4IE2A

Crystal structure of human arginase-2 complexed with inhibitor 1h
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
306
structure length
306
Chain Sequence
HSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPGFSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLIGKRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase-2, mitochondrial
publication title 2-Substituted-2-amino-6-boronohexanoic acids as arginase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 115
structure length 306
sequence length 306
chains with identical sequence B, C
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 4ie2A00
3E8ZA 4HXQA 3SL0A 1WOIA 3E8QA 2PHAA 1P8OA 1WOHA 4RHJA 4FCKA 1HQHA 3TF3A 1P8MA 1HQ5A 4Q3TA 3DJ8A 4GWDA 3E9BA 4Q40A 3SJTA 3GMZA 4GSZA 1WOGA 1HQFA 1T5GA 2PHOA 3SKKA 3MFVA 1ZPEA 4ITYA 4MYFA 1TA1A 1PQ3A 1HQXA 4I06A 3LP7A 4RHLA 3KV2A 4CEVA 1XFKA 3NIPA 4Q3RA 4GSVA 1TBHA 4IE1A 3CEVA 1HQGA 1WVBA 1CEVA 1T4TA 3THHA 3THJA 2AEBA 4IU4A 3LP4A 1P8NA 4IE2A 1TBLA 2EIVA 3M1RA 4MYKA 1P8PA 2A0MA 1R1OA 2PLLA 3F80A 4IU5A 1T4SA 1T4PA 1GQ6A 4Q3SA 4RLAA 4RHQA 1GQ7A 5RLAA 3MJLA 4RHMA 2EF5A 3E6VA 4HWWA 1T4RA 1TBJA 4Q41A 3SL1A 4Q3QA 4IU0A 4RHKA 3THEA 4GWCA 1D3VA 4FCIA 4Q3PA 5HJ9A 3NIQA 3GN0A 3MFWA 4Q3RC 3RLAA 4Q3UA 2EF4A 1RLAA 4G3HA 3NIOA 1WVAA 1P8QA 4IU1A 1P8RA 5CEVA 4GSMA 4HZEA 3PZLA 2RLAA 4MYLA 4IXVA 1T5FA 4DZ4A 3E6KA 2CEVA 2ZAVA 4MYNA 1ZPGA 3MMRA 4Q3VA 1P8SA 4Q42A 4IXUA 4MXRA 4RHIA 3TH7A 5HJAA 4IE3A 3LHLA
chains in the Genus database with same CATH superfamily
4QA0A 3E8ZA 3ZNSA 4HXQA 3SL0A 1WOIA 3E8QA 3Q9BA 5G10A 4BZ6A 2PHAA 4CBYA 1P8OA 1WOHA 4RHJA 4FCKA 1HQHA 5EFKB 5EFJD 3TF3A 2VQJA 1P8MA 5G11A 5THVA 2VCGA 4QA6A 1HQ5A 4QA5A 4Q3TA 4ZURA 3DJ8A 3EZTA 3F0RA 3E9BA 4GWDA 4Q40A 3SJTA 4QA7A 5EEIA 3C10A 5G0XA 3GMZA 5G1CA 5G0GA 5G1AA 3F07A 4GSZA 5IX0A 5THUA 1WOGA 1HQFA 5LI3A 1T5GA 2PHOA 5D1DA 4ZUMA 2VQMA 3MFVA 1ZPEA 4ITYA 4MYFA 5G13A 3SKKA 4CBTA 1TA1A 2VQWG 5IWGA 1PQ3A 1ZZ3A 2GH6A 1HQXA 4I06A 3LP7A 3C0ZA 4ZUOA 1ZZ0A 4RHLA 4ZUPA 2V5WA 3KV2A 5FUEA 5EFBD 4CEVA 5THSA 1XFKA 3NIPA 4Q3RA 1T67A 4GSVA 1TBHA 4IE1A 3CEVA 1HQGA 1WVBA 1CEVA 1T4TA 3THHA 4LXZA 3THJA 5A2SA 2AEBA 4IU4A 3LP4A 1P8NA 4IE2A 1TBLA 1ZZ1A 2EIVA 3M1RA 4MYKA 5DC7A 4ZUQA 5EFHA 3ZNRA 1P8PA 3SFHA 5JI5A 4CQFA 