4IDLA

Low melting temperature anti-cholera toxin llama vhh domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
123
structure length
123
Chain Sequence
KVQLQQSGGGAVQTGGSLKLTCLASGNTASIRAMGWYRRAPGKQREWVASLTTTGTADYGDFVKGRFTISRDNANNAATLQMDSLKPEDTAVYYCNADGRRFDGARWREYESWGQGTQVTISS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single Domain Antibody VHH A9
publication title Structure of a low-melting-temperature anti-cholera toxin: llama V(H)H domain.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
total genus 33
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2012-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4idlA00
3VFMA 1JTPA 3K81A 2GCYA 4QHKJ 2F8VA 3G6JF 1OP9A 3TFKD 5AZ2H 1ZLUH 5CEZD 1IGFL 2H32B 3HPJB 5E6IC 4MJ6A 2ZCHH 1IC5L 4W6WB 3SGEH 1G1CA 4PRAA 4NP4H 4NBZB 2XFXB 4NQUA 3QAZC 4MA3A 1RJZA 3FQRB 3VG0H 4MWFB 4CVXB 1Z5LB 3QFJB 3RI5K 1IGJA 3ARPA 2VISB 2DQDH 1VHPA 1T83C 1YNLH 3BD5A 3NCYS 3U46B 4KI5F 1DANT 1MELA 3UTSE 3VA6A 3G5ZB 3ZT6A 4U1SA 4CU8A 3V6ZA 4HH9B 2E9IA 4X6FB 2E8YA 3LZFH 5T1LA 4JM4H 5ITFB 2XWBA 4MNGA 4MJ4A 3TJEL 4UNUA 1EDQA 1E6JL 4JRYA 1FNSL 1XGYL 4JANA 4C56A 4P99A 1T66D 5JW5A 3MGTB 1IC4L 1CFQB 1DUYB 1GAFH 4LEXH 2YK1L 3UTSD 1W0WA 3N9GH 5EO9A 2RCSL 4V2CB 1T20B 3VH8B 1X5JA 2CDFB 2B7DT 1N5YL 3ARGD 3MGOA 3M07A 5BQ7B 4NRXB 2DM3A 3QFDB 3D2UD 2NLJB 5C71A 4YBHA 2O5ZH 5D72H 3IB4A 2PO6C 2OCFD 3S97C 4HHAA 2BC4A 3B6SB 3VXOA 1DUZB 4NJ9L 2HH0H 4LDOB 1DVFD 1A6UL 3V6OC 5D93C 5D2NC 1I4FA 1JE6A 5E2VH 1IFHL 1TNNA 2B4CH 4LP5A 1V3KA 4LCIL 2VLLA 4RMUA 2P7TB 2NY3C 4N8CH 4KXZI 5B21A 1ETZA 4F3FA 1CG9A 2KZWA 1KIPB 1LO4L 4IOSD 3RVTD 1VADA 4YDLB 4EIZC 1MCHA 3BKMH 1WT5A 2D7TH 3ARBD 1QVOB 4D0CA 2AERT 4GAJH 2BVUA 4L4VE 2COQA 1HI6A 2DWEA 4K94C 2X42A 5C09E 3S35H 3PDDA 5KG9A 2ZSVB 4NZRL 1YJDH 3O6FB 3O6KH 3WFDH 4FFZH 1EHLH 2FD6H 4QRRA 2VIRB 4DZ8B 5L2JB 1OAUL 4RA0C 4Z76A 4PRDA 2X1WL 1SY6H 4G6KH 3BI9X 3P0VH 5IJKA 1AIFB 2DJUA 3IDYC 3RWDB 4F15B 4Y0GA 3RKDD 4YJZL 2YPLB 4HS8L 4HC1A 3OKOB 1YNTB 2I60H 1VACA 1FAIH 1BD2B 2CIIB 4ZTPL 1FFRA 5FYJU 4LLUB 3E2HC 2ORBH 4L4VD 4MCZA 1PQZA 2X4NA 4ODUB 5TDPB 3RUGA 3T65B 4M93C 5C09D 1HHJA 4QHNB 3QUYB 1JNHB 1FG2B 3LDBB 4PJXB 4GRLD 5ALBL 35C8L 4P3DB 4PJEE 5KVGH 1F3RB 1RHFA 3O9WB 4UNVA 2NQCA 4PJHF 1XGQA 4WUUE 1LK3H 1TVBA 2CIKB 3VFWA 3NFPB 1IAIM 2JJTC 1Z9SA 1YEHL 3FQWB 4ETYA 3GK8H 1GGTA 1KPVB 4IS6B 4QT5A 3UTTB 4FQXC 4U3XA 4UV4H 3D3VB 5GJSL 4X0KB 4EXPX 2EDFA 1UC6A 4OD3L 1M7IB 2H26B 5TH2A 3PWPA 1C5CH 1RULL 1CL7I 4WUUD 3QIUA 3EGSB 4RRPA 4CADB 4W68A 2OZ4H 1U91A 5C8JB 3OKKB 3TYFA 3L9RB 3FO9B 1K9TA 1JWSB 1CK0H 2I5YL 3B2UC 4HPYH 2J2ZA 5IBTH 3U82B 1FN4A 4D3CL 1N26A 5D71H 3VFMB 4PRPB 4WW2A 1F3JA 1X7QB 3WKNA 4CNIA 4GO6B 4P9HH 5E1HB 3V4PL 4MJ6B 5I75B 3HMWL 1NC4D 1WZ1H 4PRAB 3DYOA 4PV8B 5D2LA 4UTBL 3BH8A 3D9AL 5EZJA 1B6UA 3QQ9D 5I1KL 4MDIB 5E8OA 3PHOB 5C0IB 3E3QC 3LS5L 2E9JA 2GTWA 4JPWL 1QLRA 2N7BA 4OCSH 4PTTA 3Q6GL 3INUL 2RR3A 1M71B 3V6ZB 5DD3L 4N1EA 4WGVB 4MNHB 1U36A 1C5BH 4XBEL 2JE8A 2HFEB 1MIEH 3T2OA 1ZANL 1IGIH 1D5IH 5DC9B 3RTQA 1I8LC 5IROC 1QTYT 1DN0A 1S9YA 5AAMA 4WIQA 2XWBB 5ESQA 2Y06L 2BCKA 3LAFA 2CGRL 3LCYA 1FORL 3IDNA 2FJGA 4U3HA 4XH2B 3QHFH 4OI7A 4RX4A 3MRJA 3CLFL 4U1NA 5IMKB 4GAGH 1F3DH 4XVUC 1MCEA 4R4FL 4ODHL 4YGVB 1D7FA 1TETH 4FTVA 2HT4D 4CVWA 5DD6B 4DGVL 5JPMB 4MNGE 4XPHL 2BX5A 1UCTA 5BS0E 4Y19A 4RCAA 1P2CA 3SJVE 4LRIA 4ZTOH 1WJ3A 4YQXL 4S1SL 4MA1B 4U31A 4C56E 2VE6B 1RURH 3VXQB 1YYMH 1CICB 5J1AB 3E8UH 3AY4A 2J8UE 1BVKA 3NIFE 3STLA 4ONHB 4KUZL 4Z7OF 4YC2B 5C6WH 3WSQH 3UDWA 4HHAB 1I8MB 2FIRT 3VXOB 1OW0C 2OLDA 5T1LD 1WBXA 5CP3H 1BX2B 1F4YH 1FNEA 5BS0D 3QB7C 1Q9KA 1R3IL 5H2BA 1S7WA 5E08L 1YUHA 3SJVD 4L8SB 4H5SB 4C56D 1MLBB 1ZT1A 2Y5TB 1ETZB 3V5HA 4FN0A 3Q3GB 4XZUA 3LMJL 3G9VA 1IZKA 4XP9L 3VI4E 2G9HB 2QJDA 5DLML 3MA7B 4YHYB 2C4FT 4XPBH 1R24A 2PR4L 3ARZA 4FXGA 4EOWH 3QDGA 1HI6B 3QEQB 3MPCA 3ZZ1A 4H1LH 1B0WA 3V5DA 3ROOA 4LSUH 3SO3B 5CJBA 5CD3A 5LCVL 4LDEB 1CGSL 3LQMA 3RWGA 1W0VB 3ES6A 4YHLH 4HULB 5F1KC 4Q0XL 3DX9B 5CLWA 4JM2D 1VACB 3CVIH 2JIXA 1NJ9A 3HFMH 1OM3H 1T5XB 4EI6A 4OF8A 2Y36L 4MCZB 1PKQE 1BVLB 4QRRE 4WHTA 3RUGB 5JLZB 5BV7L 5E2WL 3BD4A 1FFNB 1WIPA 3M1BA 1FL6B 3MCLL 4G7VH 3DX6B 2XYCA 4JG1H 4WNQA 2HMIC 1YEJH 4Q58C 3HE6B 1P84J 4ZAKD 4YXLL 1IL1B 1XGQB 2F5AL 3MLTA 4J3VA 3VFWB 4XNYL 5GIRB 3C6LB 5L8JB 4CN4A 4L5FL 1P7QA 3QDHA 5GGRA 2YEZA 3SE9H 1WSST 4PTUA 5HGGS 1QSEA 3M8OH 3P30L 1KACB 4QRRD 3BPCA 4Q6YA 2ZOLA 4QRSB 4OCYH 1OAZL 3RP1A 1N64H 5LXGH 4P2RA 2P5WA 4LLMA 1Z9LA 4N8VB 2FR4B 2ZUQB 4NKMB 4RFEA 5LWYL 5E4EB 1V3JA 3J8F7 3T4AA 4HKZA 3CSGA 5DVKA 5AZEL 4FFWD 4G6AC 2BSSA 3IGAB 3SCMA 4H25A 1K85A 1NFDA 4GJTB 3RIAF 4U1IA 4HS6A 3LVEA 4RBPH 2ZPKH 1J1OL 1K4DA 4S0SD 5C3LD 1K8IA 4I2XB 1NDGB 1EO8H 3B2VH 1JNLH 3V8OA 3DX8A 3DSFH 2BFVH 4OZIF 1G7PB 3IRZA 5EOCH 3SQOH 4WEBH 1NMBH 2Z35A 5EZJB 1T7ZA 4KVCL 3X3GH 1A0QH 2WBJD 4G7YL 2ADGB 4YBQD 5IHLB 2EXYC 2QQNH 1VDGA 5H35B 3BP5B 1I8IA 3WS3B 4UILL 2Y7QA 4NQCE 1NGQH 3T1FB 3QIUD 4OF7A 1KXTB 1FC2D 5EWIL 5EOTA 2A6IA 3BGFB 2BNQA 1MFCL 4Q74A 5D7JC 5D2LE 2X9XA 1WICA 1NANI 1MUJA 1BJ1H 3RTQB 2YUWA 2H8PA 3ULUF 3WYRA 3S8WA 1E28A 1A6AA 2L7JA 4IMKC 5ESQB 2AI0L 1RIHH 5GGVL 2BCKB 3VFVA 5KS9E 2E7BA 1Q9LA 3ZKXB 1XR8B 1P6FA 3QZWB 4X6BA 4P23A 5HY9A 1W0YT 1IGMH 1KJMA 2RGSA 5TE4H 2P4AB 4WTZA 3Q2CA 4NQCD 3W2DL 1SJEA 1YEEL 4Z7WA 4EBQH 3VH8G 1F6AB 1U6AL 1ZWIB 3BKJH 1U8QA 3LKOB 1NUFA 2IGFL 3QIWB 2NXZC 4Y19B 4ONGH 2DKSA 5F7NC 5I15H 4KQ4H 5JOPE 5GPRA 2NNAA 1I9JL 3CVHH 2YRZA 5C7XL 1EEZA 4FTVE 4NKOA 4Z7UB 1JGEA 4N9OB 4NGHH 3U0WL 3STLB 3KPMB 1MJUL 3D0VA 4FFYH 4MVBC 1J7VR 1GZQA 4LIQH 1A6ZB 4MMXC 4P2OB 3O3AA 3GSQA 3FQUB 3HNSH 1J88A 3HZVA 1LWRA 4HWNA 4PY8I 4NRZA 3AMKA 3LKSA 3MNWA 1FNEB 1OSZA 4DGYH 1S7WB 4OGAD 5JOPD 1YUHB 1CGYA 4N90E 3VI3E 3VG9B 4RMTA 1MAJA 2VXUH 2NY1B 3MRRB 4ZNEA 2EXWD 3V5HB 1HKFA 4WW1A 4Q9QL 2HJKA 4FTVD 1DQQA 1WEJL 3EO0B 3FOMB 4D0BB 2A77H 4HWBH 4LSTL 3VMNA 1EJOL 3WLWD 5I19L 4LNVA 1R3KA 4F37F 1Z9OA 3S5LA 1G9ML 1R24B 1XGRA 4JKPL 3WHE0 2V7HB 5IR1A 1UWXK 4L29B 4U1JB 2ZG1A 4N90D 3IFOA 4BSWA 1YEIL 3CNKA 3RZCB 3L5HA 4QRQB 3RWGB 1QNZH 1S5IH 1INEH 3LKQA 3ES6B 4C4KO 3C8KB 3HR5A 3QDGE 4LPWA 2VYRE 5A3ID 2BHZA 4IDLA 5E7FA 1XF1A 3MRDB 1P9MC 4LCWA 2YC1A 4TTDC 1BOGB 4XNZC 4IMLA 4UAOB 5I74B 4LSRL 3PABA 2LTQB 2Z92A 5T33H 1X5LA 3PGFH 3QPXL 1LP9A 5I1LB 4JDZA 3TO4C 3PHQB 1G84A 1JGUL 4O02L 1K6QL 1RAMA 1T0MB 4HKJA 1BAFH 3RJDA 3QDGD 2ICCA 1IM3A 2Y9RT 4QF1A 5BVPH 4JFDE 2CKBA 2ENSA 4Z6AT 3GMRB 2YEZB 1WFTA 3MROB 1BEYL 5FHAH 2IAMB 3V52L 1ZLSL 3EDKA 1T0NB 1JHLL 3VJ6A 4NZTH 1KTDA 5J13B 5AWNL 4LLAA 1A3RL 4JQVA 2ZOLB 2NXYC 5D7IB 3H42H 3FKUS 3VW3H 1AR1D 1ACYH 3GBML 4X5LA 3NCCB 5TQ2H 3PQYA 1QRNB 4LLMB 4DAGL 5IB3B 1R0AL 1QBLL 3S37L 3EJZD 3ULVH 1A14L 2JIXD 4RFEB 1K3IA 1QSEE 2CLRB 4ZXBB 4U1HA 3T4AB 4JFDD 3MOBL 4Y5YA 1X5GA 2EH8L 5DA0B 2L4OA 1TJHL 2W65A 2HWZL 1S7VB 4Z7VA 3UAJD 4PJCF 2DM2A 4P2RE 2NCMA 2P5WE 1NMAH 2VN7A 4U1IB 1Y0LA 4HS6B 5HDQL 4Y5XA 2MKLC 3C8HA 1QR1A 1FVEA 3BGMB 1T2QH 1K4DB 4LKCA 4YDIH 4MYWB 3PHSA 4JAMA 1CGWA 1L6ZA 4FFVC 2IANE 1P7QD 4Z7NF 4ZFZA 3BPLC 2XN9B 3WXVH 3BD3A 3IF1B 1A1MA 3QQ3A 3ZSSA 1HNGA 1QSED 2IPTH 4LASL 3ARFA 4JHWH 3RWJA 1FV1B 5EUKA 1JGVL 4MGXA 1OTTD 5GS1B 3OKYA 3A6BH 3BQUD 1M05A 2R56L 1ZT7B 4P2RD 2P5WD 1E4XL 2MNUA 1OWWA 1ORQB 1I1AA 5IFHH 4FQHA 4G42A 3W39A 4HUWA 3TBTA 4I0KA 3R0MA 2R8SH 5EOTB 2DL2A 4JFEE 3RWCA 2IAND 4G6JL 5IBUB 3EYSL 1U95A 4NO5B 4U4BA 4MJ5B 3OKNA 4JVUA 4JQIH 4UQ2A 2VUOA 5IFJA 3BEWB 3TBWA 1JZ8A 5LG1A 1A7BA 3VFVB 1BM3H 3SGDH 2R4RL 3VGEA 4GS7B 1TPXC 4IRJA 4X6BB 3QUXA 4P23B 2BNQE 4JLRB 1IAKA 1FCCA 2YMXL 4R3SA 2D3VA 4I13B 1EEYA 3L6FB 2EECA 3G6DL 1U2CA 4Z7WB 4R0LB 1BBJA 4OV6F 4JFED 5AUMA 5FXCH 1NKRA 5JDSB 4HWUA 3GJEA 1GZPA 3OKDA 1UH3A 4JKWA 2EO1A 3FB8B 1I1FA 4HUXA 4NKOB 1JGEB 2FGWL 3D39A 1ZKAA 5I1HL 3D0VB 1LO0L 2BNQD 5CHNA 5EPMB 4BSJA 2PTTA 4O00A 1QKZL 4ZODA 1NMCC 2J88L 3GSQB 4KAQH 1X9QA 2AJ3A 4WVRA 4S11A 1A7RH 1F5WA 5GHWL 4P3CL 2V6HA 5IT2H 3ILQD 1I9IL 3AS3A 3UMTA 5C6TL 7CGTA 2VDQH 43CAA 4KZEL 1EZVX 5KSAC 2VZOA 3LKRA 4JZJA 4GBXA 1G6RA 4J8RB 5IB5B 3AB0B 2X4UB 2ZWLT 3LSOB 3OB0H 2Q20A 2B4CC 4WW1B 5EC1A 2YD3A 4BQCA 1T04A 1OWRM 2X4OA 2Y72A 5DK2B 3WN5B 3TT3H 1ZS8A 2MPAH 5C2UB 1JYNA 3WNPA 1DE4A 1CDJA 4BKLA 3TBSB 5JORA 1YY8A 2ARWA 4LVNC 2DQGH 5IR1B 4OQTH 4ZNEE 1T89A 1XF4A 4RFNC 2WIIA 3O45A 3IFOB 3HE7A 3RBSA 4BSWB 4MXWL 5HHMB 3HPLA 1F4WH 2M1KA 3GM8A 3QG7H 1QG3A 3KYAA 4JN1H 4M61A 1A1NB 3LPWA 3ULUL 3I6LE 3GSUA 2YHGA 3FT4A 3HR5B 3F7YA 2CMRL 4ORGA 3TZVC 4F7TA 3I6KA 2F9BT 4NSKB 1S7XB 2VITB 4XC1H 4FQJL 3BMVA 2QSVA 3CFIC 1MHCB 2JF1A 2VDKL 3GHBH 4XAWH 1AP2B 3WUWB 3PABB 3SOBH 1MRCH 4X9IA 2D9QB 2Q87A 3QA3A 5KJRH 1LP9B 4JFOB 1XF5B 3C5ZA 2XZAL 4JDZB 4APQC 2EDDA 4R96B 2GTZB 5DJZA 3U0TA 2AEPH 4JN2B 3ARDD 4LCWE 3I6LD 3OAZK 4ZMAT 4HKJB 2A6DB 4UT9H 3RAJL 1KB5A 5GISH 1WZKA 5J0BA 1IM3B 4OTXL 4QF1B 4NC1C 4KPHH 2O26U 4YHML 4XPAH 2DJ4A 4WWKB 4ERSL 3FHAA 2C3VB 2X4RA 3EOTL 5IEHB 3FO2B 1U3JA 2GI7A 3VJ6B 3IXTA 4G8GB 3WD5H 3HRPA 4BFIB 1OSPH 5J11B 3DYPA 4KUCD 1NCWL 4XI5D 1EGJL 5EBMA 4MLIA 2FEEL 3G04A 5DJAA 4PJIE 3EYUH 4R97C 4N8VG 2OI9C 4KHXL 1ZEAH 4LCWD 3S96A 3OTTA 1T7VA 4OV5B 4ZSOB 3DVGA 2W07A 3G5VA 5DT1H 4FQCL 3N1MC 2YUZA 4LLVB 4JO1L 4U3CA 4BFGA 5HHXH 3PQYE 3ROLA 4HLZH 4Y5XB 2XZCH 1JL8A 2LQRA 5DRWA 4P2CG 1A9EB 3QPQD 4KROB 3NA9H 1NGYB 4R7DA 3MV7E 2R2CA 3WE6A 1A1MB 3TVMB 2R0LL 2CLVA 4JDVB 5HD8D 3RWJB 3LOWA 5JMOC 4P9HC 3LH2H 2HKHL 2YZ1A 2AXHA 1RVFH 2BOBA 1P1ZA 2W9DL 4Y4KD 1A6TA 4XWGH 3UC0L 1UQSA 1Q72L 1CYGA 2DQTH 3PQYD 2HVJB 1N0LA 3MRPB 3W39B 3KGRA 4HUWB 5FA3A 2H1PL 2HFGH 4Y4HA 3MRCB 4JPKL 3NH7H 1I3UA 4KZDH 3FFCA 1U95B 3MV7D 2XQYK 3QR2A 4PY8J 2PTUA 1A3LH 1HZHL 4ODTL 4L4TB 2ZNWA 3TBWB 4NQTA 4K07A 3IVKA 1JZ5A 5CFHA 1WAAA 2HTLD 4NN5B 3GGWB 4IRJB 4WWID 4NZUL 3SY0A 2UVEA 1QFUL 1FVCA 3QZWG 2OJZL 5DFWH 4ZPVB 1FSKC 3OKLB 3RNKB 3O3EB 3O2DL 1SYSA 3RVXD 5F7EH 4LMQE 3HLAB 3VMOA 4WHYG 3ARFD 1BBJB 2IFFH 3NCJH 1UWGL 4L3EB 5D5MB 4OCMC 3QRGH 2WZPD 4QRTA 4YEFA 1S8DA 4LEOA 3T77B 3VXNA 4E0RA 1G7QA 1I1AD 1I1FB 2FDBP 3HRZB 3QI9B 3OZ9H 5GRVK 3D39B 3RDTC 3RHWF 1G7JA 5F97E 3V7AE 1ADQA 1VA9A 4H0GA 5K9JH 3MJ8A 2XRAH 5H8DA 5LBSH 2R9HD 5FYJL 2J6EA 3T2NH 3HZKB 3MV01 5DUMH 1GOGA 4G9DA 1JRHH 1DL7H 5EORH 5FHBL 1RMFH 2VLJE 