4IE1A

Crystal structure of human arginase-1 complexed with inhibitor 1h
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
314
structure length
314
Chain Sequence
SRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase-1
publication title 2-Substituted-2-amino-6-boronohexanoic acids as arginase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 114
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 4ie1A00
1WVAA 3THHA 1HQHA 1PQ3A 4GWDA 3F80A 4RHQA 4GSZA 4RHIA 4FCIA 1TBJA 4MYKA 4Q3RA 4Q40A 3KV2A 4RHLA 4Q3SA 3MJLA 4Q3QA 4HZEA 4IU0A 4I06A 1GQ7A 4MYLA 3THEA 1WOIA 1RLAA 2EF4A 4IU5A 4IXVA 1T4TA 1WOGA 1P8QA 3TF3A 4IXUA 3E9BA 3CEVA 1T4SA 1HQ5A 1T4PA 1T5FA 2PHAA 3NIPA 4GWCA 5HJAA 1XFKA 4Q3TA 1R1OA 4FCKA 4Q3UA 1P8OA 3E8QA 1P8NA 1TA1A 1TBHA 4GSMA 3THJA 3SL1A 4DZ4A 3SJTA 2EF5A 2CEVA 4RHMA 3RLAA 4Q3PA 4MYFA 4Q41A 1HQGA 4HXQA 3LHLA 4Q3VA 4IE1A 3E6VA 4CEVA 3SL0A 3MFWA 1P8SA 3E6KA 2PLLA 3LP7A 3TH7A 4Q42A 3MMRA 2PHOA 3SKKA 1P8PA 1P8RA 1ZPEA 3DJ8A 2RLAA 3MFVA 3NIQA 3NIOA 1P8MA 2AEBA 3LP4A 1HQXA 1T4RA 1GQ6A 1ZPGA 1HQFA 5CEVA 5RLAA 3GMZA 4MYNA 4GSVA 2ZAVA 3GN0A 4ITYA 5HJ9A 1T5GA 1D3VA 4IU4A 1WVBA 1TBLA 1WOHA 3PZLA 4RHJA 4Q3RC 4G3HA 1CEVA 4MXRA 4RLAA 2A0MA 4RHKA 3E8ZA 4HWWA 3M1RA 4IE2A 4IU1A 2EIVA 4IE3A
chains in the Genus database with same CATH superfamily
3C0YA 1WVAA 3THHA 1HQHA 2VQWG 3MZ3A 4LXZA 5THSA 1PQ3A 2VQQA 4GWDA 3F80A 4RHQA 4GSZA 4RHIA 5THTA 3MZ4A 5EENA 4FCIA 1TBJA 4MYKA 4ZUNA 4ZURA 4Q3RA 4Q40A 3KV2A 4RHLA 5JI5A 4Q3SA 3MJLA 4Q3QA 5EFBD 4HZEA 4IU0A 4QA7A 4I06A 1GQ7A 4MYLA 5G17A 3THEA 1WOIA 4RN1A 5EEKA 1RLAA 2EF4A 5G0GA 5ICNB 5DC5A 3EZTA 4IU5A 1C3SA 3C0ZA 1T4TA 4IXVA 4QA2A 5D1DA 4BZ9A 5EF7A 5G11A 4CBYA 5G1AA 1WOGA 5EFGA 5G1BA 1P8QA 4ZUMA 5A2SA 3TF3A 4IXUA 3E9BA 1ZZ0A 5IWGA 3CEVA 1T4SA 3Q9EA 1HQ5A 1T4PA 1T5FA 2PHAA 3F0RA 3NIPA 4GWCA 1XFKA 2VCGA 1R1OA 2VQMA 3EW8A 4Q3TA 5EFKB 3SFHA 4FCKA 2V5WA 4Q3UA 4QA4A 3SFFA 5FUEA 5G0JA 5G1CA 1P8OA 2GH6A 3E8QA 4CBTA 3Q9CA 5G0XA 4A69A 1P8NA 5G0YA 1TA1A 4ZUOA 1TBHA 4GSMA 3THJA 3SL1A 4DZ4A 5EEMA 1T67A 4LY1A 3SJTA 2EF5A 5DC8A 5EFJD 2CEVA 5EFNA 5DC6A 3F06A 4RHMA 1ZZ1A 4MYFA 4Q3PA 1HQGA 3RLAA 3ZNSA 4BZ8A 4Q41A 3MZ7A 4HXQA 3LHLA 4QA5A 4BKXB 2VQOA 4RN2A 4Q3VA 5IX0A 5BWZA 