4IEEA

Crystal structure of the large terminase subunit gp2 of bacterial virus sf6 complexed with atp-r-s
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
463
structure length
452
Chain Sequence
INPIFEPFIEAHRYKVAKGGRGSGKSWAIARLLVEAARRQPVRILCARELQNSISDSVIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGIDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQANVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTKVEMKQKLGIPSPNLADALMMCMHCPALVREETEIYVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the phage Sf6 large terminase provide new insights into DNA translocation and cleavage.
pubmed doi rcsb
source organism Shigella phage sf6
molecule tags Viral protein
molecule keywords Gene 2 protein
total genus 161
structure length 452
sequence length 463
ec nomenclature
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04466 Terminase_3 Phage terminase large subunit
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4ieeA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ieeA01
1S8FA 2VBCA 5FOSA 3IILA 1ZU4A 3I32A 4GSYA 1DAEA 4OKSA 4UXHA 5KSOA 2IK8A 3N70A 2IYYA 5IHPA 2X1VA 3BS4A 3A8TA 3FMIA 2FWRA 4TYQA 2WAXA 4QRHA 3TBKA 1GITA 1QBKC 2V1XA 2RGAA 3TMKA 3AKEA 2OCBA 2FA9A 1GSIA 1N6LA 1UADA 2QM7A 1E1RD 1G5RA 3Q9LA 4HAXA 1JXMA 1XWIA 1WBBA 2OG2A 2AKYA 2Q9AA 2P65A 2IT1A 3I8XA 4LV8B 1SVSA 2DFKB 5C2DA 1JAHA 1E2LA 1IY0A 1SXJD 2GDJA 4US0R 1DOAA 3WBJA 5M1OA 4ESHA 4IFEA 3HU3A 4IRUB 4S2EA 5IRCD 3F8TA 2AWOA 2QAGA 4EFLA 5J4KA 4M9ZA 1KO7A 3DEFA 1KNQA 3CW2A 4DT1A 4HLDA 1PZNA 1QHNA 1VG9B 3KQLA 1X3SA 3CF2A 4ZDKA 3EIQA 2JJ8A 1S3GA 4RFVA 3ZH9B 2NO0A 4U5XA 4PPGA 4C0SA 3CX7A 4B76A 4Q9LA 3QEOA 4ZIRA 2P2LA 5AJYA 1IN8A 4Q1DA 2A2ZA 1XEFA 3TSOA 1KKLA 1MO3A 1ZM3A 2GRJA 4OQMA 2WV9A 2ZSBA 2R6FA 5F2EA 2QAGC 4QJ5A 1JI0A 4NCHA 3TNFA 2OLKA 4TYWA 3Q8XB 2C9OA 3AKYA 1UBFA 4EQ6B 2FFAA 4DLXA 1BH2A 5DYIA 4DLSA 2O8EB 1H8EA 4D82A 2XNDD 5FL7A 4DXAA 4CVNA 5DI3B 3QBVA 4TYNA 4V0LA 3GLIB 1EGAA 2IYXA 1W1WA 3B7GA 4J0QA 2QZ4A 1OXXK 2F1IA 4MYUA 2ZRMA 2H5EA 4RJLA 3AF0A 2FEMA 3VFDA 4ACBA 4DCVA 4KSBA 3TAUA 2QNRA 1UBGA 4HB3A 1FMJA 1KDOA 1R4AA 2GESA 4LCBA 2DWPA 3B1YA 5DE3A 4QGFA 1AJEA 1Z07A 2W6JD 3BFXA 1P9WA 5JWOA 1XXHB 1IN5A 2C5LA 1SVWA 4QJ3A 2OSBA 4M1TA 1NSFA 3AP1A 1NN0A 2J7KA 5EJEA 3AM1A 1VECA 1ZC3A 1YU9A 1VG0B 1P5ZB 3D8BA 2ZI4A 4WBSA 3U60B 4DVGA 1HT2E 1KAOA 1XMJA 3HPRA 4LHVA 3SU8A 4HUTA 4RZUA 4CZ2A 2G83A 4DLYA 2CJWA 2F6RA 1E98A 1GWNA 1YRAA 4TL8A 3EPKA 1WXQA 3FHTA 4KYIB 1H8HD 1LB1B 1KYIA 4PZZA 2QMEA 2G0NA 5GJWC 5FPTA 5TY0A 4NE2A 1P9RA 4C2TA 1B23P 3TAHA 2ZQ5A 3VX3A 4FCVA 4JYCA 5L3QB 3I92A 2DHRA 3NWJA 2NO9A 2O8FA 3ICEA 3TVDA 4YQFA 2GA8A 3T5GA 2QBYB 3P26A 3EWSA 2GF9A 1JALA 2AX4A 3ZDQA 2V4ZA 5AWFC 1M7GA 1C4OA 1A1VA 2XZLA 1E1RA 3ZIAA 5HKKD 1MO4A 1UDXA 2QRZA 2V7QD 3TIFA 4XTRA 1GRNA 1QG4A 1Y3AA 3AB3A 2A5GA 2ODNA 4TQAA 3GQBA 4FD2A 5C1BA 1OJLA 1EX6A 4RCYA 2ZJ8A 3W9YA 1ZYUA 1KKMA 4DIDA 2ZRGA 1YZLA 4URUR 5KNBA 2QQ0A 3WMEA 1YE8A 5JFGA 2F7SA 2RGXA 3EZFA 1X1SA 2QUZA 4WW0A 3T06B 4A2QA 3U7FB 2OFOA 4Q19A 4Q4JA 5JRZA 2PZFA 1I2DA 1CU1A 2CL7X 1MABB 2JLYA 2A78A 3AVVA 2ZEJA 1IM2A 2Q6TA 2FSGA 1TQ6A 1E9EA 1NLYA 3F3YA 1IONA 3ZD7A 4L9SA 2CCKA 2ZITA 3QG5A 1NVVQ 3AUYA 2ZI3A 2FX3A 221PA 2FEOA 4IXMA 4PHTA 3UK6A 4OJKA 1QHSA 3OAAA 4W5WA 3ASYA 3ADKA 3LV8A 3VMFA 2JLZA 2RGCA 1XMVA 2VP9A 2HF8A 2V1UA 5K8IA 1S3SA 4AYXA 4O2RA 3FDIA 1OXTA 1VYVA 4KFSA 3KXIA 4JVLA 2WPDD 4LJ8A 5L8VA 4NCKA 3GP8A 1HT1E 4AG5A 2MSDB 2GCNA 4TLEA 1ODFA 4IVPA 4HLUC 1OB5A 1IN7A 2F9MA 1EXMA 3KB1A 5FUXA 3X1YA 2W00A 3OE7A 2CLCX 2W6IA 3Q5DA 3R8CA 1X1RA 4AD8A 5FPYA 1J70A 3NBYC 1YVDA 2OE2A 4YMUA 5JMTA 3LVRE 2QBYA 4ITRC 3B8HA 4TTQA 1EFRA 2YJTD 4M1SA 1DAKA 1XEXA 2R6AA 3TQCA 3VQTA 1W36C 2G1JA 3GJ4A 1ZD8A 4PO9A 4TLBA 5G3ZA 4CIDA 2OHFA 1SVMA 1KHTA 2QM8A 4FMCB 4M21A 3EPLA 5K8LA 4GPTA 2GHIA 4WZAE 1N25A 1AQYA 3AGQA 5D3MB 2GKSA 3QBTA 1O87A 4Q1EA 3BXZA 2GBLA 3D7MA 4BLTA 3NXSA 5JEDA 4RKFA 4KBFA 1QF9A 1IAQA 1QVRA 3QI2A 3ZVNA 3PXGA 4R7ZA 3X2SA 2CVFA 2WPDA 4NKRA 3SHWA 2J87A 1JXOA 1R10A 1J8MF 1ELOA 1YR6A 2HCJB 2OFXA 4QHTA 3WBKA 4DUGA 1E2DA 5BWMA 1EG7A 2PZEA 5CK5A 4P4SB 4PSKA 2A3RA 3RDPA 5DHAA 1DADA 4C0JA 1W46A 2OCYC 2RH5A 4FCTA 2CEAA 4O25A 4EJSC 3MJHA 2P5TB 3KFXA 2WMNB 4ZDJA 4KXFB 4TWZA 1OXVA 2H16A 2QT0A 1G3IA 2VHTA 3DL0A 3R20A 2IYWA 3L2OB 2QAGB 2GTPA 2QP4A 1MO6A 4BASA 4C0AC 2XB2A 4JLPA 2FU5C 1KZ7B 2HXYA 3IBYA 3CH5A 2R6CA 4KCGA 1NY6A 4OI2A 4V0MA 1W7AA 4Q4AB 4WIAA 3EARA 2ZU0C 4Q4JB 3DO6A 4KHZA 4Z51A 1SKQA 2ZI9A 1KI6A 2CCJA 3PCRB 2NPFA 5DISB 3OEHD 3W3AA 3CR7A 1RYHA 1VIAA 4NCNA 1G64A 1EK0A 1KJWA 2R2AA 3LLUA 1KO1A 2PCJA 4JKYA 4NYMQ 4OYHA 1GILA 2AD1A 3GJ8A 2BBWA 3QJYA 1XEXB 5AJWA 1U90A 2OLJA 1U0LA 2FSFA 1GNPA 2NPIA 5ELXA 5GVSA 3THWA 3MJRA 3FFBA 4GMXA 2QPOA 3L0PA 2WHXA 4R2HA 3ICQB 1UKYA 4CT4B 4KAXA 1Z08A 1FUKA 3VR6A 4D25A 5EE9A 4C0QC 1JR3A 3NG1A 5C2JB 2J0QA 1XTIA 2MMCA 1CR4A 1U8ZA 3PIRA 4QFMA 2XTNA 1YJ5A 5CIQA 4P4SA 2GJKA 3BK7A 2VIIA 3MWKA 4MDFA 4GOKA 4MUAA 5AUPB 3L0OA 4LI0A 4AURA 1NIJA 4LSGA 3WNCA 3C6AA 3I5YA 5KOYA 1A5TA 4O3MA 4JLDA 4PAOA 4FMBB 3R9XA 3UPUA 5M04A 2VP0A 4G5OA 1JPJA 4IDQA 1M7BA 2DY1A 4HB2A 4X8OA 4GZLA 