3QUXD 4YHKH 2VXQH 5M95B 3BN3B 5DMJB 3QP3A 4R4NC 1YPZA 1UM4H 1CT8A 1T04B 4L8BA 2DQFA 5GXBB 5TE7L 5HGAA 5CEZH 4MLSA 5EC2B 4DKDC 4K3GA 2Z4QB 4KU1A 2D7NA 3IFLH 3BKYH 4XVTL 2BY3A 1I7TB 4YFEA 3L7FA 3GRWA 4ALAH 1QLFB 4FQIH 1HCFX 3UYRL 4UB0H 3CZFA 1ND0B 2WIIB 5I73C 1MCQA 2VLJD 2ADJA 2CK0H 3VWKC 1RUPH 3JTTA 5I17B 3C08L 4KHTH 1RZKC 3GSUB 1KJVA 2ITDA 3F7YB 3DTXA 1UA6H 5ICYB 5KVEH 4MXQD 2VR9A 4F7TB 2DBLL 4NNYB 5JR1H 3OAYH 1M7XA 3GI9L 3JTSA 4TSAL 1AO7A 4GBXD 3P73B 4I0CC 4QTIL 1T0PB 4Y2DA 1W72B 4OGYL 5DEZA 3E6FA 3TV3H 2F54E 4DFHA 4GG8A 5D1XA 3T0EA 4EXKA 1JK8A 1MFEL 5LVEA 3ZE2F 1CFBA 4E42B 1JHTA 4F57H 1QA9A 3MACL 3ZLQC 5ID0A 4P2QA 3U7WL 2J3SA 4K7FB 5DA4A 2YRLA 5F7HA 4PBXA 1I3VA 4XWOD 4B0MM 3EJYC 3HE7D 3FT2B 4QRPB 3TT1H 2R0WL 3HI1A 3P4OA 4L9LB 12E8L 2BVOA 1MI5B 3T2PA 2F54D 4JO2H 1OGTA 4N5UA 4PJ8B 5DJAB 1U8NB 3S96B 2HLFC 4B5EA 1UH2A 5DJDA 5C0JA 1OP3H 1K4CB 1QD0A 3MBXL 1BBDH 3LRGA 3NFSL 1F8TL 3PWVA 1VFAB 4PJXF 4LVHB 4TVPL 1J5OH 3C5ZD 4XCYA 5DZLA 4QHLB 3ROLB 3KPRA 1MQ8A 4PJFB 3QCUH 1WUNT 3DXAA 2ZCLL 4AEHL 4KJYB 5TPWL 4POZC 4AL8H 2Y6SD 4RAHA 1I8LA 4N0UE 3WE6B 2H6PA 4MD5A 3PGCB 1CTOA 1T22B 1G9EA 2PCPA 2VMFA 4HK0A 2ZCKH 4XXCC 3P4MA 2FO4A 1A6TB 3K80A 1FRGL 4JJ5A 1H9VA 1B0GA 1UQSB 4F37K 3FB6A 4R90L 2JB5H 3THMH 4F7PA 5E6ID 5IBLC 3SN6N 1DBAH 3HNVH 4W70A 5SX5K 2MHAA 4HDIA 5F1IA 3MLVH 4DJMA 1P4BH 4G6FD 4QYOA 4DCQA 4A6YL 4ODSH 2UWEA 1XIWA 5DTFA 1J9CT 3FFCB 5IBUG 2YWZA 4AQ1B 3UCRA 5J8OA 2NY5H 3F8UB 4KKAC 1IEBB 2OTUB 3AU1A 4MXVF 4YUEL 2QKIB 1H0DB 1LDPL 3IVKB 5F9DC 2P47B 5IW3A 5E2UL 4I3RH 3SY0B 4JVPA 3LEVH 1FVCB 5CD5C 4MHHG 3D85A 4PJAF 1EAJA 1H3UA 1JPSL 1GGBH 1B4RA 5IF0A 3NACH 1KNOB 3TIDA 3QXAB 1OHQA 3FRUA 2APBA 3U36A 4Q6IC 3W82A 1J0IA 4ISVA 2CRYA 1FO0B 1L4IA 2IH3B 1KTLA 1NGWA 4QRTB 4ODVL 4LEOB 2J1KA 3BDYH 4QNPF 5ABDE 4U1GC 2FATL 3LKPA 1ZTXL 3OGCB 3V6OE 5D2NE 4Y4HD 1A22B 4S1QH 5FUCC 3PIQB 4AQOA 5IESH 5GZOD 2V2TA 5FKAA 5C0NC 5C0BA 5K9KA 3AREC 3GNML 4LVOC 5FUOL 2CSPA 3RWIA 3GSNA 1D9KA 4OB5H 4JRWA 2FJFA 1OF2A 3PWUA 4TUKL 4P46C 4XMLH 1OTSD 5HJ3B 1L7IL 3KNBA 1CT8B 5E1AB 2DQFB 3ZL4H 4IJ3C 5B3JF 2CO6B 2M26A 4PJDA 3WHXA 2DDQH 1K3ZA 5IQ7H 3B5TA 2R4SL 1XGUB 2NY3D 3LN5B 4FQ2H 2ENYA 1U8JA 2A6JB 4DN4L 1YPZE 1ZHLB 2P8LB 3HKFA 4HF5H 1J8HB 5DJ2B 4F7MA 5JW3L 2DYPA 4R26L 4OD1L 1P53A 4H8WL 1XR9A 3QUKA 1MAKA 3IFNH 3I6GA 3TPUA 1S5HA 4JZOA 4R9HA 4JRXA 2AXGB 4XP5L 5ENWB 1I85A 3KG5A 4I5BB 5GSVA 4NQEB 3X12A 3WUWG 1X5XA 4OLYH 1P4LA 1B90A 1ES0A 4UT7L 3RX5A 5I1JL 4QHUA 1RZ8A 5H94A 4M7LT 1NLBH 3PGDB 3T3ME 5KSBA 2AJSH 3VGHA 4QTHA 3ALPA 1HHHB 5D1XB 2HJLA 3T3PF 5J1TC 4R8WH 1JK8B 5D7KE 3NABH 1A5FH 3KLDA 4P2QB 2VWEC 2BNRB 3MRKA 4OZGE 3T09A 3KJ4B 3SGKA 1PLGL 1MJ7L 4LCUA 2EC9U 3JUZA 2X05A 4RGNC 1HXMB 1PG7L 4XRCB 4AT6B 3T0EE 3PDOA 3HI1B 2XZQH 4J4PC 3VXMB 5FO9B 2GJZA 2G60H 4ONOA 4ZUTB 1A6PA 5F6IB 5E4IA 2F15A 3TN0C 4U0RC 4HIJA 1P7HL 3SE3A 3OPZH 3SKJH 2OM5A 5D7KD 2DWDB 5C0JB 4UI2A 1W2KT 4FQXD 1IRAY 1KCRH 1TCRA 2WINA 4HX1A 2VABA 3BUYA 3RKPA 3PWVB 4Y2DD 2D7PA 5C0EB 4NP4L 2OYPA 1NLDH 3SDDB 3T0ED 3VG0L 1NGZA 4NPYA 3P9MB 3BSZH 4MHHI 4MQSB 3VGGA 4G5ZL 2FSEA 3QHTC 1UJ3C 4X6CB 4X7DC 3MBEB 3BZEB 3B2UD 3E3QE 1H5BC 4M1DH 4IMKA 3KPRE 4HK0B 4GSDH 4TNVF 1XF3B 4ZQKA 4OCNC 4EI5B 2QTEA 5KVMC 2FO4B 4JM4L 3S36H 4OFIA 4PB9L 1B0GB 2OQJB 3O3BB 4F7PB 5FYKU 3TA3C 5DJYB 2MHAB 5SWZB 1LEIB 4QYOB 2WBKA 4EN3C 5JXEC 4YAQA 3PE9A 1U3HC 1GAFL 1XIWB 4LEXL 5DTFB 2FH6A 3N9GL 3UTZA 3ZT5A 5BCAA 1N6UA 1YN7A 2RFXB 3O0RL 4YIQB 2BNUA 1H3PH 3DJ9A 5MI0C 1FLTX 4AEFA 1JYWA 2P43B 1IQDA 3CH1A 3KPRD 3KPPA 3LB6C 3WMSA 2J8UB 2HFFB 2UWEE 5JHDB 4K8RC 2X1XR 5IF0B 4KRPC 3RVUC 4IHOB 2O5ZL 5D72L 2BVYA 1A9BB 3JBG7 3CFKA 1DEEA 1KBGH 1TENA 4HJGB 4ISVB 1H3WM 5EULV 3CSPA 1NCBH 2HH0L 1HYSC 5D70L 1CD1A 1AQDB 1G7HA 3BPOC 3N1PC 4F7EA 4XVUD 3WIIH 3HAEH 4HIIB 5E2VL 1O7SA 2B4CL 2AW2A 3BP7B 4JY4B 4WV1C 1YYLL 4HC1H 1KIRA 4OD2B 2R23B 4N8CL 2AGJH 3QBTB 2V2TB 4O9HH 1INDH 5HVWA 5F3HA 5C0BB 2D7TL 4FQ1H 3RWIB 3BEVB 4UOW0 1D9KB 2YPVH 3ZDYF 3LEXB 1ERNA 2FJFB 3OSKA 3VRJA 3E0GA 3Q1SL 3F12B 4LARH 4GAJL 5M7QA 3D85D 3U30B 5HYJA 3WLBA 2HP4A 3O6LL 1HEZA 3L5XH 1IT9H 3S35L 1YJDL 3O6KL 4P9MH 3VRIA 3WFDL 1IAIH 3GB7A 3WDJA 1EHLL 3D48R 5GRXG 4TYUA 4PLOB 3MNZA 3WHXB 3HS0A 1OAQH 1SY6L 1KPRB 4G6KL 4QKXB 4UIMB 4ZS7H 2PYEB 4KDTC 2I60L 1FAIL 1DBJL 4Z7UF 3EDEA 3I2CH 3MZTA 5EZLA 4NN7B 4NFCA 2ORBL 4F7MB 2WUBH 3PV6A 4PJDE 2X4QB 2D03H 3I6GB 1XGPB 3TPUB 4D2NA 5KVGL 4ZD3H 1DFBH 2AK4B 3OR6B 4QRUA 3ARVA 3OJMB 5B8CB 2D7QA 1OAYL 2WK2A 4KKCC 1LK3L 1QO3B 4QXUH 4O5LH 3NGBB 5EB9A 1MCLA 4KH2A 4NCDA 1P4LB 2Y4SA 4QHUB 1HWHB 3GK8L 1RZ8B 2OL3A 2LVEA 3QO1B 3L3HB 1LK2A 2HJLB 5L6YH 2ZOKB 5DHYA 2GK0B 5IQ9A 3DGCR 1J18A 3FO0H 4W4OC 1U9KA 3MRKB 2D0FA 1C5CL 4OBSA 2DQEH 1ZGLP 1MAMH 5CIPA 4HT1H 4QHMA 4RFOH 5KSBE 2VJXA 3B8SA 2DYPD 2HMID 4Z5RA 1MRDH 3PDOB 2WBJB 3GSOB 2GJZB 3LS4H 5T3ZE 5L2KB 1S7QB 3Q6FB 4L9DA 3DURA 3QJFB 3ZO0A 4CMHC 4HIJB 1R6VA 5D71L 1G0YR 4DW2H 2R69H 4NM4H 5KSVB 5F9OH 3U2SB 3MNVB 3Q0HA 3GMMA 3RVVD 3X11A 1TCRB 3EO1B 2WINB 3MLZL 1MCWM 5E8DH 3MMEA 5TDNA 4O2EB 1T03H 2VZ3A 2W9EH 1NGZB 4L8DA 4WI9A 3MUHL 5T3ZD 3CDYA 4YHPA 3IRPX 