4IE1A 2V5XA 3E6VA 3MAXA 4RN0A 5G0HA 1ZZ3A 3RQDA 3SL0A 3ZNRA 4QA0A 4CEVA 3MZ6A 3MFWA 5G0IA 1P8SA 3E6KA 4BZ6A 1VKGA 3F07A 2VQJA 2PLLA 4QA6A 3LP7A 3TH7A 4Q42A 3MMRA 2VQVA 5D1BA 2PHOA 3SKKA 1P8PA 1T64A 1P8RA 1ZPEA 3Q9BA 3DJ8A 4ZUPA 2RLAA 4ZUQA 3MFVA 5EEIA 3NIQA 3MENA 4BZ7A 3NIOA 5THUA 1P8MA 2AEBA 5DC7A 3LP4A 1HQXA 5EEFA 1T4RA 1GQ6A 5FCWA 1ZPGA 1HQFA 1W22A 5G10A 5CEVA 5RLAA 3GMZA 4BZ5A 3EWFA 5THVA 4MYNA 4GSVA 2ZAVA 3GN0A 4ITYA 4QA3A 1T5GA 1D3VA 5HJ9A 4IU4A 4QA1A 1WVBA 5G3WA 1TBLA 1WOHA 3PZLA 3Q9FA 4RHJA 4CQFA 4Q3RC 1C3RA 4G3HA 1CEVA 1C3PA 1T69A 2A0MA 3EZPA 4MXRA 4RHKA 4RLAA 3E8ZA 5EF8A 5EFHA 4HWWA 3M1RA 5HJAA 5LI3A 4IE2A 5G12A 4IU1A 5G13A 3C10A 2EIVA 5D1CA 4IE3A
chains in the Genus database with same CATH topology
1WVAA 3THHA 1HQHA 1PQ3A 4GWDA 3F80A 4RHQA 4GSZA 4RHIA 4FCIA 1TBJA 4MYKA 4Q3RA 4Q40A 3KV2A 4RHLA 4Q3SA 3MJLA 4Q3QA 4HZEA 4IU0A 4I06A 1GQ7A 4MYLA 3THEA 1WOIA 1RLAA 2EF4A 4IU5A 4IXVA 1T4TA 1WOGA 1P8QA 3TF3A 4IXUA 3E9BA 3CEVA 1T4SA 1HQ5A 1T4PA 1T5FA 2PHAA 3NIPA 4GWCA 5HJAA 1XFKA 4Q3TA 1R1OA 4FCKA 4Q3UA 1P8OA 3E8QA 1P8NA 1TA1A 1TBHA 4GSMA 3THJA 3SL1A 4DZ4A 3SJTA 2EF5A 2CEVA 4RHMA 3RLAA 4Q3PA 4MYFA 4Q41A 1HQGA 4HXQA 3LHLA 4Q3VA 4IE1A 3E6VA 4CEVA 3SL0A 3MFWA 1P8SA 3E6KA 2PLLA 3LP7A 3TH7A 4Q42A 3MMRA 2PHOA 3SKKA 1P8PA 1P8RA 1ZPEA 3DJ8A 2RLAA 3MFVA 3NIQA 3NIOA 1P8MA 2AEBA 3LP4A 1HQXA 1T4RA 1GQ6A 1ZPGA 1HQFA 5CEVA 5RLAA 3GMZA 4MYNA 4GSVA 2ZAVA 3GN0A 4ITYA 5HJ9A 1T5GA 1D3VA 4IU4A 1WVBA 1TBLA 1WOHA 3PZLA 4RHJA 4Q3RC 4G3HA 1CEVA 4MXRA 4RLAA 2A0MA 4RHKA 3E8ZA 4HWWA 3M1RA 4IE2A 4IU1A 2EIVA 4IE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WVA A;  3THH A;  1HQH A;  1PQ3 A;  4GWD A;  3F80 A;  4RHQ A;  4GSZ A;  4RHI A;  4FCI A;  1TBJ A;  4MYK A;  4Q3R A;  4Q40 A;  3KV2 A;  4RHL A;  4Q3S A;  3MJL A;  4Q3Q A;  4HZE A;  4IU0 A;  4I06 A;  1GQ7 A;  4MYL A;  3THE A;  1WOI A;  1RLA A;  2EF4 A;  4IU5 A;  4IXV A;  1T4T A;  1WOG A;  1P8Q A;  3TF3 A;  4IXU A;  3E9B A;  3CEV A;  1T4S A;  1HQ5 A;  1T4P A;  1T5F A;  2PHA A;  3NIP A;  4GWC A;  5HJA A;  1XFK A;  4Q3T A;  1R1O A;  4FCK A;  4Q3U A;  1P8O A;  3E8Q A;  1P8N A;  1TA1 A;  1TBH A;  4GSM A;  3THJ A;  3SL1 A;  4DZ4 A;  3SJT A;  2EF5 A;  2CEV A;  4RHM A;  