5EE1A 1XB2A 2P67A 5L3VA 2ZRLA 4B3GA 4RZ3A 2A5JA 1KK3A 1MRSA 1P75A 2HUPA 2I1QA 1Z2CA 2JIZD 1JAIA 4TMWA 1R8QA 4Q9JA 4DSTA 2X77A 4A15A 2CK3D 1J8YF 1HE8B 1E4YA 1KMQA 2BEJA 2OFWA 1ZINA 4B33A 4W5JA 2XOKA 2X2EA 821PA 2PT5A 1P7CA 1X8LA 1E0SA 1KMHA 4V0KA 2A5DA 3CRW1 2ANCA 4GNKA 4NBSA 4BUJA 4KITB 5JSZB 2XNSA 4C2UA 1GKUB 1KAGA 3AKCA 3C41J 1TU4A 4LOAA 3KUCA 5M1PA 1T8UA 5DN6A 4EPVA 4GL2A 2PX3A 5E7MA 1UBEA 2C03A 4LBVA 4JLKA 3ZQJA 2C8VA 2ZI5A 3U3MA 3A1SA 5GADl 1EFUA 1IN6A 1II9A 4LPKA 4MKHA 1W0JA 4IDPA 1K8RA 1W5SA 1NN1A 4IFBA 4IOKA 3L8ZA 1OFTA 3QXHA 2GCOB 2BWJA 3QF7A 3CF0A 3AF3A 3AVOA 1OYWA 3U2QA 4K81B 3K9NA 4Y0VA 1KO4A 3CZQA 5AJZA 3EC2A 3C7KA 2XZPA 5HCNA 2ORWA 4TMVA 1SXJB 2D2FA 1E2KA 3IQXA 2A5YB 1DVRA 2JCSA 3UKDA 2IX3A 3PEVA 3IUYA 1T8TA 2IHBA 3UATA 3NTUA 2LKDA 4ILEA 2OXCA 2OT3B 4KFRA 2ZSDA 3DMNA 3RC3A 1TPZA 2HV8A 2QTHA 5JS7A 2AFHE 1VHLA 1Q22A 4PX9A 4GOJA 4NYIR 4DWJA 4GOXA 4DBLC 1H65A 5FBVB 2D74A 3QEJA 1JJVA 4NHOA 3BFVA 1G8HA 4TN1A 3RRMA 4BRWA 4DCNA 1HURA 3UG6A 1NN3A 4TLCA 3UMFA 4A0HA 2QE7A 4IDNA 4DSUA 4ZI3A 2ERXA 3CIOA 3DOFA 4RZXA 1P2SA 1N6OA 3FMOB 4PPFA 1S1MA 3PR1A 2ZJBA 3LLMA 2VH5R 3AF1A 2IS1A 3THOA 3OESA 5TMPA 2AFIE 2LCFA 3SFZA 2N42A 2ZJ2A 3CO5A 5HZHA 5FL3A 1KK2A 2QORA 4TSFA 1D2EA 3O8CA 4JVSB 2JEOA 2XAUA 2BBSA 4GRAA 1E2MA 3SC3A 1AKEA 1XCGB 4FXPA 2HT6A 3THYA 4CGZA 2QL6A 1ZM4A 2HEIA 1ESMA 5SZHB 1I4LD 4TSFD 1XJCA 2W2XA 3A1TA 1BYIA 3BH6A 4KVGA 5BYJA 1CR1A 3U3KA 1PUIA 1US8B 3ZQ6A 3ETLA 5JBQA 1NLFA 3E70C 1E32A 2AXNA 3R8FA 2YHSA 1RJ9B 1ZBDA 2ZI7A 2PMKA 2O0JA 2WBLC 3SQXA 1TQ4A 1QZXA 4ZDWA 1VIYA 3KXLA 1YZKA 2ZJYA 1E2FA 4YXWD 2N46A 2VRWA 3B9QA 4M4SA 3BB1A 4JJZA 4JSYA 3BORA 2ODEA 1ZAKA 2E1RA 5HE8A 2QMHA 3QF4B 1I4DD 2PCLA 5HTKA 1FP6A 1S9HA 2IS4A 1UFQA 2RAPA 2J1LA 1W4RA 4XOIA 5CJ2A 4F4IA 1OYYA 3VR3A 5EUMA 3E5HA 3AP2A 3TLXA 4F92B 3U7GA 2ONJA 4YMSA 4AWXA 1OW3B 1MH1A 4RD4A 1AKYA 5FBRB 4FMCF 5EXSA 5CITA 2BBOA 4DHEA 1VDZA 2I1VB 4HAWA 2IYLD 3B60A 3C5CA 1UAAA 2R6DA 4MYCA 4Q1BA 4XJXA 1Z6GA 1ZW6A 2O8BA 2R6GA 1ZCAA 1Z0AA 4OHXA 2H7VA 1N0WA 1OKKA 4LYHA 4BLQA 1RVDA 4KV9A 2AN9A 4L9WA 1QHHA 4KFUA 3VX4A 2JLUA 1SVLA 4BECA 4TTRA 2ZSEA 3P4XA 3M4YA 1TF7A 1XX6A 1HTWA 5EP1A 3AVQA 1P6XA 4IDHA 4BGDA 3OEED 2WIAA 4FMDB 2R65A 4I1VA 3I1FA 1SXJE 4M8NE 4JLOA 5F98A 1F2TA 3K70D 4O0MA 3V9PA 1US8A 4BFWA 2EYUA 4I81A 2XSZD 4AKEA 5KNCA 4LBWA 3AVUA 4ARZA 1UM8A 2PLFA 1N0UA 1CRQA 2RGNC 1MR3F 2VYFA 1X86B 2CHGA 3AVWA 4TQ9A 5EP4A 1T3HA 2HLDD 4Q21A 4MA4A 4MRPA 2ZYTX 3PV0A 4MRSA 4BFXA 2MSCB 4IKEA 4CEIA 1JR6A 4MITA 1XNJA 3I5XA 4MKGA 1NIPA 1SULA 3GLIA 1J99A 1IY1A 1E2NA 5IT5A 1DAHA 2ZRJA 3GJ0A 4DDWA 4X8LA 1YQTA 1E1QA 1LV7A 5LB4A 4Q47A 2YWGA 4JIMA 4WVFA 3TR5A 3KQUA 4PO8A 4RCZA 4P33A 3KJHA 4HAYA 3N5CA 1P73A 3RHFA 4ZPXA 1E0KA 2B92A 3CZPA 4JZKA 1OH8A 3Q5EA 1AA9A 1JPNA 3I3SR 2ERYA 3IDQA 2ZYUX 5A4JA 3RVBA 2V6JA 3U3RA 2Q3MA 4UNQA 4GT1A 5L3SB 1RYFA 2TMKA 4XSGA 2GEVA 2ZE7A 2IS2A 2GF0A 2J7PA 5EZ6B 3QPWA 2I3BA 4QKQA 4B2IA 1AQUA 2CLSA 2ANBA 3IPXA 4LYFA 2W58A 3ZS9A 1NMZA 2HCBA 3U5ZB 4C9BA 1M8PA 3RYTC 1COWA 4LYJA 1P60A 1N0VC 2EFHB 5M1FA 3U4QA 2J7PD 5ANRB 2QA5A 2GVZC 4G5QA 3VKGA 3IEUA 1DE0A 2VP6A 2VSOA 4LJ7A 3SBEA 1OE0A 3A36A 1AGRA 5EUQB 1OFIA 4ASUA 2VHCA 2VTKA 1RC8A 1IXSB 3KKMA 2FFBA 2AL7A 3W8RA 4N0DA 5E7JA 2ZRNA 1D9ZA 2RGBA 5J5CA 2D7DA 3AUXA 2DPXA 4QL3A 4PPNA 2BMFA 1RRPA 4LV5B 1TEVA 1OXUA 2JASA 3QKRB 4QBFA 5JS8A 4WA7A 1BIFA 5KTYA 5L3SA 2J3EA 4P32A 1LNZA 4XWKA 2R8RA 1GP2A 4URVR 3WYAA 1FQKA 1RRCA 2JA1A 3IBGA 3QKSA 3EWAA 2XJ4A 3OFND 3CKLA 1XXHE 2JLQA 4F7WA 4U7DA 1T91A 2IUSA 3Q72A 2NO1A 3K70C 2Z6VA 2IS6A 1P2TA 2WIBA 5KO2A 2IYUA 2BVNA 3U4QB 2VO1A 3VNUA 3CPJB 2IYSA 1EESA 1R6BX 3DHWC 5FTNA 2WWWA 3NHBA 4EJSB 3H84A 5GVRA 2WWYA 3M6AA 1SGWA 4Q01A 4AKGA 4PC6A 4GP6A 4S35A 4LUCA 4Q4HB 4BZXA 1G4AE 1E9FA 3MAAC 1MKYA 4RFSA 3P4YA 1ZIPA 4M53A 2QTVB 2WAYA 3SNHA 1SXJC 1BYUA 1Z6AA 2GK6A 3FVQA 4B43A 5J4YA 3T1VA 3H1TA 2FJUA 3MFYA 2ODWA 4LDJA 4M1WA 3WXMA 5FPKA 1KZGB 2W0SA 1E9CA 1SQ5A 4Z54A 1ZUHA 5B57C 1ZNXA 2IXGA 1T3LA 1KI3A 2OESA 1ZD9A 1A2KC 1GRRA 2Y8EA 1CJMA 4BLPA 4E09A 4QGAA 5EE3A 5EP3A 4P4TA 1P3JA 3TVTA 2IA5A 2V9PA 4DEXA 2F1JA 4I1UA 3QPVA 4MGYR 3VKWA 2BDTA 1ZCBA 4C0LA 5UKDA 2ZJOA 5DI3A 3SFVA 3D3QA 1FUUA 3SHFA 2XOKD 5AJVB 1UKVY 4A8JB 3P27A 1Z0DA 1QHGA 5KUTA 4EFMA 3KXKA 2GETA 4UXJA 4HLUA 1SKYE 2BBTA 1DO2A 3BJIC 2O0KA 1E2IA 3QF4A 1G6OA 3A6PC 3W90A 2ZSAA 2ZETA 3OIWA 5JEEA 1ZRHA 3TGPA 1W44A 5IDVA 3OIYA 4A82A 3CF6R 2C95A 3PEWA 1DG1G 2Z4RA 3WRYC 4TMXA 1RPZA 1TF2A 2G77B 3G82C 1FNMA 1G1MA 1IHUA 2QG6A 3F0TA 4HZIA 1EWQA 3PJRA 1WRBA 1IBRA 3PITA 4FIDA 3VR4A 5DHFA 4HI0E 6Q21A 3QVVA 2WWGA 1CJUC 2JJ2A 3TR0A 1Q21A 1W47A 3H2YA 4PTLA 5JJIA 2PL3A 4CEHA 1CRPA 1JNYA 1UF9A 1G8GA 1KIMA 1XD2B 2NO6A 3GEIA 3VNVA 3GLHB 3OF5A 4POAA 4HUQA 1JQLB 2QI9C 1XP8A 3Q85A 4P0TA 4DIEA 4IVQA 3B1ZA 5HKKA 2KE5A 2IYVA 2ZRIA 5B2ZA 4B73A 1TL7C 3SZRA 3QXCA 3B9PA 1CKEA 4QM6A 2EU8A 3U7EB 3SOPA 2G9NA 2IWHA 1KI2A 3FOZA 1OIWA 2O0HA 1L8QA 4DLVA 2OAP1 3K09A 1DAMA 1R5BA 1XCMA 2EW1A 2QAJA 5M1QA 3L82B 1NI3A 5CYPA 1D2NA 1KI4A 2G88A 1Z6YA 2YV5A 4QOSA 1YKSA 3C6HA 1N6RA 1NVUQ 1PJRA 5KU1A 1JQJC 1ZU5A 421PA 3TE6A 4PC2A 2GXQA 4W7SA 2PX0A 3NKVA 5KSYA 