2FSEB 4OZ4B 1MCFA 2Q76A 4OCSL 4G6AD 4RIRA 3H7BB 1B88A 3MRHA 5DWUH 1S7UA 1CGTA 1C5BL 1ZLUK 4R2GD 2KQMA 3MV8A 1MIEL 2EDKA 4PRHB 2YA1A 3OKMB 5D7IF 1D5IL 2WAHA 2G5BA 4OT1H 5IMLB 3D69A 1X5ZA 4JHBA 2Q3ZA 3C5SB 4GRWE 4HXBH 2RB8A 3VCLB 2B2XH 3QHFL 4D9RE 2A0LC 8FABA 4KKLC 4JFFB 4LBEB 2Z31C 1RJLB 3BZ4A 2Q86B 2EXYD 2ZUTA 1F42A 4F9PC 4B41A 4O58H 1IQDB 7FABH 2UYLB 3BIKA 3SKMA 2FO1A 1OAXH 3MYZA 4ZTOL 3DNKA 5GRUH 1RURL 2H41A 1EXUA 1KXQE 2X70A 1EH9A 3SKOA 3NPSC 5ISZB 1HH9A 1AGEA 4JFYB 1G9NC 3BHBB 4D9RD 3WSQL 4XBGA 1K2DB 4KV5E 3C6SA 1LEKA 3TCLA 4MAUH 4M8QB 1WBYA 2A9MH 5KSAA 2AXFB 4UU9A 3X13A 1G7HB 1DCLA 4F7EB 1F4YL 5GGRY 1DLHA 4NCC1 4LHUB 1LE9B 1GIGH 3ULVF 1C5DA 2IQAA 3MLYH 3VXTA 5CJQH 3G6JA 3KXFA 1GGCL 3FL7A 2XACC 3HB3C 4PJ7E 1U8KA 4QXGH 5DQDH 5HDBF 1KCVH 4YFLF 4XPBL 2DJSA 4IIQC 4H0HB 4EOWL 4W6XB 1WWBX 5EBGA 1FIGH 2P8MB 4KRMB 4MVBD 1HEZB 1UEYA 2EDWA 1D6EA 2AJZA 4LSUL 1DQLH 2VH5H 1BZ9A 3KDMA 3TZVA 3W0WA 3ETBF 4LFHD 3MNZB 4P49A 2UZIH 3JWDC 1UB6B 4YHLL 4DUXA 4I77H 4DZBA 5FA4A 5HYJE 3I85A 4M4PA 4S1RH 3HFML 1OM3L 5EZLB 3FOLB 5F88A 3G08A 2C3GA 5T5FL 3F5WA 5A2JH 1F11A 4O4YH 1ZHBB 1MJJA 1ONQA 1HDMA 4G7VL 1FZMA 2OJEA 4JG1L 4JHZA 5ERWA 1YEJL 2WLYA 3B5GA 3OR7B 3L3OB 4QRUB 1N2RA 1T21B 4JDTH 5I8KH 5J4MA 2ADFH 3EYVB 4GKNB 4KTEH 5HYJD 5IWLA 2EDQA 3FTGA 2ZJSL 4M7ZB 4Q9RH 2V2XB 5HVFB 5IVZB 3IJYB 2PXYC 4WI2A 3FT3A 1J0KA 1IJ9A 3MUY1 3FN0H 3LQZA 2JTDA 1ZOXA 3FFDA 5A2FA 3GJFA 1M1SA 4TTDD 4JPVH 5DHYB 5F1OB 4P59H 4M00A 3VXUB 1R3LA 1N64L 3ET9F 5LXGL 2GHWB 2BY2A 1KJ3H 5I8EA 3AGVA 3C9NA 1QBML 2VLKA 3P4NA 3ZDXE 2A9NH 3ARGC 3I75A 4LSPH 4N8PA 5SWSB 1OT1A 4Z5RB 4JFZH 5C0CE 4R4BA 4HXAH 2D0GA 4LDLB 3DURB 2HVKB 3WJLC 4AEIH 3SDCA 4EVNA 5I1AB 4BQ6A 5DC4B 3PWJA 2ZPKL 1OLLA 4MAYA 3CXDH 1GSMA 5LKNA 1EO8L 1CFNA 1JNLL 3I3DA 2NXYD 3H3PH 4M48H 2V5TA 3F58H 4PB0H 2BFVL 43C9B 5BRZE 5EOCL 3SQOL 2BVQA 4WEBL 3VD4A 5C0CD 3FCTB 1NMBL 4L8DB 3X3GL 1A0QL 1Z9MA 2F58H 3AXLB 3MLUH 3HI6H 2QQNL 3RVTC 5D9SB 4J3UA 1BF2A 1NGQL 4RIRB 3ZE1F 1S7UB 3VU2A 1KCKA 4P5MB 1X4YA 3K8LA 5K59F 5ANME 2OK0L 4POUB 1AC6A 4U6YB 4DGIH 4HJJH 5BRZD 2YWYA 1D5MA 3D69B 2Q8AH 4FFVD 3MRBB 3DRTB 1GVIA 3IAPA 3WEXA 1ZXQA 1BIHA 1JV5A 1CD0A 4JFPB 3UZVB 3QXDA 4E41A 1KELH 3IU3B 5A2LH 3UBXA 3GMOB 1VKXB 1IGML 1HH6B 4PJHA 3MV8E 8FABB 2R2EB 3TNNB 4Y4FB 4C4KT 5TE4L 3BZ4B 1NSNH 1ZT4A 4EBQL 1VCAA 4OF5A 3BKJL 4DOHE 4NNPH 2DI9A 4PG9A 4BUHA 4ONGL 3DUSB 5I15L 4KQ4L 1OD7A 3T0DA 3C5JB 3RDTA 5F72S 1CZ8L 1EXUB 3CVHL 4CW1A 2QADB 1JPTH 3SKOB 1N5AA 2VAAB 4NGHL 2MFNA 2VXTH 2VQ1A 2FIKA 3OG4B 1AHWB 3MV8D 1UM5H 4FFYL 4LIQL 1OGAE 4JZNB 4OLEA 1MNUH 5JTWA 3HNSL 3ARRA 1DLHB 2W0FB 3O6FC 5JNYB 4DGYL 2CLZA 5DQJB 1SVCP 5E5RB 3CGTA 2R0ZH 5DMKB 1YQVH 5CKGA 2NY0B 2P46B 1QQDA 1WFNA 4PD4K 4BZ1H 1M7DA 3MR9A 1LO2L 2VXUL 3MOAH 4NM8L 3U4AA 2XG5A 3WL9A 5DJCA 1CN4A 4J23A 4HG4K 2ESVA 2A77L 5IW1B 3TYGL 5GS2D 1ZSDA 2AV7A 1WBZA 4Y1AA 1SEBB 1EFXA 1OGAD 2DKUA 3TEUA 3W9DA 2VAJA 3VWKA 3QULA 3R8BB 3G6JE 3KXFE 3QUYC 1YDPB 3LDBC 4WI6A 3RY6A 4HZLA 1NC2A 1HQ4A 3HG1A 4MA8L 5CJXC 3V4VH 2AJYH 3O9WC 3UPAA 4DKEH 2CKBH 2ZSWB 1HSBA 2DMKA 1QNZL 2N1KA 3QJHA 5F21B 4PJBB 5D5MF 1S5IL 1INEL 3KLSA 5KSAD 4X7CC 2R1WB 5JPNA 3MZGB 2OTPA 2XG4A 4M6OH 4EQ2A 5CINH 4YBLB 4DVRH 5TE6H 2C5DC 4NUJA 4KI5E 3MODH 5F88B 3W0WE 4N1CA 4XP4L 2UV3A 1F11B 3KXFD 3N50A 5INDA 5CGMA 5T33L 3PGFL 1WZMA 1MJJB 3CZJA 2X09A 1T1WA 2HN7A 1T3FB 4K7PX 4TNVK 1FZMB 4ZYKB 32C2B 3DGGA 1DP0A 1BAFL 3HHRB 3WHE1 2B39A 4PJGB 2VNCA 5BVPL 3NIGF 5HHOB 4TRPL 3FTGB 5FHAL 3GSRB 2YSSA 4KI5D 3U0PA 2JCCB 3KPQB 1FZKA 3TZVD 1MFAH 1SM3H 4NC1E 5GSRB 1EHXA 3W0WD 1A1OB 1B0RA 3H42L 3VW3L 1ACYL 1R3LB 1RK0B 1V8HA 5F89B 5TQ2L 2VTFA 2GSGB 2HT4C 3TF7C 3LRHA 3ULVL 3MRMA 1Q9OA 2DMCA 4XX1E 5GGSA 3P4NB 4APQD 1IGCH 1DQDH 4R4BB 4ZG1A 5DD5H 2JB6A 2XQBH 4XB7A 3EZ8A 3SDCB 3CFEA 3CDGB 4HWEH 1T2QL 3REWB 5ACZA 3BZFB 3I84A 2R39A 4UDUA 1CFNB 4LF3B 1IAOA 2JJWA 3B3IA 4XXCA 5HYSA 2QV2A 3WXVL 4W6YB 3V6FA 4AYFA 5HDOA 1ZAGA 5IMMA 2OMNA 3ZKQD 2QHRH 3LEYH 3PWNA 5L8KB 4NYLB 4RBPK 3C2AH 5IFHL 5CAYB 2R8SL 1IMHC 4Z0XB 4L4JA 1ZHKB 5C08E 1EEUA 4MA1C 5FO7B 4JQIL 5DYOA 2V7NA 4XXDA 3KPOA 1GOHA 1RU9H 3DROA 1HOCB 4U05A 4WGWB 4M03A 3QQNA 1G7IA 3L3KA 2PTVA 4YC2C 3VFGH 4AMKL 2H9GA 1UCBH 4RQQA 2ATKB 4K7PY 4F80A 3JUYA 1D6VH 4JCLA 1I7ZA 2LU3A 4AM0B 1G6RH 5FF6B 4RGOH 1BIIB 2RHEA 1UKSA 2W91A 5C08D 1U8LB 2AV1B 5C0DB 4E41E 4PJFF 2OX5A 4PJHE 4CW1B 3T0XA 4X7TB 3QQ4B 4CMMB 4YHYC 2WWMC 15C8H 3MXVH 3HC0A 4GKZA 2NY4B 1C16B 4X6DE 3QDJA 1A7RL 3JWOH 4YO0B 1IC7H 5IT2L 3FO1A 3JSSA 2FB4H 4K7PH 2WBWB 2CLZB 3IS0X 3SO3C 5IOPB 4LHUG 4E41D 1QQDB 2GEEA 3TC9A 3VXSB 4JHAH 1M7DB 3MR9B 4HSQA 5E2TL 1MHEA 5IJKC 2VDNH 4FABH 4K55A 4JJHA 2XXMB 2ESVB 5DSCB 5DHVB 5GRWA 3KPNB 1SHMA 3TT3L 2AV7B 4O2FB 4OZIA 1WBZB 3BE1L 3RDTD 1JWUA 2A1WH 2A74A 3ZTNH 4GG6B 2DQGL 1BQSA 4XPFH 3O4LE 4EUPA 1UH4A 1FL5B 2DOCA 3BYYA 3NVQA 4YXHL 3KPSB 4HZLB 1NC2B 2H2PD 2XTLA 4LGPB 1KB5H 2OSLB 1MEXH 4YDVB 1F4WL 5AD0B 5ADOH 3QG7L 3X14A 5EH1A 4JN1L 4Y1AE 4QLRA 5BO1H 3C6LC 4O51B 4OUOA 1H15A 4TPRH 4BH8B 3V0WH 5L0QB 1A7NH 1LILA 4XC1L 4R4ND 5C92A 1WTLA 4TUOB 4XNMB 3WXWL 3HG1E 1CLZL 5CEYA 