3RLA A;  4Q3P A;  4MYF A;  4Q41 A;  1HQG A;  4HXQ A;  3LHL A;  4Q3V A;  4IE1 A;  3E6V A;  4CEV A;  3SL0 A;  3MFW A;  1P8S A;  3E6K A;  2PLL A;  3LP7 A;  3TH7 A;  4Q42 A;  3MMR A;  2PHO A;  3SKK A;  1P8P A;  1P8R A;  1ZPE A;  3DJ8 A;  2RLA A;  3MFV A;  3NIQ A;  3NIO A;  1P8M A;  2AEB A;  3LP4 A;  1HQX A;  1T4R A;  1GQ6 A;  1ZPG A;  1HQF A;  5CEV A;  5RLA A;  3GMZ A;  4MYN A;  4GSV A;  2ZAV A;  3GN0 A;  4ITY A;  5HJ9 A;  1T5G A;  1D3V A;  4IU4 A;  1WVB A;  1TBL A;  1WOH A;  3PZL A;  4RHJ A;  4Q3R C;  4G3H A;  1CEV A;  4MXR A;  4RLA A;  2A0M A;  4RHK A;  3E8Z A;  4HWW A;  3M1R A;  4IE2 A;  4IU1 A;  2EIV A;  4IE3 A; 
#chains in the Genus database with same CATH topology
 3C0Y A;  1WVA A;  3THH A;  1HQH A;  2VQW G;  3MZ3 A;  4LXZ A;  5THS A;  1PQ3 A;  2VQQ A;  4GWD A;  3F80 A;  4RHQ A;  4GSZ A;  4RHI A;  5THT A;  3MZ4 A;  5EEN A;  4FCI A;  1TBJ A;  4MYK A;  4ZUN A;  4ZUR A;  4Q3R A;  4Q40 A;  3KV2 A;  4RHL A;  5JI5 A;  4Q3S A;  3MJL A;  4Q3Q A;  5EFB D;  4HZE A;  4IU0 A;  4QA7 A;  4I06 A;  1GQ7 A;  4MYL A;  5G17 A;  3THE A;  1WOI A;  4RN1 A;  5EEK A;  1RLA A;  2EF4 A;  5G0G A;  5ICN B;  5DC5 A;  3EZT A;  4IU5 A;  1C3S A;  3C0Z A;  1T4T A;  4IXV A;  4QA2 A;  5D1D A;  4BZ9 A;  5EF7 A;  5G11 A;  4CBY A;  5G1A A;  1WOG A;  5EFG A;  5G1B A;  1P8Q A;  4ZUM A;  5A2S A;  3TF3 A;  4IXU A;  3E9B A;  1ZZ0 A;  5IWG A;  3CEV A;  1T4S A;  3Q9E A;  1HQ5 A;  1T4P A;  1T5F A;  2PHA A;  3F0R A;  3NIP A;  4GWC A;  1XFK A;  2VCG A;  1R1O A;  2VQM A;  3EW8 A;  4Q3T A;  5EFK B;  3SFH A;  4FCK A;  2V5W A;  4Q3U A;  4QA4 A;  3SFF A;  5FUE A;  5G0J A;  5G1C A;  1P8O A;  2GH6 A;  3E8Q A;  4CBT A;  3Q9C A;  5G0X A;  4A69 A;  1P8N A;  5G0Y A;  1TA1 A;  4ZUO A;  1TBH A;  4GSM A;  3THJ A;  3SL1 A;  4DZ4 A;  5EEM A;  1T67 A;  4LY1 A;  3SJT A;  2EF5 A;  5DC8 A;  5EFJ D;  2CEV A;  5EFN A;  5DC6 A;  3F06 A;  4RHM A;  1ZZ1 A;  4MYF A;  4Q3P A;  1HQG A;  3RLA A;  3ZNS A;  4BZ8 A;  4Q41 A;  3MZ7 A;  4HXQ A;  3LHL A;  4QA5 A;  4BKX B;  2VQO A;  4RN2 A;  4Q3V A;  5IX0 A;  5BWZ A;  4IE1 A;  2V5X A;  3E6V A;  3MAX A;  4RN0 A;  5G0H A;  1ZZ3 A;  3RQD A;  3SL0 A;  3ZNR A;  4QA0 A;  4CEV A;  3MZ6 A;  3MFW A;  5G0I A;  1P8S A;  3E6K A;  4BZ6 A;  