5EEKA 2A0MA 1R1OA 2PLLA 3F80A 5THTA 4BZ8A 4IU5A 4RN2A 3SFFA 3Q9EA 3F06A 3MENA 5G3WA 1T4SA 2VQOA 1T4PA 1GQ6A 4Q3SA 4QA1A 4RHQA 4RLAA 4BZ9A 1GQ7A 5FCWA 5RLAA 3EZPA 3MAXA 5G0HA 4BZ5A 3EW8A 1T64A 1VKGA 3MJLA 5ICNB 4RHMA 2EF5A 3E6VA 4HWWA 2VQVA 4QA2A 1T4RA 1TBJA 5G0YA 4Q41A 3SL1A 4Q3QA 4IU0A 4RHKA 5DC8A 3Q9CA 3EWFA 3THEA 4LY1A 4GWCA 5DC6A 1D3VA 4FCIA 4Q3PA 1T69A 5G17A 5HJ9A 1C3RA 4QA4A 3NIQA 4RN0A 3GN0A 5EEMA 5G0JA 5EF7A 3MFWA 4Q3RC 5G0IA 3RLAA 3RQDA 4Q3UA 2EF4A 3C0YA 5EENA 1RLAA 3MZ6A 3MZ7A 4G3HA 3NIOA 1WVAA 4RN1A 5G12A 5BWZA 1P8QA 4IU1A 1P8RA 3MZ3A 5D1CA 5EEFA 4ZUNA 5CEVA 4GSMA 4HZEA 5G1BA 3PZLA 1W22A 2RLAA 4MYLA 5EF8A 4IXVA 1T5FA 4BKXB 4DZ4A 3E6KA 5EFGA 3MZ4A 2CEVA 2ZAVA 4QA3A 1C3PA 4MYNA 1ZPGA 3MMRA 4Q3VA 1P8SA 4Q42A 4IXUA 5EFNA 4A69A 2V5XA 4MXRA 4RHIA 3TH7A 5HJAA 4BZ7A 3Q9FA 4IE3A 5D1BA 5DC5A 2VQQA 1C3SA 3LHLA
chains in the Genus database with same CATH topology
3E8ZA 4HXQA 3SL0A 1WOIA 3E8QA 2PHAA 1P8OA 1WOHA 4RHJA 4FCKA 1HQHA 3TF3A 1P8MA 1HQ5A 4Q3TA 3DJ8A 4GWDA 3E9BA 4Q40A 3SJTA 3GMZA 4GSZA 1WOGA 1HQFA 1T5GA 2PHOA 3SKKA 3MFVA 1ZPEA 4ITYA 4MYFA 1TA1A 1PQ3A 1HQXA 4I06A 3LP7A 4RHLA 3KV2A 4CEVA 1XFKA 3NIPA 4Q3RA 4GSVA 1TBHA 4IE1A 3CEVA 1HQGA 1WVBA 1CEVA 1T4TA 3THHA 3THJA 2AEBA 4IU4A 3LP4A 1P8NA 4IE2A 1TBLA 2EIVA 3M1RA 4MYKA 1P8PA 2A0MA 1R1OA 2PLLA 3F80A 4IU5A 1T4SA 1T4PA 1GQ6A 4Q3SA 4RLAA 4RHQA 1GQ7A 5RLAA 3MJLA 4RHMA 2EF5A 3E6VA 4HWWA 1T4RA 1TBJA 4Q41A 3SL1A 4Q3QA 4IU0A 4RHKA 3THEA 4GWCA 1D3VA 4FCIA 4Q3PA 5HJ9A 3NIQA 3GN0A 3MFWA 4Q3RC 3RLAA 4Q3UA 2EF4A 1RLAA 4G3HA 3NIOA 1WVAA 1P8QA 4IU1A 1P8RA 5CEVA 4GSMA 4HZEA 3PZLA 2RLAA 4MYLA 4IXVA 1T5FA 4DZ4A 3E6KA 2CEVA 2ZAVA 4MYNA 1ZPGA 3MMRA 4Q3VA 1P8SA 4Q42A 4IXUA 4MXRA 4RHIA 3TH7A 5HJAA 4IE3A 3LHLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E8Z A;  4HXQ A;  3SL0 A;  1WOI A;  3E8Q A;  2PHA A;  1P8O A;  1WOH A;  4RHJ A;  4FCK A;  1HQH A;  3TF3 A;  1P8M A;  1HQ5 A;  4Q3T A;  3DJ8 A;  4GWD A;  3E9B A;  4Q40 A;  3SJT A;  3GMZ A;  4GSZ A;  1WOG A;  1HQF A;  1T5G A;  2PHO A;  3SKK A;  3MFV A;  1ZPE A;  4ITY A;  4MYF A;  1TA1 A;  1PQ3 A;  1HQX A;  4I06 A;  3LP7 A;  4RHL A;  3KV2 A;  4CEV A;  1XFK A;  3NIP A;  4Q3R A;  4GSV A;  1TBH A;  4IE1 A;  3CEV A;  1HQG A;  1WVB A;  1CEV A;  1T4T A;  3THH A;  3THJ A;  2AEB A;  4IU4 A;  3LP4 A;  1P8N A;  4IE2 A;  1TBL A;  2EIV A;  3M1R A;  4MYK A;  1P8P A;  2A0M A;  1R1O A;  2PLL A;  3F80 A;  4IU5 A;  1T4S A;  1T4P A;  1GQ6 A;  4Q3S A;  4RLA A;  4RHQ A;  1GQ7 A;  5RLA A;  3MJL A;  4RHM A;  2EF5 A;  3E6V A;  4HWW A;  1T4R A;  1TBJ A;  4Q41 A;  3SL1 A;  4Q3Q A;  4IU0 A;  4RHK A;  3THE A;  4GWC A;  1D3V A;  4FCI A;  4Q3P A;  5HJ9 A;  3NIQ A;  3GN0 A;  3MFW A;  4Q3R C;  3RLA A;  4Q3U A;  2EF4 A;  1RLA A;  4G3H A;  3NIO A;  1WVA A;  1P8Q A;  4IU1 A;  1P8R A;  5CEV A;  4GSM A;  4HZE A;  3PZL A;  2RLA A;  4MYL A;  4IXV A;  1T5F A;  4DZ4 A;  3E6K A;  2CEV A;  2ZAV A;  4MYN A;  1ZPG A;  3MMR A;  4Q3V A;  1P8S A;  4Q42 A;  4IXU A;  4MXR A;  4RHI A;  3TH7 A;  5HJA A;  4IE3 A;  3LHL A; 
#chains in the Genus database with same CATH topology
 4QA0 A;  3E8Z A;  3ZNS A;  4HXQ A;  3SL0 A;  1WOI A;  3E8Q A;  3Q9B A;  5G10 A;  4BZ6 A;  2PHA A;  4CBY A;  1P8O A;  1WOH A;  4RHJ A;  4FCK A;  1HQH A;  5EFK B;  5EFJ D;  3TF3 A;  2VQJ A;  1P8M A;  5G11 A;  5THV A;  2VCG A;  4QA6 A;  1HQ5 A;  4QA5 A;  4Q3T A;  4ZUR A;  3DJ8 A;  3EZT A;  3F0R A;  3E9B A;  4GWD A;  4Q40 A;  3SJT A;  4QA7 A;  5EEI A;  3C10 A;  5G0X A;  3GMZ A;  5G1C A;  5G0G A;  5G1A A;  3F07 A;  4GSZ A;  5IX0 A;  5THU A;  1WOG A;  1HQF A;  5LI3 A;  1T5G A;  2PHO A;  5D1D A;  4ZUM A;  2VQM A;  3MFV A;  1ZPE A;  4ITY A;  4MYF A;  5G13 A;  3SKK A;  4CBT A;  1TA1 A;  2VQW G;  5IWG A;  1PQ3 A;  1ZZ3 A;  2GH6 A;  1HQX A;  4I06 A;  3LP7 A;  3C0Z A;  4ZUO A;  1ZZ0 A;  4RHL A;  4ZUP A;  2V5W A;  3KV2 A;  5FUE A;  5EFB D;  4CEV A;  5THS A;  1XFK A;  3NIP A;  4Q3R A;  1T67 A;  4GSV A;  1TBH A;  4IE1 A;  3CEV A;  1HQG A;  1WVB A;  1CEV A;  1T4T A;  3THH A;  4LXZ A;  3THJ A;  5A2S A;  2AEB A;  4IU4 A;  3LP4 A;  1P8N A;  4IE2 A;  1TBL A;  1ZZ1 A;  2EIV A;  3M1R A;  4MYK A;  5DC7 A;  4ZUQ A;  5EFH A;  3ZNR A;  1P8P A;  3SFH A;  5JI5 A;  4CQF A;  5EEK A;  2A0M A;  1R1O A;  2PLL A;  3F80 A;  5THT A;  4BZ8 A;  4IU5 A;  4RN2 A;  3SFF A;  3Q9E A;  3F06 A;  3MEN A;  5G3W A;  1T4S A;  2VQO A;  1T4P A;  1GQ6 A;  4Q3S A;  4QA1 A;  4RHQ A;  4RLA A;  4BZ9 A;  1GQ7 A;  5FCW A;  5RLA A;  3EZP A;  3MAX A;  5G0H A;  4BZ5 A;  3EW8 A;  1T64 A;  1VKG A;  3MJL A;  5ICN B;  4RHM A;  2EF5 A;  3E6V A;  