2BVTA 3ALWA 3GHBL 1TJIH 4NUJB 1RZIB 1MFNA 3HN3A 1DLFH 2MWCA 1HXYB 3O4LD 4PRNA 1MRCL 2DQHL 2UVFA 2CDEA 4ZUVB 5KJRL 4Y16B 1UXWA 2ZUQC 5TGBA 2O61B 5GS0D 4PFEA 2JJSA 2AEPL 5E4EC 4Y1AD 5KW9H 1EFXD 4PR5B 4TVSa 4UT9L 2NY6B 4I18B 3R06A 3VWKD 3SDAA 1S7TB 4ZUWA 3VFUB 5BJTA 4KPHL 1NQBA 3ZKNC 1M6OB 3BWAA 3MRLB 3HG1D 3BP6B 3BIBX 2YSSB 4NO2B 5DQ9A 3BVNB 1FZKB 1HCVA 1F4HA 3DOSA 4C83A 4OM1H 3WD5L 4WW2C 1RY7B 1RFDL 3MSPA 2YPKA 4U6XB 3EYUL 1ZEAL 5HI3C 2DF3A 3MRMB 5IP4A 3GIVB 3CXHK 1AGFB 2IADB 5GGSB 1EGJA 3IDMA 5DT1L 1JTOA 2CXGA 5EU3A 1UJTA 1CDIA 4PJEF 5FYKL 2PW2A 4Z7OE 2I25N 1MLCA 2VLRB 5T1MA 5HI5C 5HHXL 3M17A 5FGCB 3T08A 3MRFA 4JY6A 1FVDA 1HIMH 2XZCL 3EJYD 1D5ZB 2GK2A 5ACZB 2ZUWA 3AUVA 3FRPG 2OS7A 1WGOA 3QHZL 4UDUB 1U58A 5IK3A 3NA9L 5F7DB 3RTQC 5GGQH 1MHHB 3B3IB 5HHVL 1BPVA 3V6FB 3QUMB 4J3XA 5ETUA 5BMFH 4OGAC 3LH2L 1YMMA 4M5YH 3ZKXC 2WUCH 1MCSA 2X1PA 4GW1B 4LGSB 2DLFL 5E56A 1I3RA 5I8OL 4R7NB 4XWGL 4EN3A 2EXWC 5JXEA 1FH5H 1AFVH 2DQTL 1U3HA 2C26A 1JPGB 1QBBA 3RGVA 2HFGL 4OKDA 4BZ2H 5CJ5A 3O8XA 3QIWC 1VGEH 3IDIB 4KQ3H 4LLDB 4XMKH 4KZDL 1KIQA 4LRIC 3U4EB 2EC8A 2KKQA 4D8PA 1A3LL 4TUJB 1ADQH 2V7NB 4JFXA 4OZFB 4XXDB 3DROB 4KTDH 2X89A 3RWHB 5ESVB 3AY4C 4POZD 1G7IB 1NBYA 4C57C 3L3KB 1ZLWH 5FYLL 3RI5F 5KN5A 2ZZUT 5AEAA 4K94H 4ZPTA 5DO2C 3BYTA 1N8ZA 3EKCA 2BSRB 4WO4B 3UJIH 5F7EL 3HMXH 1AKJA 3RL1B 3U9UA 4OQ1A 1AGDA 2PO6B 3RPIB 4G9FB 2IFFL 3NCJL 4H20H 3VG9C 4YXKH 1GOFA 4GKSA 1EVUA 3P0GB 1NBZB 4GT7A 4U7SA 5MP6H 3STBA 3CX5K 2BRRH 2EE9A 5DDHA 2IALA 4LLWA 4X6CF 1IQWH 1IGYA 3GRWH 3OZ9L 2X40A 2YUXA 4LCYA 5ICZB 5K9JL 4KKAD 4OFYA 1Q9WB 4GKZB 1Y18A 5I76B 5LBSL 3T2NL 5CD5D 4P57A 2FX7H 5DUML 5FUCE 4C55A 1RZ7H 4NHCH 4DVBA 1JRHL 3L7EB 1T7WA 5IKCA 4PJCA 3P11H 2Y1VA 4ZFOA 1Y6NR 3IS1X 1JNNL 4YHKL 2DI7A 2VXQL 5INCB 1WITA 5H37G 3BMWA 3VFTB 5DI8B 1UM4L 5F8RC 5CEZL 1KCUL 2J12B 3QDJE 1O5DT 2OTWB 4RAUB 3IFLL 4OZIB 5I74C 4UAOC 3QWQB 5I71B 2NYYC 1QLEH 2LTQC 1RUML 4PJ5A 5KAQG 2J8UF 3IDYB 4FQIL 4K71B 5A43C 4UB0L 4XVSH 2C7UA 2EDTA 1V3MA 1XCQB 4P0DA 3LY6A 5C0ND 2CK0L 1RIVH 3O41A 3IFPB 4TSCH 3X14B 4KHTL 4NQSA 1DDHB 5CBEB 3OB0K 5EU5B 4WFHE 3MLSH 4GLRH 3SKUD 3VGBA 5DVMA 4LRNH 1UA6L 3QWOA 3U6RA 1BECA 3QDJD 4P46D 1ZHNA 1AI1H 1ITCA 5JR1L 2IAMC 5JOFB 4P4KA 1H8OA 1A2YA 3AC0A 4A2MA 5F3BA 1BHGA 4UDTA 1IKNA 4F2MB 5J13C 4GQ9H 3OJDB 2BOCA 4NZJA 1JHKH 1JF6A 2QEJA 4JM2F 4WJ5A 1T1XA 4XCNA 1U8MA 1SMOA 3FB7A 5CSZA 2FBOJ 3TV3L 4W4OA 5CP7B 4NQDA 1RJYB 4FQXB 1WC7A 4F7CB 3U9PH 4WFHD 4ZXBC 5KVDL 4WU7A 1IM9B 4F57L 4I0PA 4UT6H 4X8XA 1S7SB 5FM4A 2IC2A 3R06B 4XPTH 4PS4H 3SCMC 1SYVB 1KLUB 3VXRB 5GGUB 3GFUA 3OWEA 3ZTJG 5EUOB 3MRGA 3QT2A 3TT1L 2EIDA 4M7KH 1MFBH 4HGWA 3FMGL 1PG7W 4MDJA 4FQLL 3L5JA 4RGNE 1U92A 3QH3B 4JO2L 1PSKL 2VDLH 3DUUA 2AS5M 3LKNA 4BFEA 4CDHA 4PBVC 1J0YA 2R2HA 4GAYB 4YDKH 1PDKA 5EU3B 1NAKH 4X9HA 4Y5VA 2FCBA 2PW2B 3QG6A 2UUDH 1MLCB 5T1MB 2BRQA 2FYYA 2GFBA 3JV0A 3KR3L 5C9JB 2HLAB 4ZUUB 3RY5A 2AKRB 4ODWA 4RGND 3VFSA 3AM8A 3GZKA 1YEFL 2NY7H 4RZCB 5D6CA 4IRSA 4AL8L 2VDOH 2VDPL 3AAZA 4M1CD 4O2CA 1FO0L 3TN0D 4CL7A 1YMMB 4GS7C 3SDYH 4MZ3A 2NX5E 2V5SA 2ZCKL 4P23C 3AMLA 5FB8A 3QCVH 5C0GB 3FN9A 2JB5L 2Z31A 1FAKT 5ESAA 5FFLA 1NAMA 3HNVL 1IKFH 3RGVB 3MLVL 1P4BL 1KPUA 4HMDA 3KWWB 1P5VA 4KMTH 3GMNB 1U0QA 5DD0L 4D8PB 2QQLL 1MCNA 2NY5L 3PWLA 2EH7H 4JFXB 5T1KA 4A6YA 3MQIA 2R29H 5F9JA 3TGXA 2NW2A 2NX5D 1F90H 4I3RL 3LEVL 3GSNH 3ZKSD 1HSAA 1N8ZB 1GGBL 3NACL 3SGJA 2AEIT 2J4WL 5I9QB 2DM7A 1PYWA 2D7OA 2W60B 4D0DA 5L8LB 4PGBA 3TA3D 3IDUA 1JIBA 3B5HA 4YK4B 5C07B 3U1SH 1JZ2A 4EN3D 3AB0C 1I3GH 5JXED 1XF2A 3BDYL 1CXEA 1G7LB 3L1OH 1U3HD 3BFOA 2JK5A 4HZAA 4NOFA 3WN5C 1SBSH 4JREC 5DRNB 1QSFE 2CKNA 3O8XD 4BZYA 1B6DA 4LCYB 4S1QL 3VFRA 4LHQB 1TFHA 5HI4C 5IESL 1QYGH 4V1DB 3KYKH 4WEUD 4IIQA 5KS9F 2D0HA 3LB6D 4P57B 3SDXE 3VDBA 4XNUH 2X89D 4K8RD 4MX7A 4UZGA 4DVBB 4GW5B 4OB5L 4U6HA 3B9KB 1UZ6F 4AIXA 4TSBL 1GH7A 4IBLT 4QGYA 1JZ6A 5F71A 3ULSB 1K8DB 3MRNA 1AKJD 3TBYA 5BZDA 1QSFD 3ZL4L 3I50H 5FK9A 4PGEA 4U1LA 2O5XH 1R5IA 2AK1H 2XKNA 1NL0L 2GKIA 3VWJA 5IQ7L 5FYJE 3VGDA 1DSFH 5DURB 4FQ2L 5EBLB 4LPUA 4AH2A 5T3ZH 3DX7A 5AAWA 1U8IA 1WCBA 3KVQA 2H3NA 3O41B 5EG6C 5K9OA 2EDJA 2IJ0C 4OI8A 2OXGA 1UWEH 4X4ME 2P8PB 3IFNL 4NO3B 3VRLF 4PJ5E 3EYFB 4OGXH 3VD5A 1T7YA 5MEOA 4WWKC 1ZHNB 3VFPA 1YY9C 1YEGH 5DK0B 5L7XL 3QNXA 4ELME 1CFVH 2PXYA 3F65A 4UDTB 4XMPH 2DLEA 5I1GH 5FYJD 1HKLH 3T0WA 4OLYL 5J11C 2YA2A 3DPBA 1KOAA 4MJIB 1U8MB 4IDJH 5IB2B 1NLBL 3FB7B 4HFUH 2AJSL 2H32A 4R8WL 3GEWB 3IU4H 5F9AC 5TF0A 3NABL 2XFXA 1A5FL 1H3GA 3FQRA 4PJ5D 2HRLA 4CVXA 1X5AA 2VISA 1OT2A 3FQXB 3OAYK 4LNRB 2KUTA 3F7QA 4NQDE 4OLUH 1CFSA 4Y5XC 1LMKA 4GRWH 4LAJH 1AJ7L 3G5ZA 2HTLC 4Y89A 2OR7A 2XZQL 3QWRA 4MDJB 2G60L 4KKCD 4KROC 4G6MH 1XGTA 2GJ6E 4X6FA 3MFGB 3DUUB 3OPZL 5ITFA 4P4KD 3SKJL 3TVMC 1CTNA 3O6MH 3ARFC 2R2HB 1KCRL 1QFOA 5E8NA 5CMAB 4KVNH 1IAMA 1MWAH 3QG6B 5T3XE 4KI1A 3IYLW 3MGTA 1CFQA 4NQDD 4AG4H 1I1AC 1I9EA 2APWA 5JW4R 1T20A 3VH8A 2CDFA 1G0DA 5EO1B 3BSZL 4X7SH 1CQYA 2P1YA 5JO5B 4BQBA 1KN2H 1RZJC 2GJ6D 1FYHB 4OCXH 5BQ7A 2R9HC 4JO3L 4NRXA 4IRSB 3QFDA 2NLJA 1OP3K 2XY1A 2WNGA 3AAZB 3ZE0E 4M1DL 