1VKG A;  3F07 A;  2VQJ A;  2PLL A;  4QA6 A;  3LP7 A;  3TH7 A;  4Q42 A;  3MMR A;  2VQV A;  5D1B A;  2PHO A;  3SKK A;  1P8P A;  1T64 A;  1P8R A;  1ZPE A;  3Q9B A;  3DJ8 A;  4ZUP A;  2RLA A;  4ZUQ A;  3MFV A;  5EEI A;  3NIQ A;  3MEN A;  4BZ7 A;  3NIO A;  5THU A;  1P8M A;  2AEB A;  5DC7 A;  3LP4 A;  1HQX A;  5EEF A;  1T4R A;  1GQ6 A;  5FCW A;  1ZPG A;  1HQF A;  1W22 A;  5G10 A;  5CEV A;  5RLA A;  3GMZ A;  4BZ5 A;  3EWF A;  5THV A;  4MYN A;  4GSV A;  2ZAV A;  3GN0 A;  4ITY A;  4QA3 A;  1T5G A;  1D3V A;  5HJ9 A;  4IU4 A;  4QA1 A;  1WVB A;  5G3W A;  1TBL A;  1WOH A;  3PZL A;  3Q9F A;  4RHJ A;  4CQF A;  4Q3R C;  1C3R A;  4G3H A;  1CEV A;  1C3P A;  1T69 A;  2A0M A;  3EZP A;  4MXR A;  4RHK A;  4RLA A;  3E8Z A;  5EF8 A;  5EFH A;  4HWW A;  3M1R A;  5HJA A;  5LI3 A;  4IE2 A;  5G12 A;  4IU1 A;  5G13 A;  3C10 A;  2EIV A;  5D1C A;  4IE3 A; 
#chains in the Genus database with same CATH homology
 1WVA A;  3THH A;  1HQH A;  1PQ3 A;  4GWD A;  3F80 A;  4RHQ A;  4GSZ A;  4RHI A;  4FCI A;  1TBJ A;  4MYK A;  4Q3R A;  4Q40 A;  3KV2 A;  4RHL A;  4Q3S A;  3MJL A;  4Q3Q A;  4HZE A;  4IU0 A;  4I06 A;  1GQ7 A;  4MYL A;  3THE A;  1WOI A;  1RLA A;  2EF4 A;  4IU5 A;  4IXV A;  1T4T A;  1WOG A;  1P8Q A;  3TF3 A;  4IXU A;  3E9B A;  3CEV A;  1T4S A;  1HQ5 A;  1T4P A;  1T5F A;  2PHA A;  3NIP A;  4GWC A;  5HJA A;  1XFK A;  4Q3T A;  1R1O A;  4FCK A;  4Q3U A;  1P8O A;  3E8Q A;  1P8N A;  1TA1 A;  1TBH A;  4GSM A;  3THJ A;  3SL1 A;  4DZ4 A;  3SJT A;  2EF5 A;  2CEV A;  4RHM A;  3RLA A;  4Q3P A;  4MYF A;  4Q41 A;  1HQG A;  4HXQ A;  3LHL A;  4Q3V A;  4IE1 A;  3E6V A;  4CEV A;  3SL0 A;  3MFW A;  1P8S A;  3E6K A;  2PLL A;  3LP7 A;  3TH7 A;  4Q42 A;  3MMR A;  2PHO A;  3SKK A;  1P8P A;  1P8R A;  1ZPE A;  3DJ8 A;  2RLA A;  3MFV A;  3NIQ A;  3NIO A;  1P8M A;  2AEB A;  3LP4 A;  1HQX A;  1T4R A;  1GQ6 A;  1ZPG A;  1HQF A;  5CEV A;  5RLA A;  3GMZ A;  4MYN A;  4GSV A;  2ZAV A;  3GN0 A;  4ITY A;  5HJ9 A;  1T5G A;  1D3V A;  4IU4 A;  1WVB A;  1TBL A;  1WOH A;  3PZL A;  4RHJ A;  4Q3R C;  4G3H A;  1CEV A;  4MXR A;  4RLA A;  2A0M A;  4RHK A;  3E8Z A;  4HWW A;  3M1R A;  4IE2 A;  4IU1 A;  2EIV A;  4IE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...