3LX5A 2YWHA 3QKUA 4I99A 4DLTA 2ZS8A 5FOUA 2WJHA 4RVCA 4D81A 2Q3FA 1E2QA 1SVOA 2WKPA 1G3MA 3PUVA 3FPAA 4M0LA 4EDHA 3AP3A 3KJEA 2F55A 1KY2A 1FW6A 2P0EA 4BLSA 1W0JD 2GILA 2V54A 5EXTA 1OIVA 2GJSA 3S1AB 1U9IC 4NTZA 4Z1MD 1I2MA 3KX2A 3P1JA 1M7HA 1SZPA 1Q1ZA 3OZXA 3A4MA 4OQFA 1TQ2A 4W9MC 1RKBA 1E2JA 1OH5A 1U98A 1II0A 2Q9CA 1T5LA 2F1RA 4QBIA 5FR2A 4B32A 4TMKA 2ZYWX 1IQPA 3T1QA 2OBLA 1BMFD 4WOPA 4LBYA 4F4CA 3VU9B 4A6XA 1IJFA 4M9SA 3U6KA 1N5LA 3CBQA 2KI5A 4PAQA 2ZRAA 3D31A 3T34A 1H8ED 5FOXA 2ZRDA 2BOVA 3DZ8A 2AHOA 1E79D 1E2HA 5A0FA 1XTSA 4I1OA 3SQWA 5K8UA 4C0KA 4DT1B 2H1LA 4ABYA 1KSGA 2JLXA 2CK3A 4B3DA 4XWOA 5C4GB 4LJ4A 5H68A 1CP2A 5FOTA 2QGZA 1HQCA 5KPDA 2W2VA 4JKIA 4Z8YA 3V4RA 3MWJA 4FCWA 1D8TA 5JI3E 3LBNA 1E9SA 4ACAA 5KSPA 5CJPA 4DLWA 1KSFX 4G5SA 4LYAA 2OCAA 2A5FA 1PUJA 4Q18A 3W6PA 4HSEA 1MOZA 4RD1A 4DEYA 3QKRA 1GRQA 1G3RA 2NZ8A 2REXB 2REBA 1N5KA 2FOLA 4L15A 1TQDA 2WICA 3V00A 1RRFA 3FFAA 2XB4A 3QKSB 4RD6A 5JWHA 4QBHA 3DKVA 3JZAA 4KFTA 2WVJA 2GJ9A 2ZE5A 4FI3C 4UJ5A 4URXR 3EA0A 2OM2A 5KSZA 1KK0A 2F43B 1DELA 2UKDA 1S96A 3CPEA 4FW9A 4CRWB 5M1KA 5CLLA 3RS5A 2WMOB 1P2VA 2VA8A 3K0SA 2C2HA 1VTKA 4DCTA 2F1HA 3QPUA 4B48A 3NBFA 5FUWA 3L0SA 2BCJQ 1U8AA 5E4FA 2GNOA 3QE0A 3LAWA 2ZRBA 4NYMR 1F2UA 2CBZA 4JLAA 2FZLA 2Q3HA 4Q1AA 2WWFA 2C77A 5H70A 2CVHA 4HAVA 3NHAA 4V03A 4ZO4A 2FNAA 4D26A 2OV2A 1GDDA 2RHDA 3NDPA 1KJZA 1CXZA 3AQ4A 2VL7A 2DB3A 5BYKA 1Q1QA 3LNCA 3LBIA 5FTJA 2D2EA 2RCNA 1KI1A 3LXRA 2QEQA 4LX0A 4KYUA 2WOJA 1Q12A 2JAQA 4KLNA 4NH0A 2C99A 1V5WA 5BN4A 3VKHA 1N6IA 1P4SA 1HY3A 3N2IA 1ETUA 2JLSA 3W3ZB 1XBTA 1E79A 1U0JA 4BFSA 4AY2A 3IO3A 3HYRA 4V0ME 5A5GA 1XU4A 4JVMA 3MLEA 2L0XA 3QKTA 2NMVA 1NF3A 3HYTA 4AKIA 4MYTA 3PG5A 4MRRA 3PUWA 4Q1CA 4B44A 4L16A 2NGRA 4JL8A 3A4NA 1P9NA 4U02A 3DM9B 4P3YA 1FX0B 3PENA 1KTVA 3RSOA 4TYYA 4PC1A 1J90A 2GCOA 4YDHB 5CYOA 3M1IA 1AZSC 4NMMA 3WP1B 5F3WB 1A4RA 3NVAA 2YWFA 2FV8A 3ADDA 1R5OA 1RRGA 4M2LA 2FPKA 3CONA 2CNWA 1T5IA 2BJVA 4TZ0A 5DYGA 1Y63A 4CF7A 2VF7A 3I61A 2CLDX 2J9RA 4E03A 1M74A 1EFRD 1MV5A 2D7CA 4ZDIA 3K0FB 2F43A 3LY5A 5C10A 1ZMXA 4RKEA 5EP2A 5LB2A 3VHXA 4NCJA 2GJAA 3D6TB 4RSGA 4PZYA 1KO5A 1TUIA 3WNDA 1TMKA 1KJYA 1F2UB 2AK3A 2RGEA 2ZUDA 1WA5A 1G7RA 4QNMA 1CJVC 1L4UA 3CR8A 4B3BA 1Q3HA 1HUQA 1XJ0A 2KBEA 3JVUA 4HATA 4DB2A 3KKNA 1U94A 4G5RA 1QHXA 2OILA 2FG5A 2ECKA 3VR5A 4QGGA 521PA 2FGJA 2QU8A 4ON9A 3NDBB 2OZEA 1ZUNB 3OEEA 1NVWQ 1C1YA 3FHOA 2B8TA 3K9LA 3KKQA 5GJBA 4RZ2A 3B2EA 2QT1A 4LPSA 1OFHA 2AD5A 1LW7A 3Q7QA 3WP0A 3T1TA 1GL7A 4AG6A 4RD2A 1J7KA 1JR3E 2DWOA 2ZUCA 1GL6A 2V3CC 1EWRA 1WQ1R 3A1WA 3IIMA 2GBLC 3QXSA 3LH5A 4F91B 4MGIR 2SHKA 2RB4A 3ZZTA 2ATVA 4NYJR 1AGPA 3CNLA 3RC8A 4L8GA 4YXWA 2QP3A 2JATA 5HCIA 2CL6X 4HZUA 3BRWD 3R7WB 5JSZA 4HEJA 2V8OA 4WZ6A 2BCGY 4WZBE 5LD2C 2E9SA 5D3MA 3LWNA 1FFHA 1G8YA 2N1BA 3K0FA 4TMTA 2PH1A 2H57A 2WWIA 3LW8A 3OHMA 4M1MA 1T0JB 3GEHA 4QG7A 3EPJA 3CNNA 1VYTA 2FFHA 2OCPA 2PZGA 2B7BA 3BAFA 3KJIA 2QSZA 2RMKA 2BEKA 2O8CA 2ZS7A 2WSSA 3B85A 3DM5A 3RSLA 2OO7A 4BRUA 1IY2A 5JCZA 5FH9A 1Z63A 2CL0X 1NP6A 1W5TA 3CB4A 4JS0A 5J40A 3VAAA 4EJSA 5KPJA 4D4JA 2LKCA 2Z4SA 5CLQA 4G5GA 1XTJA 5LDDC 2YYZA 1HQYE 2EFDB 3HU2A 4XWAA 2GZAA 1R8SA 4OK5A 4ZKDA 3OIUA 3UIEA 3HR8A 2VP5A 4Q1FA 4PXAA 3BBPA 3BB4A 3FYHA 5TARA 4B75A 3TUJC 2EQBA 3U7HB 2XZOA 1B0UA 2R44A 3S1AA 1DO0A 3KKOA 3L8YA 2I4IA 2BKUA 3EIHA 2DCUA 2BHRA 2FPLA 2QGNA 5CB8A 3UXMA 4UJ3A 4HDCA 1GZSA 2J0VA 3BB3A 3SJCA 1DAGA 1KI6B 3B5JA 4LJYA 1HYQA 1N6NA 1U0HC 5SZKB 1N5IA 1NRJB 3C15C 3KQNA 4BE7B 3K09C 2ZVQX 2X19A 2ZRHA 1FZQA 3A1VA 5B30A 3QIAA 5B64A 3C4JA 1UDWA 3THXB 2H92A 2P6UA 1OHHD 3NC1C 3TUZC 1IOZA 3BC1A 1E3MA 2ZAOA 2YOGA 3EZ9A 4PSVA 2FSHA 5CDFA 2MMGA 3R9IA 3SYKA 4B71A 1OH6A 3O8BA 1NKTA 4DJTA 3EAQA 3EG5A 4DCUA 2KJQA 1R0YA 1S9DA 1ZC4A 4MDEA 1YZNA 3DPUA 4YLGA 3O8RA 1GUAA 3U61B 4QHSA 3U6BA 2O8DA 3GLFB 4OHVA 4EPRA 2XSZA 3ZLJA 4RD0A 3QXXA 1L4YA 1R7RA 2QTFA 2GK7A 3KZ1E 4LRWA 3CPHA 2WTUA 4DUGD 4URYR 3EZ6A 5HR5A 3PQCA 1FTSA 5G3YA 2VP2A 4CEIB 1N3BA 1NMXA 3EPHA 1Z47A 4E22A 5J4VA 1Q1EA 2J41A 2K5UA 2O8BB 2KWIA 4NYIQ 2AWNA 1XPOA 1T6NA 2IWRA 3CRQA 2RGGA 1NG9A 2GXSA 1GKIA 1DAFA 4NCIA 2O5VA 4DKXA 4P31A 1OKKD 2OEPA 2XITA 4IOJA 3EIEA 3M0EA 5BN3A 3J81k 4JL5A 2PEZA 3GFTA 1OV4A 3P20A 1NBMA 1KGDA 3X1DA 4D4MA 3WYGA 2O52A 3UG7A 2ZS9A 3CWZA 4XVQA 1DTSA 2GAAA 4FWIB 4UKDA 5GJVC 3TKLA 1PVOA 1VCNA 1KDRA 3A1UA 5SZIA 1CS4C 2ZU6A 4A8JC 2D62A 2PJZA 4TT3A 3KTAA 3HJNA 2B8WA 4D6PA 4D0NA 4LHYA 2PMDA 2QRNA 1VHTA 1G19A 2J0SA 2JJ1A 4R2IA 5JECA 2YKGA 2JIZA 4URZR 5E3HA 2Q21A 4I1SA 4NDZA 4IJMA 1F2TB 4A4DA 1Z6XA 1CR0A 2PLRA 5F9HA 4BLRA 5P21A 1VCMA 4LHZA 5FUYA 5TVKA 5CDFE 1DARA 3DMDA 3ADBA 2DFNA 2VSXA 1AIPA 4Q7MB 3LO5A 2BC9A 1D2MA 3JZMA 1CF4A 1NY5A 2CE2X 1COWD 1TX4B 3LFUA 5EXXA 1VCOA 3DOEA 3B1XA 2ZRKA 3X1XA 2B7CA 4Q7KA 2O8EA 3CRVA 5DSZA 1CR2A 1EX7A 4C30A 5FR1A 3B78A 4YONB 1JJ7A 1CBUA 4ZKEA 3H0KA 3TSZA 5BN5A 3ND8A 2WJIA 3X1WA 2JLRA 5CM8B 5TDHA 4JLJA 5JWRA 8OHMA 1I4TD 3TW8B 1ONBA 4YC7A 4B6FA 721PA 4KSCA 1G3QA 3UMRA 5JJKA 5CM9C 1ZNZA 3MWLA 3IEVA 2FFQA 2ORVA 1QDEA 3FKQA 2XXAA 4TL6A 1K5GA 2QMOA 2IUUA 1Z5ZA 4OJQA 1IXZA 4YDSA 1EFHA 3HPQA 3I4LA 5J4HA 1UKZA 2EVWX 2CJWB 