4IEEA

Crystal structure of the large terminase subunit gp2 of bacterial virus sf6 complexed with atp-r-s
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
463
structure length
452
Chain Sequence
INPIFEPFIEAHRYKVAKGGRGSGKSWAIARLLVEAARRQPVRILCARELQNSISDSVIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGIDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQANVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTKVEMKQKLGIPSPNLADALMMCMHCPALVREETEIYVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gene 2 protein
publication title Structures of the phage Sf6 large terminase provide new insights into DNA translocation and cleavage.
pubmed doi rcsb
source organism Shigella phage sf6
molecule tags Viral protein
total genus 161
structure length 452
sequence length 463
ec nomenclature
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04466 Terminase_3 Phage terminase large subunit
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4ieeA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ieeA01
4PC3A 3VQTA 2QP4A 1IN4A 1CEEA 4P33A 3RWMB 1NIJA 1HUQA 3ZVRA 3HPQA 1Q3HA 1FUKA 1KDOA 2FGKA 2IYTA 2QRZA 2NGRA 3A8TA 5KSPA 3W8RA 2VP5A 5C15A 3AEZA 4KFUA 1LF0A 4HUQA 4RD4A 3TLXA 3T12A 1E4VA 2FSGA 1XWIA 1VCIA 4BLRA 5BW8A 3VHLB 1JB1A 1X3SA 1VCOA 3L0IB 1VYUA 1NSTA 1S0UA 2X8AA 5G40A 2IS2A 2PMKA 5KSYA 2VHUA 2G1JA 1D9ZA 5FTKA 1A2BA 3W6NA 3VU9A 3NWJA 1W36C 5M1PA 1DG3A 1RZ3A 3K0FB 4C0BA 4A1FA 3I5XA 4JT4A 2OAQ1 4NCIA 5EZ5A 3IO3A 1II8A 4FXPA 2BDTA 2UZIR 4LGMA 4OKSA 5HKKD 4Q03A 3MFYA 1AGRA 4AG5A 4B44A 3QENA 4JYCA 4C9BA 1F2UA 2ZREA 2ZS7A 2FFHA 4URZR 3NBXX 1XNJA 2LWIA 4JZKA 3N70A 3QVVA 1V43A 4CEHB 1YZTA 1F2TA 2ZU6A 1ELOA 1KZ7B 3AF0A 2FFAA 1WE2A 2ZUCA 1OIVA 4XH9B 2GJ8A 1MRNA 3OEHD 4ESVA 1L8QA 3CPHA 4MUAA 1IAQA 4YDSA 1Q44A 4KV9A 2NIPA 1R0WA 3AVYA 1GRNA 3HWSA 5FL3A 4QHSA 1I4LD 3V4RA 3BK7A 2RGEA 4B75A 4EQ6B 1EFCA 4A6XA 3V00A 2ZIAA 2KBEA 4RFSB 4Q4AA 3LDAA 2FV8A 2GA8A 1CJMA 1NKSA 3D8BA 2H5EA 4U5XA 2N46A 4YONB 1E0JA 1EGAA 4GSYA 4TLEA 3C8UA 4EJSA 1RFLA 4JLJA 3FGNA 4TMWA 1VHTA 3EIQA 2LCFA 1YZQA 2ZRAA 4MKGA 5AJYA 4BGDA 1QG4A 2ZRJA 1VYTA 1G6OA 1E1RA 4IRUB 5GJBA 5L3QA 1EFRD 1N25A 2F6RA 3QKTA 5FPSA 3WNCA 1XXHA 2QA5A 2XOKA 4Z54A 2W6JD 3GQBA 3LLMA 2ZRFA 4ZO4A 2F3RA 4WZ6A 4DKXA 1PVOA 3MG9A 1XD2A 1S1MA 2L0XA 1JXOA 2VP4A 4GPTA 5E7MA 3WRXC 4QHTA 3SYKA 5J4VA 1SULA 4QM7A 2V1UA 1LFDB 4V0MA 2JLYA 4M9QA 2XB2A 1E1QD 4PC7A 2BM0A 1GNQA 3PEVA 1KTVA 3PITA 1YZNA 2CDNA 1BMFD 3H4MA 4KSCA 4MYUA 1Q1BA 4IXMA 4XJXA 4HAZA 4KLNA 2XEXA 5H1YA 2F3TA 3D6TB 4P3YA 1AS3A 1R2QA 2J41A 4ZDIA 2QTFA 4JLPA 4CDGA 5EQTA 2VHQA 1JEDA 3AF1A 3MWYW 2YWGA 3DZ8A 3U44A 1YQTA 4BEBA 5C2DA 2CJWB 1CR1A 3RS0A 2KB0A 4MRNA 1UBGA 2IYRA 2GVZC 5JJLA 4AYXA 4ZCLA 5KUTA 1F6BA 3CNLA 2W6ID 3TSWA 4LWZA 2NMVA 2ZI4A 1ZIPA 3AF4A 1Z08A 2V54A 1CJTC 1HV8A 2JLSA 2PL3A 4NE2A 1KNXA 4Q7MB 1W4RA 2GZHA 2W0MA 1S8FA 4D25A 2R8RA 3VR1A 1P75A 1XPUA 3BE4A 3VR4A 5FPHA 1K6MA 1P2VA 3CNOA 3SYNA 1M34E 1T5IA 4FCVA 1EWQA 2FPKA 2CVHA 3ETLA 4TT3D 4YXWD 4KO8A 4QJ3A 4E07A 4Q9LA 4JL6A 1G3RA 3C5CA 4C2UA 4E03A 5G3ZA 5KNDA 1WDTA 3HR8A 3K0FA 4RKEA 2GAAA 4KODA 5KSZA 1SXJE 1HQYE 5GVRA 5IF9A 4CEJA 2H57A 4HYYA 1VG9B 4DIEA 5B64A 1E0AA 1XTJA 5EP2A 2HF9A 4NHOA 4L16A 2OBLA 4M1YA 5FH9A 4XWKA 5TB5A 1IM2A 1AM4D 5BWMA 2RGBA 1N6HA 4JVNA 1E0KA 6Q21A 3EC2A 5CLLA 2CHGA 3Q72A 3S1AA 2HLDD 4BZPA 3F0TA 1NIPA 4PR0A 4U7DA 4AKHA 1Q0UA 3M4YA 5HE8A 2B8TA 4CEHA 1E96A 1GKUB 4NU0A 2BJWA 1P9RA 4Q4HB 4BUJA 3LXXA 1Z2CA 3AP2A 5DN6D 4QM6A 4TQUS 3VR6A 4B35A 4V0NA 2NTYC 2AK3A 3FMIA 4C0SA 3LVQE 1E9AA 1OKKA 1GFIA 2ATXA 1R5BA 2EFGA 4QBGB 3EZ9A 3VFDA 2J0SA 1KI6B 4PPNA 5IK2D 5FBRB 4BFVA 2GRJA 5M1QA 4IOJA 3B1WA 1IY0A 2AL7A 4TL7A 3CB4A 4B48A 4OQNA 1DTSA 3I73A 5K8IA 4WIAA 4BQSA 3PCRB 4TLBA 3AKEA 1OFTA 1KO5A 3UPUA 4EPWA 3OIVA 1NN5A 5M1NA 3QJYA 3W3ZB 5EE5B 1KOFA 3CZPA 4DSTA 4LPKA 1YZLA 3A6PC 1B23P 3OESA 4OQMA 1VYVA 4HDOB 2Z43A 5FOWA 4A4DA 5DE3A 4B2IA 1CJUC 1DAGA 1P2SA 2OCAA 4TYWA 2JJ1A 4DLSA 1E9RA 4F4IA 3FMOB 3P32A 4DLRA 1JR3A 1OIXA 4B6FA 1E2EA 2HT1A 3KFXA 3GJ5A 1BS1A 2F55A 1DADA 4WOPA 2CK3A 3RS5A 2QQEA 2UZ3A 4II7A 4C0KA 3U7FB 2XNSA 4BFSA 1ZCBA 3AGQA 4NH0A 4BFUA 1G4AE 1XJQA 5M1FA 2CCJA 1A7JA 1U90A 3GEIA 1XMIA 3EZ6A 1JAHA 4HLQB 4LSGA 4ZDJA 2ZSAA 4O0MA 1XMVA 3EW9A 2CBZA 2H17A 4KCGA 3VNVA 1MT0A 1YHNA 4X8LA 4ABYA 2MSEB 2IWHA 2NO0A 1AZSC 2Z5FA 4KVAA 4L15A 1Z29A 4OJQA 4M8NE 2IT1A 3KXLA 5J47A 5HCNA 3GLGA 1G3IA 3TMKA 2WZQA 3UMFA 3OIUA 1CRQA 1LVGA 3SJCA 1ZUHA 3CW2A 4FMCB 3KXIA 5LB4A 4JL8A 4JBWA 4UNNA 3DKPA 5BN3A 5CB6A 2PCJA 3I62A 1W49A 1TPZA 3IEVA 1M7BA 3LH5A 4BLSA 2WM9B 2WKQA 1XCMA 1ZW6A 4ILEA 4LC0A 3OEEA 4KI0A 1OXSC 3EZFA 2X1VA 4KLZA 4LC1A 2CJWA 2ZRNA 2RHDA 4US0R 5SZJA 4LZZA 2DB3A 4URYR 4PFSA 2FZ4A 2AWOA 2FEOA 5FPYA 3AP3A 1HT1E 3UK6A 3RC8A 1J8YF 1JECA 4MRSA 3LO5A 1M7HA 1TU4A 5SZHB 1DAEA 4O2LA 3L0OA 4D0NA 1M8PA 4XOIA 3ICEA 2YC4C 2Z83A 1W47A 3A1TA 5KDDA 2J59A 2ZRPA 3QBVA 3UMSA 2H7VA 2W2XA 4MRPA 1OIWA 4A2WA 4TTRA 1OFUX 1W0JD 1KDTA 4WVFA 3KQNA 1KI7A 3E5HA 1EX7A 2H1LA 4KAXA 1RVDA 5FBQB 3SJBA 4TYQA 3DZDA 2IS6A 1TQ6A 1YE8A 4E09A 1XZQA 2GNOA 4QJ5A 4QC2A 4C7OB 2O8EA 