4IEEA

Crystal structure of the large terminase subunit gp2 of bacterial virus sf6 complexed with atp-r-s
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
463
structure length
452
Chain Sequence
INPIFEPFIEAHRYKVAKGGRGSGKSWAIARLLVEAARRQPVRILCARELQNSISDSVIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGIDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQANVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTKVEMKQKLGIPSPNLADALMMCMHCPALVREETEIYVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Gene 2 protein
publication title Structures of the phage Sf6 large terminase provide new insights into DNA translocation and cleavage.
pubmed doi rcsb
source organism Shigella phage sf6
total genus 161
structure length 452
sequence length 463
ec nomenclature
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04466 Terminase_3 Phage terminase large subunit
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4ieeA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ieeA01
1XMJA 3QJYA 5FOSA 3NHAA 1XTSA 1N6KA 5FTNA 2XB2A 2ZXUA 4QHSA 1AS0A 1N5LA 1K6MA 5JHGB 4GDFA 3B9QA 1US8B 4ZO4A 3KXIA 3N5CA 2ZSBA 4BEJA 2IS6A 2DCUA 4A0HA 2V6IA 3RDPA 1VMAA 4CEJA 1UAAA 1Z6TA 2J3EA 2Q9AA 3ZYCA 3QSYA 5JCZA 2XZPA 1HEIA 2CEAA 1L8QA 3ZQJA 2IS1A 1J8MF 3HR7A 3AGQA 4MGIR 2YOFA 2QN6A 2ZE8A 2D7DA 2QGZA 3UMRA 5J4KA 1R5OA 5AJYA 2EU8A 2IUUA 4HLDA 1XWIA 3O8RA 2G1JA 4TLEA 4M9SA 2ZRGA 2P2LA 2WWGA 3U4QA 4DUGA 4BEBA 2W0MA 1NI3A 4BUJA 2IUTA 3RABA 4KSBA 1G64A 2IC5A 2WAYA 3KX2A 4ZKDA 3GLGA 2FV8A 2BM1A 3W6PA 3LY5A 4IOMA 1FQKA 2NZ8A 4RJLA 2CLCX 1X6VA 5L8VA 1W4CA 3U6KA 1TEVA 3R7WB 5K8LA 5FL3A 3THYA 2IEZA 1OIVA 1JBKA 3GJ5A 2MSCB 2XSZA 2WJGA 4PZYA 4I99A 1A4RA 4BLSA 5HPYB 1P2UA 4QRHA 4DCUA 2YWEA 3HJNA 3BAFA 4XVRA 2YNMA 3TSOA 1P9NA 2A2ZA 3AF1A 3MWKA 1IXSB 1E4VA 2H18A 3Q8XB 1AN0A 3LH5A 1XMIA 3A6PC 2REBA 3U3MA 1F3OA 1N0UA 5H70A 3QVVA 4MQBA 4D2IA 2ZSDA 4KYIB 4Q4AA 1NIJA 5BQ5A 4A6PA 1GUAA 4ZIRA 2B8TA 3WYGA 1UBFA 4AYWA 2F9LA 1SQ5A 4PTLA 1J2JA 2VEDA 2XJ9A 4HB3A 2VP5A 5BWMA 1G7SA 1G18A 3GLGE 1OLOA 3IDQA 2AR7A 3PITA 3ZZUA 3THXB 1KSJA 3B1ZA 2O0HA 5EE3A 3SYLA 3CF0A 3A1TA 3TKLA 1TQ2A 5JEDA 3A1WA 2P6NA 5EJEA 1RYFA 1OHHA 1M1YE 3OF5A 1FX0A 1DG1G 4IXMA 1OH6A 4B2IA 5M04A 4GT1A 1ZYUA 4ZDJA 1Z6GA 3SYKA 3MWYW 1C4OA 2JLQA 1FUKA 4Q48A 1E9FA 3SS8A 4BFVA 1Q1EA 3K0FA 4HI0E 2V4ZA 1DAMA 5SZHB 3L2OB 4M1OA 3WXMA 3VNVA 1G16A 2OXRA 3MLEA 2EFDB 3I62A 2ZREA 121PA 2QENA 2G1KA 5K8UA 4V0MA 1CJMA 4ZI3A 2F7SA 4K81B 4RZ2A 5CB6A 1G1MA 2QAGA 2VHUA 1U99A 2QEQA 4R2HA 421PA 4P4TA 4Q9HA 1G7TA 6Q21A 1WB9A 3LV8A 1G7RA 2WIBA 3RS2A 5JI3E 4KBFA 1BS1A 1ZNYA 5G40A 2WMNB 1E2NA 4PC2A 3EIHA 4KU4A 1TQ6A 3QXXA 1EGAA 3D6TB 4JSTA 5KHOC 1LF0A 4MYTA 1RJ9B 3QBTA 2HF9A 1EG7A 4QGHA 3A1UA 2DWOA 3CONA 2R6DA 4KLZA 3R9WA 4POAA 2RGCA 4NYIR 721PA 2ZJAA 3PJRA 4A8JB 1G4AE 1RYHA 1S0UA 5G41A 1W49A 2CHQA 2FPLA 1XTQA 2Z4RA 4U00A 3T1TA 1IY2A 4X8LA 2XZOA 1HTWA 1P2TA 4EPXA 2P6UA 3GEIA 4OJQA 2ORVA 3A4LA 3QKRB 3WMFA 1RKBA 4LJ5A 3O8CA 3QF4A 1XD2B 4FCVA 4DUGD 3AQ4A 2WJIA 1W44A 4V0ME 3P20A 4F92B 3HDTA 1GL6A 4PO1A 5DI3A 5EXTA 5CITA 1GRNA 3VTKA 1GRQA 4L4UA 4HDOB 4MITA 4Q1BA 3OEHD 1I4TD 4GI7A 3Q9LA 4MKHA 2GJ8A 4NYJR 2RGNA 3QNUA 4PHGA 3I92A 2QT0A 1LNZA 1CXZA 1VDZA 3CWQA 1KI7A 2C78A 1G8HA 2XSZD 4MUAA 1V43A 2ZUDA 1G4UR 4W9MC 5CM8B 1RRPA 2B6HA 5G3ZA 1YZLA 2G83A 2VP6A 1CKEA 2Z43A 3U44A 1AGPA 1OIXA 3VAAA 1DO2A 3WNBA 2NG1A 1HH4A 3IBYA 3L0PA 4D4KA 3A58B 5KTYA 1XD8A 1KI6B 5A4JA 2QRZA 4OK6A 5EUMA 2NTYC 4QC2A 4P0TA 4RCYA 1Z0KA 4RZ3A 3R7WA 2IL1A 2YINC 1X1SA 3CZPA 3KFXA 2BEKA 4LYHA 2RGGA 3ZS9A 2X77A 2WWWA 1VHTA 1Z3IX 1GITA 4UJ3A 4B3BA 2ZROA 4B3GA 1TU3A 1ZU4A 5DLQC 2IA5A 3LVRE 4US0R 3T35A 4KFUA 5FI0B 1DAGA 2GA8A 4X8OA 1KO8A 2GCPA 2XJ4A 2CCKA 1OHHD 1YE8A 2OG2A 3TNFA 4L15A 2OO7A 3TH5A 5JS7A 3EC2A 2XXAB 3RAPR 4GL2A 2DWPA 2EQBA 4IOLA 1XCGB 5D3MB 3IEVA 5BYKA 2WAXA 4DT1B 1II9A 1NKSA 1M8PA 1XF9A 2ORWA 4YMWA 2V1UA 2FU5C 5C12A 4HLUA 3VR5A 1PVOA 4AY2A 3EASA 4G5RA 1W0KA 2MMCA 4ARZA 4DLXA 5FTMA 4XVUA 2D2FA 4KI0A 4UXHA 3W3ZB 1CP2A 5EE0A 4JVNA 1XX6A 3I3SR 1ZNZA 3IQXA 4OK5A 2QT1A 4EPYA 3PVSA 3THOA 5TXGA 4EPRA 3ICEA 3NC0C 4IKEA 4P31A 2FSGA 3I1FA 2CCJA 3QOFA 4P3YA 4DLYA 1Z0IA 1F2TB 2QUZA 1DADA 3K0AB 4NYMR 1ZC3A 3EX7C 3ZLJA 1OPXA 5JWOA 2VPPA 1KI2A 4JJKA 1KDPA 1DO0A 2IS2A 2G77B 3MD0A 4LJAA 2EW1A 3AVWA 4I4LA 2F9MA 2O8CB 3DL0A 1AK2A 1F2UA 3K70B 4CDGA 4B75A 2F3TA 3KKPA 1A7JA 1UKYA 4DCVA 1YU9A 1CR0A 3VR4A 3CWZA 3RRMA 1AJEA 