4IW3B 1NNEA 5EE0A 4Q7JB 2A7QA 4G3XA 3QVUA 1G5PA 4CYMA 4ZCLA 2HLDA 1VPLA 2VP4A 2H17A 1RE0A 3A37A 2QMUA 2KB0A 2REOA 4A0GA 3W5JA 3IHLA 1R0WA 3PUZA 4ZCMA 2IW3A 2KBFA 2ZTSA 4Q4LA 3L0IB 2PT7A 3IO5A 1N6HA 3T61A 3IQWA 3ZJYA 3ZVMA 1OB2A 5DNYB 1W2HA 2B6HA 1ZUIA 1TU3A 1R0ZA 3ZS8A 5CB6A 2VHQA 4XTCS 2LWIA 2RKOA 3WY9A 3DKPA 4IOMA 2FGKA 4A9AA 4F4JA 1CTQA 3KUDA 1LF5A 3H4MA 5FFMA 4PAMA 4DSOA 4CEJB 3WNBA 4A2PA 1A2BA 4KLZA 1IN4A 4LV6A 5G41A 4KI0A 1WDTA 3TSWA 5JCPA 3NEJA 1HV8A 3Q7PA 4MKIA 2ZRCA 3LA6A 3LW7A 3KB2A 4D0LB 3K9GA 1IJEA 2XXAB 3A58B 1W2GA 3MRSA 2GVDC 5H8WA 4AI6A 4TYPA 5FPSA 1AN0A 4II7A 2CNWD 5G40A 1DAIA 5KDDA 4PPQA 4B3XA 3R7WA 1BKDR 4A0RA 1PLKA 1GVNB 1UEJA 2VSFA 2J59A 2WM9B 1OXSC 5AUOB 2HT1A 1X8JA 4PFSA 1W0KA 1F60A 4PR0A 2WJYA 4C7OA 1OPXA 4TL9A 4AK9A 1KMHB 2EFEB 4BWYA 1TF5A 3P32A 4GMDA 4PHFA 4V0NA 2O8CB 1E2PA 1A82A 2C96A 4MUBA 2ZRFA 4ZCIA 4KO8A 4BLOA 4BPBA 4IHQA 2DFTA 1LS1A 3K0CA 3FB4A 3RRNA 4XD7D 2KSQA 3CRMA 2V55B 4TZ6A 4W5HA 3VR2A 3W34A 2J5XA 3KJGA 5JJLA 3KQHA 4B6EA 4JLBA 4GZMA 1OSNA 1Z0FA 3KFVA 1GL9B 3ZZ0A 4D4LA 1T0HB 3GPLA 2ZR0A 2CHQA 4C0HA 4CT5A 2H18A 1BOFA 3C8UA 3CNOA 2VLIA 3CX8A 3PEYA 3MGCA 1NBME 4DZZA 2ZANA 2BM0A 4XVRA 2BM1A 1NLZA 2FZ4A 2Z83A 3DDCA 1WMSA 3SJAA 2HYIC 1SVKA 3OAAD 2EFGA 4D0GA 1M2OB 1LVGA 1M6NA 5TXGA 5AUNB 4LY6A 1N6KA 2ZJ5A 2XTMA 2V7QA 4BFTA 3E2IA 3KDSE 4MYHA 4AC9A 4UQOA 4EAQA 4DDVA 2IF0A 1SVIA 4XIGS 4JBXA 2JGNA 2V6IA 1NSTA 2Z0MA 5C2FA 4BZQA 4ZIRB 1ZVQA 1G16A 2BIFA 2FPMA 4Q66C 2ZM5A 2IBMA 3KL4A 4MKFA 1G9XA 1QRAA 3PUYA 5JHGB 3LD9A 3FTQA 4UNNA 4UNPA 2JLWA 5TB5A 1RW4A 4LHXA 2GCPA 3VR1A 2FN4A 3QUSA 4BFZA 3EXAA 2ZUBA 1WE2A 1TADA 5FUVA 3PUXA 4JLNA 4JL6A 1XZPA 1G20E 4HAUA 4JLVA 4B3FX 4IDOA 1T3SA 2VF8A 2R9VA 3FKSD 5L3QA 2JDIA 3CH4B 1G4UR 1OT3A 3UANA 2E87A 4ERNA 1DG3A 4A1FA 4G0NA 4V0OA 3BH7A 1VMAA 5IK2D 2BV3A 1P2UA 4AYWA 1H8HA 2IHYA 5FBLB 5FTLA 4US1R 4TL7A 1VG8A 1OFUX 5KDLA 4OI1A 2W6JA 1Z8FA 4C7OB 1GNRA 2DBYA 4RY2A 1ZM2A 5KNDA 1AZTA 1L2TA 2AKAB 2P3SA 4WXRA 4PZLA 3LQRA 3BOSA 2Z5FA 4HUQB 2CHVA 1NVVR 3RABA 5K8TA 1XPRA 2HDNB 3RS0A 4DC9A 2IYZA 4Z1MA 1Q57A 5BW8A 3RS2A 4GDFA 4AKHA 1Z06A 3AVTA 3AF2A 2IXEA 2P6NA 3K0AA 1UKEA 2NG1A 2QPTA 2A9KA 1AS2A 3CX6A 2HXSA 3OFNA 4URWR 3SJBA 3NH9A 3SYLA 1X6VA 3FKSA 3ZYCA 1Z22A 2D06A 2IEYA 3ADCA 3REGA 4V02A 3ZD6A 3TUIC 3X1ZA 3EA5A 3EZ7A 1CJTC 3R9WA 1N5JA 4Q48A 4UXIA 5DO9A 4C0BA 4ESVA 4Q00A 4OHYA 3RRYA 3GLHE 3FE2A 3T35A 1HE1C 4NYJQ 1MABA 5FPHA 1XTRA 3K9HA 3GLGB 4JSTA 3SDZA 1GNQA 2IC5A 4DDTA 2NO7A 3HDTA 4B74A 1AK2A 3QQ5A 4KBGA 4MQBA 3I72A 4OBEA 3BH0A 3NH6A 1XCPA 2XGJA 1X8KA 2IYQA 2GAOA 3WMGA 3NC0C 4PC3A 2ZSFA 3C14C 3RRZA 3W6NA 2IYTA 1G5TA 1KDPA 2NOAA 3I73A 3BFKA 2CXXA 3VHLB 3PEUA 4HLQB 1WF3A 2C98A 2P6RA 1Q3TA 1Q20A 2UZIR 4Q4HA 3FMPB 3GD7A 1TAGA 3B82A 4Q5IA 1S0UA 2DYKA 2IEZA 1DS6A 3SE0A 1QHYA 1ESNA 3DVLA 2O8FB 3WRXC 2G1KA 3KQKA 3K0AB 3OEHA 3QENA 2RGNA 4N3NA 1R2QA 1D5CA 4PSAA 1XDBA 2UVQA 1E9DA 4PQYA 2WWHA 3ZIAD 2WKRA 4B34A 3GCGA 4HAZA 4NP6A 2YOFA 1NVXQ 1HEIA 1G7CA 2YC4C 1G17A 1S1CA 1E94E 1XJQA 2IL1A 4M22A 3BGWA 4OI4A 5JZVA 1CIPA 1XMSA 2ONKA 2CE7A 1W4AA 2ZROA 4Q9HA 4M1OA 4RD3A 3BERA 3HP1A 4YMWA 1SHZA 2CCGA 4EPYA 3FHCB 2QY9A 2C04A 4PQFA 2YINC 4FN5A 1R5NA 1F48A 1CULC 4BEBA 3GLFE 3WMFA 4CEJA 1UBCA 5J47A 4JLMA 1KSHA 4LJ9A 5E7IA 3TRFA 3IPYA 3L43A 3UWOA 2OXRA 4XD7A 5DH9A 3QY0A 3AH8A 1KOFA 5JHHB 1JEDA 1FNNA 1XRJA 2G0TA 2FF7A 2ZI6A 4DCSA 3W5IA 3FWYA 1XXHA 3O47A 3U3OA 1BO6A 2AK2A 1JB1A 2ATXA 5FBQB 2GEUA 1YZGA 1GTVA 1RZ3A 1K6MA 1Z3IX 4HDQB 4CW7A 1XF9A 1E6CA 1AM4D 2ZVPX 3B1VA 1BS1A 1P61B 1PLJA 1S4QA 3AKDA 2EFCB 1PV4A 3QSYA 2G3YA 3C5HA 4TT3D 3GJ6A 1NMYA 5KDOA 1KI8A 4OK6A 4BFUA 2IYRA 1Z28A 3H86A 2AXPA 2GJ8A 5L3RA 4M9XA 2ZYVX 4HDOB 1C9KA 1QHIA 1FL9A 1LFDB 1BMFA 3GFOA 5IK2A 1PLLA 3TH5A 1MT0A 3U3JA 4DSNA 1AS3A 1FX0A 1OLOA 3B6EA 2F9LA 4HYYA 5JI2E 1YR9A 3K8YA 3JVVA 3VTKA 2C78A 3GFPA 3RANA 4WXPA 3EC1A 1YR7A 3RS4A 3QXJA 4JT2A 2Q0HA 2NZJA 1TTTA 4OQXA 4AYTA 1KNXA 2Q9BA 1OF1A 2H8KA 2OBNA 1U8YA 4DLRA 2X2FA 2W83A 4Y0AA 2DFLA 4EKDA 3GLFA 2JDID 1UEIA 4WAUA 4BQSA 3ND9A 2B21A 1RJ9A 2ZRPA 4GBMA 4H1UA 4NPHA 4FINA 4TTPA 1E0JA 4AIIA 4MGZR 4A2WA 4PANA 2IXFA 3U44A 2WKQA 4LJ6A 1U9IA 1YZUA 2YWEA 4XSHA 3RS7A 4PHGA 3TJZA 2AR7A 5FTMA 3ASZA 1ZM9A 2BMEA 2DR3A 1Q1BA 1G6HA 1FP7A 1K5DA 5KHOC 3LDAA 1MO5A 4B2PA 4C3ZA 1IXRC 3IHWA 5DLQC 3EW9A 1E69A 4XH9B 2OUKA 5AR1A 4A92A 1GAJA 2JLVA 1DEKA 1O3YA 2IUTA 3SJZA 5EE5B 3TW4A 4RFSB 2JJ2D 4GFDA 1G8PA 3ZZUA 2QQEA 5C46F 3W6OA 2Z43A 3MCAA 5GJCA 3MG9A 3RWMB 3GJ3A 1JBKA 4M9QA 4F93B 4D80A 2YNMA 2ASEA 3ONWA 2HYDA 2QROA 2ZJZA 3PFIA 1XPUA 4NU0A 4TQUS 4B2LA 1W36B 5AK0A 1KI7A 2PBRA 4GI7A 3EX7C 1KK1A 4OL0A 4B47A 1LTQA 2C9YA 4X8MA 5DI9A 1YZQA 1G7SA 1E2GA 3GJ5A 1W48A 1KY3A 3G5UA 3VU9A 4MRVA 3MMPA 2ZR9A 2J45A 2A30A 3REFA 2J46A 2HJGA 3UMSA 4PO1A 4EPWA 3THWB 3BE4A 4HZUB 4Q9IA 3NEYA 1TEXA 1N2CE 2WJVA 2XEXA 2WSSD 2MSEB 2X8AA 2F3RA 1NJFA 4JYBA 2ZAMA 1L7VC 4G01B 4US2R 1GFIA 2WJGA 1Z2AA 1S2MA 4MRNA 2FH5B 5FTKA 4P4UA 2VQSA 3HU1A 3QOFA 4HB0A 4ZI2A 3K0EA 1FMLA 4YMVA 2BJWA 1HA3A 1VYUA 1E9BA 1V43A 3QG1A 3WYFA 4F38A 3ZVLA 4JVNA 2VHUA 4TLDA 3LX8A 1D6JA 4UNSA 5J4LA 1P62B 4EPTA 2IF2A 3SR0A 4BZPA 