4HWW A;  2VQV A;  4QA2 A;  1T4R A;  1TBJ A;  5G0Y A;  4Q41 A;  3SL1 A;  4Q3Q A;  4IU0 A;  4RHK A;  5DC8 A;  3Q9C A;  3EWF A;  3THE A;  4LY1 A;  4GWC A;  5DC6 A;  1D3V A;  4FCI A;  4Q3P A;  1T69 A;  5G17 A;  5HJ9 A;  1C3R A;  4QA4 A;  3NIQ A;  4RN0 A;  3GN0 A;  5EEM A;  5G0J A;  5EF7 A;  3MFW A;  4Q3R C;  5G0I A;  3RLA A;  3RQD A;  4Q3U A;  2EF4 A;  3C0Y A;  5EEN A;  1RLA A;  3MZ6 A;  3MZ7 A;  4G3H A;  3NIO A;  1WVA A;  4RN1 A;  5G12 A;  5BWZ A;  1P8Q A;  4IU1 A;  1P8R A;  3MZ3 A;  5D1C A;  5EEF A;  4ZUN A;  5CEV A;  4GSM A;  4HZE A;  5G1B A;  3PZL A;  1W22 A;  2RLA A;  4MYL A;  5EF8 A;  4IXV A;  1T5F A;  4BKX B;  4DZ4 A;  3E6K A;  5EFG A;  3MZ4 A;  2CEV A;  2ZAV A;  4QA3 A;  1C3P A;  4MYN A;  1ZPG A;  3MMR A;  4Q3V A;  1P8S A;  4Q42 A;  4IXU A;  5EFN A;  4A69 A;  2V5X A;  4MXR A;  4RHI A;  3TH7 A;  5HJA A;  4BZ7 A;  3Q9F A;  4IE3 A;  5D1B A;  5DC5 A;  2VQQ A;  1C3S A;  3LHL A; 
#chains in the Genus database with same CATH homology
 3E8Z A;  4HXQ A;  3SL0 A;  1WOI A;  3E8Q A;  2PHA A;  1P8O A;  1WOH A;  4RHJ A;  4FCK A;  1HQH A;  3TF3 A;  1P8M A;  1HQ5 A;  4Q3T A;  3DJ8 A;  4GWD A;  3E9B A;  4Q40 A;  3SJT A;  3GMZ A;  4GSZ A;  1WOG A;  1HQF A;  1T5G A;  2PHO A;  3SKK A;  3MFV A;  1ZPE A;  4ITY A;  4MYF A;  1TA1 A;  1PQ3 A;  1HQX A;  4I06 A;  3LP7 A;  4RHL A;  3KV2 A;  4CEV A;  1XFK A;  3NIP A;  4Q3R A;  4GSV A;  1TBH A;  4IE1 A;  3CEV A;  1HQG A;  1WVB A;  1CEV A;  1T4T A;  3THH A;  3THJ A;  2AEB A;  4IU4 A;  3LP4 A;  1P8N A;  4IE2 A;  1TBL A;  2EIV A;  3M1R A;  4MYK A;  1P8P A;  2A0M A;  1R1O A;  2PLL A;  3F80 A;  4IU5 A;  1T4S A;  1T4P A;  1GQ6 A;  4Q3S A;  4RLA A;  4RHQ A;  1GQ7 A;  5RLA A;  3MJL A;  4RHM A;  2EF5 A;  3E6V A;  4HWW A;  1T4R A;  1TBJ A;  4Q41 A;  3SL1 A;  4Q3Q A;  4IU0 A;  4RHK A;  3THE A;  4GWC A;  1D3V A;  4FCI A;  4Q3P A;  5HJ9 A;  3NIQ A;  3GN0 A;  3MFW A;  4Q3R C;  3RLA A;  4Q3U A;  2EF4 A;  1RLA A;  4G3H A;  3NIO A;  1WVA A;  1P8Q A;  4IU1 A;  1P8R A;  5CEV A;  4GSM A;  4HZE A;  3PZL A;  2RLA A;  4MYL A;  4IXV A;  1T5F A;  4DZ4 A;  3E6K A;  2CEV A;  2ZAV A;  4MYN A;  1ZPG A;  3MMR A;  4Q3V A;  1P8S A;  4Q42 A;  4IXU A;  4MXR A;  4RHI A;  3TH7 A;  5HJA A;  4IE3 A;  3LHL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...