1KO1A 4HZIA 2AFHE 3B1VA 2ZRDA 3ZVMA 1B0UA 1Q1QA 2MMGA 2QGNA 4JT2A 3CH5A 2GF0A 3NKVA 4RKEA 5CJPA 4NE2A 2OAQ1 4HB0A 1ZIOA 3HYTA 3NDPA 1P9WA 1OXTA 2Q0HA 4DLUA 4JL8A 2VP2A 2V1XA 2UZIR 3K8YA 2QAJA 2YJTD 5E7MA 1KY3A 1T8TA 2CL0X 5M1FA 2YVUA 3AVXA 5G3YA 4OYHA 2IXEA 2WWXA 1X1RA 2KJQA 2ZI9A 2ZUCA 3IIJA 3X1ZA 5EE5B 1CEEA 1L4UA 2BBSA 5C4GB 1W5TA 2PLRA 3VU9B 4PHHA 4IXNA 3G0HA 2J87A 1UKZA 2KBFA 4EDHA 1IJEA 1S8FA 4AKHA 5BYJA 3DMNA 3WNDA 3M1IA 5FUXA 1YRBA 3ND8A 1NJGA 3B85A 3GLIA 5E3HA 2BMDA 4DDTA 1L4YA 4RFSA 1YJ5A 1DAIA 2ZRIA 1G3IA 3DOFA 4BFTA 4M9ZA 4ZDIA 4OK3A 3PENA 4RD3A 2C96A 2OEPA 1SXJB 2PJRA 3NEYA 1G8YA 4TL7A 3TAUA 4A9AA 1GAJA 3JZAA 3EC1A 4C7OB 1F5NA 4N1AA 2FOLA 1P2SA 3W6NA 1ZINA 4EAQA 1XEXB 3IO5A 1I2MA 2GJAA 4LI0A 4W7SA 3AF0A 3C5HA 1RFLA 1UJ2A 4Q1AA 5EZ5A 3VKGA 1GIAA 4XVQA 1SKQA 4KXFB 3QE0A 2CVFA 5J4LA 2XGJA 4RKFA 2E1RA 1Z06A 2IYQA 2AHOA 2WZQA 2GDJA 1E0KA 1AQYA 2WSSA 2P67A 2IYYA 4EJSC 1W0KD 2J1LA 2VSFA 3CNOA 3SHFA 3KQLA 1G8FA 3GEEA 3OFNA 1JAHA 3WNCA 3QKSA 3UXMA 3N70A 3QY0A 4B47A 2AD5A 2FX3A 1ZD8A 1KI4A 2W00A 5FBVB 1J7KA 1HE1C 1S9DA 4WZBE 5AK0A 5FOXA 4AKGA 2ZS8A 3ECCA 5DIFA 3CB4A 1IOZA 2YC4C 4HUTA 5JEEA 3BFXA 3CH4B 5JSZB 4JLBA 1IN6A 1PLJA 4Q01A 4Q4HA 4KFTA 5GJWC 4E07A 4FWIB 1EX7A 2BM0A 2QPAA 5C46F 2GZDA 1JXOA 4JYBA 5J4HA 3ONWA 2RGAA 2JAQA 4FWTA 3OEEA 4U5XA 1SVKA 2ZYVX 5IT5A 2RGBA 3PUZA 1MO6A 3CPEA 3GFPA 4EPWA 4HYYA 3QXHA 4JBXA 4LV8B 1CJUC 4PHTA 3NHBA 3L43A 1KDRA 4FMCF 1XPRA 2GJ9A 1Z07A 3KKMA 3SBEA 3LDAA 3BD9A 1GL9B 3GLHB 4YMSA 3QG1A 2TMKA 4TYPA 1UBGA 4JVLA 1JXMA 3QPWA 4TMTA 4A92A 3K0AA 2A9KA 4F7WA 2KB0A 4HAUA 1NN0A 1YZGA 5DH9A 5A5GA 3TUZC 2I1VB 1JI0A 2BBWA 4FN5A 4IOKA 1KZ7B 1W36D 3H0KA 4O3MA 4DSNA 4QM6A 5CJ2A 1II8B 2Z6VA 1VG8A 5C1BA 1S1CA 1VIAA 1TL7C 2HYDA 4BLOA 4FCTA 1GNPA 1RE0A 3TR5A 3MJRA 2D4HA 4FCWA 5KSYA 2VP9A 1GNRA 5HTKA 1W48A 2REOA 3LNCA 4XTCS 2BC9A 3AUYA 2G9NA 4PPFA 4ESHA 4M1TA 2IXGA 2WJJA 3W9YA 2EYUA 1DBSA 3I8SA 1U0LA 3LW8A 5C4MA 4V03A 4AIIA 3OIUA 5UKDA 1KI3A 4CIDA 1CF4A 2ZEJA 4D25A 4HLCA 3D8BA 2BMFA 5HKKA 5DISB 2BMEA 3LQRA 5J40A 5FUVA 4KITB 2IYLD 2FGKA 4AKEA 3SOPA 3KB1A 3THWA 1GM5A 3C14C 2OCBA 2JLUA 3AVOA 3RRYA 1EX6A 3FHCB 3KJHA 1NMZA 1U94A 2OCYC 4DLTA 2WSMA 1EK0A 2CLDX 5FI1B 1OV4A 3GFOA 2MSDB 2ZUBA 2QQ0A 3OIVA 4P4SB 4Q47A 3H4MA 2ZE7A 3MG9A 3AVQA 4A4DA 3I32A 2NO6A 2PMKA 1NY5A 5JWRA 5KYKA 4F4JA 4PC3A 2N46A 2IYXA 4NCJA 4M22A 5FPTA 1G19A 3CBQA 5KNCA 4PO9A 1NLFA 2WSSD 2ZS9A 2PX0A 3BB3A 1IN4A 1VYTA 4BFXA 3ADDA 3KJIA 1U8ZA 3OFND 2GBLC 1H8EA 4NONA 1XPUA 1SXJA 2J0VA 5DE3A 4PR0A 1G3QA 4NP6A 1KKLA 3UMFA 4B32A 1UF9A 3LX8A 5K8IA 4N0EA 2NO0A 3AEZA 5JECA 1R0XA 3DM9B 4U02A 4BFUA 2ZRCA 4V0NA 1S4QA 1W4RA 1GKYA 4JLKA 5B57C 1P72A 1P62B 1U8AA 4QBGB 4XSHA 1MABB 1TEXA 2FEMA 4JLAA 3TQFA 4TSFA 3AKYA 5KUTA 4K46A 3G5UA 3VR2A 2QG6A 3E1SA 4WVFA 1CJTC 4BLRA 3MUFA 3OEED 4W5WA 3G82C 5EP2A 1XZQA 2BEJA 2F1RA 1LB1B 2BKUA 2WBLC 3F0TA 2PT7A 3K0EA 3O8DA 3L0IB 1P75A 1BYIA 2HJVA 4TMWA 4PAOA 1Q22A 2BKEA 4KSCA 4BWYA 2VP0A 3DKPA 3T1OA 4DIDA 4M1WA 3Q3JB 2NZJA 2VIIA 2GXSA 1P9RA 1N6IA 4CVNA 3DMDA 3MJHA 1E2QA 5JSZA 1SXJE 3KFVA 3A1SA 5GVSA 2BHRA 2XEXA 5DSZA 5HE9A 2FGJA 1T4GA 2PL3A 1PLKA 4CRWB 4HDQB 5M1KA 2CE2X 4LUCA 4MYUA 3V9PA 4NZYA 3VHLB 4FIDA 3GLFB 1UEJA 2ZJ8A 4NMMA 3LXRA 4LDJA 4PPGA 1KJWA 3DZ8A 3RS7A 2VHJA 4DSTA 4Q7JB 4DCNA 4KHZA 1S1MA 4OBEA 4A2QA 1TMKA 1N6NA 4EFNA 3EZFA 4Q1CA 4D0LB 3IBGA 2PX3A 4HZUA 1RZ3A 1JR3A 3K1JA 1KK0A 2Z83A 3LRPA 4B3DA 1JJVA 4XJXA 1E2JA 4URUR 1ZW6A 1ODFA 4JVSB 4WXRA 2I3BA 1EFCA 2JEOA 5FL7A 2PEYA 4YXWA 4LJ6A 4Z8YA 2QZ4A 2FSHA 1XMSA 3DDCA 3GJ7A 4UNSA 3PEYA 2VSXA 2WV9A 3MSXA 2ZI4A 1F60A 4A8JC 4BRUA 4RD0A 4IVQA 3SJZA 2CHGA 3VQTA 1NJFA 1E9BA 3IPYA 5M1QA 1Z08A 2VSOA 3ND9A 1OFUX 4J0QA 4B74A 4IEEA 2ZR0A 4IRUB 2CL6X 3SE0A 3NXSA 3DM5A 5AJZA 3REFA 5DN6A 4CEHB 4X8MA 2D74A 4Q5IA 4KVGA 4QBIA 5A0FA 3V4FA 3UATA 3UK6A 1R0YA 4LBWA 4Z1MA 4JYCA 1KK3A 4BASA 5IF9A 2QE7A 4TYQA 2AWOA 3AF4A 3LBIA 3QUSA 4TYWA 3WYAA 4B3XA 2WOOA 1IHUA 1Q12A 2NIPA 5EP4A 3RRNA 3UIEA 1JR3E 3LA6A 3C5CA 3EAQA 4JL5A 3K09C 2YV5A 1AZTA 1HY3A 2J0UA 2OBLA 1YZUA 2ZRPA 3C16C 4E5UA 2JLSA 4LJYA 2IHYA 1H8ED 1E79A 2D2EA 3FWYA 1SXJD 4LSGA 1CRPA 2IK8A 4ZDWA 3TQCA 1WE2A 3R9IA 3T61A 1DAKA 5E4FA 1EWRA 4GMXA 1R5BA 2V9PA 4XH9B 4WIAA 1VG1A 2FSFA 4TZ6A 1G7CA 2GVDC 4ZCMA 1FFHA 1E2DA 5DI9A 3OIWA 1DAFA 2J46A 2BBTA 2A78A 4TSFD 1TQ4A 4DWJA 3IKJA 3K9HA 2Q21A 1JQLB 1CJKC 2DFTA 4F4IA 3DEFA 3AVPA 1BO6A 2ZU0C 2QA5A 2HF8A 3BERA 5L3SB 4M2LA 3C41J 4US2R 5AUQA 