1OIXA 4MH0R 2WSMA 4B35A 4MGKR 1W0KD 3IIKA 4Q02A 3LXXA 5CK4A 4QBGB 1G7TA 1RIFA 2YZ2A 3E1SA 4JMPA 4R98A 3F5FA 2J0UB 1P72A 2D4HA 1E9AA 4A8JA 2ZPTX 3AVPA 1ZNYA 2F3TA 5TV2A 5HPYB 4DLUA 1GIAA 2YC2C 1ANKA 4NZYA 1II8B 1NKSA 4CDGA 1Z0IA 2ORIA 4Q7LA 2EWWA 4JBYA 5H1YA 4Q9KA 3AF4A 1KI9A 1YR8A 3WHLA 2ZIAA 5EQTA 2XNDA 5FL7D 2YOHA 2RGDA 2FSIA 3UWKA 4OK3A 3RLFA 1QG2A 3LBHA 5JLJA 1CEEA 4M1KA 1LF0A 4LJ5A 4Q4AA 4B3CA 2OBMA 5C4MA 1XEWY 4KODA 2PEYA 3RWOA 4XVUA 3TQFA 3AGPA 5DN6D 3GLGE 3GLGA 3NBZC 5F9FA 1Q0UA 1ZIOA 4EUNA 1XMIA 3CWQA 621PA 2NTYC 4A36A 1WP9A 4TMZA 2G6BA 3AEZA 4CEHB 3BD9A 4IEIA 1GKYA 5IF9A 1F3OA 2VHJA 1U2RA 2P5SA 1W4CA 4JBWA 4LC0A 1OHHA 1XD8A 3B1WA 3GLIE 3GMTA 4R71A 4EFNA 2BKEA 5C15A 1DBSA 5JRJA 4LHWA 3ECCA 1XTKA 5C12A 3RAPR 2WWXA 2GZHA 4KVAA 1UJ2A 4H9GA 2D3WA 1MRNA 2J0UA 4N1AA 5EXPA 4EQ6A 4YMTA 2EWVA 5EZ5A 3DZDA 4QM7A 2NQ2C 4ASUD 1SXJA 1WCV1 1AS0A 4K46A 3THXA 4I4LA 4UNRA 3K53A 4HB4A 2XX3A 5FI1B 3Q3JB 1CJKC 1D9XA 1G8FA 1XD9A 4X8HA 1T9HA 4PQRA 3THYB 1YHNA 5DGXA 3EASA 4QJ4A 1YRBA 4JT4A 4LZZA 1TUEA 3AV0B 5HE9A 3LRPA 5LPNA 2CMKA 3MD0A 4G1UC 4PC7A 3T1OA 4DDUA 2GWHA 1II8A 3T5DA 1G291 5SZJA 5AJXA 3B13B 1QHHB 2FMXA 2QPAA 5BXQC 1NJGA 5FI0B 4IOLA 2NIPA 3T12A 4A6PA 1WBDA 4QC2A 4QXAA 4O2LA 4E5UA 5B58C 1E2EA 3EZ2A 2ZE6A 4TLAA 4JJKA 1R0XA 1ZNWA 2PJRA 1GOTA 3SI7A 4DLZA 3ZGXA 1Z0JA 1XEWX 4LJAA 3IGFA 3WHKA 1NG1A 1LS6A 1E96A 2ZREA 3AVXA 3N2EA 4EPXA 1E0AA 4E07A 4ARZB 3PVSA 2QN6A 2W0MA 2XJ9A 1G41A 1JR3D 3NIBA 1KDTA 1W4BA 1XZQA 1Z6TA 4OHZA 5BQ5A 2QE7D 4OHWA 3MSXA 2FE4A 3FMFA 3TK1A 1G18A 3K70B 3SS8A 1U81A 3K0CC 1G3UA 2BMDA 3BIFA 3HWSA 3KTAB 3FGNA 1NBMD 1TNDA 4D4KA 2JJ1D 4FMDF 3CM0A 4BEJA 4EIWA 4M1YA 3G0HA 1T4GA 2GXAA 2WOOA 121PA 4Q03A 1VKJA 3GJ7A 1Q44A 1E1QD 1M34E 1NN5A 1UPTA 1Z29A 1Z0KA 2ZJAA 4DB4A 4BFYA 4QNRA 2FDCA 3LVQE 3SBDA 2WJJA 4IEEA 2BMJA 4K8OA 3A4LA 3BWDD 3CLVA 4H1VA 5CIWA 3U44B 3GEEA 3I62A 4U00A 1DPFA 4KU4A 2R62A 3V4FA 1JEEA 1U99A 1ZM7A 4LC1A 1FOEB 3SN6A 1A7JA 1J2JA 1OH7A 5HZKA 4PHHA 3CRRA 4ZV4A 2GZDA 4HLCA 2XTZA 1M1YE 1FQJA 3IIJA 2W2TA 4LWZA 5C18A 3W8NA 2GEDA 2ZR7A 2QSYA 4GP7A 1KSJA 1XFAA 4N0EA 1W36D 1F6BA 3GLHA 4NL4H 5KYKA 3IKJA 4OQNA 5M1NA 1EFTA 4R9UC 1VCIA 4Z8XA 1ZD1A 3HR7A 4A0FA 1FTNA 1KO8A 1QVAA 4QHYA 4C4PA 3LQQA 1SHKA 2HJVA 3OE7D 1RFLA 2VPPA 4IXNA 1E99A 5LBIA 1VG1A 1XD2A 3MUFA 2HF9A 4BFVA 2VEDA 4L5BA 1G21E 1CLUA 2QENA 1GG2A 5DIFA 2CDNA 4OI0A 1E9RA 3SYNA 2C9CA 4LBZA 4L4UA 1W49A 3OIVA 2QP9X 1N6PA 3T15A 3GJXC 2UZ3A 1ZP6A 3SEAA 2W6ID 4D2IA 5E95A 4FWTA 4QGHA 1NL3A 4IVRA 4DRZA 3RS3A 5LD2B 4NONA 5G53C 2O8DB 2ZE8A 3CUEF 3QNUA 1GM5A 3K1JA 1E4VA 3RNLA 3ZVRA 3O8DA 1SKYB 1YZTA 1ZJ6A 5FBWB 2GXUA 1Z83A 1HH4A 3NBXX 1F5NA 1XTQA 3C16C 3I8SA 3KKPA 1FPMA 1WB9A 2RHMA 4LK2A 4OQLA 4KJZA 5FOWA 2ZXUA 5AUQA 5FOVA 1JECA 3AVYA 1EFCA 2EYQA 4LGMA 3MWYW 5D3QA 1LY1A 2DWQA 2OAQ1 2ODBA 2WZQA 2YVUA
chains in the Genus database with same CATH superfamily
2QUHA 2OV4A 1ULSA 3VEVA 1WWKA 3L49A 4IIDA 1L7NA 3OJLA 4BUCA 4BWFB 4UXHA 3N70A 1TVKB 3SUPA 4UMEA 3MAQA 3SAFA 2KLHA 2TECE 2X1VA 2DTDA 4WD3A 3KUUA 3INYA 2AJ8A 1EB8A 3BG5A 3DTNA 2PNJA 2QLMA 1TQ8A 2AXQA 1YU6A 1IM5A 2RGAA 2V1XA 3OD1A 3TMKA 3DLKA 4ETIA 4EL5A 4MNTA 2PL5A 2Y1WA 3W3ZB 3BRWA 4NJEA 3OQMA 4F2SA 1G5RA 2NXCA 3AUJB 1JXMA 1XWIA 2G7MC 3Q12A 2OG2A 3REOA 3M5WA 2Q9AA 3VEYA 4LKRA 3P2JA 4MUEA 4DVJA 2P65A 1G59A 2IT1A 1AXGA 2WAAA 3AMVA 3I8XA 1PX0A 1SVSA 5C2DA 4IIXA 1YH3A 4QS9A 1QS0B 2W6CX 4KC0A 1SXJD 4ZI5A 3WXMB 1NKEA 4H27A 4H6XA 4UU1A 1WQ3A 4MR8A 5KVQA 3VYTB 1WUJS 3WBJA 2LIVA 4ESHA 2BGLA 2PZBA 2JLAA 1FFEA 1VIDA 5ESWA 1KAQA 3AL2A 1OGIA 2JZCA 5TF4A 3S2IA 1ZR2A 2C07A 2JCGA 4JGBA 2H4XA 1SG0A 5EWJB 3GV0A 1S7GA 1WBJB 1T43A 1X3SA 1J1ZA 1PN3A 3NHUA 3CF2A 5KYXB 2CV2A 1EE1A 3TSPA 3BXFA 1ZLXA 5H81A 4RFVA 4DMRA 2H29A 2H1OA 1GAWA 2VF4X 3Q7IA 2WD7B 4EFKA 4A16A 2G80A 3BZWA 5EC8A 3RKUA 3TSAA 4C0SA 5JNVA 3QEOA 1VMEA 2EJWA 2P2LA 5AJYA 4O5AA 4K42A 5IC4A 1BU8A 2HQRA 2BEWB 3KZCA 4K0RA 3HA5A 4KE9A 4RVHA 1JDTA 4MS4B 4ZYXA 3OYMA 1X8XA 4GUAA 2WV9A 4G65A 4KR2A 2YQ5A 2RAVA 2LIPA 5F2EA 2QAGC 1C1XA 1SHLA 1KJ9A 1RM0A 5F9MA 1EM6A 5ADXA 1P81A 3ROFA 5JCJD 3SUNA 4TLMB 2V6BA 3NRCA 5G02A 3U17A 2D2XA 2VUSA 5DYIA 4DLSA 1H8EA 4EA6A 4YAOA 6AT1A 2WHPB 4Q37A 1NOZA 4JJ6A 4TRRA 1B9FA 2R85A 2HF7A 2HF2A 3IQHX 2JFVA 1YS9A 4YPFA 2IYXA 5CB4F 2FLVA 1OXXK 5FRDA 2IU6A 4G9EA 3KLPX 2P2YA 3GVPA 4L51A 5AVUA 1LPPA 1S1XA 1HDGO 3DLHA 1A0OA 3AF0A 2FEMA 1A9OA 3CMAN 1FDOA 3DEAA 3ILYA 3QU7A 2XBUA 4IWNA 3RRXA 4J0HA 3A28A 5LJWA 4KSBA 4PZUA 5T4FA 5TVGA 1PJ3A 1X1QA 2QL5A 3WLPA 1FMJA 1KDOA 2GESA 2ZBVA 4QYXA 2DWPA 1WX1A 4GBJA 4X1IA 2WQZA 4BB9A 4B6JA 1E5LA 1ID1A 4DYVA 5KOHA 2H7YA 4BX2A 2P30A 2W6JD 5BOVA 3BFXA 3BFPA 5J1EA 1HDZA 2GD1O 1JU4A 1IN5A 2NYAA 5AKZA 3WL7A 4QJ3A 1H3EA 3JYNA 1WB4A 3AM1A 1U0BB 1Q92A 2PX4A 3PNLA 2GBZA 1YU9A 4FLVA 2H9AA 2XB8A 2PKCA 1VG0B 3MXMA 1P5ZB 4GSLA 1DDIA 1XCJA 2X74A 4WBSA 3NOOA 4DKJA 3K2PA 2VYPA 3HPRA 1XMJA 4JKEA 1X1CA 2JFZA 1VFNA 2C7GA 3AM4A 3RBZA 2O2ZA 4P4NA 3UAOA 5P8WA 1E4EA 2EV9A 1A5VA 4F2GA 1FXSA 4A8TA 1EWVA 4PW0A 5B6IA 1ZGAA 1E98A 4C7XA 3EIXA 1MOPA 2ZT5A 4GMJB 3EPKA 3ZNNA 4G2TA 3G2KA 1AB5A 1H8HD 1LB1B 1U0RA 4CQJA 2ECPA 2QMEA 