4IRJC 4GSDL 3QCTH 5D7JB 1MVFA 3QUXC 2XQYG 1JJUA 1JI2A 5T3XD 3S36L 3WNMA 2N4IA 2B5IB 3B6SA 1W8NA 1DUZA 1OY3B 1RZGB 2K7PA 4WFGE 3IXAB 3O3DB 1J0ZA 1KPUB 2F53A 5EU6A 3GMLB 4YHZH 2P7TA 3PWLB 1FFPA 4OZFG 1DQMH 5T1KB 4A6YB 1WTGT 1FFQA 2AEQH 5E9DB 4CVUA 1AE6H 2NXZB 5D1QA 4ETQB 2JELH 3GSVA 1CGXA 1HSAB 1T6WA 1C1EH 3BGAA 5HDLA 4WFGD 3CFBB 1FNGB 1ZGLM 1ZGLA 1BOYA 1KBGL 2YD1A 2IBZY 2ZSVA 4PGBB 1FFOB 1NCBL 1DN2A 3I02B 4JZJC 2VIRA 4GBXC 1CDYA 2A0LD 2ATPA 3UXFA 3WIIL 1AIFA 2JK5B 2Z31D 2Q1EA 2YPLA 3F6LA 1YNTA 1UXSB 2ITCB 4HC1L 2NY2C 4N5ED 1BD2A 1S9VA 4PJ7B 1N0XH 4MSWA 2AGJL 4RA3A 5KVFH 4LLUA 4XCFL 4ZOBA 2DTMH 2LVCA 2YD2A 1INDL 4ODUA 5TDPA 2CRMA 1C08B 1T89C 4XWOC 4QHNA 1JNHA 1FG2A 4PJXA 3HE7C 4LPCA 4DEPC 5CJXA 4P3DA 2GSIB 4MNQB 3O9WA 1JPST 2OP4L 3MOQA 2HG5A 4ZO7A 2CIKA 1IT9L 2DLHA 1U8PA 2B0SH 4P9ML 1IAIL 1U93B 5BZDB 3VD9A 1Z0MA 3MTRA 1AXIB 1KPVA 5FK9B 5JMRA 2OL3H 1R5IB 3UTTA 1TZGH 5BXFB 1FNHA 1MH5A 3D3VA 4ZS7L 4X0KA 1C7TA 2H26A 1SY6A 3HB3D 5C0RH 1BFVH 4N0YH 4IOIB 5AYQA 2H3NB 1Z3GH 2WUBL 5C0AE 5GJSH 2VDMH 5CIPH 3EGSA 4CADA 5FGRA 4OD3H 1D5XB 5C8JA 2VC2H 2D03L 1A7PH 3OKKA 3KLAB 3L9RA 5J6HB 1JWSA 1DFBL 1CBVH 5IM7B 4EDXA 3VFPB 3TO4B 3ZHDA 2Y6SC 1KN4L 1FG9C 3G5XB 4JFHE 4O5LL 2VLME 3FQTB 5MEPB 4PRPA 1S78C 1UGNA 5EIQA 1X7QA 4PJAA 3GI8H 3H0TB 3LHPH 5C0AD 1T1ZB 5L6YL 5DC0A 4UTAH 4PV8A 3VWJD 5HGBB 2X44D 1CI5A 3FO0L 5KAQF 4P2YA 2YD4A 5B39B 2BSTB 1B9ZA 4MDIA 4Y2OA 2DQEL 3GBLA 3HMWH 4LVHC 1MAML 3PHOA 4HT1L 2W9LA 5C0IA 4RFOL 4JFHD 2VLMD 5HGDB 1CFSB 2PKDA 5DF0A 1M71A 4PJBF 3W5MA 4MNHA 3LS4L 4KK6C 1KT2B 2HFEA 1XGTB 1I1RA 2ZUYA 3K1KC 4JVWA 1CLYL 3QFJE 1J0JA 5D8JH 2R69L 4NM4L 2PXYD 3VGFA 5F9OL 4KWUA 2W92A 5SV4A 4XH2A 1E4XI 3MRIB 1CXLA 3EDJA 5E8NB 5E8DL 4GFTB 5CS7A 4JR9H 5IMKA 3RA7L 3BPLB 1T03L 2P5EE 1GL4B 4Q97A 4YGVA 2KH2B 2W9EL 1FORH 5DD6A 5IW6A 3DO7B 4Y4HC 5JPMA 5ILTH 5GS2H 5GZOC 4PJGF 3QFJD 3EOAA 2VZSA 3QXTA 2YS4A 2VE6A 1MRFH 5DWUL 2JCCF 2APTA 3VXQA 5IMOB 1CICA 5J1AA 1Q38A 9CGTA 2WANA 4OCRL 3BOVA 3QWRD 4ONHA 4PJIF 4JG0L 4OT1L 2IG2L 1I8MA 1FJ1B 2P5ED 1OTSC 1UVQB 2EYSB 4HXBL 1OCWL 3LIZL 5EOQH 2B2XL 5GGTH 1BX2A 1U41A 3T4YA 2F53B 4NQXB 5EU6B 1OL0A 4L8SA 4H5SA 2AEWA 1X4XA 3ECBB 1FFPB 1MLBA 2Y5TA 3Q3GA 4MD4B 4O58L 4XNQB 1NCDH 7FABL 1UZ8B 1NEZB 1OAXL 5FDWA 5D1QB 2G9HA 1BLNB 4RGMB 1NCCH 3GSVB 5GRUL 3MA7A 1EEQA 4AIZB 3QEQA 1CGUA 1ZGLB 5EN2B 4MAUL 2E8ZA 2PR4H 4X99A 1VGKB 2A9ML 2MCPH 3KJ6H 5GRZA 2KDGA 3ZE2E 2ATPB 1W0VA 4RWYH 1A21A 2AJVH 3DX9A 1GIGL 1SJVA 1CGSH 2DIJA 3MLYL 1TZIB 5CP3A 1S9VB 5CJQL 4MSWB 1FNAA 1T5XA 2ICWJ 3OBAA 1QEWA 1BVLA 5JLZA 3TESA 4Q0XH 1FFNA 3OAUH 1FL6A 4QXGL 1MF2H 1KCVL 3DX6A 2YPLE 1KEGL 3D0LB 2R1YA 3HE6A 4JB9H 1BD2E 4DTGL 5BV7H 1FIGL 2HG5B 1IL1A 5E2WH 1P7KB 5GIRA 5MENB 3C6LA 1U8PB 2BJMH 2DQIH 4RFNB 1DQLL 3CJJA 4GKOA 2AQ1A 3O6FD 4PJXE 4HIEB 2UZIL 1S3KL 2F5AH 3H3KA 4PRIB 4XNYH 1JGLL 1MH5B 2KBGA 4I77L 1VENA 4QRSA 4L5FH 2Y07H 3W81A 4Y2DC 3GJFH 1N3NA 5CJOH 1G1YA 2YPLD 1CCZA 5D1XC 3L5IA 3PP4H 3T0EC 1MJ8H 1YNKH 4N8VA 2FR4A 4NKMA 1BD2D 3PDGA 4NZDA 3UTTE 5ECJE 3DIFB 3VDAA 25C8H 4F58H 3D3VE 4DFIA 3MJGX 4EDXB 3QUYD 3IGAA 3LN4A 4U49A 4JDTL 5I8KL 3MLPA 3O9WD 3BPNC 4V2BA 2FEEI 4KTEL 5AZEH 3B9AA 2XA8L 4Q9RL 5F6IC 4I2XA 4OGZA 1NDGA 1TIUA 4PJAB 1VFBB 2APFA 1CDHA 1EAPB 4UV7H 3NFNB 1G7PA 1PD6A 4OLVH 3UTTD 4JPVL 4K9EC 4P59L 1BJMA 4RMRA 5HYQA 3WFHB 4UBDC 4GG6F 4P48A 4MXVE 1ZLVK 3D3VD 3MREB 3IJSB 2EE6A 1KJ3L 2Y5EA 1Y6KR 5GGVY 3DMMA 4ZOCA 5CGTA 2EYTA 2ADGA 4MQ7B 2OI9B 3QEHB 3SDDC 5H35A 3BP5A 1L7TH 1VEOA 2ZUXA 4L1HA 3WS3A 4LSPL 4JFZL 3T1FA 1VFOA 2GT9A 4X8JB 3K4ZA 4HXAL 2GYSA 4YPGB 1FYTA 2EDNA 4AEIL 3MBEC 5CWSB 3CXDL 3BRDA 1ED3A 3H8NA 5EWIH 5JW4M 3MLWH 4ZS6C 4QNPE 5B38B 4UNTA 2W0PA 4M48L 1XR8A 3H3PL 3QZWA 4PB0L 3S37X 3MLRH 5DVLA 1ZVYA 2AI0H 5LGJA 5IB4B 4R6UA 5IW6B 1F6AA 1ZWIA 2YKLH 3LKOA 3F7PC 4PLNC 3QIWA 3MLUL 5SX4I 2EYRB 1XIWC 4U1MB 4JRYE 1X5KA 2EDLA 3G5YB 3HI6L 2K9UA 3EOAB 5J1SC 1CXHA 2XIDA 2K3TA 1DR9A 2FL5B 1KYOK 2IGFH 4RISL 4Z7UA 2FH8A 3KPMA 4DGIL 5B3JE 4HJJL 1KUMA 3IDGB 2Q8AL 1A6ZA 4J3TA 4P2OA 5C7XH 1OQOA 5A2IH 3FQUA 3V4UH 1J8KA 4GRMB 1KELL 3A67L 3T4YB 1MJUH 1PEWA 4JRYD 5D7LA 5CZKA 1P4IL 4GQPH 1AGBB 3MRRA 1QACA 3EO0A 5HHQB 1QFWI 3FOMA 4D0BA 4H0IA 5FDWB 3RVWD 3W5NA 3WFCL 1RJCA 3EYOB 5GS0H 3QEGH 3WS6A 1JPTL 4KKNA 4OAWB 2V7HA 3GIZL 1A4KB 4HV8B 4LVEA 3P9LB 2VXTL 3OXSB 4L29A 4U1JA 1D9KC 4WU5B 1CICD 1RZKH 5I19H 5FOJA 3P4LA 1ZK9A 1UM5L 3CVHA 3ARWA 3RZCA 4TN9A 3WJJA 4QRQA 4X99B 3U30C 3B9DA 4G8IA 1RSFA 3C8KA 1JF1B 3QEQE 3MRDA 4BZ1L 5DUPH 4XC3L 1X5FA 3MOAL 1IEHA 1BOGA 4LSSH 1QEWB 2QR0A 3D18B 5JA8B 5I1LA 1V3LA 2EEAA 5GGSY 4NRYB 3PHQA 1DJSA 2R1YB 3MLXH 4BK4A 3HNTH 3KLHC 5IVXB 2WWMD 1T0MA 2C4XA 2X2YA 5J12C 3RUGE 3QEQD 3DRQB 3V4VL 5I30H 2AJYL 3GMRA 5B8CC 5FOBA 3MROA 4FZ8H 1I85C 1K6QH 2IAMA 3WCYA 1BVZA 4H1LB 1T0NA 4PJ9B 2ICEB 3RVVC 1AD0B 3REVA 3P9WB 2GW5A 4M6OL 5D7IA 3RQ3A 1S9XB 5CINL 1N3NB 3T04D 4NUGH 4DVRL 5TE6L 3K2UL 1QRNA 3MODL 5IB3A 1CWVA 1B3JA 5KTEH 1RUKL 2ZNXA 2CLRA 5F93C 4ZXBA 3GMQA 1MOEA 3R0NA 3GBMH 1CVSC 3SGKC 4LL9A 1QBLH 2YD5A 3LN4B 1A14H 3QNZB 1S7VA 5T1DH 3PWPE 2P49B 4M1GH 4RNRA 5F9WB 