2ZRBA 2BVNA 5FBRB 1E9EA 4Q7KA 2C5LA 2AX4A 4D26A 3I8XA 1P7CA 2O0JA 1QHIA 1Z6XA 2ZQ5A 5KDOA 2JA1A 3WHLA 1RIFA 1MABA 1A82A 1P3JA 3FMOB 5CM9C 1DS6A 3CR8A 2W6IA 4YONB 3HPRA 4BGDA 3EZ6A 4BE7B 4G5SA 3NWJA 4IDQA 4LJ8A 4FI3C 1QBKC 3LBHA 1AM4D 4EJSA 4KO8A 4H1VA 3JZMA 4LHYA 2P5SA 3CRVA 4XOIA 1JR3D 4C30A 2X2EA 1SVSA 3MAAC 3AV0B 5HZHA 1G41A 2R6FA 4WZAE 2EVWX 2GAAA 1M7HA 1G8PA 2J45A 4UNQA 4QHYA 4URWR 4UKDA 4MGYR 5BXQC 3RC3A 1X86B 4EPTA 1NMXA 2BOVA 3QF7A 5FL7D 1E2LA 4YXWD 2ZRMA 3CM0A 1W2GA 2HYIC 3X1XA 1N6OA 1OXSC 2QQEA 3IQWA 1EXMA 1DELA 3QXJA 2EFEB 1ZAKA 2V55B 3GLFA 2W83A 1G5TA 4C2UA 1ZM3A 2VL7A 4WBSA 3K70C 2I4IA 1E9AA 3B7GA 3R20A 4LWZA 5TVKA 2FFQA 4AC9A 4CZ2A 2GXUA 1GWNA 5LB2A 1M6NA 4HUQB 3HWSA 4TTRA 3ZZ0A 4DDUA 3CPJB 5DN6D 2OFWA 2MSEB 3NH9A 3SHWA 4C4PA 1SHZA 5LB4A 4HB2A 1XMVA 3IO3A 1JQJC 5E7IA 4Q9IA 3KXLA 3TRFA 4DKXA 1YVDA 4Z1MD 1T0HB 3K9LA 4EKDA 4TLAA 2QE7D 2ZRNA 3LAWA 4MKGA 4ZCIA 3CX8A 5L3QA 1G3UA 2QBYB 4LHWA 2GK6A 2JJ8A 4Q4JA 3ADCA 2GWHA 2VO1A 1NBMA 2V8OA 3NBZC 4URYR 5CDFA 1UBCA 1QHHB 1SGWA 2JLVA 2VQSA 1E9SA 1HUQA 1XXHB 5CLQA 4URZR 4R2IA 1OFHA 1LF5A 4C0KA 4LJ9A 5FR1A 1E79D 2QSZA 3TSZA 4BFSA 1VHLA 4BPBA 3OIYA 3HPQA 5FBLB 4AG5A 1Z22A 3R8FA 2WWYA 3FYHA 3GLFE 1RC8A 1KAOA 2FA9A 3SFZA 621PA 3KTAA 4L5BA 2FMXA 5H1YA 5JCPA 2PMDA 2GCOA 4PFSA 4DCTA 5KPDA 4AURA 4JLDA 2NQ2C 4WOPA 4RD4A 1T3HA 1M34E 1L2TA 1US8A 5M1PA 2FH5B 5EXXA 3U2QA 4JLVA 2GEDA 2W6JA 5TDHA 3K0CC 2WKQA 1HT1E 4TQ9A 5FPKA 1CJVC 1SXJC 2HCBA 2P6RA 4JBWA 4DEXA 1WQ1R 4NCHA 4DLRA 4FMDF 4KODA 3VKHA 1IQPA 1XU4A 4XWKA 2B8WA 2ZAOA 1N6LA 2AL7A 2EYQA 2QM7A 5F98A 3FKSA 1RRFA 1NBME 3LFUA 1VYUA 3E70C 1G3RA 5CDFE 3U3KA 4TTPA 3GQBA 1GL7A 1OYWA 5H68A 3TJZA 2J0SA 1QHSA 2GAOA 4PQRA 3FOZA 1OT3A 4RD1A 3SBDA 2PJZA 1X8LA 4BZXA 1XPOA 2UVQA 3RRZA 4O2LA 1OIWA 2VRWA 2FFHA 2W6ID 4IVPA 1YRAA 2ZRJA 4JS0A 2BBOA 2PT5A 3IGFA 2VP4A 5L3SA 5L3RA 2G88A 2O8EB 1TU4A 2IW3A 1CULC 3UWKA 2GK7A 3LD9A 2GBLA 3NTUA 4L9WA 4JMPA 3UG7A 1A2BA 3IIKA 5G53C 2BV3A 4Q1EA 4IJMA 5IDVA 2GNOA 2QP4A 3MCAA 2QTFA 4QNRA 1WA5A 3EZ7A 4JT4A 1G6HA 4Q9KA 5SZKB 1E9RA 3P1JA 1MO3A 2IWHA 4GOKA 2AKYA 1I4DD 1S3SA 3ICQB 1E1RA 4NCIA 5F9HA 4O0MA 4F38A 1Z8FA 2QPTA 3CRQA 4OQLA 2FSIA 3RS3A 4I1SA 1K8RA 1E9DA 1N6RA 3L0OA 1ELOA 4DSOA 5IHPA 2ODBA 1OW3B 1OXUA 4UNNA 4M1KA 4C0BA 2GETA 4DZZA 3THXA 3CZQA 2V6JA 2JJ1A 1Z6AA 4M9QA 4IDOA 4YC7A 4DIEA 1DOAA 5JJKA 3TR0A 1CR2A 1Z6YA 3KKQA 3NBXX 3AVYA 2O8DB 3C15C 3LQQA 4BLQA 1G20E 1FOEB 1Z0FA 3CNLA 3L0SA 3Q7QA 1NBMD 4GRAA 4E22A 2O0KA 3ZVRA 3AGPA 1VYVA 3PR1A 2R65A 2X2FA 3BORA 3NBFA 2VYFA 4QJ3A 2BCJQ 2HT1A 1YQTA 4WAUA 2W58A 2AXPA 2F43B 4B33A 2Q9BA 4A6XA 5TARA 5KDLA 3MWLA 4G01B 2V3CC 4MRPA 2C2HA 1MKYA 4D6PA 1W2HA 3V4RA 2JLXA 3X1YA 4B35A 3P32A 2CMKA 4HLQB 3TK1A 4JVMA 3BGWA 1NVXQ 2ECKA 1R10A 2Y8EA 3SEAA 2IYWA 2OFOA 2RH5A 3VKWA 1AIPA 4V0KA 3ZS8A 1RJ9A 1SKYB 1TQDA 3REGA 2YHSA 4PZZA 1Y63A 1G17A 4PSKA 3SQWA 2G3YA 5EXSA 4M1MA 5AUNB 4Q02A 2W0SA 2W6JD 4G3XA 4BRWA 5TMPA 4A8JA 4D81A 2GCNA 3BB1A 2REXB 2E9SA 1NN5A 4OHVA 2LKCA 2GXAA 3TIFA 2XNSA 1QHNA 1ZCBA 5F9FA 1ZP6A 3U61B 4KVAA 1XRJA 2Q3MA 1OB2A 3FKSD 2NO7A 2RHDA 3EIEA 3QKRA 4FMCB 1P73A 4Z54A 3QENA 5DHFA 1G8GA 5CIWA 3WYFA 4LGMA 4A1FA 1XD2A 4HAVA 5KOYA 4G5OA 1NN1A 3MGCA 3GJ0A 2RGEA 1F48A 4M53A 4UJ5A 4UQOA 4M21A 3NG1A 4NHOA 1IAQA 4HB4A 1H8HA 3VMFA 1G21E 1SVMA 1NIPA 4OKSA 1YZNA 2ZYUX 1E2EA 4LCBA 5FTLA 3K09A 3T1VA 2P65A 3FTQA 5JS8A 2ZE6A 2ZJYA 3MMPA 1WP9A 1Z28A 2IS4A 3KJEA 4GOXA 4LZZA 5B2ZA 3RLFA 1IXZA 2PZGA 3BBPA 3AKEA 1KI9A 3AUXA 3U7FB 1FL9A 4A82A 1YZTA 3KUDA 3I5XA 2RKOA 4L16A 4QGGA 4IFEA 4PC1A 1PZNA 1ZC4A 3RHFA 2Q3FA 4TMXA 4D80A 1KI6A 1TUEA 4TT3A 4U7DA 3IHLA 1KNXA 1UM8A 3C8UA 3QKUA 1ZNXA 2ONJA 3SU8A 1LS6A 8OHMA 1E1RD 1UFQA 2OBNA 3VFDA 1N5JA 4C0AC 3HR8A 3EWAA 4PPQA 4QXAA 1TNDA 5J47A 4AKIA 4M9XA 4MRRA 1G5PA 5B30A 2IYRA 4KAXA 1FMLA 1XP8A 1U0HC 2QROA 2R44A 1W4BA 1YR9A 1X3SA 3OE7A 4RCZA 3ZZTA 2YWFA 4JKYA 4YDHB 2IYUA 2KI5A 1SULA 3QKTA 1Y3AA 2JJ1D 2QMUA 4PSAA 4DCSA 4LJ7A 3WMGA 1FTNA 5GJBA 3CIOA 1W47A 2IXFA 1NVVQ 2A5YB 2XXAA 2GJKA 2LKDA 3ETLA 3NBYC 1JALA 1ETUA 4YQFA 4C2TA 1HE8B 1XBTA 5D3MA 5FOTA 3S1AB 4MKIA 4DT1A 2ZYTX 3U3RA 3D3QA 1YZKA 1QHYA 1CRQA 2NOAA 5JFGA 1L7VC 2KSQA 2O8BB 2GF9A 1DG3A 4OQXA 3C6AA 4AG6A 1KMHB 1LW7A 4D4LA 3CRMA 2ZRAA 3AH8A 5F3WB 3EPKA 1OJLA 4OHZA 1KK2A 1ZD9A 1U2RA 1ZU5A 2VF8A 5FBWB 1E4YA 1ZVQA 2PBRA 4HAZA 4TQAA 4KCGA 2ZIAA 1FTSA 2FG5A 1BH2A 3AP2A 2CHVA 2HXSA 5SZIA 4NDZA 2ANCA 1LTQA 3QEOA 3P27A 4QBFA 3QBVA 1Q44A 3SJAA 