4DS5A 5TY0A 4K6MA 4NE2A 3U3DA 3ZU5A 3CN9A 3FWPA 4N49A 1B23P 5C53B 1Z7YA 4P93A 4G6ZA 2J07A 4WJLA 4IAOA 4WN9A 3U1BA 5F7OA 2ON6A 4J0GA 3OY2A 4BNXA 1BVHA 3TS1A 3FTCA 1IIRA 1KFCB 2DY0A 1NASA 4MINA 1XHXA 5KQDA 4U9UA 4Y98A 1L5KA 4DHWA 4X62B 3QV2A 1GLEG 2O8FA 3DXMB 3ICEA 3G6WA 3EGIA 3IERA 1Q17A 3T5GA 4DARA 1J22A 7MDHA 1DSSG 2FX2A 2Q28A 3EWSA 2OA8A 5DGIA 4DJDC 2GF9A 3CC7N 4KH6A 4AVYA 2V4ZA 2RDMA 4JEIA 3R3WA 3HRIA 4FOEA 2XZLA 4R3UC 1PF7E 2Y1DA 1ORVA 4RY0A 1UDXA 1ZH4A 1REVA 4UDXX 3UJPA 1E7QA 1SUIA 3DB1A 3IOMA 4D46A 3AB3A 3JQAB 3ZX3A 3S2SA 4D9IA 1QE5A 1VC2A 3OOSA 4B9SA 2ZJ8A 3MC1A 1ZYUA 1RDCA 2A4KA 5CP8A 2O1SA 2XQVA 3B7PA 4URUR 1BMDA 5EIEA 5FXMA 2VQDA 3R23A 2B69A 1E7WA 1XN4A 1MG5A 1TW3A 1PNVA 2XCUA 2B8JA 3E53A 2IC3A 4HNRA 3TCXB 1BOTO 4G84A 4YCAA 4BLVA 4F85A 1CU1A 2CL7X 1B41A 4FT2A 3AVVA 1I2ZA 1VLHA 3COSA 4HMPA 4J1NA 4BAZA 1M2WA 1KZYC 3ZD7A 1IONA 5CNIA 5L4SA 1PX2A 4L9SA 4AJKA 2I54A 5IWAK 3L40A 2DTUA 2B3DA 5NULA 4CJ7A 5J2UF 2ZI3A 5LM3A 4C4ZA 1BA0A 1YVNA 2IY9A 1PL0A 1JEJA 3OAAA 4OFWA 4WKNA 3ZIDA 3ASYA 1OA0A 2CHUA 4WDQA 2QT9A 3EY9A 4WGFA 1DDGA 4DQRA 3TPCA 3WJ2A 4E1NA 2HF8A 2V1UA 2BONA 4Q3KA 2HZ7A 3WJAA 1JTVA 5K8IA 2A0WA 1WXIA 3F7MA 1SCBA 2M2IA 5D8DA 2C84A 1H2HA 2J5QA 1EDOA 3FDIA 4IG9A 4RVFA 4X71A 3W8FA 4BXOA 3IS9A 1BG6A 3C0BA 3RYHA 3H2KA 3K3PA 4LJ8A 5KWEA 5JCXA 5L8VA 1T0PA 3MFQA 5NLLA 1CUDA 1TKRA 4IZ9A 1J06A 3SUQA 4C88A 3IJPA 2VHZA 3GL1A 1VLQA 2FSVC 2OHHA 1XZKA 4LG1A 3FBGA 3I4CA 4Y1RA 3KB1A 4H1HA 2C59A 2W00A 3OE7A 1U3TA 4F2PA 1ZBUA 3I2KA 1T6DA 3NBYC 3FUCA 1DKRA 3O90A 4YMUA 3RVCA 1FY2A 4O55A 1NF8A 3KZMA 5G4KB 5CA1B 3MHTA 2QVCA 3HCBA 4BG8A 4EW3A 2BHNA 1VQ1A 4I9HA 3ISNC 2YXNA 2IP1A 3VU0A 1ZK1A 4TLBA 1G9SA 2QEXN 1JAZA 1I9CA 2OHFA 3AEUA 7AT1A 1JN0A 3EPLA 4GPTA 4G67A 1VRWA 5JICA 5BT8A 3L8BA 2ZB8A 4Q4DA 2GKSA 3DZCA 4M76B 3SEFA 1U2QA 1O87A 4LHSA 4Q1EA 3D7MA 4GKVA 3NXSA 5EA2A 4KH5A 4BLTA 4X66B 1QF9A 1QVRA 3E84A 3QI2A 4EWLA 3KZVA 3AW8A 2EKQA 1INLA 1SUBA 2LRHA 3MCUA 1EUDB 4H0CA 4QXOA 3PXGA 4JODA 3RMAA 3C6BA 3GGGA 3GNTA 1JXOA 2WMYA 1R10A 1J8MF 1ELOA 3VJLA 1RDWX 1E2DA 2CDBA 1N78A 1ZGBA 4OQZA 3SKYA 4D97A 1Z5VA 1A72A 1EG7A 2PZEA 4HTAA 2V6MA 1EXWA 3S2GA 4RTQA 4MUIA 2EHGA 1X94A 5HJ2A 3UPTA 1DWQA 1RAHA 4L3QA 4WKGA 5DHAA 1TUUA 1P1CA 3TZHA 2CEAA 2PS3A 3WLFA 1Q0TA 4G9ZA 3OYLA 3I23A 4KRYA 1J5PA 3I05A 4TWZA 2W7TA 3MGGA 2QK9A 1PP4A 1HQEA 2XBLA 4PYMA 3V2GA 5B4UA 4B3RK 2HSWA 3H9BA 2GTPA 1D9DA 3T1HK 2QP4A 3L2OB 4ZQFA 1KDZA 3VNBA 4BASA 3E9MA 1YDMA 1DC4A 3OY7A 1GCOA 2ISCA 1T4DA 3IBYA 4X1KB 5F1KA 4KCGA 1NY6A 4OI2A 5LQUA 1T8EA 4X3PA 3UJDA 3PSIA 1UKCA 3W4JA 4BRGA 1Z13A 1EKEA 3ZCRA 1E6EA 1BFDA 1XN1A 1HNXK 2NTVA 5E2AA 1I3AA 1JHMA 1HDXA 5C7LO 3SQ1A 4WI1A 5DISB 3E23A 3OEHD 4H6VA 3CSSA 3O2JA 3L18A 3W7BA 4BC2A 1HYZA 2WUFA 1KJWA 2Q6IA 2R2AA 3EODA 3E03A 4AJ1A 3A9RA 3A25A 3KTFA 2XE8A 3DB2A 3VESA 4LF5K 1Y7LA 1KAEA 4KQCA 5HIKA 3L4KA 3WLLA 1F06A 4IGEA 1H2BA 3CM6A 5BW6B 3KM0A 1WKVA 3H65A 2JD2A 3E9EA 1U90A 4AF8A 4YO7A 1U7OA 3IVXA 3VPBA 4BE1A 1Y6FA 1DTQA 4L8LA 4MGHA 3MJRA 1OROA 3EE6A 3FFBA 3I30X 4F12A 4ZQHA 2QPOA 3CLRD 1R6XA 2BR3A 2X6QA 1XDZA 2BFNA 1YA8A 3ETNA 1NQVA 1Y6ZA 2UAGA 1XLTC 1V0JA 3HN6A 3NYQA 5EE9A 4U39A 3ZSYA 5FAXA 4C0QC 1G8MA 1UOQA 2MMCA 4U1RA 4CUKA 4DXDA 5JNWA 3LI2A 1TYEB 2WFZA 5CIQA 1VPEA 1Z7GA 3BK7A 4NB4A 1MJGA 1VQ9N 5HZGA 4B46A 2XDAA 4NS4A 4MDFA 3C3CA 5E9JA 5EJFA 4AURA 4YRRA 2C92A 1PFYA 3I9JA 1K0UA 3OT5A 1KYQA 1A5TA 3KWIA 2QJFA 4O08A 4EUEA 5D7BA 5KOYA 3LWBA 5L4NA 4KDEA 2VP0A 4R54A 1X2EA 2VXOA 3QBDA 3B6PA 1L8OA 3USZA 3WB2A 3L0QA 2VYND 1KFDA 3CNQS 3OM1A 2AOTB 3R6LA 1ADGA 1XB2A 4HB2A 2ZRLA 4NU8X 4KQFA 4RK1A 3T7CA 3W2HA 1FDUA 5EVCA 3CFPA 1NQXA 1MRSA 3RG8A 3M8SA 2BYTA 4MW2A 1Z2CA 1NTRA 1PKEA 3CWCA 1JAIA 3H99A 4FSDA 4OJYA 5FTWA 1R8QA 2B7LA 3QVXA 5K3SA 1R0SA 4N5IX 2PWAA 4D7AA 4YCJA 4FLUA 1OU0A 2OGUA 4QDXA 2D5CA 2LZ0A 2XCIA 1KMQA 1HE8B 1E4YA 1VHJA 1ZGHA 4FYIA 3ZEIA 3OTOB 3HU5A 4J0DA 5CPBA 2FN9A 4TKVA 4RE5A 2GO1A 4F2RA 2X3FA 3DMYA 3RVLA 3VEWA 2CV0A 4KXMA 3ZXIA 2WYHA 3D7EO 4MS3B 2PT5A 4RXUA 4NG4A 1CYEA 1XNQB 1X8LA 1PKXA 3HCFA 1P1BA 1PEKE 2VAWA 4WDRA 4ZZ0A 4HCCA 4POOA 1FSSA 1B26A 3LCUA 3VZCA 2ZOSA 4GNKA 4BUJA 3VA0A 3WX0A 5HRRA 1VJDA 1CZOA 3FPFA 3WZ2A 1DUSA 4MIYA 5LYJB 1GKUB 1R0AA 3RJZA 1OKJA 2Q3BA 5FD8A 4MW9A 3F4BA 4UQLA 3G02A 3H5RA 4QNMA 1OX5A 1G21B 3NF9A 3QETA 1RHRA 1ZH6A 5DYNA 2PX3A 4ZWNA 4LN1A 5IVIA 3ROMA 5JYBA 3BWBA 1FA9A 4LXUA 4OB8A 1XZFA 3G88A 1ZAYA 1T10A 3T9AA 3T5BA 2PD6A 2XB9A 2Q0XA 1AB6A 1W73A 4P36A 1QVFM 1TQHA 1LPBB 1KS2A 1QMGA 1YB7A 2C8VA 3NATA 1HTBA 3SS9X 4C4OA 4CMEA 1ONNA 4KQMA 4YUWA 4E5PA 1HZJA 3ICVA 3MRVA 2C5BA 1QGUA 3PYLA 4FR5A 3Q5GA 4TSRA 5EINA 4IDPA 3ZCUA 5LYJA 1K8RA 5EHXA 6ADHA 1HO3A 3QXHA 1HYGA 1OFTA 2GCOB 4IOKA 3RIXA 4F5EA 3S1LA 2Z2IA 4RGVA 5JFOA 3I2FA 4IDFA 4DU1A 5DLEA 4LYYA 4K81B 3K9NA 4UM9D 2IIRA 4FSXA 1T03A 2DR0A 3AERA 1GAXA 3QBEA 4D0RA 3CZQA 2YS7A 5AJZA 3T3OA 3COZA 5HCNA 4KQXA 1QZTA 2ORWA 1EZZA 1PR0A 3E66A 3HL4A 4Y6SA 1N2CA 3ZHRA 1Q7GA 1DVRA 2BTFA 1MN6A 4FKZA 4IIVA 1A9RA 4IV5A 3UKDA 3IUYA 2HWXA 2A1UA 2B35A 2HXGA 3JZFA 4QAGA 4GEKA 4KH4A 3UATA 4NQRA 3TW0A 2OXCA 2I2WA 3HCEA 4KACA 5DGDA 3T4EA 1N2SA 4PGHA 1WNFA 2ZSDA 