1FMLA 4MUBA 2QPOA 4B6EA 2JIZD 1W36D 4NKRA 2CMKA 4XTCS 5DNYB 4EIWA 2WAXA 4OHYA 2QG6A 1XZPA 4RY2A 1SZPA 4IFEA 4B3GA 1RPZA 3DOEA 2XX3A 4LBYA 4URUR 4JLOA 1ZAKA 1UBFA 4Q4HA 4NYJR 1T9HA 4PO9A 3GMTA 3WMEA 3NG1A 5G3YA 1XD9A 3Q3JB 1G20E 1NBMD 4HDQB 4US1R 2ZUBA 3EASA 4JLAA 2FGJA 2Z0MA 4QXAA 1FPMA 1NMXA 1P4SA 2FG5A 4DRZA 2DWQA 4M1MA 2QE7D 1U8ZA 3T5DA 1W5TA 1TUEA 2IYXA 1Q20A 1Z3IX 3C6HA 2XSZD 4LV6A 4Q1AA 5FOVA 1X1SA 1M74A 2GK6A 4URWR 4DXAA 1COWD 2PEYA 4DDVA 1TQ4A 5CM9C 1G21E 2YYZA 4V0ME 1A4RA 2GZAA 5K8TA 5DHAA 2WTUA 2ORIA 4RD3A 5UKDA 1C4OA 1RYFA 4P32A 5KSOA 4XD7D 4Q1CA 1D8TA 4B3FX 1AKEA 3GP8A 3GJ4A 3EARA 1HH4A 2GCPA 4NYJQ 3DOFA 2ZI3A 3OIYA 5AJZA 4B47A 1EXMA 2WJIA 1MV5A 3MSXA 4TSFA 1G17A 4UNSA 3QY0A 2K5UA 3A1WA 2P6UA 2C04A 3SYLA 4KVGA 4BFTA 5FUYA 1X8LA 1K8RA 2ZTSA 5J40A 1GG2A 2OCYC 4LBZA 4Q9JA 1DELA 1IY2A 1KI2A 4JMPA 3W8NA 4JLBA 2F1HA 2ONJA 4BFZA 2YWFA 4F93B 2JJ2A 2QPTA 4GP6A 2R6DA 3NDBB 1TADA 5K8UA 2YKGA 2AHOA 3C5HA 3RANA 1ZUIA 4PC2A 4Q19A 1Z8FA 1DE0A 5IT5A 4CGZA 1R0XA 1G8PA 4ERNA 4URVR 3X2SA 3BGWA 3ZZTA 1VG8A 5C4GB 3RC3A 3DPUA 4PHHA 3CF6R 2NO9A 2QNRA 2XNDA 4EJSC 4KXFB 3CRVA 4A82A 1XF9A 2XAUA 5GVSA 2XTNA 3I4LA 2IS1A 4FCWA 1H8ED 2PH1A 1JPNA 5IRCD 3B2EA 2C03A 1UKEA 1ZM3A 4B2LA 1FX0B 3GLIA 3N5CA 3V4FA 2HT6A 4JKYA 3KL4A 4GZLA 3LFUA 121PA 2ZEJA 4RD1A 1LW7A 4US2R 2EFHB 1YU9A 1QHIA 2IYQA 4Q5IA 2CE7A 3IPXA 2LKDA 1TF7A 1Z0FA 1KI1A 2GF0A 5C4MA 4FIDA 2OHFA 3UG6A 2FFQA 4F7WA 3VR5A 1D2NA 1G291 5A5GA 1UJ2A 1TL7C 3OF5A 2X19A 4HB2A 4N3NA 4DWJA 1IXZA 5CLQA 1ZU4A 5FL7D 4KU4A 3SE0A 1D9XA 1XP8A 2E9SA 2QGZA 4C7OA 4DLWA 1W4AA 2Q6TA 2HDNB 2WJHA 4C0LA 1T8TA 2P2LA 4DB2A 3BORA 4FMDB 4OBEA 4TL8A 4ESHA 3Q7QA 1OH6A 4WXPA 1AJEA 2A5YB 4P0TA 3A4LA 2EFCB 4FCTA 4QBFA 2EYUA 4HB3A 4MRVA 1G64A 4LYHA 3I3SR 1E9FA 3U7EB 4GOJA 5BN5A 1YRBA 2ZS8A 3X1YA 3IPYA 1XRJA 3FKQA 2ZE7A 4JKIA 1E6CA 3FHCB 3PUXA 3GLHA 5C2FA 4W5JA 4L9SA 3SR0A 1LB1B 1QBKC 2IF0A 1GM5A 4B2PA 1JR6A 1QVRA 4L9WA 4NDZA 3IBGA 4IDOA 4IDNA 3VMFA 5JEEA 3Q7PA 3WBJA 1YKSA 1VIAA 2JLUA 4GL2A 3C6AA 2C2HA 1QHHB 1E98A 4IDHA 4OQFA 1II8B 2IF2A 3PUYA 3RDPA 2BMJA 2GCOB 4LX0A 2FPLA 2RGNA 2JDID 3CUEF 1HA3A 2WSSD 2C5LA 3LD9A 4I4LA 1W48A 3K9NA 4N1AA 3TAUA 3GFPA 4TMXA 3RWOA 4ASUA 4DCVA 4F4CA 2ZAOA 1L2TA 1TUIA 5TV2A 2PLRA 1G3UA 1E2KA 2OBMA 1NN3A 1KAOA 1NG1A 3TNFA 1E69A 3B5JA 2Z4SA 2CEAA 2NQ2C 2J7PD 2PJRA 3R9WA 1KO8A 4QGHA 4Q18A 4XIGS 4IFBA 2QPAA 3GLGE 1EG7A 4WW0A 4EPRA 1XBTA 1UFQA 1DAMA 2BMDA 5TVKA 3EWSA 3O8RA 3K0AB 3CPJB 2PCLA 2J0UB 1VKJA 2RKOA 3U7GA 1E2IA 2OILA 3TAHA 1G16A 4I1SA 1L7VC 5KDLA 3QG5A 1XEWY 1Z22A 2V55B 4K46A 1SKQA 5G53C 3HPRA 2GBLA 4K8OA 4LK2A 3OAAA 1E2DA 2Q3MA 2WBLC 2VLIA 5DISB 5KNBA 4CIDA 4XWAA 4DCUA 2BMFA 3N2IA 5BXQC 4LJYA 4CT4B 3AM1A 3K1JA 4LY6A 1SXJD 3TRFA 5EUQB 2ZRCA 2PJZA 5HCIA 1DAHA 5B2ZA 1KJWA 1KJZA 4Q1BA 3EZ7A 3HYTA 3PUVA 5L3QB 2ZRBA 1BYUA 1XXHB 3IIKA 3FDIA 2RGCA 5GADl 1FP6A 3B1VA 2GJSA 5TMPA 5M1OA 1TEXA 2ONKA 1AZTA 1ZD1A 1N6PA 2OG2A 1GSIA 1Z47A 2VPPA 3CH5A 4GMDA 2BBTA 4YMUA 3DO6A 1XD2B 4IDPA 3F3YA 4JBYA 4MH0R 3AVWA 2YC2C 4TTPA 4G01B 1K5GA 4GMXA 4C3ZA 5SZIA 1U99A 1KI9A 2OAP1 4LUCA 4QRHA 4B74A 4JLDA 5KTYA 5GJCA 1E2PA 2R2AA 1CXZA 2FPMA 5KO2A 3ADDA 2G1KA 3ND8A 4XWOA 1HE1C 1HYQA 1P73A 721PA 2OV2A 1R5NA 3W6PA 1OJLA 3CX8A 4RKFA 5EXXA 3HU1A 5IHPA 5AJVB 1HT2E 5AJXA 2JEOA 3OFND 4EPXA 1G6HA 2V7QD 3NDPA 2JLRA 2R6GA 4GP7A 3TUJC 3NHAA 2J9RA 4QBIA 4GI7A 3D31A 1AN0A 4MRRA 5JHHB 5JS7A 3P20A 4M53A 2GJAA 1D6JA 2QMOA 4TYPA 2WJGA 3R9IA 3B85A 3KUDA 2DFTA 2CCGA 1JBKA 2Q0HA 1G1MA 3BH7A 3RLFA 1DVRA 2C9OA 1KY3A 1L4YA 1ZC4A 2EQBA 3QXSA 4LOAA 1RRFA 5B57C 5EE0A 1P7CA 1Y3AA 2QU8A 4JYBA 3Q8XB 1VPLA 3KB2A 2I4IA 4NYIR 3GCGA 2FSFA 3FFAA 3THOA 1ZM4A 1UBEA 2B7CA 1PUIA 2QUZA 2B6HA 3CWQA 1G8HA 2C8VA 3BB1A 1U0JA 4UQOA 5TARA 1W4BA 3BH6A 5JECA 3LV8A 5J4LA 5DLQC 3BJIC 3Q85A 2VH5R 4B3XA 2H8KA 1DAIA 3EPHA 3CRW1 5L3VA 3VAAA 1QHSA 3AVOA 2LKCA 4XTRA 3U4QB 1VIYA 4TMVA 4R2IA 4HAWA 4GT1A 1X8JA 5F98A 1NJFA 1QHHA 4CEJB 2ZI7A 3LRPA 3HYRA 4LBVA 3W34A 2ZRKA 4LJ8A 1E94E 2GCOA 3SDZA 1R8SA 3R7WB 1OLOA 5JWRA 3IHWA 1Z83A 1JQLB 1WMSA 2C77A 3P27A 5HKKA 4NYIQ 3WHKA 2HCBA 4IVPA 3S1AB 2IXFA 2OLKA 2UKDA 4X8MA 3PVSA 2QGNA 3THXB 2YWHA 3PENA 2ZROA 5CJ2A 1GVNB 4JIMA 5HR5A 2ANCA 4PANA 3V9PA 2IXGA 3FYHA 4G5RA 2AR7A 3JZAA 1IY1A 2ZR9A 2IS4A 2Q3FA 4LRWA 3REGA 1E0SA 1N6NA 4ARZB 3QNUA 1MH1A 3K0AA 4JLKA 2J0UA 1CIPA 3I1FA 5FI1B 3TK1A 2R62A 3OEHA 2ZI5A 1NI3A 2A30A 1HTWA 1ZYUA 3GLIE 3RRYA 1NN1A 2W2VA 3PJRA 2IWRA 4JSTA 4O25A 2D2FA 2FSHA 1WF3A 2AD1A 3LQQA 4Q4JA 2GCNA 2QT1A 4Q47A 2EYQA 3WXMA 2QROA 2VYFA 4BFYA 3I72A 3NC1C 2GXUA 2NPIA 3PEUA 4MGKR 3IBYA 1G3MA 5FTMA 3H0KA 4XVRA 3MGCA 1NG9A 4AD8A 3LY5A 2ZSBA 2CE2X 2Z4RA 1EFRA 1QVAA 2ZI6A 3K9LA 2GJ9A 2W6JA 1TNDA 3KKMA 1YZKA 5EXSA 3CO5A 4P4SB 2V9PA 4TLDA 3EAQA 3ASZA 3NVAA 4HLUA 2I1QA 2RGDA 4URXR 4TZ0A 3QKUA 221PA 3IIMA 2ERYA 1G7CA 1TMKA 3RRNA 1GKIA 1YVDA 3QVUA 1NY5A 4FN5A 1G7TA 4FD2A 3B8HA 3GFOA 1KK0A 3KKPA 1A1VA 4KBGA 1W0KD 1E2NA 3GLGB 1ZNYA 2R9VA 3I32A 1BMFA 5KU1A 1TEVA 2ERXA 2ZS9A 2VSFA 4M9ZA 4TZ6A 1TQ2A 2OXRA 3O8DA 5KNCA 2P6RA 4Z51A 4G1UC 4M1SA 3CRMA 4Q1EA 2GWHA 3VX3A 4G5QA 5CJPA 1J2JA 2PLFA 1DAFA 3U3KA 