1OXVA 1F2TA 2B21A 1WBDA 1CU1A 3RANA 1R0WA 3PUXA 4JLMA 1N5IA 3C7KA 1IONA 4R98A 5KPJA 3PQCA 1MH1A 4LRWA 5AUPB 2LWIA 1Q3TA 4C9BA 2JASA 3ADKA 2O8CA 3WMEA 1AZSC 3F5FA 1XEFA 5P21A 2BIFA 1XB2A 2J7PA 1CIPA 1OFTA 5CYOA 3KQHA 4BQSA 1U0JA 4OL0A 4D82A 1KDOA 1XJCA 4PO8A 5HCIA 3EZ9A 1SVOA 4XSGA 2A7QA 4GFDA 4WA7A 3IUYA 4FW9A 3VR1A 4LHVA 1D5CA 4Y0VA 4LOAA 1XCMA 4Q66C 1MO4A 2H17A 1LFDB 1H8HD 2ERYA 1AA9A 2A5DA 2OAP1 3HU1A 4DLWA 1M7BA 1B23P 3KQNA 1TADA 3PFIA 4DDVA 4JLNA 2OHFA 4TMZA 3TW8B 2QY9A 1P61B 2ZJOA 4DXAA 2A5FA 4UNPA 4BFYA 2IYTA 2RHMA 3W5JA 3BS4A 4H1UA 4KYUA 4RD2A 5EZ6B 4HAYA 4ACAA 5EUQB 4DB2A 3EARA 3VU9A 1S2MA 2FEOA 2CLSA 3QIAA 1GRRA 2XAUA 3VR3A 1C1YA 1NKTA 4FD2A 1R5NA 1X8JA 4IOJA 3ZGXA 4B76A 3KXKA 4V0LA 4DEYA 3CX7A 3RS5A 1NLYA 3BC1A 3BH7A 4TT3D 4HDCA 2ZM5A 1JR6A 4CEJB 3PUWA 1XTRA 4GP7A 4MDFA 1QHXA 4OQNA 5FOVA 4JLOA 4UXJA 1GDDA 3QVUA 4MKFA 2ZRKA 3AM1A 2J9RA 3K0CA 1G9XA 3X2SA 3KB2A 5DO9A 2QPOA 3OE7D 5BN3A 2XTNA 1SKYE 4C7OA 4Q7LA 4TLBA 3U4QB 3RS4A 1FP6A 4ITRC 1XEXA 4DRZA 1QRAA 3GLGB 4KLNA 3FMPB 1N0VC 4PXAA 4Q19A 3SFVA 2JATA 1Z2CA 3KJGA 1QF9A 1T91A 4TL6A 5CK5A 1UKEA 3C6HA 1T5LA 3TUIC 2WHXA 3GFTA 4R7ZA 4TYNA 1D9XA 1KAGA 1NF3A 2PCLA 4R71A 5FFMA 2OLJA 3H86A 2OM2A 1IN5A 2YYZA 5ANRB 2W2TA 2FFAA 4D4JA 1G6OA 3CO5A 3PUVA 1KYIA 4MA4A 1Z63A 3UWOA 2RB4A 2OILA 3Q85A 2VHCA 2RCNA 5JWHA 3A37A 3CKLA 3OHMA 1WDTA 4K8OA 4NH0A 3SYNA 2GVZC 2RAPA 4IDHA 3AF3A 2XB4A 3PIRA 5CLLA 2IX3A 4CW7A 2OZEA 1EFTA 2CK3A 3GJ6A 3UG6A 4Q4AB 1KI8A 1J90A 4ZIRB 4B6EA 1MO5A 1NL3A 4RD6A 2ZSFA 2GHIA 5TB5A 4C0QC 4PSVA 4LHXA 4F91B 3E2IA 2ZR9A 2FPMA 2XITA 4B34A 1NLZA 4BFWA 5FH9A 5J4YA 2GJSA 1R8QA 1ZM7A 3K70D 1KO4A 2AWNA 2IHBA 4A2PA 1D8TA 4PC6A 5DGXA 5FUYA 1IY0A 4OI2A 2J7PD 2DFNA 2FPKA 4QGFA 2WPDA 3R9XA 1FX0B 1TPZA 4LBYA 2OESA 3W8RA 3DZDA 1KTVA 5JBQA 2ZI3A 3RYTC 4TN1A 1J70A 3ZIAA 3GLHA 2ZI5A 3AKCA 2RGDA 4RSGA 4URVR 2AFIE 2DBYA 1GOTA 2FFBA 4NPHA 3K0FB 2IWRA 3X1DA 2NGRA 3ASZA 1FQJA 1YHNA 3LBNA 4AYXA 1ZM9A 3W90A 1FMJA 2JJ2A 3F3YA 4EQ6B 4RZXA 1F6BA 2ERXA 2GXQA 4B73A 3D7MA 3ZJYA 5HKKD 2ONKA 4I1VA 3VNUA 1NSFA 1E32A 2ZR7A 2QAGB 4A36A 2IT1A 1II8A 1K5GA 2VBCA 4QFMA 3LW7A 4QOSA 3K9GA 4NU0A 4RY2A 5KDDA 3BIFA 1UADA 1ZUNB 2DB3A 4HATA 3A36A 2HXYA 2J7KA 4ZI2A 4NCKA 4HAWA 2A30A 1AQUA 2ZETA 1O3YA 4PAQA 1WBBA 3CUEF 3PG5A 3PV0A 4LHZA 5KSPA 1KO5A 3SNHA 1XCPA 2PLFA 5BW8A 1U8YA 4P4UA 1YR8A 3WBKA 1AS2A 2OCPA 5E7JA 2OCAA 1OH7A 2GEVA 2KWIA 4MGZR 4PC7A 3LXXA 1FNMA 2XNDA 3T5GA 2WVJA 2EFGA 2FJUA 3GLHE 1XJQA 5EP3A 1M7GA 4C0JA 2XOKA 2IBMA 2ZJ2A 3RS0A 1AKEA 2WM9B 3GJ3A 4JIMA 5KNBA 1GTVA 4DVGA 1MV5A 4PQYA 2KE5A 1KGDA 1T6NA 2HT6A 3OESA 3W6OA 3VX4A 4OHYA 1D9ZA 5AR1A 3B1XA 3PEUA 5DI3B 5GVRA 3LLUA 4MGKR 3TUJC 1N3BA 1KK1A 3TGPA 4P4SA 2DYKA 1KSHA 3UKDA 4FXPA 1N2CE 1FZQA 1PV4A 3ZVLA 1EFUA 1D6JA 1E96A 1CTQA 2Z0MA 3AF2A 4YDSA 1IBRA 5KSZA 1R7RA 2O52A 4QG7A 5EQTA 1GZSA 5AUOB 3UPUA 5CB8A 4F93B 1VECA 2DPXA 3L8YA 3B2EA 3B6EA 4YMVA 4PAMA 1E0AA 2A5JA 4GPTA 4LY6A 4DDWA 3MWJA 4GOJA 4PX9A 2D06A 4KFRA 3U44B 1GSIA 1XTKA 4IW3B 3BH0A 2B7CA 2ZVQX 3DPUA 3WBJA 4LYFA 2CK3D 4OI4A 3U7GA 1P2VA 4WXPA 3OEHA 4HSEA 1PLLA 3IPXA 4B48A 3EZ2A 2EWVA 2WJVA 4XTRA 1KO7A 5EXPA 4OI1A 4KV9A 3GMTA 3VHXA 1UKVY 2OFXA 1ZM4A 2R2AA 5TY0A 3SJBA 4ACBA 4L8GA 4C0SA 1BYUA 1DAHA 1GKIA 1E0JA 4OQMA 2Z5FA 3RSOA 2UKDA 5JZVA 2WPDD 4FMDB 1KHTA 3NEJA 4XIGS 4BZQA 1U90A 3B5JA 3V00A 2XX3A 4XWAA 1DVRA 1JNYA 3ZIAD 4BLTA 3E5HA 4GNKA 5AJWA 3B13B 3ZVNA 2HUPA 4DLZA 2E87A 2QP9X 4Q9LA 3EG5A 1M2OB 2XZLA 1ESMA 5JRJA 3U3JA 1W1WA 2JJ2D 3BOSA 3AVUA 4ARZB 1KSFX 4B3FX 5JJIA 1ZBDA 2QL6A 2GEUA 3QG5A 3U60B 3TSWA 3GJ8A 4EFMA 3FB4A 3PCRB 4NL4H 2DY1A 4TTQA 3RC8A 3IHWA 2ZI6A 3EIQA 4LBVA 2V7QA 3CRRA 4JJZA 1U9IC 2C9CA 1I2DA 2PH1A 4IDPA 1Z0DA 4OHXA 3GPLA 4B2PA 4CT4B 1ZIPA 4CEIB 4ZV4A 3TVDA 1T9HA 2WJHA 2OT3B 4TMKA 2IF0A 2DFKB 1UPTA 2GKSA 3JVVA 4CGZA 4BZPA 3UMSA 1HQCA 4EQ6A 4RFVA 2X8AA 4WW0A 2ZSAA 3P4XA 1QZXA 2XNDD 4TLCA 3W8NA 5HE8A 2ZAMA 5IRCD 4AI6A 1COWA 1TF5A 1F2UB 1WXQA 2XOKD 2YZ2A 4XD7A 3PUYA 1N5KA 4DLSA 2JGNA 1O87A 3BJIC 4NCNA 4W5HA 2GZAA 5IK2A 4CEHA 4I81A 5HZKA 2ANBA 1U98A 4F4CA 3ZH9B 2PEZA 3CNNA 5FOUA 4B6FA 2EFCB 1OYYA 3Q5EA 5EE1A 4G5GA 3TE6A 5GADl 3TVTA 2NMVA 1UDXA 3KL4A 1XEWY 1TF7A 4LK2A 1AKYA 4PPNA 1IN7A 2GRJA 3SC3A 3J81k 1LVGA 2AK3A 2B92A 1WCV1 3KKOA 3X1WA 2ZRHA 4DB4A 2OE2A 1W36B 3U5ZB 4IDNA 3LWNA 1Q3HA 1YZQA 4HAXA 1JAIA 3FHOA 1Z5ZA 1JECA 2AN9A 1Q21A 3IEUA 1R8SA 2CCGA 4B3CA 1E99A 3LLMA 3DOEA 1IN8A 3CPHA 5DHAA 3FMIA 1E2PA 5LDDC 1YKSA 2BDTA 