGCE 4MAYD 4QNPE 1C1EH 1S9KC 3VXSE 4FMFA 5LQBH 3BWAB 2HVKA 5MP6L 2IMMA 5DRWA 3GSRB 3KPRE 5HYSB 1LK3H 5C0FB 3HRZB 3RPIA 3FT2A 3FL7A 5CJXC 4PJFB 5HYJD 3PDDA 3STZA 2R56H 1LDPH 4OI9A 4G8GA 3NCJL 2YMXL 1K8IB 4FFWC 3X13A 3IDUA 5F7NC 2NY0D 3OPZH 4NNPL 4XNXL 4NP4H 2JK5A 3QNYA 5IJVB 2YMXH 3V9FA 1FV1B 2AEPH 5JDSB 3VRJB 5KOMC 1R3JA 2IH1A 3O41A 5IK3A 2HMIC 4NQSA 3Q1SL 4YUEH 4Y19B 2VXSL 1KIQA 4OZFG 5AG9A 4LCCA 4TQEL 3TC9A 3KWWA 3VGAB 3ZYOA 1JF1B 3PWPD 4YXHH 1BFOB 3V0WH 1S7SA 3REVB 2VUOA 1QOKA 1S7WB 1HCVA 4NFBA 5HYSA 1FAIL 5CEZD 2YPLA 4PGBB 3VCLB 4WHYG 4F7CA 3O81A 1BIIB 3TO4D 2CK0H 1MRFH 1JN6B 2AJVL 5JHDD 2MHAB 4M6MH 4PY7A 1ORQB 1ND0B 4GG6F 2EDTA 5FYJH 3CD4A 3GMQA 2FLBT 3QIWB 5E94A 4YDVB 5I2IA 4Z7VE 1G0XA 4ZD3L 3D69B 3QNZA 3ZDYE 5B38G 4XBPA 1J0IA 4AK1A 1MVUB 3DV4B 1FV1A 3Q6FB 5JDSA 4X6EB 3GSUB 5DJAB 3N1GC 1IM3B 2EDJA 4NQSB 1KIQB 2J8UF 2Q3AA 1P4BH 2BY2A 1OGAE 3O2DL 3QIUB 1JF1A 1BFOA 3DX9B 4IBLT 5GRVK 1O5DT 3S96B 3PP3H 1G7MB 5HI4C 3AU1B 4LLVB 3LKNA 3BYTA 4CADA 4UNVA 1P4BL 5B38A 3RVVC 5C0AA 4UQ3A 4W4OC 4ZXBD 5FO8A 2E9WA 1BEYH 1KC5H 5ITFB 3U48A 3TESA 2XV6B 3MRNB 1OTTC 4PJGB 4PRIB 4ONHB 3QO1A 3FFDA 4RAUB 3HI5H 2YBRB 3C8KB 1U8KA 5D9SB 3L3DB 2V9QA 2HJKB 5ESVB 2H2SC 3VXTA 4NBXB 1KELL 3DV4A 1MCDA 1VGKB 1JPGB 4ZSOE 4QRQA 2FL5A 1RUPH 3D0VB 1OGAA 2GK0A 5DQDL 1QNZH 2JJWA 3EO9L 2AW2A 2C26A 4G9FE 5AG8A 2H26A 3UYOD 4G3YH 2O26U 3BKMH 4DZBA 3RKPA 3SGKC 3DROB 1BVLB 1VSCA 4CADB 5B38B 2HTLD 2OSLB 4UU9A 3JVGC 3AB0B 4J3XA 1A1NA 4JFYA 3HMXA 3JUYA 3OXSA 4M3JA 4DCQB 4G7YL 4D9QD 3FOMA 1FL5B 4JFED 3VU2A 1QHPA 1CQKA 2XKNA 2ZOLB 2EICA 2WBJA 4JANB 5K33A 2Y07L 3IFOB 4FZ8L 3WFCH 4FQIL 4P9ML 2VR4A 1MFAL 2FO1A 4IRSB 4OIAA 4HIEB 5E9DD 2ICWJ 4O5LL 1BVKB 2X9XA 3SDCA 4PJ7A 1RZGA 2FL5B 4MQTB 1LEIB 1MEXH 1AO7A 1OGAB 1DJSA 4OGXL 2WP3O 5B22A 3UTSD 1RK1A 4PRID 1T03L 3UJTL 2CGRH 4XHJD 2WUBL 5E1AA 3GUTA 5JOPD 1RUQL 1OAKH 4MJIB 5A1AA 3BO8B 4HFUH 2VB5A 1DQQB 1SY6H 2VLJD 3KNBB 5BV7H 4P59H 1C5BL 4OM0L 3IDYB 4U7SA 4KTEL 3ARYA 2G75B 2FH6A 5ICYB 4HSQA 3OL2A 5IVOA 1ZT7B 4W81A 1MI5A 3OB8A 3EOTL 1EFQA 5F1OB 1I1AB 2DLGA 3DURB 1XF4A 3TZVA 4BZYA 3Q2CA 4X98A 2DIJA 4ONFH 3GJFA 2WANA 1T6WA 5FKPA 1FNGB 1UZ6F 3O6FA 3X11B 2R9HD 3LN4B 3GJEA 4O4YH 2MKWA 5KJRH 4XC3H 1F02I 5KS9B 3QDGD 2VDPH 3IJSA 4AL8L 1PKQE 5I1AB 2PW1B 2VLKA 1RZGB 3QUML 4O4YL 1AO7B 2OMBA 1RURL 5ADOL 2GQHA 5HHPA 2VH5L 4OKDA 2YUVA 4EXKA 5E1AB 3GUTB 3BIKB 3BPCA 4UUJB 5T1KD 4YBQD 5KOVC 3DLQR 4JZNB 5CSZB 4QHMA 4S1QL 2XXMB 5ERWB 3RIFF 4G42A 5E08H 1CVSC 4M8QA 4MB4A 4UDUA 2Q86B 5FA3B 5EIQA 1VFAB 4LDEB 4ACPA 1UJ3B 3B6SA 4P2QA 4IJ3B 4N9OB 5C07E 3L7FB 3RTQB 3OGCB 1WUNT 3MLVL 1F8TH 3OG4B 2W60A 5F3BB 1YMME 3EZ8A 5EOCH 3TCXA 3H9SE 2YC1A 3GSQA 1J1OH 5FV1L 2VLKB 3GMPB 5I1CH 5IHUH 4HV8A 1PY4A 4LP4A 2EIDA 3HR5B 1CDUA 5C0GA 4KZDL 1YN7B 3MA9H 1AC0A 5JO5B 4PRAB 1JFQL 3N1FC 2P48B 2H8PB 1OP3H 1UVQB 4Y4KB 3RWJA