1QHXA 4G0NA 2GF9A 5HE9A 4XVUA 2ZJYA 2ZYVX 5FBLB 3M6AA 1T3SA 3NEYA 2FWRA 4FI3C 3IEUA 1QHGA 5FOUA 1KI8A 2AFHE 1E2FA 3TW4A 5A4JA 4W7SA 1DBSA 4HAUA 4UXIA 2JLVA 2W6IA 2WWIA 2A78A 3BIFA 3MJHA 1S4QA 3NBYC 821PA 1Q21A 5JLJA 3SFVA 1XTSA 3ZS8A 1Z2AA 4AKIA 4Q7LA 5AR1A 3B9QA 1J8MF 3AQ4A 3QKSB 3GEHA 1KSFX 2WWXA 4AK9A 5JEDA 4PHTA 2JLXA 2VP0A 4W9MC 1OHHA 4W5WA 4BLOA 2ZU0C 4TL9A 3SC3A 4I1UA 4PSAA 2ZRGA 2NG1A 2V6JA 4JBXA 3O47A 4TT3A 2IYUA 3WMFA 1KJYA 1A82A 1MO5A 1QF9A 3U60B 1IN8A 3AB3A 5C46F 3U4QA 1II9A 3K0CA 2O8EB 4D4JA 2G0NA 2ZJZA 4G5SA 1P62B 2H18A 4HI0E 5P21A 1UPTA 1FQKA 3NBFA 1P61B 4M1OA 1U8AA 4M9SA 1Q57A 3R7WA 3IKJA 2FZLA 2IYWA 1G5PA 3GJ7A 4A15A 5HZKA 2GXAA 1T6NA 4PO1A 1MKYA 2VL7A 1C9KA 2V4ZA 3BAFA 3ZLJA 1Q1EA 1CP2A 3NHBA 3ZVNA 3THXA 2CL6X 3CBQA 4BLTA 3AV0B 3E70C 4IOMA 2KSQA 3SQXA 2DWPA 2W0SA 4BLPA 2NZ8A 1J99A 2JA1A 4PZLA 5DN6A 4ARZA 2CCKA 2WKRA 4LYFA 5JCZA 1FL9A 2ZRMA 5L3SB 2QY9A 2HYDA 1G18A 5KOYA 2VP6A 4HAYA 1XX6A 3AVUA 2O8BA 4ACBA 3WRYC 1S3SA 2QM7A 3LWNA 1A2KC 4A8JB 2BEJA 2QSZA 4Z1MD 1E79A 3QEOA 1KSHA 5D3MB 3SBDA 4Q7KA 2JLWA 2OCBA 5FBWB 4A6PA 4EKDA 4M2LA 2HYIC 1XCGB 1GRQA 3AVVA 4OHVA 1ZCAA 4DT1B 2FF7A 3BC1A 1CJKC 2VP9A 4C0HA 1YRAA 4B3BA 3WMGA 2HXYA 4DLUA 1ZMXA 1OKKD 2B8WA 4PZZA 2RGNC 3T15A 2ZJOA 1GP2A 2VEDA 4DUGD 1G8FA 2DFLA 5AK0A 3DM5A 1MO3A 5AUOB 1WQ1R 5A0FA 4Q00A 1ZM2A 1ESNA 4HLDA 2GKSA 3FKSA 2JAQA 4NYMR 1TU3A 3CONA 2ZJ2A 4P4SA 2OBNA 3K70C 4DBLC 3QF4A 1VG0B 1RRGA 3LQRA 4NL4H 2O5VA 2WWWA 1OXVA 2IYZA 2PZFA 1WBDA 1ZNZA 2JJ1D 4RCZA 3RS4A 2IA5A 1N2CE 3MRSA 2J5XA 1UKYA 2GBLC 3SU8A 2CK3D 1N6KA 1NVUQ 5EP4A 5FUXA 3SN6A 4D4KA 1OXXK 4YQFA 5EJEA 1PLKA 2D74A 2TMKA 3KJGA 3SJZA 4C0QC 3I61A 1C1YA 2PX3A 2A5JA 3T1OA 1T3HA 4NYMQ 2ZYUX 1KK1A 1PUJA 3HU3A 2B92A 1BYIA 1UEIA 4M21A 3CR8A 1GL6A 4KFSA 2J87A 1M2OB 2IXEA 2KWIA 3L82B 4K81B 4DZZA 3DMDA 3EIEA 1DAKA 3LBNA 3GLIB 1G8YA 4CVNA 2DWOA 4B73A 1NL3A 2KE5A 3MJRA 5FOSA 2GXQA 4CT5A 4MDEA 2C95A 1S96A 2NO6A 3G0HA 4LJ9A 3KX2A 3U3RA 1MOZA 1RC8A 3RVBA 2R6FA 3FVQA 421PA 2HV8A 3R9XA 1KHTA 3MMPA 4JSYA 3QKRB 2QEQA 3X1XA 3QKSA 2GTPA 1X1RA 4DSNA 3J81k 3SBEA 3UKDA 1R6BX 3CH4B 5LB2A 2YHSA 1R8QA 4BASA 1W0JA 2W83A 4OHWA 3CX7A 3THWA 3UG7A 3MCAA 4A2PA 5FTLA 2D3WA 1KAGA 1WBBA 4QG7A 2FSIA 2W00A 2JASA 3C14C 4ZI3A 4UXHA 3JVUA 2IYSA 2CHVA 1Z6GA 3KQLA 2G3YA 3BERA 3CIOA 2ZR7A 1U9IA 3IGFA 2JIZA 2VSXA 1D2EA 3L2OB 1X86B 3EC1A 2XGJA 5KDOA 2AKYA 4JLVA 1N6RA 1IN6A 4A0RA 2MMGA 1Z0IA 1ODFA 2AWNA 3B60A 1DO0A 3P26A 5CK5A 1OH7A 3GLHB 5JSZB 1SKYB 1T8UA 3BB4A 1VDZA 3LW8A 1YZGA 4RD6A 5JJKA 1XXHE 3ZD6A 1ZD8A 4CZ2A 1G3QA 5L3SA 3OHMA 2O0JA 2ZJ5A 1NBMA 1HQCA 4OHXA 2FE4A 4QJ4A 3G82C 3QXJA 4A8JA 1IOZA 2QZ4A 1FNMA 4BZQA 1E9BA 2QENA 3K8YA 5D3MA 2QE7A 3K9HA 2OT3B 3ZIAD 1UKZA 4DT1A 2ZANA 2R44A 5CYPA 4CEIA 1CULC 3SOPA 1COWA 1FTSA 3B6EA 4M0LA 5FFMA 1ZC3A 4DCSA 4C2TA 1D2MA 1N5IA 1NKTA 1EX6A 3K70B 5JWOA 5GJWC 4JL5A 4MDFA 1F48A 4BFWA 3E2IA 1KKMA 1MO4A 2AXNA 1IJFA 1N0UA 2XXAB 2JLZA 1QDEA 3JVVA 1R0YA 2VTKA 3C15C 4ZDKA 4WAUA 5CDFA 4TYYA 1G4UR 1FQJA 4PAOA 4IEEA 4ZV4A 3PV0A 4Q01A 4M4SA 4NCJA 3HJNA 4GOXA 2FJUA 3CKLA 3AVTA 3EWAA 1ZP6A 4MYHA 4F4JA 4PSKA 4TSFD 4ZPXA 3AH8A 2FEMA 2FOLA 4PQRA 1VECA 1OT3A 5EXPA 2WPDA 1UF9A 5LPNA 3X1WA 3U3JA 4EAQA 3IUYA 5LBIA 2JJ2D 2G9NA 1AGPA 3SFZA 1JPJA 3NEJA 1WB9A 3U3MA 4WXRA 4L4UA 1Z06A 2RGAA 3ZVLA 1FW6A 1SVLA 1FFHA 1VHLA 4W5HA 3ZJYA 1V5WA 5IDVA 2AFIE 4BECA 1XPRA 4B3DA 4JVMA 3PEWA 1SVIA 1GDDA 2CVFA 3ZH9B 3EG5A 1UEJA 1U98A 1KK3A 1ONBA 3BRWD 4HLUC 5L3RA 4AIIA 1N0WA 3Q5EA 2QT0A 2G6BA 4V0LA 2A5FA 1XB2A 3QKRA 4M9XA 1E2JA 1GRRA 2GAOA 1T5LA 2FNAA 1PJRA 1UAAA 3OE7D 4HZUB 4GNKA 4PC1A 4NCHA 5JI3E 2N42A 2ZETA 2IUTA 3ZS9A 4BWYA 1K5DA 4LHVA 1KK2A 1I2MA 3TW8B 3LXRA 4DLYA 1XJCA 3PEYA 1YR7A 2CNWA 2ECKA 3RSOA 2R65A 2WICA 4GBMA 2IL1A 3C4JA 3TE6A 3Q9LA 1F5NA 2XJ4A 1KDRA 3CNNA 5K8LA 1EWRA 5HTKA 1ZU5A 2F1IA 3RS7A 1BO6A 2EW1A 4A92A 1GZSA 2J3EA 2RHMA 4YDHB 2KI5A 2NO1A 3T1QA 5DHFA 1G7SA 2FDCA 1YZUA 3TVTA 2O0HA 4AYWA 4OK5A 1IQPA 1O87A 3LBHA 1E9DA 3THYA 1NP6A 4F38A 1M1YE 2HUPA 3LNCA 5JSZA 1DEKA 5EP3A 4BE7B 5AUPB 3IO5A 1MRSA 2ZE8A 4EFNA 4QGAA 1JR3E 1BOFA 3PXGA 3IDQA 3VKWA 4DLXA 3MD0A 1KMQA 3EZ2A 2ZUDA 1A5TA 2O8FA 4DSOA 1FNNA 4I81A 3VR2A 2WKPA 2JDIA 3K0CC 3QPUA 5F2EA 2BKEA 3SJAA 5JRJA 3NH9A 5LDDC 1Y63A 5DYGA 1NRJB 4IW3B 1N0VC 3B13B 2X2EA 3LX5A 1TAGA 4M1WA 1HURA 1OE0A 4HAVA 4LHXA 1U8YA 5FOTA 4FW9A 1UDXA 1UKVY 5GJVC 2CHQA 1TTTA 2D4HA 3TQCA 2VO1A 1SHZA 2C9CA 2XXAA 2AKAB 3SEAA 5J5CA 2B21A 4F92B 3B1XA 1GNPA 4JVLA 2C78A 3KB1A 1ETUA 2QN6A 4UNPA 4NP6A 1FOEB 2P3SA 2GDJA 3VR3A 3CM0A 2HJGA 4TQAA 3U6KA 3K70D 3TKLA 4LJ7A 3BFXA 3RRMA 2HEIA 4QL3A 2BMEA 2RCNA 4Q4JB 1GUAA 2AN9A 1GNRA 3MAAC 5JI2E 3MWKA 1NLFA 4O2RA 2WOOA 3QOFA 2A2ZA 4LI0A 1U0LA 1H8HA 1SXJA 3OIWA 3JZMA 4TMKA 5C1BA 1YR6A 4D82A 4LJ5A 5KHOC 3LVRE 3OAAD 1AQYA 2FX3A 3AKDA 4KSBA 1P2TA 4DLVA 5EZ6B 2EVWX 2F1RA 3HU2A 4P4UA 1JEEA 3VNUA 3QXCA 1EK0A 3WYAA 3GJ3A 1Q1QA 2AXPA 3W9YA 4QKQA 2Q9BA 1Z63A 4MGYR 2PT5A 4KYIB 4IKEA 4TWZA 2IYVA 3LAWA 5BYJA 5SZKB 2IEYA 4U00A 2V8OA 4YLGA 5ELXA 1W46A 3GJXC 2VP2A 2BBWA 2WMOB 3KJHA 3PFIA 3KZ1E 5H68A 3L0SA 3VTKA 5ANRB 4HLCA 4JLNA 3TSZA 3FOZA 1E99A 2XZLA 5JHGB 