1OVZA 2ILLA 4R2GC 3HE6D 3BH9B 3BGMA 1CE1H 4XNXH 1NEUA 5ACLA 1R3JB 2VXVH 3C6LD 4ZO8A 3QIBA 4FRWA 4HUNB 2HWZH 1FLRH 3WFBH 5DRXB 4G43B 3SE3C 1MFAL 3UEZA 3PL6A 3EHBC 4CDGC 2XN9A 3OHXA 4X9FA 3IF1A 5HDQH 4J1UA 1FV1A 5HYQB 2V17H 5GS1A 5B39G 2YXFA 3DMMB 4G8EB 4I2XE 2EYTB 1ZT7A 5ADPH 1CU4L 3PWPD 5F1SA 4ZFGH 4FMKA 4XCCL 1ORQA 1IGCL 3ARYA 5DS8B 2V2WA 1DQDL 1CS6A 2GT9B 3S4SB 5DD5L 5KBNC 1FYTB 3NA4A 2XQBL 4BJLA 4NO5A 4MJ5A 3ZKND 3BEWA 1TVHB 1ED3B 5HXMA 5K9QG 3T0BA 1LEGB 3EYQC 4OF0A 1MPAH 1HHKA 5FV1L 3MRQB 3V5KB 4H26B 4JLRA 1IE5A 1NCTA 3L6FA 5LGJB 2R4RH 4OZGF 4R0LA 5HI3D 2QHRL 5DJ8B 3VXPA 2X4PB 3UJTL 3ZDYE 2OMBA 5JDSA 1OP5H 4L3CB 5D4QA 3C2AL 4MA7H 5IHZA 5EUOF 5HI5D 1F4AA 2DN7A 4GOSA 1FQ9C 2C1OA 3FB8A 2P24A 5EPMA 2E27H 4Y19E 3OKEB 1RU9L 1OAKH 4YHOH 2OBGA 2CJUL 1A7OH 3RTQD 3U83A 4OJFH 3VFGL 3LRSB 4KXZH 1LO0H 5D7LB 1UCBL 1QKZH 1TZHB 4RX4D 2UY7A 2J88H 1KJ2H 2C1PB 4J8RA 1G6RL 5IB5A 3LSOA 2X4UA 3C60B 4RGOL 1GC1H 2QQKH 1I9IH 3KS0J 4G8FB 5DK2A 3WN5A 1NEZG 1PBYA 5IV2B 4KZEH 3WDHA 3QIWD 4M7JH 4Y19D 4OCWH 4KRNA 4Z0BH 2YZ8A 3OF6A 5ALCH 1AD9B 3TBSA 4OIAA 4LOUC 4H88H 4U1GB 4EUPH 15C8L 3CVHB 2BP3A 3MXVL 4DK6A 4PV9A 5DEFB 1A1NA 4G8IB 5DO2D 4L8CB 3JWOL 4WENB 1IC7L 4P2OD 2FB4L 4PREB 3AREB 1F2XK 4QOKB 3GUTB 4NSKA 4ZO9A 1S7XA 2VITA 1BWWA 1INQA 2B1AL 3CCHB 4JHAL 3QO0A 1MFDH 3OJ2C 1RIUH 4BA8A 4NNXB 5LAXB 2P48B 1MHCA 4URTB 2VDNL 2QR0B 1AP2A 4NN6B 4TOYH 3WUWA 2NY1D 2CK2A 1QBAA 4JFOA 1XF5A 4QXTA 5I1DB 3FQNB 2A1WL 4R96A 3ZTNL 2GTZA 4X4YA 4XPFL 4JN2A 2A6DA 1R5VB 2ARJA 1KB5L 4X5XB 4RSVA 5ADOL 1A02N 4WWKA 5FOBB 3J7HA 3STZB 2C3VA 5BO1L 1EUTA 3H9SB 5IEHA 3RZCD 3FO2A 2YR3A 4TPRL 3RAJH 4G8GA 3REVB 1KCSL 3V0WL 4BFIA 4M7ZC 1CL7H 5CKAA 5JW4Q 1EMTL 1TJIL 1JGDA 2VR4A 1DLFL 4FNLH 4NKIH 5B3NA 4OV5A 4ZSOA 3GMQB 5T5NG 5DGRA 5D1ZA 2NYYD 1CE6A 3E6HB 2E7LC 5D7IE 2HAZA 5D96B 4LLVA 4ZFFB 1QHPA 1UKQA 2D7MA 4XVJH 5M94B 4RNRB 4M9OA 1QRNE 5K9QI 1GPOL 1KB9K 5JHLH 3QUML 4LLYA 1MCRA 3QIBB 1A9EA 4U6TA 1NGYA 2NW3B 3PL6B 4OM1L 3OHXB 2IAMD 2GJJA 3TVMA 4J1UB 4X6EB 1NFDE 3SGEI 4JDVA 4MCYA 3NZHH 5E5MB 2O93L 3RIFK 2A6KA 1VB9A 5TDOA 4J2XA 3N1GC 1QRND 1H3VA 1D5BB 2HVJA 5ELIA 3ILPB 3RZWA 1FNFA 3MRPA 1I7UB 5JZ7C 2V2WB 4NQVA 2XN9E 4XHQA 1CR9L 5E8PA 4ZXBD 4OUUA 4P5TB 3MRCA 4WHCA 2NZ9D 4U2YA 3M45A 2PF6A 2R15A 3BUTA 3SCMD 4HAFA 5DEGB 1AGCB 4L4TA 1TQCC 4HBCL 2WSKA 5DD1L 5DRZB 1JZ7A 4YE4H 5LJYH 3IKCB 2XWTB 5GQBA 4K8RH 3QUZB 4HCRA 3RU8H 2LFGA 5GRVL 5B38G 2CD0A 3GGWA 5AG9A 5GGQL 2HJFB 1HHKB 3DVFA 1UJ3B 4ZPVA 3O3UN 4PGCB 3OKLA 1ZA6B 3RNKA 3O3EA 5BMFL 1SJXA 2XN9D 4M5YL 3WNOA 1H5BB 1WK0A 2WUCL 3HLAA 1OARL 3VXPB 1V05A 3QSKB 4L3EA 1FH5L 4Y4FC 4HK3N 1AFVL 5D5MA 5HDBE 2IPUK 3T77A 1FNLA 5F7FA 4BSVA 4BZ2L 5IHZB 1RHHA 2C1OB 4KQ3L 4XMKL 3QI9A 3HRZA 2P24B 1BZQK 4Z7WE 1PX3A 1T1YB 1ADQL 1UACH 2QADC 4KTDL 5MI0B 3HZKA 3CFDA 4YHNA 1AHWC 4NO0B 4K94L 2EO9A 2E6QA 2X9YA 3UJIL 4P23D 4KRPB 3HMXL 3KHQA 5FYJH 1MQKH 2J7LA 4TULH 2AABH 3SPVB 4YXKL 1PZ5A 1ULVA 3LPFA 5EC2A 4MB3A 3IAGC 2Z4QA 5MP6L 3O81A 3EO9L 2Q7YB 1QSFB 4OZHB 1I7TA 3CLEH 4LQ1A 1IQWL 1QLFA 3GRWL 3L3IB 2WWKO 3UTQB 1ND0A 1T2XA 4Z77A 4JFQA 4F8TA 2N7AA 2YD6A 3WFEH 1TITA 2IBGA 4XVTH 5HYEA 4HKBB 4PV9B 5I17A 3DETC 4I9WE 2FX7L 3MFFB 2NZIA 1EUUA 1RZ7L 4QGTA 1FPTH 4NHCL 1E4JA 4KI5C 2HRPH 5ICYA 3P11L 2D2OA 4NNYA 1INQB 3BKCH 4HK3J 3QO0B 4K3HA 3C08H 3CFJA 5HHME 1FE8H 2J8HA 2A73B 3QXUA 1YECH 3P73A 1QSZA 1A7QH 3VGAB 1W72A 5DJXB 5JIPA 2FHBA 4QXTB 4I9WD 4X4YB 4M62H 1YC7A 3OF6D 5HI4D 4YR6B 3U7YH 4E42A 4XVSL 4QTIH 4DKAA 1GHFL 4OF6A 4OGYH 3DV4B 5ID1B 3K46A 2ARJB 4K7FA 5BV7C 1RIVL 5E6ZA 2RIKA 1XCTA 1LP9E 5HHMD 3FT2A 3MLSL 4H1LG 4QRPA 5ICXB 3MACH 1KV3A 2XWJB 1F58L 4LRNL 5IWLC 4L9LA 1AI1L 1MI5A 1FZJB 5T3XH 1UM6H 4PJ8A 1JGDB 3VD3A 1U8NA 2FBJL 4LU5H 1JHKL 4PJ7F 4OIIH 3ZE1E 1CFTB 1K4CA 3OX8B 4XTRC 5I2IB 5D1ZB 1CE6B 4G8GE 1VFAA 1NGXA 4MD0A 1MCPH 4QWWD 1EZVY 4QHLA 3MBXH 4UT6L 2PUQT 1BQHB 3S3JA 4PJFA 3UTSA 2EIZB 4PS4L 5EIIB 1G7MA 1DQJA 4ZSOE 4LLYB 2Z91B 4ENEC 4KJYA 3SE4A 3SDCC 2V9QA 4WWKD 1MFBL 4MAYC 1YY9D 2EC9T 3HI5H 4Z7VE 3PGCA 1T22A 4MCYB 2ZCLH 4G8GD 3TIEA 3D2UA 3H9HB 5TPWH 2VDLL 5GJTL 4EQ3A 2A6KB 2DB8A 4OM0H 1T2JA 5TDOB 4X7FC 4CMHB 3C09C 3WIHA 3HC3H 4NOBA 4YDKL 1NANH 2VSCA 4NQVB 5I0ZA 3IJHB 1NAMH 5E8PB 3OB8A 5J9PB 3S4SG 4OUUB 1DVFA 5E00B 4QY8B 4HGMA 4NJAH 2FNBA 2D4DA 4OF3A 1PG7X 1KEMH 3MO1B 3W9EA 1IEBA 2OTUA 2BSED 2QKIA 1H0DA 4CBPA 1EPFA 5DFVC 1KLGA 1G9NH 2VDOL 3UJJH 3TWCL 4KROD 1NCUA 3OXRB 5EFIB 1KNOA 1BQLL 4YUEH 1Y6MR 3ARBA 3QXAA 3UPCA 2RBLA 3SDYL 3TVMD 4L4TE 5FYKE 4WUKL 3QCVL 1N59B 1JPSH 4FG6C 1FO0A 2IH3A 1U8OB 4YNYB 4BSVB 2XKSA 1FGNH 2ERJC 1RHHB 4XBPA 4PP2A 3IDJA 4HUUB 4I4WB 4NWTH 3MV9B 1UYWH 3OGCA 4I3SL 4QCIA 3PIQA 4ODVH 4L3EE 5D5ME 5HYIA 2H2PC 1QFWL 2AP2A 4BUGA 4K3EH 4XGZA 1T4KB 4L4TD 3P40A 3CFDB 5FYKD 1F90L 4YHNB 1ZTXH 1TQBB 1HNFA 5I16A 4MS8C 3NIDF 4JO4H 2AJUH 4N9GB 3GSNL 1L0YA 2ARJQ 2NY4C 5CEXB 3D39E 4IRJD 5C09A 5IIEB 1HQRA 4NHUB 1NGPH 3NPSB 5HJ3A 2QLVB 2PW1A 1I8KB 5L9DL 5E1AA 3JWDH 2IH1B 5F7LB 1PZ5B 2MSPA 1JWMB 5EU4A 3U1SL 3V0VB 1I3GL 1IZJA 4L3ED 3L1OL 1WWAX 4Y7MA 1D3CA 1URLA 1ZLWK 1U42A 1SBSL 1XGUA 2D31A 3LN5A 