2CVHA 4D0NA 2C77A 1VTKA 3L82B 5CIQA 5LD2C 3U3OA 4LV6A 1QG4A 3SJCA 4C3ZA 1E98A 1Q0UA 2J59A 1D2NA 4ASUA 4EPVA 5M1NA 5EP1A 3HU3A 1JEDA 2ZTSA 4QM7A 3GLIB 2ZITA 5LBIA 1MRNA 4N3NA 4RFSB 1A5TA 1ZMXA 1OF1A 3QQ5A 4M4SA 5LPNA 1J8YF 1R2QA 2ORIA 4CT5A 1NP6A 2D7CA 3QXSA 1ZUIA 3MFYA 1P5ZB 1KJZA 1FUUA 1LY1A 2ODWA 2EWWA 821PA 2C8VA 521PA 5FUWA 1I4LD 3SQXA 2VHQA 3I61A 4MRSA 1TX4B 3CLVA 4GBMA 2HJGA 4Q9JA 3LX5A 3EPLA 3HU2A 3H2YA 4TQUS 3TMKA 2KBEA 1Q1BA 4GMDA 5C18A 5F2EA 4US1R 4DSUA 4WZ6A 1OXXK 3CW2A 2G0NA 1P4SA 1Q1ZA 1Z29A 2H92A 2ZSEA 2WIAA 1E69A 2CNWA 2P3SA 4JLJA 4PZLA 1NG9A 4IHQA 2ASEA 2BCGY 5GJVC 4TZ0A 4OJKA 1P6XA 3QKSB 1N6HA 5C2DA 2ATVA 4B2LA 1E6CA 3KQUA 3TBKA 4LC1A 1V5WA 5ELXA 3AP1A 2V7QD 2OUKA 4LJ4A 1E2MA 1HURA 1ZRHA 1XFAA 4KBGA 1PUJA 2JDIA 1IM2A 5AJXA 3ZD7A 2NO1A 1HT2E 3CR7A 4TWZA 2ZJBA 1XZPA 2C04A 2H16A 3BXZA 1W46A 2WICA 3KDSE 3P26A 4EUNA 4Q4HB 3VR6A 4Q1FA 1NVVR 1P60A 1W5SA 1AS3A 5FR2A 2QM8A 3BFVA 5FBQB 3AVTA 1Z0AA 3I73A 4ABYA 2VF7A 1Q20A 3B1YA 1OKKA 1W7AA 3GJ4A 1NN3A 1ZNWA 2NPFA 1COWD 4XD7D 1VPLA 3SDZA 1NRJB 1OE0A 1VCIA 2FN4A 3DHWC 4MRNA 4YLGA 3AB3A 4DLVA 3KUCA 1GNQA 4TL8A 2UZ3A 4HUQA 5FPYA 4BECA 3B82A 1NVUQ 5IK2D 5KNDA 3BRWD 4KFSA 2ZS7A 3N2IA 5DYIA 3OAAA 2P5TB 3GD7A 1YR7A 1VIYA 2ZPTX 1OSNA 1NG1A 1T5IA 5EE9A 4BFZA 4CEIA 1E2FA 5FTKA 2ATXA 4QHTA 2QP3A 1DARA 2C95A 4Q03A 3T5DA 3SR0A 3U7HB 2QBYA 3K9NA 4NYIQ 3GP8A 2CBZA 3B9PA 1UDWA 5KU1A 2D62A 4OI0A 2QU8A 3Q72A 1QHHA 3UANA 4DJTA 4LX0A 1XXHA 4Z8XA 1Z2AA 5L3VA 1CR4A 3M6AA 4X8HA 2HCJB 4P32A 1R0ZA 4YMTA 1ZUHA 1EFHA 1Z0JA 3L8ZA 5SZJA 1SVLA 4I1UA 4M8NE 2HLDA 1MRSA 4KJZA 4ZCLA 1UBEA 3FKQA 4A15A 4B43A 1IJFA 4ASUD 1XJ0A 1ZD1A 1XTIA 1VCOA 5FTJA 1D2MA 4G1UC 4NYJQ 1KOFA 5K8TA 4NTZA 3EW9A 5TV2A 3ADBA 4QJ5A 3PEVA 3H84A 1CR1A 4ZDKA 1LS1A 1ZM2A 4ZKEA 3FMFA 2YWHA 1OFIA 3FVQA 4Q4LA 3THWB 5BN5A 5D3QA 2C9YA 4JLPA 3QEJA 1M74A 4PHFA 3T06B 1T8UA 4IVRA 3W5IA 3ZDQA 4AYTA 2AKAB 1OB5A 1BIFA 4S2EA 1S9HA 4GSYA 4V0OA 1VG0B 2P0EA 5GJCA 1Z83A 5C2FA 3B78A 1BKDR 1WF3A 3EWSA 4G5QA 2FWRA 3NVAA 5C2JB 1XXHE 2NPIA 5FPSA 5LD2B 2QMEA 1DEKA 1QHGA 3QPUA 4ZPXA 2ZRFA 1OH5A 3BE4A 4LC0A 3EA0A 2R6AA 3O8BA 1JPNA 2D3WA 4MUBA 1KMQA 1RVDA 4QJ4A 1KDTA 3O47A 2FZLA 2Z4SA 2CNWD 3AP3A 1YR6A 3A1VA 2WKRA 5CK4A 4A0GA 1QDEA 4I1OA 4Q00A 2IF2A 4FINA 3RSLA 2C03A 1PJRA 1E2IA 2O8EA 1E3MA 2H1LA 1RW4A 1CS4C 2CL7X 2YOHA 3A4MA 3BB4A 5JLJA 4QKQA 3AVVA 5DNYB 4MYHA 2L0XA 2JDID 2VHTA 2EFHB 1E1QA 2G6BA 2VTKA 3A8TA 3TW4A 1T3LA 1CLUA 1NSTA 3IIMA 4ON9A 1G3MA 5JHHB 2DWQA 4B44A 1VG9B 2X1VA 1X8KA 3FHTA 1G291 4L9SA 1GILA 3FDIA 4CF7A 3KQKA 3Q5DA 2ODEA 1QVRA 4Q7MB 4E03A 2ZVPX 1C9KA 1OKKD 3WP1B 2IYSA 4LPSA 2WWIA 5JMTA 1SVWA 2FE4A 4JSYA 4NKRA 3FPAA 4M1YA 2F1HA 3GEHA 2Q9CA 3TAHA 4CYMA 3DO6A 4JL6A 5HR5A 3GLIE 2JLZA 3NH6A 3CRW1 3GCGA 3OAAD 3B1WA 2FDCA 4R9UC 1EESA 3KZ1E 2AD1A 1A1VA 3PEWA 4NYMQ 2FF7A 2QRNA 1HV8A 2QI9C 2SHKA 3LO5A 2WTUA 1JEEA 4TLDA 3F8TA 4Y0AA 1KSGA 2G0TA 2O8DA 2C99A 1UEIA 4AWXA 2QNRA 1T0JB 1VCNA 2DR3A 4LPKA 2F3RA 2QAGC 4O25A 1KZGB 1EFRA 1QG2A 1G5RA 1VCMA 5JJLA 3WY9A 2ZANA 1TTTA 5DYGA 5J5CA 4JBYA 3BH6A 4C0HA 2BJVA 4HZUB 2VA8A 2XTZA 2F43A 3HP1A 1TF2A 2IUSA 1ANKA 4RZUA 2GILA 1GG2A 1J99A 3N2EA 2GZHA 1ONBA 1U9IA 1W0JA 2HLDD 1NVWQ 1FNNA 2CJWB 2JIZA 2H8KA 2Q3HA 1DPFA 1SZPA 2VLIA 3DVLA 4EIWA 1JJ7A 3MRSA 2HV8A 2O8FB 1KY2A 2A3RA 3DKVA 1S96A 3D31A 5CYPA 5E95A 1H65A 3CX6A 5JRZA 5C15A 1E94E 3B8HA 2YOGA 3R8CA 4H9GA 2ZU6A 3W3AA 2ODNA 5HCNA 3WRXC 2H57A 1XD9A 4BLPA 1BMFA 2XTMA 4D4MA 1GFIA 2I1QA 1WRBA 1IY1A 1RPZA 4LBZA 2N1BA 1T3SA 3RVBA 5B58C 1VKJA 4AK9A 3FFBA 2DFLA 1DAEA 1XEWX 3FFAA 1NY6A 4P33A 3M0EA 4MYCA 4Q18A 2WKPA 1XNJA 5FPHA 2RGNC 3GJXC 4M1SA 2ZJZA 1BOFA 4GZLA 4C0LA 2J0UB 4D0GA 2YWGA 1CBUA 1D2EA 3ZQ6A 1ESNA 2H7VA 4OHWA 3PXGA 2NO9A 1MR3F 2QTHA 4IFBA 1GVNB 4RVCA 2WOJA 2HEIA 3T34A 4GZMA 4MRVA 5C10A 1E2GA 1II0A 2RMKA 2QMOA 3NDBB 4UNRA 4O2RA 3P4YA 4ESVA 1JB1A 4MDEA 3BWDD 3WRYC 2R6CA 4N0DA 2WJYA 3CF6R 1E1QD 5AJVB 2DHRA 3EXAA 4Z51A 1MOZA 3TLXA 2WWFA 2IYZA 3RNLA 2AK2A 4LYJA 2FZ4A 2R6GA 3K53A 3QPVA 5JI2E 4QL3A 3RWMB 1FPMA 2F55A 3HYRA 2JLRA 3T1QA 3EPJA 1XDBA 2WWHA 2LCFA 5FOWA 2HDNB 5KSOA 4MH0R 2Q6TA 2RGXA 4QGAA 2BJWA 2R62A 3WP0A 1PUIA 3THYB 1GKUB 1SVIA 1KKMA 1DE0A 3EA5A 3CF2A 1EWQA 2K5UA 4II7A 5KO2A 2IEYA 3W34A 2PCJA 2J41A 2ZJ5A 2H5EA 3AKDA 4UXIA 3I5YA 2WMOB 1ZJ6A 1HA3A 3LVQE 4QBHA 5H8WA 2J5XA 2A5GA 2PZEA 1GP2A 2J0QA 3RWOA 4FMBB 5M1OA 2ZE5A 1W4AA 2OV2A 3NC1C 1IXRC 2F6RA 4HLUC 3QXCA 2B7BA 3M4YA 3B60A 4XWOA 1QVAA 2QMHA 