4Y0VA 1CTQA 5EUMA 3ICQB 3WP0A 3A37A 1KY2A 1ZINA 2WVJA 4HZUA 2ORVA 1NMYA 4TL6A 3TR5A 4YMWA 4Q21A 5LD2C 1J7KA 3T1VA 2FMXA 4LHZA 3FPAA 2OFXA 2PZGA 2ZVQX 2R6CA 3FHTA 4GRAA 2YV5A 1ZNXA 3GJ0A 621PA 2WIBA 3AVQA 1NBME 3HP1A 2WIAA 4EFMA 5FPKA 2BOVA 1HY3A 5JMTA 1CR2A 5TXGA 1NNEA 4V0OA 4ZCIA 4NBSA 3K0SA 5JJIA 1XEXB 5FUVA 3M1IA 3NTUA 1S3GA 4KFRA 4YMTA 4Q7JB 4MKIA 3U2QA 1Q12A 3M0EA 5HPYB 1Z07A 2QMEA 2E1RA 3DKVA 4LJAA 1KNQA 3FHOA 1SVOA 4QOSA 1SQ5A 4DB4A 2D2EA 5CK4A 3KKQA 4OI2A 1VMAA 4CRWB 2ASEA 3TJZA 4BFXA 3B7GA 4YMSA 1N6LA 2YJTD 5FI0B 4AC9A 3RS3A 1KO1A 1R7RA 3CX6A 4PXAA 2ZI9A 2YOFA 4EDHA 5CDFE 5H8WA 1GILA 5J4YA 2ZQ5A 1JI0A 4Q1DA 3PR1A 5DSZA 2GESA 4LYJA 1VCMA 5KYKA 1AKYA 2GXSA 3AUXA 4KHZA 3LX8A 2VHTA 2O8CA 4V03A 3A4NA 4BRWA 1U9IC 2EWWA 4HSEA 1W4CA 1LY1A 2WWGA 1XTIA 2PT7A 3QI2A 2IUSA 2N1BA 4HUTA 1KSGA 3AKCA 2ANBA 1OB5A 4AURA 1CU1A 5KPJA 1U0HC 2QSYA 4QNRA 2O8BB 1KO7A 2BBOA 3W6OA 5DGXA 1WP9A 4Q02A 4X8OA 4CW7A 1W2GA 1N3BA 3PQCA 5FUWA 3KTAB 3E1SA 5EE1A 4MYCA 2MSDB 4BLQA 1P3JA 1RJ9A 2J45A 4YMVA 1W2HA 4MKFA 3SHFA 1T4GA 2X77A 4J0QA 4S35A 1JJVA 3QE0A 1N5KA 3KFVA 1FMJA 3REFA 5F3WB 5CIWA 4Q1FA 2NZJA 3AF3A 3ND9A 1P2UA 4IVQA 4A8JC 4B76A 1ESMA 1HE8B 5G41A 2E87A 4KFTA 4B71A 2WAYA 2NPFA 1QG2A 3O8CA 4PPFA 2BJVA 4EUNA 2Z6VA 4H1UA 4A0GA 4N0DA 3AP1A 4LYAA 3D7MA 3GLFB 2ATVA 2ZR0A 1T0HB 2QMHA 4LPSA 2DY1A 1Q3TA 1KDPA 3MLEA 2V1XA 1G19A 1LS1A 1N5LA 3W90A 1LTQA 1JQJC 3A58B 4G5GA 1KMHA 2QAGA 2IYYA 2QQ0A 1MABA 1X8KA 2CL0X 2J1LA 3KJIA 3QXHA 5BQ5A 3QF4B 2ZSFA 3TBKA 2P6NA 1UM8A 2QTHA 1OH5A 1I4DD 3ZGXA 4JS0A 4LV5B 3ZYCA 2EFDB 2YVUA 4ON9A 4NZYA 1E1RD 2ZE5A 2W58A 3QEJA 4ZIRB 2RB4A 4NCNA 4MQBA 2XOKD 1CBUA 1E1QA 1VG1A 3GEEA 1Q1ZA 1G8GA 4RJLA 2OM2A 2F43B 4OK3A 5LD2B 3DEFA 1W0KA 2PBRA 4PAQA 4UKDA 1MO6A 4LBWA 4RZ2A 1VCNA 4LHYA 3KKOA 2YNMA 1I2DA 2BEKA 3T34A 4IHQA 2DFNA 4NTZA 2OUKA 5KPDA 3WP1B 3GLHE 4B33A 3OZXA 3U6BA 3ZD7A 1QRAA 2BHRA 1SKYE 4UXJA 1GL7A 3RSLA 1R5OA 4CF7A 3L8ZA 3H2YA 2A9KA 1TF2A 1WXQA 1TF5A 5TDHA 1NLYA 5DI3A 4TTQA 1G9XA 2Q3HA 4PPQA 1E2LA 4JLMA 2REBA 3ADCA 4AI6A 4PTLA 3DL0A 4N0EA 1GTVA 4YC7A 1XD8A 1QHYA 1DPFA 4QGGA 3WYFA 3CF2A 4A36A 2VRWA 4WA7A 5FPTA 1XEXA 3WBKA 2A3RA 3EPKA 3HR7A 4OI1A 2P67A 2YINC 4LV8B 5E3HA 2J0QA 1AQUA 2O8DA 1W1WA 2DYKA 4JT2A 4DCNA 3ADBA 1OYWA 2Q9AA 4I1OA 4OQXA 1LNZA 2NOAA 2OXCA 4B34A 5CITA 3PIRA 3R8FA 1E3MA 2F1JA 3W3AA 4B32A 2D06A 4OK6A 4Q9KA 3KUCA 1GIAA 1AIPA 1S2MA 2A7QA 2WJJA 3THWB 3LBIA 3PG5A 3KJEA 5M1KA 4YXWA 4PO8A 3MUFA 2ZITA 4KBFA 4Q9IA 2MSCB 4O3MA 1KKLA 3A1VA 3LLUA 4RZ3A 3EA0A 3SZRA 4GFDA 1NSFA 4QHYA 3RS2A 3EPLA 3UWKA 5E7JA 2GZDA 3DMNA 2C99A 3QBTA 2CLDX 3B9PA 4C0AC 3RNLA 3CPEA 1X6VA 1W36B 4POAA 3AVXA 4QFMA 1N5JA 1OHHD 3BXZA 1CF4A 4HB4A 521PA 2EFEB 1XMSA 3NBZC 1CKEA 3CRQA 2V6IA 1XCPA 1F3OA 3P1JA 4FMCF 3TH5A 2HLDA 1O3YA 5EE3A 3T06B 3UATA 2IX3A 4LHWA 1IXRC 2Y8EA 2VF8A 3QSYA 2RH5A 4R7ZA 2HXSA 1N6IA 1IN5A 3C16C 3B1YA 3RAPR 1AS2A 4CYMA 1OFHA 4KJZA 2WWYA 4G3XA 3C41J 2P5TB 3NH6A 3ZVMA 3BFKA 3KTAA 1AS0A 2AK2A 1KZGB 5AUQA 5IK2A 1SVSA 4TYNA 2GEUA 3PUZA 4TMZA 2P5SA 2WOJA 2BVNA 3O8BA 4Z1MA 1E2GA 4AY2A 3QUSA 3U3OA 1CR4A 1D5CA 1Z0JA 1PZNA 3W5IA 3TR0A 4CEIB 1ZIOA 4HB0A 5B58C 1IHUA 4FINA 2VF7A 1HEIA 1AA9A 2JJ8A 2RAPA 3NKVA 2FU5C 1PLLA 3GLFA 3CRRA 3LA6A 3P4XA 4HDCA 4TLAA 4DUGA 1E79D 3A1UA 5FR2A 3BBPA 3H86A 3WNBA 4EQ6A 3KXKA 2BIFA 4DDWA 4PAMA 2PZEA 4RFSA 2P0EA 2B7BA 2H16A 1IN7A 2BV3A 1WCV1 1US8B 4Q9HA 3SHWA 2QP9X 2CLSA 1XTQA 1KSJA 2ODNA 4IOKA 4PQYA 2FA9A 2OESA 3U7HB 4R98A 5J4HA 1GITA 3R8CA 4C0JA 1DS6A 2OE2A 2OZEA 1DO2A 3Q5DA 5DH9A 4TN1A 5JS8A 4ZIRA 1LS6A 1Z6TA 3FB4A 2ZJBA 3I92A 3TGPA 1Z6AA 3AGPA 5JWHA 1JR3D 2WWFA 1YR8A 3FKSD 2VQSA 2OEPA 2ZSDA 3K09A 4TLCA 3UANA 5CIQA 5BYKA 2C98A 1RIFA 3I8SA 2ODEA 2F43A 1S9DA 1ZBDA 4WBSA 1JALA 1P9NA 5E4FA 3HDTA 4GZMA 1RRPA 3UWOA 3H1TA 1SVKA 1RW4A 5M04A 2DFKB 4ACAA 2X2FA 3G5UA 2J46A 1SXJC 1KYIA 1ZD9A 2WMNB 3KQHA 2IEZA 3ZZUA 2WSMA 5DIFA 3DDCA 3WHLA 1EFUA 3EPJA 2QL6A 2ZRIA 3X1ZA 2JATA 2CXXA 2DCUA 1XDBA 2J7KA 2F9MA 5JRZA 4C30A 1LF5A 5AJWA 2XZOA 3KQKA 2GILA 3FFBA 1KGDA 1R10A 4ITRC 3T5GA 4RD0A 4DC9A 5L8VA 2BCJQ 2VIIA 4RVCA 1FUUA 5F9HA 1OF1A 3H84A 2BM1A 3N2EA 1JXMA 1SHKA 2HJVA 4OI4A 3OEED 4ZKEA 2YOHA 3CLVA 2GJKA 2JGNA 1UDWA 3KDSE 2PEZA 4D0GA 2G88A 2EWVA 3I5YA 3I8XA 2ZM5A 4IVRA 4OI0A 1JJ7A 3F8TA 4A2QA 1ZM9A 5FOXA 1ZNWA 2H92A 4UNRA 4MGZR 3BD9A 2FFBA 2CLCX 2QORA 5FR1A 3SNHA 2F9LA 3FE2A 3L43A 1R4AA 2QRNA 3BH0A 4S2EA 4LDJA 3B78A 2MMCA 1RE0A 2R6AA 2VHCA 4R2HA 4DEYA 3IHLA 5JFGA 4IEIA 4P31A 1OH8A 5F9FA 2SHKA 4ZI2A 4M1TA 4M22A 3AVPA 1KI3A 2ZRHA 1T91A 1NVWQ 4AG6A 5B30A 2VSOA 4U02A 1RKBA 3TSOA 3GJ8A 4AKEA 3THYB 2JLQA 3UXMA 2QP3A 3ADKA 3EX7C 4LJ6A 1Z0AA 1E4YA 4BRUA 3DVLA 3GJ6A 5CYOA 1ZRHA 1NLZA 1W7AA 1OXUA 5JBQA 2C9YA 1CR0A 3IQXA 4MKHA 1G5TA 1Z6YA 4D4LA 2ZXUA 3VHXA 4GOKA 2O8FB 1CLUA 1KI4A 3VKHA 1FTNA 4Q66C 4FWTA 1UADA 2XSZA 2ZE6A 1GAJA 4BEJA 3ZIAA 4XSHA 4IXNA 3DHWC 1ZVQA 4DEXA 3WYGA 4HATA 2OO7A 2P65A 4AKGA 5H70A 1Z5ZA 2GETA 5J4KA 3CZQA 4I1VA 2IUUA 3NIBA 1KI6A 2ODBA 3BS4A 4XD7A 2ZSEA 1YR9A 2IHBA 3ZZ0A 3B1ZA 2D62A 3FTQA 3L8YA 4WZBE 4DLTA 3QXXA 1H65A 4PPGA 2ZYWX 3B82A 4LJ4A 2WJYA 1P9WA 4Q48A 4ZCMA 2GHIA 