4QDUA 3L2RA 3DMNA 3RC3A 4L74A 1OGYA 1YCDA 2QTHA 3GIDA 1EFPA 4P3XA 4P81A 3UOAB 4YJKA 1VHLA 4UHEA 1Q22A 2HRQA 4PX9A 5JSUA 1MG0A 4DWJA 2GB4A 2ZIFA 1X9JA 2D4AA 2P9CA 3EK2A 3O4HA 3ZGVA 3PT5A 2FK8A 2ZB3A 1XC3A 4DBLC 2YWCA 3H0CA 3QEJA 4IICA 4HX9A 4K9PA 2E6UX 3F2IA 2NVUA 3L8FA 3VU8A 1HURA 4QTUB 3ESDA 1O9BA 1QFYA 4TLCA 2PLNA 4XWTA 4IDNA 4ZVNA 4DSUA 2ERXA 1SKBA 3JARA 3KPYA 3BYZA 4IMJB 4IS2A 4N01A 1N6OA 1OC2A 1PEAA 3GB9A 1JAXA 4PPFA 3S8EA 2K6GA 3EFEA 1U1GA 4PBSA 2PJDA 2GWKA 4N4AA 3CLTC 4L08A 1KYYA 2IS1A 4Z9BA 2AFIA 3OESA 1SUEA 4S2UA 1BA2A 4HX2A 4K9KA 3KLNA 2LCFA 4ZYVA 2B82A 3SFZA 2N42A 2ZJ2A 3CO5A 3GYGA 5CEFA 3D64A 3KT3A 4I5FA 4IRXA 4ZP1A 4MVJM 4V0RA 3M6LA 3OE5A 3V3TA 2BKXA 3MELA 4ER0A 2GRAA 3A7DA 4GR9A 2BBSA 2PY5A 1NQWA 2JD1A 5AHOA 3KKEA 2H2AA 2YN2A 4X92A 4XUCA 3THYA 2HT6A 1C7ZA 4DJAA 3KE9A 4TWAA 5IZCC 4D6XA 3L0CA 1T9GR 2PPVA 1ESMA 5JZSA 3Q1LA 1I4LD 4D8VA 1RBMA 2W2XA 3A1TA 4Z6KA 5HGXA 3QHAA 3U9ZA 4GQIA 3G2LA 3TQTA 1PUIA 4LDQA 5JSKA 3JYLA 4QXMA 3WLSA 3WSWA 2WQ7A 4DLBA 4HLNA 2LSNA 2ODTX 3ETLA 1TO1E 2Y0PA 4QODA 2B3TA 3U4GA 4AJ9A 1YBMA 2AXNA 1F0NA 4DDKA 3R8FA 1PS9A 2ST1A 2A0YA 1B8VA 3DPSA 1S6QA 3MJCA 1X7XB 1RJ9B 1ZBDA 2ZI7A 2A1RA 3H11A 1X39A 1TQ4A 1QZXA 3I3OA 4KK4A 4BDSA 5HOEA 3U31A 2ZJYA 4B4OA 3ELDA 3FZYA 1FFXA 4LRXA 4G1BA 4Z9FA 1R37A 2BEVB 4YUVA 2XOEA 2ODEA 4WECA 3U19A 1ZAKA 3QEIA 3N2NA 5HE8A 4AXXA 1RPAA 4P0QB 4N9QA 3KQYA 1Y9EA 3OTQA 5AI8A 3WC4A 4E21A 2ZSHA 3ENNA 4EYKA 5BSVA 1HPZA 4YOUA 5FROA 1T4BA 1Z5NA 3L7YA 4XOIA 5IM4F 4FWNA 2AJTA 2KM1A 3HBAA 4AP9A 3QMLA 5CIYA 4AY4A 4F92B 3U7GA 1CQZA 1DRKA 1FF9A 4OJNA 3ZY2A 5CITA 2M6LA 3PKZA 1EBFA 3HMKA 4ER3A 1RT3A 2PRKA 2I1VB 1ZD5A 2C97A 3ZLVA 2HB6A 1BE6A 2ZBGA 4ZQBA 4DV2K 3KD5E 3ZCPA 2X40A 3BMNB 2ENUA 3SK0A 2O4IA 5HQ3B 3HUFA 1YT3A 3IP1A 1I5OA 3LUFA 3BE8A 4DJ5X 3ZDYB 3RBXA 1Z0AA 3LDHA 2H7VA 4IWVA 1OKKA 1QH9A 2Q99A 1CV2A 4QYIB 4H5TA 4E7HA 2GSWA 1JL3A 4HWKA 4BMCA 4KFUA 3GD5A 1WUAA 3DL2A 2JLEA 1V45E 1F0KA 1V8PA 5IKPA 1U2ZA 5K14A 2X7HA 3U3YA 2CFIA 2EGGA 3P4XA 1LVHA 1TF7A 3ZHVA 1IJBA 4FYDA 2YQ4A 3TAMA 1T0IA 1Y4DE 2AG1A 2WIGA 3T7ZA 2RJNA 1T4CB 3AVQA 3AHEA 3N6VA 3OBBA 3OEED 3RSZA 1RJFA 3S8YA 4YRFA 2X0JA 3SZ3A 3SR4A 4UW9A 2UUAK 4RA6A 2WU1A 1U8FO 3OTIA 3V9PA 2A9PA 2IYFA 3G9XA 3SCXA 1US8A 3OPXA 4D96A 2EYUA 1Y1SA 4I81A 2XSZD 3OQBA 3VH1A 5KNCA 4IJNA 1I01A 1P6QA 1UM8A 4UUBA 3TTDA 3VC3A 1SXHA 2PHZA 2XVMA 3JYHA 1O6FA 2PJUA 3LRTA 1MR3F 2VBGA 2EGUA 5BMVA 1I6WA 3T3FA 3S9HA 1SU4A 2CHGA 2J33A 2VJNA 3FD8A 4HQNA 4TQ9A 2PS1A 1TM4E 3BF8A 4IKEA 1PJLA 1TGYA 3LDFA 3CUUA 4PLWA 4F45A 3I5XA 1MEJA 2P2NA 1LLQA 2VHYA 3ZTTA 4WPGA 1IY1A 2X6TA 3IAEA 3NHPA 4TN5A 4EG7A 3QBWA 4X66K 1QORA 4O8ZA 3B3GA 2AA4A 3AO5A 3A14A 1LV7A 3EYZA 1E1QA 4GKJK 1XZJA 2C1XA 1CY1A 2CVOA 2AOXA 4JIMA 2CC2A 3TR5A 3W9UA 3PFBA 1UIRA 2V9ZA 2AOUB 2DWUA 1P73A 5FWYA 2HW8A 3ZU3A 1PS8A 3FYUB 4WLEA 4N8SA 1BU6O 1HDCA 1OH8A 2NZ2A 3F4LA 3Q5EA 4F1WA 4KR6A 3DJCA 3O4RA 1JPNA 1IL0A 3K16A 4R1QA 5LY3A 4FJNA 1B7GO 1N1EA 1BO5O 1A7KA 1VCHA 4H2DA 3VV2A 5A4JA 1ZLYA 2PUJA 2V9CA 3AR8A 1RYFA 2NUTA 2QTBA 4M7XA 4R79A 2WM2A 4KE6A 4BTEA 4DIFA 1Z0SA 4D9FA 2IS2A 3MB8A 1LWEA 2W11A 5GOTA 3W0LB 2I3BA 4CKZA 3HT3A 3T7SA 4FJMA 2QLJA 3ES9A 4LYFA 5KQLA 3DD5A 5IAKA 1YONA 4MQ4A 1KPGA 2NQ8A 4JKFA 4JNKA 1WULS 4LK3A 4MR7A 4O4HF 3RYTC 3MA0A 4C9BA 1Z26A 3TM4A 1OTYA 1PFWA 2ID9A 2EFHB 1IMOA 2BFBB 4B8AB 3KELA 5M1FA 1YK1A 4BAGA 4BB5A 5H4GA 3SSNA 1H2WA 4EZ6A 1V16A 1Q0RA 1YL7A 1RMQA 4GX2A 4L3OA 4M0FA 2H8GA 3IEUA 3A70A 4UMVA 1DE0A 4DSAA 2VP6A 4J2OA 4LJ7A 2C4KA 5FRMA 5CHIA 5AQWA 1ZI8A 3SBEA 3A36A 3ZLBA 3C3DA 2VYCA 3P5SA 4IIBA 4L8WB 1ISFA 1JLGA 5K3AA 4UATA 2MR5A 3I6MA 4RO0A 1GQYA 2D4WA 2RC6A 5F7ZA 1SIWA 4CJSA 2Q4DA 3Q4GA 3MECA 3JTMA 4EBFA 4DSIA 2FFBA 2AL7A 1U45A 1C3OB 2ZRNA 3BZKA 2ZB7A 4RPIA 5EIHA 4D9EA 3C3YA 2K4MA 2DPXA 1P1KA 2JFFA 2WUVA 1MC4A 3KCQA 4HEHA 4GYWA 4QQKA 1Z73A 4TXMA 5K51A 3SLKA 3OEWA 1UFRA 1KDYA 4LV5B 4Q3AA 1UQRA 5JALA 2ZAGA 1P39A 5JD3A 2PUCA 4F71A 5KTYA 1Z5UA 4GWGA 2B5VA 1Y64A 4EYEA 4MVJH 2HO4A 3K2QA 3Q9UA 3BZCA 1FQKA 4JJ4A 4ERXA 1MHPA 1QQTA 3PQ3A 4RZSA 2FRVA 4M3YA 1QIJA 2X4LA 3EWAA 1YJAA 1U5BB 5K3BA 1NKCA 3HTXA 2MSLA 4IDEA 4LISA 1D2HA 3KJXA 1T91A 1TZJA 4CDRA 3C1AA 5BSRA 2ZPUA 1U2GA 2Y1FA 4FU0A 4HR7A 1N92A 4RADA 6GPBA 2DBVO 1ILWA 3AW9A 1VQON 5EWMB 4ZVLA 2JANA 3NUZA 3K70C 3DE6X 4OATA 4R31A 5KO2A 2HLNA 3IAUA 2BVNA 3GFSA 4X90A 1Q18A 2QUJA 3U4QB 2GM4A 1DBQA 1UPFA 2IYSA 3CPJB 3H2SA 3VNUA 4Y9RA 2DFPA 2RAUA 2V3WA 3NHBA 2CYBA 3C39A 4JJIA 4YWHA 4EJSB 4EGAA 4NDNE 4Q7QA 2O1EA 2PUGA 1W35A 2ZTHA 3DKRA 4LTDA 3FCEA 4CK3A 1JYSA 3NTQA 1DCKA 3ZE8A 4LUCA 4WXYB 3TWHA 2CZQA 4KX5A 3AIOA 5DNDA 4NATA 4HVLA 5J58A 2DLNA 2VC2B 1G4AE 4RIIA 1BD3A 4XXHA 5CVJA 5ESDA 3K31A 3TNLA 4ARIA 3EUFA 1N2OA 4XR4A 2ACEA 3BAZA 3EQZA 1EWKA 3SC2A 1YACA 4B81A 1Y4UA 3F4KA 3FR7A 4MQEB 3ZDXB 4RFSA 3N4PA 3DAHA 4D99A 2W2QA 4F56A 1SXJC 2GK6A 3FVQA 1JLBA 2I33A 2JZOA 1I3OA 1SS6A 3I9KA 2BD0A 3L7DA 1MX5A 2FJUA 3MMVA 3UMGA 2ODWA 4LDJA 2PUFA 2EKDA 2QE6A 2HHVA 1FJHA 1X0VA 2HBMA 1ZRNA 2VDWB 5B57C 6YASA 3HCRA 1IQ0A 2DSNA 1TYAE 1PFQA 2IXGA 3MT7A 3U40A 3CI5A 5DWDA 3M4ZA 3C8DA 4MK4A 4E09A 2GUGA 5A9SB 1HFWA 1AXRA 3GDGA 3PA8A 