3S1AA 1RRGA 2JLYA 3NIBA 1ZCAA 1EFRD 2GTPA 3BK7A 4W5JA 3OZXA 4A2WA 4EJSB 4URXR 2O8BA 2AXNA 1KJYA 2JLWA 3SZRA 1NNEA 4JKIA 1KMHA 2R9VA 2C98A 4LV5B 3KKNA 4PANA 2CDNA 2JCSA 2OBMA 2F1IA 5AWFC 1KNQA 1FW6A 4S35A 4GP6A 1W0JD 2ZRLA 4TYYA 5J4VA 2CE7A 4A0FA 3SN6A 2W2VA 4E09A 1SHKA 1HQYE 2JIZD 1WMSA 1XTJA 3QI2A 4TL9A 1JPJA 4G0NA 4IEIA 3T15A 1E2HA 3IILA 1KI1A 2ZYWX 4PQFA 1NMYA 4NBSA 3H1TA 1OH8A 4A0RA 2BWJA 2PZFA 2O5VA 4DBLC 2V54A 2N42A 3I72A 3SI7A 2W2XA 1LV7A 1S3GA 3U7EB 2QORA 4TMVA 3ASYA 1BMFD 2GESA 5BN4A 2R8RA 4DHEA 5B64A 1N0WA 4V02A 3FGNA 1K5DA 1Q57A 2BMJA 4OQFA 1RRCA 2CJWA 1N6PA 2ZI7A 4QNMA 2YKGA 3A4NA 3Q7PA 5L3QB 3BFKA 2OSBA 1DTSA 1E9CA 2OLKA 4Q1DA 2O8FA 1AGRA 1N25A 1E0SA 4Q4JB 4ILEA 4YMUA 1FP7A 1R6BX 1W36C 2VH5R 3I4LA 3U6BA 2IYVA 1HYQA 4DC9A 3WHKA 3VX3A 2F1JA 4M0LA 4ERNA 3EPHA 1KIMA 1E2KA 1TUIA 4LYAA 1A2KC 2X19A 2QTVB 4JZKA 2QSYA 3JVUA 4Q21A 4AD8A 2YC2C 1R4AA 1Z47A 3C4JA 4EFLA 2OXCA 2FNAA 1MT0A 1TAGA 221PA 2C9OA 4HEJA 4B71A 3K0SA 1U81A 3FE2A 3KTAB 3QF4B 3ZD6A 3T12A 2GCOB 2CXXA
chains in the Genus database with same CATH superfamily
1S72N 5FOSA 3EDOA 5LBTA 2Q9AA 2O1SA 4GDMA 4ROSA 1M8KA 1RT1A 3QEBZ 3U9TA 2H7YA 1PYOA 5J4KA 4TLEA 4BUJA 1K0UA 2IC5A 4ZKDA 2A0XA 4RJIA 4IIUA 4IOMA 3A3PA 4BKRA 4F2SA 4B3IA 5GV7A 4JXJA 3H2KA 3H4IA 4TXJA 4B3MK 1H3FA 4PZYA 1P2UA 3JCZA 4P2BA 1RC0A 1ZOSA 1ADYA 4ICLA 1ZONA 3RYHA 3ZHBA 2INGX 4RTRA 5EZYF 4F9EA 2B8TA 2VEDA 4ER6A 4K9LA 1G18A 2X5NA 3MRTA 2Z3WA 1JS1X 4CZLA 4XOUA 2L42A 3SYLA 5EE3A 1YTAA 4DV6K 3ZXSA 1ZYUA 3QEMA 3N8IA 3NM6B 5GIOA 4IIJA 1E9FA 3SS8A 3MM4A 4UCFA 2GPAA 1QIJA 3TL2A 4K81B 5L40A 4FWRA 1U0FA 1DT3A 2DHQA 4LEIA 1R27A 4LQDA 2RHGB 3MXJA 3RAJA 1SKRA 3UOGA 4OFBA 4ZU3A 2H08A 1ZMTA 3C74A 5IXYA 4COOA 3GDOA 2P4HX 1LVUA 1RJ9B 4D3ZA 1VSIA 4LQ4A 4NF2A 2RKWA 1QLJA 1NQOA 3IERA 1K7XB 2P6UA 3A3KA 3GRPA 3I83A 2DERA 1UOQA 4B46A 2BFEA 5DM1A 3AQ4A 1CERA 1M1ZA 4KO1S 3C6XA 4RL6A 4MTLA 2QUIA 4WZBB 3N4QA 4B1YB 1ID8A 4J3NA 3CWQA 3TD6A 5LMNB 5EUCA 3LY8A 3W2HA 3KYCA 3VERA 2Q29A 4RCYA 2HMWA 4KGZA 2WYOA 2YINC 5NULA 2L18A 3M5PA 1KDVA 2QN7A 2GCPA 4WD3A 1EFPB 2OO7A 3T1HK 1HOXA 4I3GA 5LYJF 3IP6A 3JWIA 1PVOA 3H8JA 1GQOA 4ARZA 5A4FS 2QY6A 2Q1UA 1I7NA 4AHUA 3THOA 2YCHA 2BM9A 3PDUA 2GFQA 4CF3A 4BWJA 3BDIA 2BLNA 2JPDA 3GGSA 3ZGOA 3O93A 1EK6A 2C4KA 2GBPA 5IJ0B 2EW1A 4I7FA 2IIRA 1OWPA 1DC3A 1C0MA 4UUAA 3A1NA 1IG3A 2WE7A 3QHPA 4HKTA 4OGKA 1UIMA 3L3UA 2VKTA 2IC3A 1SH7A 5IHXA 4E5SA 4DNQA 1LVHA 3X1ZA 2B61A 2AEMA 2PYIA 3MWTA 1XVTA 3G0HA 1UKZA 4DSIA 4EDHA 1A8HA 1VIMA 1C7EA 2ID8A 5E7QA 1H9AA 4O3FA 1IXYA 2CXNA 3TLBA 2Z8YM 1L7BA 4RFSA 4AMZA 1JZTA 5EJAA 1YE5A 2UZAA 2OEPA 3EGXA 1HE3A 4PX2A 3TAMA 5K09A 5HRCA 2QXTA 5JAOA 1O1WA 4RK6A 4TS1A 1ZH6A 1MUUA 1DKRA 5B1EA 2H65A 2XADA 1E7RA 1YAHA 5BNWA 3A6FA 1NZFA 1PW7A 1YAJA 4E11A 4DCMA 4EEZA 3D7NA 1EX7A 3LZCA 3ONWA 5C42A 5J58A 4HYYA 3JQEA 3QXHA 3ZSQA 2UVDA 3R9XB 1XPRA 3S3MA 2H3HA 5ECDA 4TYPA 1Z4JA 4BE0A 4F7WA 5EEHA 2JFFA 5JBIA 4FN5A 4QM6A 4DV1K 1G2IA 1H66A 3FYCA 2REOA 1QUEA 5J9FA 1DBSA 3SZLA 3TXAA 4GKVA 1WCYA 2A1UA 4WKCA 5T57A 3RTGA 3AVHA 5DISB 1ZCFA 1L9XA 2OCBA 1O7JA 2O9JA 3DF7A 4GKBA 4HWRA 5CBPB 3KJFA 4DYHA 1ICEA 1HSOA 3AIMA 4UFNA 2FZCA 5BVHA 3RKSA 1PJTA 5K8IA 3SC2A 3AEZA 2QTBA 4LXGA 3V2IA 3DG9A 2MSWA 5B6JA 3VR2A 2NU9B 1J9AA 3AO3A 4LXIA 2CLHB 4CFAA 1BHLA 1BQMA 4HVLA 3H83A 3W9SA 3L0IB 3HP9A 2XTJA 3OS2A 3LUGA 5BOSA 4OQPA 3DTVB 1IUKA 4YRZA 2GSWA 5KIAA 2VIIA 4DDMA 1N6IA 1LEHA 1Z7WA 4YJHB 4KTTE 4JP5A 5IF3A 1T4GA 4KRGA 4NVRA 2XMBA 3M33A 3DLRA 3ZTWA 3DZ8A 3TKYA 1N6NA 4JJEA 1RTHA 1JYSA 2X74A 1KK0A 4KR7A 1MZVA 2I3BA 1EFCA 2X5OA 1AQLA 5K0NA 3BXHA 2D8AA 4UNSA 1R6VA 3EBLA 2VSXA 4QJIA 1LRJA 2CNLA 2CHGA 5DNAA 3NF8A 5DEIA 1QX4A 2CL6X 2HBKA 3T3FA 2D74A 1BRMA 1S8OA 4Q5IA 4QBIA 2I2FA 4ZOLF 2CJYA 3J7AP 3UK6A 4LBWA 3WXBA 2HVIA 4LY9A 4TYQA 4O4IA 1G63A 4IIBA 3MN5A 5IYZA 5E1OA 3G7UA 3D9QX 3I64A 2ZUFA 3A10A 4GOMD 4S24A 3HHPA 1CRPA 1LRLA 1BIUA 3TM4A 1P4RA 2PQ6A 3NAQA 2ZIFA 4UD2A 4TZKA 5F1YA 3O4IA 4IUCS 2EATA 3VR2D 4PL7A 1BO6A 2QA5A 5L3SB 1N5RA 3ORYA 2XE6A 3BF8A 4Q7KA 1VJ5A 2P2ZA 4O5BA 5F73A 2ET6A 1P7CA 2O0JA 5FAXA 1D0IA 2XDWA 5KDOA 5HZGA 2E37A 4EHKA 4FNOA 3ST7A 1GTJ1 4YONB 1B9DA 3KLEA 3WZMA 3F96A 1QBKC 2Q4DA 1M66A 1QLWA 1BX3A 4H3VA 1U9JA 4W5NA 4WZAE 4MRMA 4W6ZA 4FOPA 4UNQA 2GELA 2ZGZA 1E2LA 2HYIC 4C4AA 3KP1A 3QXJA 3QVKA 2P9NB 5K51A 4BX2A 2O6HA 3B7GA 1GGHA 4F8JA 5CD9A 3CPJB 2MTBA 5B3AA 4KYVA 1N33K 4Q9IA 2D0PB 3W1EA 2FSKA 4EEKA 4N40A 3TMYA 2R7NA 4E6EA 4O08A 2FWPA 2GWHA 