4FMDF 1XFAA 3BWDD 2QM8A 2ZJ8A 3R20A 1US8A 2A5GA 2VBCA 1NN0A 2Q9CA 3TVDA 4DDUA 4DSUA 1G41A 3GD7A 5DO9A 1R0ZA 3WY9A 2DPXA 1T0JB 4HZIA 3ZDQA 1FZQA 3TIFA 1P6XA 3RABA 4F91B 4OYHA 2RGGA 2UVQA 3T61A 1XTRA 2QAJA 3F5FA 1NY6A 2IW3A 2DR3A 4JJZA 3RYTC 4UJ3A 3FMPB 1S1CA 1GOTA 1TX4B 3ZQ6A 1Z28A 3QG1A 1SXJB 2XB4A 4HAXA 2PMDA 1ANKA 1G7RA 3C7KA 4XVQA 5C18A 4RD2A 3BFVA 1U94A 4PC6A 1II0A 5TY0A 1YJ5A 4Z8XA 2QBYB 1H8EA 1EESA 5C12A 1E9EA 3EIHA 4G5OA 1OPXA 2BWJA 3AUYA 4L5BA 2RMKA 2D7DA 4A0FA 4DJTA 5FBVB 3FMFA 3TUZC 1M6NA 1IJEA 4RSGA 3VKGA 5E7IA 1AK2A 1W5SA 2KJQA 2QAGC 4EPYA 1E9SA 2WPDD 2RGXA 2XNDD 1ZUNB 1Z6XA 3QPWA 4PQFA 2IHYA 2DHRA 4H1VA 2ZYTX 1WRBA 3BOSA 1Z0KA 3IQWA 4XSGA 4NPHA 4JJKA 1XEFA 2QI9C 2VA8A 3K53A 1IONA 1XTKA 3ECCA 4JVSB 1Q22A 1KO4A 2KBFA 1E2QA 3OE7A 1CJVC 4BPBA 1NJGA 3AKYA 4TQ9A 4V0KA 2FH5B 4MYTA 4EPVA 4L8GA 2NO7A 1I4TD 1NF3A 1TQDA 1PLJA 2G83A 3NC0C 5FL7A 1U81A 2JCSA 3DM9B 3KKNA 1XJ0A 1Z0DA 5BN4A 5AUNB 1GL9B 1ZM7A 2XTZA 3U61B 1OXTA 4D81A 1OFIA 1VTKA 1J70A 1P72A 1P5ZB 2I3BA 3U5ZB 3T1TA 3EA5A 2OCPA 2WWHA 2ORWA 4DHEA 2CNWD 2Q21A 1U2RA 2OLJA 2ZVPX 4D6PA 4EFLA 4IJMA 3AF2A 2IBMA 4E5UA 3SI7A 2OFOA 2HF8A 4UJ5A 3GLFE 2YWEA 4OL0A 3A36A 5HZHA 4WZAE 2ZAMA 4PX9A 1OSNA 4RZXA 2J0VA 2F7SA 4PSVA 1J90A 4C4PA 1E32A 4HEJA 2V3CC 2O0KA 4A9AA 2PX0A 4HUQB 1M7GA 4TMTA 1KIMA 3K0EA 1GWNA 1F60A 2ZRLA 4KYUA 2CL7X 2WJVA 4EPTA 1XU4A 2FN4A 2WSSA 2BCGY 4DLZA 3X1DA 3WNDA 1N6OA 3QF7A 1NVXQ 1LV7A 4FWIB 4QNMA 5JCPA 3KQUA 4AYTA 2O8CB 1W44A 1EFHA 4NCKA 4AWXA 2XJ9A 3VU9B 4MITA 3RHFA 5C10A 4DDTA 3CR7A 3W5JA 1XMJA 2J7PA 1CS4C 3PUWA 2DBYA 3GFTA 1L4UA 1IBRA 4LCBA 3ONWA 4OJKA 2C96A 4UNQA 5AWFC 4PHGA 4D80A 2ZPTX 4P4TA 3T35A 2REOA 2EU8A 4ASUD 5D3QA 1EFTA 4DIDA 2G0TA 4Z8YA 3IIJA 3NXSA 1F2UB 1RJ9B 4D4MA 5DI9A 2GEVA 3SQWA 3LW7A 1P60A 4H9GA 4RFVA 1SGWA 1F2TB 4A0HA 2GK7A 2ZRDA 4X8HA 5E95A 2OFWA 2W2TA 3MWLA 1QHNA 2WHXA 4D26A 2O52A 4R71A 3BB3A 1OYYA 2OSBA 4BZXA 4PHFA 1S9HA 1RYHA 2QMUA 2XTMA 2YOGA 2BC9A 1GKYA 3MWJA 3FWYA 1SVMA 1RRCA 2AX4A 1E2MA 4Q4AB 4NMMA 3TUIC 4I99A 1KMHB 2QAGB 3QQ5A 1BKDR 4FMBB 1MABB 4IDQA 4M1KA 2QBYA 1CRPA 1UBCA 3ZQJA 4RZUA 8OHMA 1DARA 4EJSB 1MR3F 2ZJAA 5FTJA 1WA5A 1JNYA 1OB2A 1H8HD 3VX4A 1G5RA 3IILA 4Q4LA 4D0LB 2IK8A 4DCTA 2XZPA 3QPVA 4PZYA 3SS8A 2GEDA 2QTVB 3GPLA 2HCJB 3L0PA 3RRZA 4NONA 5EE9A 3QIAA 1JAIA 1NMZA 1DG1G 4KITB 4OHZA 5CB8A 2ODWA 2XITA 5JZVA 4V02A 1XPOA 3D3QA 2GVDC 1DOAA 1NVVR 1BIFA 4DVGA 2D7CA 4ZKDA 5DYIA 3EXAA 1FX0A 1OW3B 2REXB 2AD5A 1IXSB 1XEWX 3A1SA 3OFNA 5EP1A 5EXTA 4B3CA 1OV4A 2V7QA 2WV9A 3K09C 5FTNA 1PV4A 3CF0A 1E9CA 1ZJ6A 1E2HA 3P4YA 4R9UC 2BKUA 2G77B 5DI3B 2A5DA 3UMRA 1B0UA 3A4MA 3CWZA 4QBHA 4ZDWA 2YZ2A 3ASYA 4D2IA 2IYLD 4E22A 3K9GA 4GDFA 4IOLA 2I1VB 4RCYA 5CM8B 4B43A 3TQFA 2BBSA 2VHJA 1SVWA 3UIEA 1BH2A 4OQLA 4QGFA 4MGIR 1FP7A 2O8DB 4MA4A 1T3LA 5C2JB 3U44B 1NVVQ 1QZXA 4Y0AA 2IC5A
chains in the Genus database with same CATH superfamily
3DQPA 2XOXA 1WZUA 1HUQA 3RFVA 1SQKA 4PLPA 5KSPA 3U1TA 3AV9A 3TB4A 4WZZA 5BSMA 1LF0A 3UHFA 3T12A 1WCWA 3DHVA 3LDSA 3SAHA 3R0IA 1FE8A 1VCOA 4CJRA 3CLRD 2X8AA 1ZJ4A 1KC3A 1L5LA 1ZHFA 2G1JA 3CVWA 4GBGA 3LPNA 1U63A 3CQ8A 4ZEXA 5ES4B 3I5XA 2Z5LA 3HSKA 5DT9A 3U3GA 1C3OA 4BROA 4IQ8A 1V26A 4AJOA 1G99A 1O4VA 2FUG6 4KO2S 1KTIA 3SD7A 3OEHD 4UHKA 5JYEA 1IAQA 5JQWA 3ET5A 4A8PA 3H1VX 4RFSB 2FEPA 1CJMA 1NKSA 4LNHA 3NBMA 3JD0A 3MAJA 3H16A 5KVSA 4R40A 1WKBA 1YZQA 3IDFA 1ZBQA 2J5BA 3LUJA 3IKLA 2I4LA 4LEIA 3G0CA 3MYRA 3FR7A 3K92A 2NZ2A 1SULA 4CFDA 3S2IA 5B7NA 2A4KA 1LSOA 1JLRA 5EMHA 3KIOA 2XEXA 1R2QA 4NLBA 1CUHA 2YFKA 4MS1A 4IFTA 5DBFA 3CT4A 4YRZA 1YQTA 3V4LA 3FGZA 4YOXA 1EXNA 3SUQA 1TD1A 1F6BA 4KR0A 2HI0A 3E7PA 4I14A 2IOYA 1RXIA 1ZIXA 2R8RA 1XPUA 2P9JA 3D5QA 1VSHA 3CNOA 2FPKA 3I9KA 4LF7K 3BWXA 4BNLA 4ZAFA 1ECJA 4KQ1A 5EYPB 4R7TA 4L0MA 3E6AA 4DIEA 4F9OA 3HGTA 1SKSA 2MYPA 4JVNA 2CHGA 3S1AA 4BZPA 3OZUA 3E61A 1Q0UA 2NVBA 3ZDBA 3FPCA 1WD7A 2NTYC 3I9NA 1KJNA 5EMLA 3RSEB 1T1RA 4QBGB 4NBKA 1L3SA 1SL0A 1EM6A 1IYZA 2HU2A 3L49A 4AZVA 3B53X 3GVCA 4Z7QB 3SP1A 1OBHA 4OQMA 1F8GA 5DE3A 4DFPA 3DI6A 5BRNA 5KTQA 3C4QA 1ST2A 2EKLA 1O58A 2GEJA 4LOKA 4CMKA 4BFSA 1KMIY 4BFUA 2AYZA 4D3SA 4KCGA 1A04A 2YUTA 3VNVA 3BGRA 2X0NA 3G7NA 2IHJA 5KCZA 4OJQA 4M8NE 3L7JA 1E3LA 2CC2A 4DCJA 3CW2A 1RAIA 2P2YA 3SYRA 5LNK6 1CD5A 2VTBB 1NXWA 2Z2XA 3OOYA 4LZZA 3E4CA 1YS9A 4O63O 1J8YF 3OLXA 2PUVA 1NXXA 4O2LA 3ED1A 2Z83A 3OC0A 4M1QA 3SC6A 1ACMA 3WHPA 1SCNE 1LOTB 2YDYA 4DWOA 1KI7A 4WKCA 4U7HA 4FSVA 3I9V6 4J3JA 2V7BA 4KKXB 2IU6A 4W7IA 1SZPA 3Q7IA 3R41A 3PHCA 1JCGA 3PQ3A 3M1FA 4CJTA 4JY7A 1K9MO 2FHPA 2P9PA 3QWAA 1RLTA 5E41A 2HCRA 4M1MA 1G9TA 3FFIA 5EZYA 3C6HA 4L78A 4IGKA 4GL4A 4A5SA 2O1SA 5A06A 1D8TA 1RAFA 1T43A 3DOFA 3OIYA 5F52A 6ADHA 3KUXA 3RI3A 3QK7A 3NDJA 4CIVA 3UKRB 4Q9JA 3IB6A 4XLLA 2QA4N 4CM5A 3TTDA 3S2SA 2G8HA 1JG4A 3WA6A 4BNVA 3B2EA 3PQDA 1RJEA 4JKYA 1IBSA 4MAAA 2B1IA 5HEKA 2CE7A 4MS4A 3NHKA 5J2NA 4OSPA 3RYFA 5BY2A 4DNPA 2XGOA 1XQ6A 1U4OA 4N3NA 1XKLA 1QQ6A 5TMEA 4DLWA 2HDNB 3C3DA 4TL8A 4ESHA 1UMCA 1FEZA 4WXPA 1DC3A 3GJZA 3NALA 2DPHA 3BM5A 5EIOA 1YRBA 1CNEA 4LVUA 2W2OA 5KNCH 4C04A 4EHBA 3NBQA 4DTXA 4M8SA 4BX2A 4K40A 1AG9A 1SUQA 3WGHA 