5FYLE 5GS0C 2A6JA 4Z9KB 2XKUA 1ZHLA 2P8LA 4Z77B 4JFQB 4OI9A 3D39D 1J8HA 5DJ2A 3DVIA 2R4SH 1RPQA 3RY6C 4PJEA 4XNUL 3S6CA 1G9MC 4U1KA 4WUUA 4J12A 1WZLA 2AXGA 3G6AB 5IHUH 5ENWA 2BZDA 2ZG2A 3CFJB 2HT2C 2DICA 1K5NB 3L95B 4I5BA 3ARXA 4NQEA 3O4OB 2E5EA 1LO5B 3QDMB 5FYLD 1WLHA 2QHLA 4AY0A 1KULA 2YD8A 3I50L 2EKSA 3PGDA 4XP5H 2O5XL 4J7RA 1CIUA 2H32H 1HHHA 3NZ8B 3MJ9A 2KL6A 2NY2D 1DSFL 1JF5A 4UT7H 2GAZA 3LV3B 3HR6A 1NC4A 4Y16C 5T3ZL 2BNRA 2G2RA 3GMPA 2ZP0T 3JV4B 2WP3O 2KZ1B 4D9LH 1XCTB 1HXMA 3R1GH 1UWEL 2NY6C 4I18C 4XRCA 5DUBB 4AT6A 1J12A 3HUJB 3H6JA 4OGXL 4YZFE 5FO9A 3VXMA 1VESA 4ZUTA 5IFAH 1PLGH 1YEGL 5CCKH 1B2WL 1CFVL 4XMPL 5I1GL 1MCBA 2IPKA 3SEPA 4UQ3B 2DWDA 2WMPA 4QRPE 2VZTA 4IDJL 4HFUL 2VO5A 3UYPA 4M6NH 4F9LA 3PJSB 1KTKE 1NGXB 1U3YA 5IUSA 5IEKA 3EFDH 4MD0B 1MI5E 3IU4L 5C0EA 2ADIB 4NT6B 3SDDA 4BK5A 1AY1H 3FN3A 3UTSB 4DKFL 1FL3B 3P9MA 3QNYA 1G7MB 1DQJB 4KGLA 3KYOB 1LQSR 4OLUL 2XTJC 1BWMA 4X6CA 2IMMA 2V9RA 5B4MD 1DBKH 3MBEA 1QRKA 2Y25A 3ARGB 3BZEA 4Y88A 1NCAL 4QRPD 5A40E 4G6ML 3BP4B 5C86A 3FONB 4G5ZH 1S78D 2Z8SA 3D2UB 3TIEB 1XF3A 1ORSA 3GHEL 4XCEA 4PJFE 4EI5A 4NDMB 1MI5D 3O6ML 4PJ8D 5CGYC 2OQJA 3O3BA 1KENH 1MVUB 3ZYZA 4CU7A 2P5EB 5DJYA 2R1XB 5SWZA 1LEIA 4KVNL 4KRLB 5T5NF 1MWAL 1DVFB 3GKWH 2Z8RA 3L5WB 4Q7DA 4PB9H 4AG4L 2VL5B 3DV6A 4DUVA 5BS0A 2RFXA 4YIQA 2VKWA 3BO8B 3SJVA 3W9EB 4X7SL 1X5HA 4RMQA 3CH8A 4HGKC 3QXVA 1KN2L 3NCYP 2ZUVA 4OCXL 1TDQA 4OLWH 2FJHA 1KLGB 3O0RH 4K2UH 4KJPC 2J8UA 4Y8DC 2HFFA 3T8XB 4KK6D 5JHDA 3FFCE 4IHOA 1Q0XH 3ARBB 3WNKA 1A9BA 3QCTL 2G75A 2G5RA 1JUFA 2WQ8A 2UUDK 3D25B 4FQPA 1J1PH 4PPTA 1WAAE 4HJGA 2GITB 4WO4C 3MCG1 1AQDA 4ZOAA 1FBIH 4HIIA 5GZNC 5HYFA 2O5YL 4XBPB 4PP2B 4A2LA 3IDJB 4ELKB 2YN5A 2CUHA 3BP7A 4JY4A 1NFIB 4YHZL 4QCIB 4OD2A 5DMYA 5D70H 2R23A 1WIOA 3VFOB 3RX7A 4OSUH 1DQML 3FFCD 4JM2A 3U48A 3B43A 2CO7B 4PG2A 2AEQL 4S2SB 4XGZB 1AE6L 4XPGH 5I16B 5I18L 4L4VB 4M5ZH 1YYLH 3BEVA 2JELL 3RWFB 3LEXA 1C1EL 4ONFH 5C09B 3F12A 3NBNA 1HQRB 1P69B 4GRLB 4UUJB 3BAEH 4ZDHA 2PW1B 2LAAA 5EU7C 1I1YB 4ZAKA 4D94A 3Q1SH 5EU4B 1WFOA 4PUBL 1YQ2A 1GC1C 1KPRA 2H2SC 3O6LH 4UIMA 4OLXH 4U7MA 3NOIA 5HGHB 2PYEA 3PNWB 2D31B 2Q6WB 1PKQA 2F5BH 4KTYA 1N0XL 5I71C 3HAEA 5KVFL 5JQ6L 2BY0A 1REIA 1G0XA 2DTML 2LABA 4K71C 4HMEA 2I9LB 1MIMH 5TF1H 4M6AA 4PJEB 2X4QA 5I1EH 3B8YA 3VE0A 5E7BA 1XGPA 4U1KB 1DBJH 2R2BB 4WUUB 5F8QC 5IB1A 2AK4A 3OR6A 4S1DD 5B8CA 3L3DB 4IEFB 3U4BH 2FHFA 1J8HE 1QO3A 1T5WB 2B0SL 1YEDB 5A16A 2JKXA 2EKSB 1AC0A 3ULUC 3QO1A 2OL3L 2RQ8A 3L3HA 3QEUB 1OAYH 3MUGB 5I8CB 3S7GA 2X10A 1TZGL 2YBRB 4LAQH 4GXVH 1NDMA 3DHMA 1VSCA 2ZOKA 4LK4A 2GK0A 5J57B 2GAZB 1NC4B 1AO7E 4NQEE 2F8XC 2EDYA 2VN4A 2G2RB 2LV4A 3GMPB 1BFVL 2CPCA 4N0YL 5C0RL 2LU7A 2JJSC 1GRWA 1Z3GL 5C70A 3RL2A 1JFQL 2VDML 4X6DF 1J8HD 1YEKH 5HHPA 2VC2L 1A7PL 3SDAC 2WBJA 3CC5B 1CBVL 1N6VA 3GSOA 5L2KA 1S7QA 3Q6FA 1S7RB 1MSPA 4P2QE 5FO8B 2C3HA 2BNRE 3LPGA 3QJFA 4M1CC 4U33A 3OQ3B 1E6OH 5J6GA 2IPKB 5KSVA 4RMSA 3FJTA 3U2SA 2X7LB 3MNVA 2DMBA 1AO7D 3IDXH 4NQED 5AZ2L 3EO1A 3GI8L 5I66B 3VXME 1ZVSB 3LHPL 2ZCHL 1X6LA 5IEKB 4O2EA 3CDFA 2GCYB 4UTAL 1GYAA 5D1XD 4YFLI 5IVXF 3MLZH 4DN3H 3ZSTA 1BQHG 1EFQA 3AS0A 3QNYB 4NQCA 2DQDL 4P2QD 3ZKMD 3T2QA 5BOZG 1Z0NA 1F3DJ 1YNLL 2BNRD 5C0FA 5I1CH 4OZ4A 4LQFH 4CKVX 4MA3B 1RJZB 3H7BA 1C12A 1ACZA 1F45A 1IGJB 1T7XA 1PVHA 3BISA 2WM0A 5DMIH 5I0DA 5MERA 4PRHA 3N1FC 3VXMD 3OKMA 1ORSB 2Z0BA 4XCEB 4RAVA 3LZFL 4PD4J 3DXAE 5D8JL 5KS9A 5IMLA 4U1SB 3C5SA 3CU1A 3K3QA 4LSDA 4M6MH 4X6CE 1U8HA 3VCLA 4HG4J 4PYHA 5T1LB 1YA5A 4JR9L 1YZZA 4UBDD 5KOVC 4MNGB 4JFFA 4LBEA 1RJLA 3DV6B 5BS0B 3RGVC 4JRYB 2Q86A 3O8XC 3SJVB 5ILTL 4JANB 3SDDD 1UADC 4C56B 4HIXH 2UYLA 5JW5B 3SGDI 5SWZE 1W0WB 3DXAD 4HLZG 5EO9B 2FJHB 4M43H 1TTGA 1MRFL 2JJVA 1J05A 1QFHA 3MBED 1XFPA 5ISZA 2G75B 4JFYA 3MGOB 3BHBA 4AENA 4Z18A 1JUFB 3NCMA 4ZS6D 1K2DA 3HTLX 3DWTA 3TNMA 4M8QA 4EI5D 5I9QC 2AXFA 2OR9H 3DECA 1ZVHA 2XNAA 5EOQL 3U79A 5GGTL 5JHDE 4FOMA 4LHUA 3DI2B 1LE9A 2BC4B 3GBNH 4HEPG 5JW4N 4YK4C 5SWZD 4KJWC 2HKFH 3CK0H 4RDQG 1XIWD 1O7VA 3SO5A 1I4FB 4JM2B 2I27N 5EZIH 3BKML 3F7VA 1NCDL 1J10A 5IJVA 2VLLB 1NCCL 1GGCH 4F3FB 1CG9B 4K3JH 3ME0A 1VADB 1C7SA 4OLZH 1V7NH 2P8MA 5JHDD 2EDXA 4ZDHB 3ZDZF 1TTFA 5KANG 3T0AA 4FFZL 4ZAKB 4D0CB 3B9KC 2FD6L 5C0BE 2MCPL 3KJ6L 1OPGH 2DWEB 1RQ5A 2IBBA 4C59B 2VOTA 3OL2A 3P0VL 4RWYL 1UB6A 5KG9B 1J86A 2AJVL 1PKQB 4QRRB 3K4DA 4Z76B 3O2VH 4PRDB 3N85H 3FOLA 3HAEB 1JZ3A 4YWGH 1I7RA 1ZHBA 3OAUL 3VE0B 1MF2L 1WWWX 4UMGA 4X80H 2APVA 1ZLVH 4J3SA 2PYEE 5C0BD 5IB1B 4JB9L 5HPOA 3OR7A 3L3OA 1D9KD 1PQZB 2X4NB 1T21A 5T5FH 4JFDA 2X9WA 1GJIA 3RX8A 1HHJB 4KDWA 3EW3B 3EYVA 4GKNA 2BJML 2DQIL 5A16B 4S0TD 3RGHA 1CF8H 4P4KC 2V2XA 5IVZA 3IJYA 1IKNC 1TVBB 4I48A 2AK4E 4UV4L 5E70A 4JRXE 4PYGA 1NDMB 2Y07L 2DQCH 5CJOL 2ZJSH 3EOYG 3VXUA 2PYED 4QT5B 3PP4L 1MJ8L 1YNKL 2E7LA 1U2HA 1LE5A 1DZBA 1FHGA 3RL2B 5EOCJ 4ZUSA 4I0PC 2OZ4L 5HHPB 3WO3B 5BW7C 25C8L 3BQUA 5SWSA 4F58L 1WQVT 1DANU 1WFUA 2VR5A 4I8DA 5TH2B 3KLHD 3PWPB 1CK0L 4XHJC 1XZ0A 4HPYL 5IBTL 1T80A 2HVKA 3QIUB 1QBMH 1U91B 2AK4D 2KPNA 3ZHLA 4JRXD 3TYFB 5I1AA 5J6GB 2IANA 4XP1H 1HYRC 3FRPA 2J5LB