1WABA 1DJQA 3L5OA 1QHHB 3NS7A 4GWKA 4URZR 1WUIS 1P2DA 4EHFA 2QSZA 4D56A 2WAOA 4UM9B 4CLOB 621PA 2XKKA 2ZJQL 5KPDA 4WERA 2ZXEA 3N6VA 2B25A 3T52A 1OI4A 3DL4A 2ON6A 2YMMA 5FPKA 1NU0A 5B3JA 1MV8A 3MMZA 3T5MA 4CR6A 4MV6A 2JGIA 2XMCA 1OREA 2HGZA 4KRXA 4LYDA 2IEBA 1MXFA 2PJZA 4LOJA 2FFHA 3AU9A 2G1AA 3IKTA 1QF7A 3NHFA 5AXCA 2BBOA 3R5TA 2ZB8A 3OY2A 2HDWA 4JI0K 2GK7A 1A7UA 3DYIA 2QTFA 3LBFA 4FMPA 1MO3A 1CUDA 2ACWA 3LY9A 3DE1X 1M67A 3E27A 3U39A 1WMAA 1JHUA 1C9DB 2O5CA 4K28A 4FWKA 3C15C 4RGVA 4DF4A 3C43A 3HEAA 3NGLA 2Q3LA 2Z57A 4YK7A 4CM4A 2DPNA 1RABA 1UPCA 3B6PA 5BT9A 2HZBA 2YWJA 2ZYGA 4DQKA 4LF4K 1AIPA 5AQOA 3L05A 4V0KA 4BP1A 1K75A 1HQEA 3TLJA 4RHTA 4IOXA 3TPFA 2HA2A 5MN6A 2HIHA 4KVAA 3INTA 3D6VA 1F4PA 1P73A 3WYFA 5D5PA 3PHHA 1M0WA 3KUXA 3F7NA 1A5WA 4M42A 4M21A 1W1UA 4AFNA 2UU9K 4R2JA 4BVOA 1U0NA 5E9JA 1U8EA 3AEKA 1PP4A 1HR0B 4DA4A 1WU7A 1FL9A 1EZ1A 1TUEA 4JKFA 1RLJA 4QBKA 2OPBA 4UE3S 1LU9A 4FI3F 3EWAA 1F38A 2QROA 1XYVA 1YKFA 1FSPA 1Y3AA 1DKMA 3HBJA 3DAYA 2ZYIA 1RPNA 5FUQA 1ETUA 2LCIA 4UQPA 3KQSA 1CRQA 4NEHB 5FO1A 2XCRB 1XNGA 2GF9A 5IBPA 3TAPA 3JYQA 3TVYA 1NGSA 3VR6H 1EM8A 1PT7A 1YOVA 5SZIA 5CZ1A 3HB0A 3P27A 1TRKA 2RI6A 3HOSA 1LBQA 3VDQA 4REMA 4IICA 3Q3CA 2P9PB 4FP9A 1NLUA 4C9BA 2O8CA 1XEFA 1NDQA 4WT7A 5BWNA 5EHQA 2IHNA 4HRVA 4BX0A 1TKCA 1SUDA 3UTDA 1XNQB 1JHYA 1SVOA 1L5NA 4YAOA 2BDUA 1MO4A 4BN5A 2WAAA 1AA9A 3HU1A 4DLWA 2OHFA 3GJRA 4DXAA 3VZDA 2PR7A 1KXJA 5EZ6B 5AI6A 3H6HA 1PGOA 1NBWB 4YJ3F 4X6YA 1U6ZA 4HDCA 2HQBA 1XTRA 4I9HA 4UEKA 1BOOA 2H2GA 5AOAA 3T7JA 2GN8A 3K0CA 2FG7C 1OAAA 4BQFA 5LIRA 2C07A 4IF6A 1DIRA 1YJNN 4NICA 2WJZB 1MN6A 2MU1A 3R24A 4J75A 1PGNA 5KHAA 4WQ4C 4MFBA 3S99A 4FDLA 2XECA 5ENZA 3QVOA 1VRTA 2OD7A 4RULA 4MA4A 3QE4A 3S27A 2V45A 3F71A 3Q85A 4EB0A 1UINA 3AHFA 4K8OA 4NH0A 1CUXA 3P0EA 5EJ8A 2C3OA 2ODTX 1WAJA 1USKA 2FX5A 3ZE1B 4ESEA 5IABA 4QULA 1Y4AE 4LHXA 3CEPB 5CHIA 1FF9A 4XFKA 1ZVVA 4EHUA 3KR1A 4QGFA 2OESA 3DZDA 3AKCA 2RGDA 1M2FA 2X86A 5K99A 2IWRA 3ASZA 1FQJA 4AYXA 5ICSA 2G5GX 3K1AB 1F6BA 2ZBEA 5A9TA 5HWSA 3IUBA 2OKGA 1N2CA 4MPDA 3GBTA 3CNHA 4KN6A 3TLGB 4XH1A 4PVDA 5BW8A 1KEEA 2WQ7A 3GV0A 5E7JA 2OCAA 3LP3A 1D4AA 5TF4A 4YRSA 2FJUA 4C0JA 3JALB 4KX3A 3HT3A 3L8MA 1GKLA 1JUDA 4L5CA 4AWBA 3PHGA 4GBGA 1QRUA 3CCFA 4YDSA 3QVXA 4EKIA 3IQDB 3ZDAA 4KN9S 3AUSA 4RV9A 4HADA 3VYSB 4GPTA 1U3CA 1D04A 3KV1A 1VM6A 4BQIA 4DUYB 2K87A 2ACVA 4B1UB 4LYFA 4OP3A 5CX1A 5EXPA 3B52X 3AUJB 3MRXA 4CTKA 1BC5A 3CQXA 4GR4A 4HRXA 1WKBA 3B5JA 2W4IA 3D4PA 2ZSIA 2HUPA 3KL2A 4Y6OA 4ZXFA 2F4VB 1PYGA 3BK2A 5IJWA 4K3VA 4EFMA 1UQTA 3PCRB 1K7FB 1SC3A 4JJZA 1XQWA 2PGNA 4YAGA 1R6DA 1S6QA 4YT5A 4EMTA 5HGJA 4BRCA 2DFKB 4IG0A 2PKYX 3A26A 3KXPA 3UMSA 4RFVA 2BTEA 1FSGA 4XD7A 1GG5A 3GRUA 4H6WA 2JL1A 5K3BA 4W5HA 3ZGYA 1SBYA 1MIHA 2P9QA 1XMQK 1C3EA 3K9KA 1OKJA 3VQ4A 1F6DA 3R6GA 4LK2A 1CDOA 1Z4QA 5DRYA 3MINA 2ZVDA 2VAVA 1PQYA 4AZSA 3WB0A 1R8SA 1YASA 3CPHA 1MLDA 1YKSA 5JISA 4PWYA 3HU3A 4MJXA 1HMPA 2ZTSA 1Y7TA 2PV7A 4M0KA 4YA6A 2WC9A 3KNZA 4HTFA 4ZFNA 2EX3A 1UC8A 1G20A 2PZKA 3CVUA 3HBMA 3T95A 1VQ4N 3BJEA 3BQ9A 5AOCA 3K94A 4WZ6A 3CW2A 2HIAA 3W0LB 3ICOA 2B94A 1U0GA 3HVHA 2HSDA 3C1AA 3DFZA 1L5MA 2HFKA 1XZGA 5KINB 1V5WA 1A4IA 2JDIA 3NWPA 3CR7A 3GFRA 4KTVE 3QHAA 1ZZEA 1GTZA 2ZBVA 3VR6A 4NBWA 4N6OA 5J1EA 3DWIA 1CSEE 3BWYA 1W8IA 5DT2A 4XD7D 4DJFC 2PD6A 1NRJB 1OE0A 2J32A 5JSYA 3AUTA 1GNQA 4HDNA 1OSNA 4AN0A 1CUUA 1S2NA 2ATXA 3BMQA 1FY2A 3FUTA 3CLRC 3FWNA 2CBZA 3B9PA 2O4IA 4CEQA 1JYEA 1G0NA 5AI4A 3AY9A 2IP4A 3PDCA 4MWDA 2QAIA 5SZJA 1ODSA 2A1IA 2NUPB 2AOWA 3HCBA 2J5KA 1MJFA 4Q3KA 4HLNA 3AZQA 1E5QA 2HJRA 3H84A 3WQQA 1ZM2A 5C35A 4KQGA 5JLHA 1P5JA 4J2BA 4JGIA 1BKDR 2LTAA 2QMEA 1V9SA 4YCJA 2WFLB 1FMFA 4F8YA 5JZSA 3OYMA 1RW4A 3CX3A 4RNDB 4ZA2A 2JDID 3PGVA 4MROA 3ZY2A 5DX0A 4I3HA 1GL3A 2BFFB 3VR6D 5JHHB 3MT7A 2ZVPX 2OVFA 2R68A 3PXUA 4TSKA 3P0IA 1WPGA 3V1OA 5HR5A 2EHJA 4NFSA 3ZZMA 5JZOA 1SOMA 3STUA 2QI9C 3LO5A 2HNDA 5H02A 3FYDA 5I47A 4YJ2F 2O8DA 1L1FA 1WLYA 2V03A 3ZY6A 2IZ1A 2DPGA 3INGA 2NVUB 1JH9A 2OENG 2CJWB 2BSXA 4X66K 5B5SA 5LP6B 2A3RA 2AQ8A 1S96A 3PX7A 1UBSB 3VR4H 2YOGA 3MXOA 5EESA 4PZAA 5AVTA 3SC4A 1BHQ1 1JCEA 1V8OA 3AARA 4I55A 1CJSA 3WNEA 1DAEA 1XEWX 3FNHA 5G0UA 4HNTA 3GGGA 5BNZA 5D2CA 3VC3A 3ZQ6A 1X1TA 3T4PA 3T34A 1SC6A 2ZAYA 4WZZA 1CUFA 5KPZA 4PU0A 5AQZA 4CJKA 4JYZA 4CTJA 4NXMB 2CT8A 1FU4A 3IRUA 2G28A 1KAHA 2XXBA 3RREA 2LCFA 4DV7K 4PYRA 4MZDA 2N9UA 4X91A 3I6MA 3V2GA 1XRLA 1T8RA 1Y9JA 4LXYA 2H5EA 3PSIA 1HF3A 5F52A 4QBHA 