2DBQA 4ND5A 1ZA2A 2AEJA 1V7QA 2BFBB 1C3EA 2GCOB 5AFUH 2FPLA 4M46A 3ZV6A 4HXGA 3OX4A 4ASUA 1TUIA 3LMKA 2VCPA 4IQ4A 2J7PD 2XKBA 1VQKN 1PFUA 4L3WA 2H1RA 1FMTA 3BJMA 4CNQA 4I1SA 2HF2A 3Q3EA 4DHYA 1LPSA 5ALDA 4BWJA 5AQJA 4RLFA 1K8XB 2Q3MA 3LDOA 4DCUA 2EQAA 4JQOA 5B2ZA 3HYTA 4G0UA 5EKDA 1NP7A 3MF4A 3GQBB 4CHOA 3C6YA 2FUNB 4HHTA 1YOVA 2BH9A 5EJGA 4TTPA 3P96A 3M8RA 5DDIP 4KO4S 1CXZA 3NF6A 2NSHA 3QMMA 4Z94A 5CLHA 3KU1A 4RKFA 1HT2E 3A11A 3K9WA 5J1TB 2MSWA 3Q3IA 3CLTC 1N34B 4EO9A 4QBIA 5AP9A 2A6AA 3P20A 4MV3A 3NYRA 4G97A 3I5AA 3F6RA 3VA7A 4NQZA 3EAGA 2QXFA 3RLFA 2PSSA 1L4YA 5A2QA 5B57C 4XI9A 4RZHA 4IICA 1Y3AA 1MVLA 2APJA 2OMEA 4C7VA 1WS6A 4EFDA 4RK1A 3O2QB 1E58A 3LV8A 3L6CA 3LYLA 5L3VA 3AVOA 2LKCA 3U4QB 4TMVA 1AK1A 4CEJB 3B6MA 3CLSC 3HYRA 3W34A 2QG4A 2IP1A 2P9IB 1HLUA 4Z9AA 4MVJI 3AK4A 5JLFA 2ZTMA 4NAVA 2DX7A 1UQTA 2XDQA 2QLLA 3L6EA 4JI5K 3FYHA 2AR7A 2ZR9A 3VVMA 3OJWA 1VL2A 1G1AA 1NI3A 3L7YA 5JE8A 3A6EA 1Z0ZA 1CDDA 3TTTA 3MNFA 3ZBQA 1EE9A 4EHHA 2EFJA 1EDBA 3B6PA 2FTKE 4MGKR 1M1YB 5LP6C 1JDUA 1NG9A 5H16A 2H2HA 1EFRA 4OGFA 1JMYA 1YZKA 5CG2A 1Z5PA 4N41A 1GTJ1 3NVAA 4YAIA 2GK4A 2V6BA 1GKIA 5BWBA 2NRXA 3JVEA 1GT6A 4DRXA 1TW3A 1OWPA 2R9VA 1BMTA 2OXRA 2X0RA 2YQ5A 1Y3IA 4IMPA 3S5UA 4K9OA 5SWMA 2FCAA 5CJPA 1DAFA 3CKKA 4ZZIA 3LDLA 2BI8A 4OQDA 3VJRA 5FBLB 2HJRA 5CB0A 5HUHA 2M6KA 1BDMA 1DQZA 5B8HA 2QLBA 4Q7LA 3NXKA 3AQ4A 4PO3X 3LIPA 3CRZA 3E9YA 3K5LA 3KOWA 4BLOA 4F6RA 4DCMA 3B8EA 3V7WA 4UCWA 1KP3A 4D8UA 1J24A 1UPTA 1FQKA 2FZLA 1K8QA 4PL7A 1H05A 1VK0A 5LYJB 2X86A 1P29A 4XH5A 3LDNA 3R6DA 1UL1X 3KLNA 4IYRA 5ARDA 4WLFA 5JD6A 3ORSA 1BWQA 1Q16A 4EKDA 4YJ2A 4OXIA 3VR6D 3QFSA 1NBEA 5IDQA 3E9ZA 3G88A 1QP7A 3W4JA 3WFIA 5EJMA 4CBVA 2Q3LA 4J6FA 2Z95A 5CT6A 3OT4A 4YRSA 3ONDA 2WEKA 4G56A 2GHQA 5MGNA 1N5DA 5BV1A 1GPYA 3BVPA 3BDAA 3DXMA 3TI9A 4UEOA 3V4IA 2EATA 3GEDA 4K81B 5ALXA 4ZRNA 4CVNA 2DWOA 2GASA 3T1YB 3MJRA 3A32A 1J20A 4H1TA 2W42A 4EHLA 1QQ7A 2AI3A 1HRDA 2HRRA 1ZGJA 2OC4A 2W71A 5CAEB 4KV8A 1X87A 3A14A 5FTLA 1X9IA 3JYTA 3ER9A 4KN6A 4FR2A 1P7VA 2JIZA 5LZ5A 4LKOA 2G8NA 3QHAA 1X86B 3G2LA 1BVHA 4QQKA 3CX3A 1Z0IA 2C61A 1CCWA 1R50A 2YNIA 2I2CA 1XVLA 1DO0A 4RTMA 4HDKA 1OH7A 3LVFO 1C7QA 5JSZB 2IJGX 4KTZA 3VERA 4FHCA 2E2NA 3O03A 5CA1B 3I0ZA 3PHIA 3QA9A 3GZNA 3WR5A 1VHQA 3MWTA 3GRZA 4CEIA 1COWA 3B6EA 4D8YA 2SNIE 3WFJA 1UPBA 3EYZA 1ATNA 1JLQA 1MIOB 3EVZA 4NG4A 3AFMA 4PNPA 2WAOA 4RY0A 5EU7A 5BOSB 2VTKA 2PS0A 3M6IA 3TLGA 4NCJA 2QUBA 3UZUA 4JP5A 4YDRA 4DRYA 3OVMA 1CY7A 2Q3EA 5K51A 1UXGA 3OTHA 1UF9A 2QKBA 1SQ0A 5ALRA 5LBIA 4JD5A 1Q91A 2XGMA 3NEJA 1WB9A 2YY7A 1C30A 1EFAA 4L4UA 2RGAA 4RH1A 1ZHHA 2XWPA 2C7VA 3ZJYA 5K09A 4FXOA 3VH4A 3EG5A 2GTDA 1M1XB 3GZ4A 4HLUC 2WUFA 5EOVA 6ABPA 1PJRA 3M3PA 4H4CA 5TE9A 4QDOA 4QS9A 3ZCRA 1YR7A 1QE5A 4LJLA 1APBA 5REQB 1CVRA 5AKYA 2HBJA 4DHWA 2O1XA 3QVTA 3W9SA 4ZYXA 1KC1A 3LRXA 3LBHA 1YZVA 1WSGA 4J4HA 4OJYA 1FS6A 3C39A 3KD1E 1JR3E 4ZANA 1FZTA 4WFJA 2FSKA 2G76A 1NRXA 1RXCA 2E5WA 2JGFA 5JRJA 3QO9A 4B4OA 3VQDA 5FOTA 5FCDA 3CCFA 3TQCA 1PWZA 1NMNA 3GXBA 3N58A 5LQCA 2G67A 4S1TA 4AECA 2J4FA 2FW6A 2AJLI 3M9WA 1ZKMA 4QUJA 4LY7A 3K70D 9GPBA 4R5HA 1A7AA 2BCEA 3NTXA 5JI2E 5K1ZA 2A2ZA 2HPAA 4OG2A 5C1BA 1R6UA 5JAQA 2FN9A 4YNQA 2FX3A 3DZGA 3VC3A 5EZ6B 1MCZA 2CVQA 3IKTA 4WASA 3TPFA 4JI6K 1AXRA 2V8OA 4LXIA 1M2WA 2VNIA 1G8JA 4J1SA 4FFNA 4K88A 2G9UA 3BMNB 1JL1A 4BWGA 3BK1A 2CXHA 4W8HA 5DB4A 2EZTA 1ZOLA 2HK8A 5TT0A 3IRXA 3WWZA 1UT5A 4EFMA 4DSLA 1F4LA 5JMTA 3S7TA 1EP2B 2VYQA 1WQ4A 4WADA 1NTOA 1GD1O 4YMTA 3GLUA 3GX1A 1Q12A 3N8IA 1YIAA 5CIYA 4YRKA 5KOHA 4KRXA 4Y1RB 3VA3A 5FX2A 2EZ9A 4IKOA 5KSWB 4V3BA 2YOFA 1M2VA 1XROA 1M9NA 2C8JA 3A4YA 4R9VA 1E4EB 2GXSA 4KHZA 4MQ3A 4V03A 1QK3A 4DTMA 2PT7A 4KB5A 1CY0A 3SQNA 1J5OA 5C8YA 2NZUG 2P9ZA 1CETA 4ILJA 5KC8A 5K3FA 1U8FO 1NI5A 4ID3A 3ZWAA 3I83A 3LC1O 3QP9A 5F3WB 4BUZA 4A8JC 1SL1A 1J8DA 5AI6A 2AQIA 4FPAA 3AIMA 1T0HB 2XKJE 4V2IA 1QH8A 4YOTA 3AYXB 3W90A 2YJFA 1GLEG 5AKJA 3KJIA 2QTHA 4MUIA 1MB0A 3ZYCA 2W58A 2QW1A 3QE3A 1T3VA 1RMYA 3G9QA 4QDXA 3PE6A 4G89A 4WZBA 1QP0A 4TVKA 1DEOA 1UJCA 1VSQA 1VCNA 4NTZA 4TTJA 2OUKA 3W78A 3GLHE 3DBVO 3IVCA 4F5EA 3BXGA 1T29A 1GVHA 4QVKA 3OU2A 3M82A 4U7TB 4YMLA 4XEIA 1WMDA 4CG1A 3DEHA 3GCZA 2RBGA 4CKBA 4OI1A 1T5TA 2J0QA 1AQUA 2AMVA 3V34A 3R8FA 3RGWS 3KUCA 1GIAA 2WIDA 2CT8A 1KKLA 2B20A 4QHYA 1L5NA 2GZDA 3DMNA 3B9PA 2QL9A 5TIIA 4H60A 3AVXA 2QTWB 4UFPA 1O08A 1GQFA 2IX3A 4FSHA 3L3VA 3MEEA 2VF8A 2P91A 1ZCFA 1N6IA 5JR3A 1KCFA 2CJYA 2VZEA 5JUWA 5D86A 1RYZA 4MHOA 2UXDB 3IR5A 1XUPO 5IK2A 5FQOA 3ETGA 3QUSA 4OYRA 4RLHA 4IIJB 1IHUA 2FMIA 1ZRSA 2OSVA 4NV0A 3LWLA 4IBOA 2JJ8A 2IX9A 1EWTA 4HDCA 4MB2A 3BBPA 1JFSA 4OHFA 1PR9A 2CWDA 2GN2A 2G08A 2ZIFA 2P9BA 4FLVA 1BX1A 1C2YA 1DO2A 1VLQA 3SZGA 2DC1A 3RC2A 1HQKA 5ALOA 2OEPA 2PU5A 8MHTA 3I8SA 1SBIA 5E4FA 4IAOA 2WD7B 4B3OA 4QYSA 4FWKA 1VL0A 1XC3A 3R0QA 1ZI9A 4DSEA 5DIFA 3WHLA 3EPJA 3RAEC 5YASA 1WR8A 4BYMA 4C30A 2JWLA 5FWAA 1LSSA 4ITRC 2VWQA 3QUQA 4Q12A 2ZJ4A 3EZYA 3EE8A 3NJ8A 5H82A 4RANA 3PFCA 1ZM9A 4EP5A 5H4GA 5H81A 1W29A 1K6XA 1NHGA 3E5RA 4EB0A 3L43A 2RHWA 1JLLB 4J1NA 5KRTA 3RQSA 2PR7A 1D1QA 1KI3A 1H85A 4F9FA 3KCNA 3TNYA 5CYOA 3SAJA 