1GQFA 2F1JA 3ENOA 1KQPA 3QPVA 4DEXA 5T5QA 4ER7A 2J32A 5MLCQ 1JXQA 1ZCBA 8ADHA 4ZI7F 5UKDA 4HMOA 3EZXA 4OHUA 4O4IB 1C7EA 2E5FA 2PM8A 3D6VA 2C3OA 5TGTA 3SBOA 5CFOA 5L7WA 1N7IA 5IX8A 2BTEA 3D3QA 4KH0A 1F7VA 3ZX2A 1ZN9A 4OFXA 4C4SA 5AJVB 4LCJA 4FNAA 10MHA 1SL2A 4A8JB 1DXHA 1ECGA 3F5DA 5DCUA 4ZHSA 3F9IA 1OBFO 1NXPA 1VSEA 4URVR 4W7HA 4EFMA 4FILA 2GETA 4UXJA 4HLUA 5LOVF 1SZ2A 1DO2A 2BBTA 3BJIC 1B6RA 1H94A 1JQKA 1H6DA 4R8KA 3NGMA 5F7JA 3C3EA 3QF4A 1SBTA 3GXOA 3TLBA 5KPTA 1KYZA 5ICSA 2IOFK 2YRXA 3W90A 3A6PC 1W8IA 3EUWA 3F6YA 4IMPA 1KFEB 1K8QA 1ZRHA 2W5UA 4O4JF 5IDVA 4DJFC 3OIYA 3B70A 3TGPA 1U2VB 2C95A 3AO0B 3WL5A 4CU2A 1IM8A 2Z4RA 1W94A 2JVKA 2C2YA 1DJPA 1ENYA 2A9RA 4HDKA 4HYEA 4MV4A 3S2EA 5JARA 1G1MA 4HZIA 4KRXA 3VQEA 5DRYA 4Z4FA 1U6KA 3PFKA 4RX1A 3PJRA 1KARA 4KR0A 5AT1A 5DHFA 3VR4A 4ISFA 6Q21A 1CJUC 3CFRA 3CYFA 4KSYA 3O1BA 4GO1A 4QSHA 3TR0A 1B9DA 4YWJA 2OPRA 1I7LA 3ZTYA 3CLTD 4YDUA 3BULA 1TZ2A 1Y1QA 4ILKA 3I37X 2PL3A 5E6RA 4UMFA 1UF9A 4CM7A 3VNVA 1U1DA 1XD2B 3GGDA 3OF5A 2IU3A 4Q7EA 5I9TA 4E30A 4F2HA 4X1YB 3OZRA 4DIEA 3GPDG 1JEQA 3O31A 3B1ZA 3QVGB 2YNMD 4BVKA 2KE5A 3OOYA 2VDLB 3UXEA 4D3YA 2IYVA 2ZRIA 4M1ZA 4UTPA 1ZICA 5AI5A 3QXCA 4JR1A 1Y1PA 3KPWA 4J1TC 4OKKA 3CLSC 5TMBA 4RJTA 1VGRA 1VL5A 2EU8A 3GA0A 3FBWA 2AMVA 3L1HA 2X0FA 3BXEA 4YQZA 3SOPA 3TF5A 3CNBA 2FPXA 1KI2A 3CHYA 4YN3A 1YGYA 4DEVA 4BMYA 2Z2ZA 1C0LA 3O93A 3VBCA 2OAP1 3K09A 3I8BA 1KD1O 1T15A 2NVBA 1KGSA 2Q3LA 5CE3A 2Y1CA 4L2IB 1RADA 1NHWA 4Q3NA 2DFDA 3RIEA 3CLKA 3PTZA 1RBZA 5A5DA 1KI4A 2VI5A 1N8NA 2B37A 4Z4CA 1S2NA 2FQWA 4EITA 5JAPA 2X3YA 4NCAA 1NVUQ 1XQSC 2II6A 2GCEA 2OGTA 4K6CA 3DW3X 1ZXOA 4UHKA 1D0SA 2RKIA 2R7KA 3TE6A 421PA 2XA2A 2FZWA 2RFLA 2XGOA 3KAPA 1SQFA 1UWKA 2C5AA 2HA6A 2I6TA 3D6UA 3O1JC 3WICA 3WWZA 2PX0A 1KOLA 4CV1A 3ED5A 1LWNA 3QKUA 3CCMN 1UJNA 3FVTA 1Y4ZA 2JW5A 4GPBA 1U2SA 3JS5A 1GPKA 2OPHA 3TFQA 1A97A 4JRPA 2Q3FA 1E2QA 2VATA 2WKPA 2YWRA 4C23A 2UUAB 5GZ3A 4Y6LA 4GC5A 3SZOA 1K6YA 2EFYA 1ZBHA 1BOOA 1IYZA 2LNDA 4HN4B 4DUPA 5K0SA 3UHFA 3L6CA 5TX7A 2GILA 2FZKA 1RCTE 3SXUB 3WYNA 2V54A 3F2VA 1TC2A 3FYUA 4CETA 3DXYA 3UE5A 1IDOA 1OIVA 5M3BA 4XEIA 3AJDA 5LL6P 4NENA 1CUFA 4ZQCB 3FZLA 2W70A 3CCFA 5CR9A 3PHCA 4I3FA 4Z1MD 4XM1A 5A03A 1GLDG 1SZPA 3BL8A 3OZXA 2ETVA 3A4MA 4R6XA 1L1FA 1ZK0A 1TQ2A 4JEPA 3EXEB 4J3FA 2ISQA 1RKBA 4F46A 3I56N 1U7DA 4MVJI 1OH5A 1U98A 2BH9A 2HBYA 5IJ9A 5KC9A 4QBIA 3O9RA 3F67A 4GKKB 2ZYWX 4Z94A 2AMLA 2XY6A 2X9GA 4KQGA 4DV2B 1XLVA 5KJCA 4L3WA 4BXOB 1M1UA 1ZIXA 2H08A 2O07A 1H6AA 3OSZA 3VU9B 3Q88A 1IJFA 3H3JA 2P3OA 3WQUA 2IV7A 3U6KA 4X1YA 3TSQA 1NVTA 1P77A 4TT8A 4PAQA 2ZRAA 3JQCA 1T9GS 1PO7A 5LMUK 4R16A 4H03B 2F8LA 2JRCA 4G36A 3PX0A 3HUDA 4AX8A 4IJ5A 1BA3A 4F9EA 1EJ6A 4XZ3A 5B2EA 3LSTA 3ERCA 4LFBK 2SKDA 1Y0BA 4MVJG 3ZXXA 4L0DA 1E79D 1NW8A 1XTSA 2ZWAA 2XWPA 4X3CA 4Y9TA 1O95A 2H1LA 3VSDA 1UZNA 5DASA 4ABYA 4B5LA 5K8UA 2CK3A 3TD9A 3L1KA 1B4DA 5FRNA 1GPNA 2GX9A 3F3KA 3KQSA 3J80O 5FOTA 1NAHA 1ULTA 2W2VA 4DZRA 4ZVUA 2IHJA 5T8KA 5JI3E 4BRLA 3GBVA 4FOOA 4HFRA 4D57A 4HT3B 3MGKA 3VAYA 5K4GA 3CQXA 2ZTMA 1SWVA 2R48A 3H11B 1B2LA 4BVPA 1RAFA 3N2KB 1JDPA 3NJ8A 2D2VA 4YV1A 3HLTA 5EN4A 2OCAA 4J29A 3TR6A 1T24A 4WQ4A 2Q1UA 4CIWA 5HL7L 1JS1X 3NF6A 2IQIA 3QKRA 1GRQA 3RU2A 3HZ6A 2CHEA 2OR3A 2XQIA 1X1TA 1DAOA 2H4FA 2CBGA 3M1AA 4GXTA 2YY5A 4Q15A 2IXBA 1GSHA 3MLAA 5EL0A 2P9BA 3TJMA 2YZ7A 4PGGA 3IUJA 1NQ5A 3ZCQA 2WICA 1PJBA 2C2XA 4OSOA 2AZMA 2XB4A 3QKSB 1UXJA 4NENB 3TN7A 2PN1A 3KT6A 4KMMA 2C31A 4QBHA 4LFBB 3L4EA 2FQYA 2GJ9A 1VSLA 4L72A 4BMSA 3EA0A 2OORA 1KK0A 3NR2A 5A4DA 4DMNA 5M34A 4DU3A 1Y97A 2V7GA 4A7PA 2Y1IA 3K5NA 3OLYA 4FW9A 4OGLA 4CRWB 5M1KA 5CLLA 3KBBA 1M66A 2VA8A 2HAEA 2X15A 4KIFA 1YB6A 3NGXA 4I50B 5EI5A 1TAUA 4RM3A 1YBFA 2C61A 2ZWOA 3K35A 5GPBA 1WS6A 4B48A 1JA1A 2BCJQ 1HL7A 3OQ6A 2VJKA 1IRIA 4CM4A 2YL2A 5DNEA 1YI0A 5HHTA 1VQ7N 4B8WA 1C0PA 2VJDA 4GW3A 3AHJA 4DNFA 3GVCA 2FZLA 4LXQA 4Q1AA 1JHPA 4LC9B 3CZMA 5LA6A 2WWFA 3BE5A 5H70A 1NJ1A 3OLCX 5E38A 2OZSA 3NHAA 4J94A 4PZDA 1NUQA 4AF6A 3LPDA 3MJFA 5DM0A 2OV2A 3HKBA 1O08A 1OZ0A 1KY5A 2JFBA 1Q1QA 3NDIA 3OWHA 4JI5B 4CLOB 3BGRA 3ZWPA 4DCCA 5FTJA 3CCJN 3CUWA 2C1ZA 1I1OA 3VMMA 3AVYA 3KQTA 3RUDA 2Y1KA 1QU2A 2LDBA 2J09A 3PU6A 3VKHA 1JT9A 4YRGA 4MQFB 4AZ3B 1HY3A 2DHCA 2PSFA 3JCZA 1I2AA 5BSUA 4GE3A 5F78A 4UBMA 2PXCA 3ETJA 5B5SA 4KWIA 2P1ZA 4BFSA 4WY8A 1QQ6A 4CIEA 4I6EA 1GGHA 1OTXA 1V8ZA 2UDPA 3AJ8A 4I1RA 2PUBA 2XI4A 4FYPA 1YJBA 4JVMA 1SUCA 3KTDA 3L6DA 3BHIA 1XCLA 3PG5A 3IV9A 4FGLA 3C1UA 3IUBA 1HYSA 1MQ9A 4N0PA 3K9CA 2NGRA 4Q1CA 4HS9A 4RHYA 3K6SA 3IEVA 1SNYA 3A4NA 3BWMA 4FR0A 4P3YA 5G1PA 1RPZA 1WXEA 3ZHTA 3Q40A 4Z7JA 5A05A 3AEYA 4DV7B 1KERA 4IO1A 3D6FA 3RR7A 1S6PA 1OXKB 4UUMA 3RQSA 3M1IA 1AZSC 4NMMA 4KOEC 5T4BA 5JO0A 3N2YA 5SYNA 5FAKA 2X76A 3ADDA 1RRGA 1YQUA 1QYDA 4QOFA 4H7EA 4ND5A 1T5IA 3S29A 2VF7A 4WNCA 2J9RA 2ZBEA 3T38A 2A1TR 1M74A 4FW2A 1CZHA 3HGQA 2NZWA 3EPHA 2EGHA 5IDYA 1RXSA 1XA0A 2F43A 3LY5A 4UCQA 5EP2A 1NDHA 4MVXA 3D6TB 4RSGA 3W2IA 2PUVA 2JIDA 3EXIB 4NZ9A 4PZYA 3ROKA 5A3QA 1KO5A 1TUIA 1NGIA 2IPMA 2X1LA 1F2UB 3T7IA 3UMVA 2Y1OA 4GNRA 3WNDA 4CGIA 2RE2A 1G7RA 2JK1A 3CB2A 4JRQA 4GVPA 1CJVC 2O2XA 1QA