2OMKA 1EBFA 4MAFA 1CR0A 2BH1A 1I4EB 1JWLA 4LZWA 3VKHA 1RLUA 3RKSA 1O2DA 4D02A 4DEXA 1LEHA 4DARA 4ED9A 3P0JA 5J4KA 2A35A 3C6MA 1R8JA 3FTQA 1H65A 2J3KA 1P9WA 3D0KA 2FW7A 3BWDD 3TVDA 1P6XA 4EW2A 3N7AA 3LPDA 2JFHA 2JL1A 3P0HA 4JJZA 1G9SA 2PL1A 2W2PA 3Q8KA 4PV7A 1I3MA 2PMDA 2IEDA 3L6QA 3B6JA 2L18A 2JHPA 3EIHA 4U0KA 4G5OA 1FXUA 4LF5K 1YHZA 1W6UA 3NBPA 5CNJA 1BGWA 1D1TA 2HN9A 4PQFA 2DHRA 5HL7L 3OF3A 2R6JA 4P54A 3K53A 3LDQA 5AMXA 1DCKA 1Z4KA 4UARA 4IJQA 2Q1NA 1M2JA 1OX5A 3GGJA 4CJ5A 4FJKA 3NVMA 2JGAA 3K94A 4HC4A 4M8LA 2FN3A 2GBFA 2JAHA 1J70A 3BHMA 4O4JA 2FFRA 5FLYA 3ZKWA 3KQOA 2YNGA 1YVPA 1QVZA 1RTJA 4MCAA 2ZVPX 4N9WA 3FPHA 4UJ5A 3GLFE 2DUNA 1ZD5A 3VOTA 4R8SA 4MWGA 4C4TA 4Q3NA 4J7AA 1NQXA 1CF9A 3K0EA 4JUCA 4CECA 2VF5X 3HCWA 2WJVA 4PRYA 4FWIB 1YJ8A 3F2KA 4KOAA 1L4UA 4UNQA 1KYZA 2V7WA 2BR4A 1IVNA 3A10A 5AK4A 4BR7A 3ZI4A 4QTZA 4D26A 5KYTA 3HXKA 4MPRA 4LD0A 3MWJA 3Q6MA 3M6WA 3J7AC 3TR6A 1QQCA 4XE5A 3TD6A 3NIGB 3ZD9A 1MR3F 5K3BA 5FTJA 5EESA 4LXYA 3F47A 1THMA 5HKLA 5BURA 1S89A 5EE9A 4TSXA 2PMWB 4YR7A 5CB8A 1EBUA 1NVVR 2CBXA 2C5SA 3DE2X 2REXB 3A1SA 5CDYA 2JJQA 1EBBA 1GAEO 4IZ6A 5DMXA 3CF0A 4KXWA 2Q45A 5H02A 1DC7A 3V1KA 2ZYIA 3P9XA 1RXEA 4X44A 4DMGA 1B0UA 1LI7A 4L2IB 3TNDA 3UW1A 3HCAA 5CM8B 3GVHA 4EHFA 1QCCA 1JHQA 3EGIA 1IJBA 3A9RA 4B44A 4MQFB 5EWMB 2IC5A 1V7ZA 3CUTA 1NIJA 1KYTA 2I2AA 4LAFA 3EGVA 3AEZA 5GOZA 4F2RA 3PE4A 3LG2A 2DLCX 3A05A 1R4NB 1PV1A 3ANYB 4CJQA 2CHEA 3ZJUA 5KJFA 4YEDA 1LLQA 4MJ7A 2Q50A 3TAGA 1H3FA 5MFPA 3HXMA 2R7KA 1U0FA 4BMNA 3UM9A 1MRNA 2YX6A 4Q3CA 4B75A 4DIBA 1ZK0A 2ZZKA 2ZIAA 3UXHA 2VPWA 1LVUA 4WFAL 5L9AA 3OJXA 1VYTA 1EHIA 5FPSA 5LYJF 3WNCA 5I01A 3MK6A 2X7JA 4G0MA 3LOPA 3OM9A 3NHYA 3MG9A 1OREA 3WRXC 3SPXA 2GDZA 1N8TA 1L4NA 4M9QA 2P3OA 3FWKA 3CVOA 4KSCA 1Q1BA 4HAZA 2P40A 3KAKA 2QTFA 2MYTA 1U1GA 4JLPA 2EAUA 3WTCA 5DCUA 4WL0A 5T6BA 3BGSA 1FC0A 3K30A 3RS0A 4DA0A 4MRNA 4AJPA 1ECGA 1RS0A 2W6ID 4KIWA 3RAJA 1ZIPA 1HE5A 3DBRB 1RBMA 2PLWA 4FZRA 3FUUA 2W6KA 2VG8A 1JEAA 3WKEA 1EWQA 2CVHA 3ENVA 1RLJA 3ETLA 3J7AP 1A76A 4KUHA 3KSAC 4E5SA 4JC4A 4B84A 1H6CA 2EFYA 3U80A 3SYZA 4PIMA 4HGOA 1C4XA 2PWZA 2WHRA 2X74A 2K7FA 2ISSD 4H7DA 3RC1A 4L16A 5FH9A 2X78A 1N6HA 4MVJP 4XDGA 2RHTA 4P86A 1SBYA 2E6MA 1GKUB 3V42A 3GPCA 1R5BA 4KH1A 3PRHA 1RPJA 1NMSA 4R5PA 2ECOA 1QFZA 3OPYA 2OAGA 4F97A 3W5BA 3QJYA 2C3YA 1EFVB 3CF5L 3K5MA 4B9QA 1X39A 5LUBA 4MI1A 3P32A 5K3SA 1OIXA 4B6FA 3RUIA 1DADA 2CK3A 1ISMA 2FX5A 1N36B 1ZCBA 3GEIA 5CA1F 1YUWA 4E7OA 3JALB 2E4AA 4ZVVA 3M9LA 4MRAA 1A1SA 4YMGA 5AKGA 2AUMA 4DQIA 1G3IA 1RZRA 5EIBD 1LRJA 3MXTA 3HXPA 4BLSA 5JTUA 3ZLUA 5SZJA 1D0VA 1J9AA 2ZSJA 3KIPA 3O3CA 5BQPA 3GN2A 4EUSA 1MX1A 2LV8A 3W0LA 3COSA 4JSRA 2H1LA 1E1CA 3PRJA 2ZIZA 1T7PA 3I12A 3NUQA 2D59A 1IUOA 2CMKA 2VH1A 2WAXA 3MC1A 3HUFA 3V6MA 2BFFA 1UBFA 1P1BA 5KWVA 3MWEA 3TLCA 1I39A 4Y6LA 2KM1A 1W5TA 1EFPA 3AETB 3PA8A 4BN5A 1Z3IX 5M2QA 3VISA 1DC6A 1C4OA 2YV2A 2G9VA 3A6LA 3GP8A 2CB9A 5GAHP 4BZWA 5BT9A 3U4LA 5AJZA 3W9UA 3A1WA 1NJWA 4BFTA 4BWMA 5EHZA 1UWKA 4C78A 1L4BA 3FCEA 3W8NA 4CU5A 1V8DA 1H0HA 2FX2A 2PUDA 3A26A 4Q19A 2WILA 4KQIA 5C4GB 4XDYA 1NPTO 2NO9A 5TJ9A 1H8ED 5IRCD 3Q4GA 4M41A 3VPBA 4GWGA 3DO5A 1JL2A 3FYDA 4PYKA 1DTQA 5HYVA 4Q3LA 2AF4C 2EFHB 1QHIA 3MHPA 3RKRA 5ITZA 3PLRA 2QGFA 4GVPA 3JARB 4J0KA 2FFQA 1LQUA 4I55A 1QIIA 4Y2GA 5HK8A 4K41A 2Q5EA 3D5EA 4XB2A 1OX4B 5HIKA 1AJEA 4L08A 3GUVA 3HTXA 4HB3A 1Y8AA 1T44A 1X9MA 2C9ZA 4UFOA 3CZAA 1JHXA 4GI1A 3IDZA 2RI6A 4CMJA 3G0GA 3Q7PA 1G59A 4AMUA 5B1EA 2BKLA 4OQFA 3T19A 4KNWA 2VEOA 4YGXB 2FN8A 3TAUA 5KX5B 4M0MA 1YS1X 4DCVA 1EH5A 3VQ8A 1RC1A 2HA2A 4QELA 3T0FA 4TKVA 1BXZA 3EK2A 4NBTA 2VDPB 2J0UB 1YMUA 1KFEB 3DXKB 5KDLA 3UHPA 4PG8A 4LK2A 3OAAA 4DLKA 3ENQA 3AA4A 2BMFA 3N2IA 3U9SA 4ZQEA 1NBWB 3IP6A 5TEVA 3L77A 1KJZA 2NTJA 2PUHA 3WLTA 3H18A 1HDXA 2VPPA 1GG8A 2Q2WA 3EPPA 2O2DA 1SU6A 4JBYA 1Q5PA 3MEQA 3MMXA 3GNQA 2P9CA 5KI6A 2B5OA 1ZI8A 4MGEA 4G24A 2WHPA 1HYQA 1AQIA 4P8RA 2OV2A 5CFZA 3GAFA 5AJVB 2JEOA 4EPXA 1G6HA 3MQ2A 1NJYA 3DE7X 3G0IA 4AF7A 4CQJA 4MRRA 5LMCA 1BA3A 1R8XA 1R4MB 4XIIA 2C9OA 1BHJA 2KMLA 3OY7A 4R2JA 2O06A 3MQFA 4JLHA 3H75A 1KP2A 3WQQA 4ZGGA 4TTVA 1DDGA 2GM9A 1VI2A 3CWQA 4BFCA 1X92A 4QXOA 1NGHA 3C65A 4E7HA 1DJLA 4N7JA 1UBTS 3D0OA 4H5VA 3DTNA 1BXGB 1XI2A 2O07A 4IVPA 4BRDA 1TQHA 1GVNB 2R60A 3HLTA 4B40A 1NOKA 4FCCA 3I1FA 4ZO8A 3OYNA 2R7MA 3L2UA 3G1WA 1PFYA 3GLIE 3LDHA 5DM1A 3IPLA 2R1VB 4C20A 4CV1A 4GE0A 3ITHA 1WF3A 4X6UA 2QT1A 1DRWA 4EG0A 2VYFA 3ABIA 4BFYA 4GSKA 4IGFA 1JLKA 3U4IA 1W581 4OAPA 3EKUA 1QVAA 3HP9A 2GJ9A 2W6JA 2ZG6A 3EQZA 2XHEA 3ASZA 4OF4A 2I1QA 4URXR 1N9ZA 3EXHB 1I0LA 4WFNL 5AM5A 3GLTA 3T5PA 3T9EA 1H42A 1I6WA 4IIJF 2P3LA 3VUEA 4BOYA 2C97A 2GBGA 1SC1A 2O4CA 3WLQA 4Z0NA 4P83A 1X3MA 1GGVA 1V2GA 2Z09A 3K2PA 3TX2A 3KE9A 1HKUA 4RNCA 1GPWB 5A4JA 5HROA 3NBYC 4P6VF 5EEHA 1J8MF 1VL6A 3LTNC 1GNLA 3Q40A 5C7IO 4ER7A 4WKPA 2ZRGA 3QLTA 1KJYA 2XVZA 2PSDA 3TGLA 3EDOA 5SZTA 4A15A 1WU8A 3BAFA 3ZVNA 3H6HA 3TQSA 2BE9A 4YT5A 3SQXA 3MS4A 3OQPA 4Z4HA 3NMUF 1VZ3A 3G13A 3LZIA 4LYFA 3C3KA 4Z0TA 3AVUA 1Q2XA 4YORA 4CM9D 4C6TB 3PHJA 1SA0B 5KYXA 2VBIA 2EIXA 4WKGA 4G5FA 1YRAA 4NFLA 3ALYA 3SC2B 2R4TA 3QIVA 3VPFA 4N39A 4DFMA 1I13A 5EFZA 3L06A 4ZWNA 1XNRK 4HYEA 3LQRA 2WWWA 1KOJA 1ZNZA 4JKOA 4NB4A 2FRXA 3GNSA 3W6UA 2FQXA 2B2XA 5DF1A 1L8XA 4CQLB 2HSTA 4DR3B 3CVUA 3LQYA 4XWWA 3BF7A 1BUPA 2FSUA 2VSQA 3FSGA 3G0HA 2OV4A 4D3YA 3COWA 2RKWA 4Y2YA 4MWZA 3AU8A 2VT2A 3AERB 2XT0A 2XO7A 3TDMA 3PPYA 1U0TA 1Y8CA 2YHSA 4D4GA 3CNBA 4KXNA 4OHWA 3H5AA 4U7WA 4L72A 3E5NA 3NYQA 3MRTA 2ZR7A 4IOXA 1ENOA 1PZGA 1Q7BA 3EC1A 3CZ4A 3RFFA 3WGIA 2NT4A 4D9MA 3P26A 4YR9A 3O9MA 4NFHA 4X1YA 3ZD6A 3A9UA 4CZ2A 5L3SA 2FE4A 4JB3A 1E5QA 2IH5A 2UZ1A 3R7AA 3ZIAD 1SCQA 1W19A 3OD5A 1SR8A 2EQ5A 3ZT2A 2VTDA 2WR8A 3QPDA 2O2HA 3HV2A 4OGKA 1NKTA 4KDFA 3IG1A 1F48A 4RF5A 3C7AA 2QWPA 4R01A 4BVFA 1N34K 2JLZA 1R0YA 4IHAA 1MB3A 1YIJN 4AMZA 2RONA 4QPZA 1ZP6A 4DIKA 1HDOA 3KEFA 4MUEA 2FOLA 2UU9B 1PVDA 5AI0A 4RX1A 1AGPA 4HV4A 1VE6A 4RETA 1QNLA 1WLJA 4BECA 4MUHA 2FR8C 5ALSA 2DY4A 1KK3A 4GKAA 1A98A 1NMEA 4CTOA 1KZHA 4XUDA 1VFPA 2QYHA 2GN4A 1KZ1A 2ZB7A 3WZ2A 4F1KA 2BELA 5BYAA 2DUMA 3BL5A 3IUJA 2X0FA 3WADA 2B3DA 4DWWA 2FDCA 1X9SA 1A9OA 3EODA 3WJ7A 4GC9A 3PXBA 5AQIA 1IH8A 4UEKA 3ILYA 1ZBIA 4TKZA 4DLXA 4A73A 3O8QA 4CZLA 2O8FA 5CEFA 2QJFA 4FP9A 3FN4A 2WZCA 3ONEA 2G82A 3AR3A 1OU4A 3QV2A 2OBFA 2O7QA 3R0VA 3T9CA 2NRZA 4DV1K 5EXEA 2FI1A 4K86A 4HGQA 4E46A 1HQDA 4F92B 3KB1A 1NTRA 5I7OA 1PFQA 3BFXA 2HEIA 3HZHA 1RJGA 2AN9A 3F67A 4QQFA 4CIFA 4LI0A 3F6CA 4YP6A 3JYNA 3MW8A 2F1RA 3HU2A 3V4SA 4JQCA 1A50B 1HLDA 1JQKA 4U39A 2PT5A 1QX4A 5ELXA 3LS2A 1KFDA 3IVGA 4KE6A 1AHNA 2QUAA 3LUBA 3BWVA 4UULA 5K3EA 1A9SA 5D8DA 5DBHX 4CJ4A 1PNTA 5CY4A 4LDNA 4CHYA 2A5LA 4QLBA 2CXPA 5CGQB 2WIBA 2BDUA 2WONA 4F5YA 3HP1A 4EHDA 2WQ6A 4ZCIA 3V2UA 2QRVB 3NTUA 5CFQA 2ABWA 2RIPA 5HPYB 2E1RA 4B9LA 3QX9A 4INJA 4MR8A 2BH2A 4OI2A 3K1ZA 2ASEA 2VGMA 1USUA 3TL2A 4S1OA 3M33A 1KO1A 4EDHA 4ZT2A 1A0OA 1E8MA 3UJ9A 1VCMA 4NAUA 3T0IA 2AHRA 4EW3A 8GPBA 2QJTA 1Q0ZA 2ANBA 4ZCRA 3K7EA 3G2NA 2XWBF 3NFAA 2AA4A 5COQA 5EE1A 1IMOA 4EZEA 4UUOA 2J45A 4JGGA 1T4GA 2X77A 3QE0A 1N5MA 1T8RA 1T8EA 1N32B 1SH7A 4TXNA 2WAYA 3KWMA 4HMPA 3D7MA 5AI9A 5AW1A 4FW2A 1PO7A 3U49A 4E7JA 5AXCA 1RR6A 3CE9A 5HZGA 2NXCA 1FXSA 1KQPA 1UT8A 4GRDA 1BFUA 3ROTA 1SUEA 4IHQA 1T8SA 3LF1A 3WP1B 2DKOA 3V9ZA 5CURA 2GKOA 4JUIA 5KYYA 1FA9A 3TANA 1LWEA 1YRYE 3QUBA 4YAGA 5HJ2A 4WA7A 3OHSX 4LV8B 4XR4A 4JWKA 1A7UA 3AVBA 3DLAA 1XU9A 1OI7A 3KQSA 3UKUB 2R6HA 4RPIA 3G49A 4OK6A 4HWKA 4EITA 2JI8A 3A1VA 3SZRA 4C0AC 4FWLA 3UWSA 5CYGA 1X6VA 1OHHD 3GFBA 2GCEA 1JJIA 1GPDG 3IUCA 4ZA2A 4HUJA 2COUA 1Z88A 4UZFA 1P1CA 1I7PA 3HFRA 4YCMA 4LHWA 2Y8EA 3QWHA 4FCYA 5K3CA 1NQTA 4P7KA 3MVEA 1OFHA 4L28A 2HGZA 5IXYA 2QWOA 2Y1JA 4U6SA 3HI0A 2A1TS 4UE2A 2QD5A 2FU5C 3ISVA 1E79D 5FR2A 4C21A 4EQ6A 4UU7A 2P0EA 4H7HA 4AILC 2AJTA 1RDBA 4ISEA 3PDIA 4NBWA 3TZKA 3U7HB 2X58A 3V4PB 3RU7A 3MXMA 1VQ8N 1LS6A 3FB4A 1SXIA 3VYUB 2DCMA 3QEAZ 4LWOA 2RHRA 4PYQA 3D0RA 1YSCA 4YP0A 4ACAA 1VJCA 3IP5A 3ZHOA 4GMFA 2QL6A 4AROA 3I8BA 3BDPA 1JSLA 1Q3KA 5L8VA 4J07A 1HNWB 2Y1GA 4UBLA 3E1GA 3FPSA 5AQTA 5DLEA 3A31A 1D4FA 2RGRA 3GQVA 3MINA 1CG6A 2F2TA 3HE3A 1BVUA 3IHLA 3OVNA 3MUNA 4NI5A 3RBZA 1R18A 3THYB 2WV7A 3AKZA 1YULA 3B1JA 4NU8X 3DFKA 2FN7A 2ICAA 2NXWA 3D3WB 1OXUA 1QH1B 1D7AA 1ADJA 4AWBA 1EKXA 1I7LA 2NZYA 3OCXA 5AW7A 1JSCA 3WYGA 4DJDC 5EERA 4C7BA 1XZCA 4IO0A 2ODBA 3BS4A 4YMHA 3MWPA 3EIUA 2ZYWX 4LJ4A 5T41A 2DMRA 1QG0A 2CDBA 1XFAA 2JFOA 3M70A 4DSUA 1RT5A 3KZKA 2RGGA 2XKKA 4PIVA 3KLEA 2LP4Y 3D7SA 4X7RA 3VKVA 4NZ9A 2PK3A 1EA7A 1FNSA 4IRMA 4K3VA 3FBTA 3WWYA 2HTFA 5T4HA 2PMBA 1YJ5A 2XA1A 1CE8A 5KX5F 2P8SA 1KEKA 4BATA 2O3QA 3O9RA 2GPWA 2VQFK 2WUWE 3JRNA 4UU0A 2JGEA 5HKBA 4JVSB 4YUYA 5IZCA 2JK0A 3E2MA 4V0KA 3O9QA 5FL7A 1VMIA 1R0LA 3OTOK 1IWBB 4MW1A 3DGEC 3KV1A 5ILGA 4B85A 2QM0A 4QXRA 4D6PA 1X0VA 1YQDA 1IRIA 5LM3A 2HA5A 1K8YB 4QPJC 1WEKA 3AUTA 3AR7A 1KH1A 5BR8B 1EWKA 3AG6A 3UH1A 2YWCA 1YA4A 1NJZA 4ND8A 4JI0B 3M5DA 1TM3E 1S02A 4RACA 1W44A 1EFHA 4AWXA 1TUYA 2XJ9A 3R3HA 3D54D 1R66A 2VJNA 3PUWA 3PXEA 3GFTA 1ZQ1A 4E6PA 2PGDA 2ZBDA 2VXCA 2C00A 2EU8A 2OV6A 3EFBA 5FPEA 5D3QA 4NZNA 5DI9A 5CDGA 3LW7A 3R2JA 3IAAA 1IXYA 2JD2A 1QHNA 1T03A 1RYHA 4YMIA 4AZ3B 2VBFA 1KEVA 1TK3A 1UBCA 2GZ2A 5JNRA 4FHEA 2VG7A 3PX6A 4RQAA 4IFYA 1BWSA 4QQRA 4MDAA 4PZYA 5ALPA 5FPPA 3QIAA 1NGIA 2ZSHA 5JY6A 2XE4A 1H69A 3ITDA 4ZKDA 2AD5A 1P9LA 3A9VA 2QDXA 1RBUA 1K2WA 1SURA 3D3EA 4MQUA 4LCEA 4H6XA 5ALFA 3DZKA 3QU4A 2UXDK 4I1YA 4BVGA 2YHBA 4FLTA 2I1VB 4BU1A 3PEFA 2R87A 4FE4A 5EC8A 5JQGB 2FW1A 2RF2A 2OHVA 4WXRA 4MI3A 1X1PA 1I32A 3HPQA 4KE9A 3EH1A 4OA5A 1EVIA 2ZWPA 4X85A 4XYGA 1BQNA 1HSOA 1T2NA 1A2BA 3W6NA 3VU9A 4KNVA 2PZAA 4C0BA 3M49A 5FPQA 2BDTA 3FYUB 5ILOA 1NGAA 3VO2A 2BR3A 5E6UB 4C9BA 2ZS7A 5FROA 3LECA 1QDLB 3KTQA 4QTTB 2CL5A 1GTL1 1IHYA 1X38A 3W5AA 3EXEA 3QVJA 4X1IB 2BSQA 4DLGA 4O2AB 5KZMB 3HBMA 3OG9A 1XXHA 1KS9A 4ZO4A 2OTJN 2Z5GA 1DJPA 3SR4A 5KPZA 1XQWA 3NZEA 4OA8A 4WQ4C 3MT7A 3MPUA 4I5FA 3QEMA 3QETA 3TIXB 5A4AA 1TIPA 1IPHA 3ZYZA 5L40A 2QN2A 1GAXA 4NENA 4S1WA 1JEDA 3LDFA 4LFCB 1QAOA 4JQYA 2H85A 2G17A 4KJXA 3TSWA 1QP8A 1CJTC 4QG3A 2W0MA 4M0CA 5HFJA 2IYEA 1AX9A 4IVNA 1Y3DE 3E3NA 3OBBA 2JFZA 4YK7A 1W96A 3JTMA 3OIDA 1FUEA 1W35A 3G23A 3SJHA 5KNDA 5AQNA 1U2ZA 4WOBA 3CNHA