1XL1A 3GLTA 4CEAA 1QK5A 2NSLA 5LA6A 3B60A 3DL2A 1V26A 4EUSA 3MEQA 3IDSA 3SZRA 4FZZA 1KMHA 1N9GA 1XK7A 4I9LA 4ZYXA 3W5BA 1KZYC 3N2LA 4JLUA 4PQFA 2ZYWX 4QTXA 3PLAE 1L8LA 2VJMB 5JQGB 5I8ZA 4BMVA 2J6BA 3WISA 1N0WA 2PM8A 1T10A 4C5BA 3W8EA 1Q57A 5L3QB 1XDWA 2OLKA 1T9KA 3U6BA 4UPEA 3PPWA 4O8KA 4G0XA 4EIAA 4JDUA 2A5XA 1BA0A 3I01M 1HJOA 1O57A 4CK1A 3QF4B 3UV7A 1N36K 4CCHA 5C7LO 3O1BA 3B9QA 1QBGA 2Y4NA 3IV9A 3TPCA 4XYGA 1YRLA 1MVNA 5AQKA 2XVAA 3R3SA 3HR7A 2FRVA 1ZZGA 2QGZA 2G8KA 3WJ1A 2IUUA 1SRQA 2P2LA 2WWGA 1CZOA 1BDMA 3DZBA 3EFOA 2WAYA 1JLLB 2FV8A 3LWZA 4B8ZA 4RJLA 5L8VA 2R7KA 1NW7A 3U6KA 1M1YA 1M6YA 5F4BA 5FL3A 2VG6A 1TL3A 5JU6A 1MAUA 1YH3A 2RAUA 3R7DA 4AN1A 4IH9A 1CHNA 4NDAA 4JUFA 1AN0A 2YHIA 3IEIA 2PQMA 1SD1A 2Q2VA 2Q6IA 3I6ZA 5ARDA 1UBFA 1I1OA 3UFXA 5KYGA 3M1FA 1UMDA 1GRVA 2BGMA 2X8JA 4NENA 4YRTA 3UW3A 1OH6A 2GTHA 3VF6A 1X1CA 2WD9A 1B2LA 4E2FA 5CYMA 4F86A 5I7FA 3IEXA 2G1KA 2QAGA 1QWOA 4CERA 5IJXA 4P4TA 3I9NA 1U9YA 5I7AA 3RS2A 1PTJA 1TQ6A 2F59A 5TQ2B 1C3JA 1EG7A 2HF9A 3R9WA 1IDOA 2GPYA 4NYIR 4Q7EA 1UBMS 5G41A 3CZAA 1N4DA 4S0ZA 2IOCA 4CODB 5CIYA 5HM6A 1M2NA 4RA6A 3OZCA 2E5FA 3LQYA 5EYPB 1EP2B 1XD2B 1ATRA 4HPXB 1GOBA 4F92B 4EO4A 4PO1A 2BP7B 1J2RA 5IAGA 2ASOA 2EBWA 4Q1BA 1I4TD 4KLCA 3KSUA 3WWEA 2RK3A 1JLEA 4X64K 1DKNA 1BU6O 2H3GX 1YJXA 5JSHA 1G4UR 4CJ4A 2G08A 3BXXA 3WNBA 1NR5A 1NMNA 2VQDA 1Q5PA 3AR2A 3ET5A 1B42A 2CXPA 1N9ZA 2H4JA 1XHFA 1Z8NA 4ZCTA 4P82A 5A2QO 4ZVKA 4B3BA 3Q7IA 3TH5A 2AE1A 4RIEA 1GCUA 3NMUF 3W5DA 2WVHA 3OS1A 1M8PA 1XF9A 4YMWA 5K0LA 4HLUA 2BR4A 5T3UA 1RLTA 2B34A 4UXHA 2QD5A 3D8HA 3UV3A 4C0WA 1RDAA 4N4AA 2NTJA 1N7IA 3QU2A 4JJKA 1OZFA 3AVWA 4BR9A 3M8PA 1FFYA 4JEIA 4CDGA 4B75A 4QXPA 1YUMA 5JXHA 3VR4A 1AN9A 1Q1QA 1YR3A 2XAAA 4JT2A 3CH5A 4LYYA 5CJPA 1J9EA 1JG4A 3K5HA 2CUTA 1P9WA 5GZ6A 2VP2A 4M8SA 1T8TA 4MHSA 2ECOA 4GPZA 2X76A 3MX2A 3NRCA 4EG1A 1U11A 3VU9B 1XWWA 1J06A 2IIPA 1U5AA 4J0DA 3WLOA 4FCYA 2A9QA 2GHTA 5YASA 4RL4A 5JXGA 1NOIA 1HKHA 5CR4A 4PY2A 1SXJB 2PJRA 2X6SA 2B3TA 1P2SA 2ETJA 2C4NA 3W6NA 5BMVF 1PR5A 2EX1A 1ZLXA 3ZXYA 1GUDA 3G17A 1Z4IA 1V6CA 4CCAA 2JI4A 3I37X 2O2CA 3GB9A 4BTLA 3E7PA 2GDJA 3LP6A 2IYYA 4D9GA 3SHFA 1NOKA 1G99A 4ZAZA 3UXMA 4QQ8A 4EB8A 3O2QB 5LCXA 3P5SA 1ZWLA 3DV0B 5EWJA 3PNLA 3OKFA 3T1YK 2ORED 3A9UA 3VR4D 3BD9A 5BPNA 1VL2A 1C9EA 3U1VA 2ZWHA 3DRSA 2C59A 2ASMA 4DUZK 4AY4A 2UXBB 1ZY2A 2BBWA 2IIBA 2R8OA 4ZYLA 1II8B 3HI4A 1S1CA 5A06A 3D2EA 1YL6A 3PC2A 5KSYA 3NYQA 1GNRA 5HTKA 2PWYA 4N0MA 4M1TA 3S4YA 4P35A 4MUKA 5C4MA 4BC1A 2C3UA 1OBFO 1QOQB 4D25A 1K08A 3FZYA 3L1IA 5AKGA 3KB1A 1YR1A 3IELA 3LPLA 4TSXA 3FHCB 5E0OA 4K9NA 3MWDA 3KPWA 4PGHA 1IO2A 5FQOA 4D9FA 1F9EA 3TSCA 2IYXA 2AOXA 3M1YA 4RTJA 4O44A 1NLFA 3KJIA 2QA4N 1C8VB 1THTA 4IFYA 3B38A 2BKVA 4JBIA 3GA5A 4B32A 1ZJYA 3HTXA 2X41A 2VDRB 5DVZA 3DM9B 1TO2E 1C14A 1MFZA 4E3WA 3TQFA 1CUCA 4JT8A 2BFAA 4LNAA 2OHXA 3WLJA 1CJTC 3MUFA 4HUJA 1GQYA 4LF5B 5F5LA 3TMAA 1NGAA 3KAJA 2P41A 1E1LA 1P75A 4EBFA 1JF8A 1BJRE 2BKEA 1H6DA 4RWZA 1RBUA 4ELVA 3RV4A 4X5OA 3DOJA 1ZXXA 5JOQA 2OFFA 2J9GA 4HDQB 5M1KA 1NJ5A 4M36A 5F76A 3KK1A 3OX2A 2QD4A 5AVUA 2OPRA 4JI4B 4UPVA 4CMEA 2Y1FA 4Q3EA 1ND5A 2CVQA 1W5AA 1ULAA 2KMLA 3BDAA 1LWNA 2M98A 3LKBA 1M2WA 4TUYA 2VSOA 2FKAA 3KZCA 4I66A 1T34A 5B8HA 3C97A 1U1DA 2JIPA 3AF4A 3L2QA 1GZ4A 1IHUA 3LA6A 2DQ4A 4E7JA 3H9GA 4LSGA 4GRDA 5BR8K 3WE7A 3O9TA 3TWHA 3CJBA 4CDNA 4MVXA 3A0IX 4MAAA 4HVAA 1K4MA 2N47A 4PLVA 5E84A 1CJKC 4FW2A 4CZJA 4M2LA 1DEXA 5FBRB 2IW1A 3EXFB 5IKXA 1UC5B 5BVGA 3S2GA 3DAHA 4YAUA 4BGDA 3EZ6A 4BE7B 2K7ZA 3NWJA 2VN8A 2EC5A 4LCEA 4LHYA 3AM5A 4P3KA 4L4XA 4QHYA 3FUCA 4GQIA 1JFSA 1QK4A 2WSLA 2PZBA 1CV2A 4O4JA 1ZM3A 4GVMA 4UOQA 4M8LA 3TOSA 1QYXA 3H3JA 3LTNC 1M34A 4HB2A 3P2YA 3KXLA 2CW5A 4Z7JA 4L22A 4OAPA 3ELBA 3N59A 1AUVA 1RCHA 1W76A 1KTIA 5L7TA 3EEOA 2DHDA 1SBQA 1TQHA 1V8BA 2AG5A 4IMIB 1Z26A 4M3ZA 4QYSA 2NQ2C 4PCLA 2AQHA 5CDHA 2ROQA 4MVWA 3H04A 3BMNB 1NBME 2IY9A 3RK4A 2J0SA 1QHSA 2KX7A 3TW6A 5LZ4A 3QWIA 1QQNA 2QE6A 4U2KA 2Q1XA 1VE7A 4NE7A 1BWFO 4A0SA 3OUTA 4Q9NA 2IW3A 1OAOC 5JDIA 3LD9A 5PNTA 2EL7A 3UG7A 3W3DA 4QUKA 4DU1A 1GPWB 3DUFB 1TZBA 2DHEA 1Z9BA 4G24A 1FXSA 1L5QA 1T0IA 4I1SA 2VH1A 2ZPAA 4UNNA 4HFMA 3CZQA 2JJ1A 2KPOA 4FOLA 2RGUA 4H3HB 3KKQA 4JJ4A 4HWTA 4HVCA 2JFQA 2BY4A 2Y4OA 2ODPA 3L0SA 3O3MB 4QFCA 3KSBC 3MK6A 2ZIWB 1YQTA 1G2OA 3MWLA 5E9AA 1VSTA 2P2GA 4B35A 1Y37A 3TK1A 4HDSA 2P2YA 1Y8ZA 2L17A 2NAFA 3SQWA 4M1MA 2W0SA 4UU8A 4ENUA 1K7SN 3BB1A 2GXAA 3BMXA 4Z86A 3M6XA 4J76A 3E9CA 3QENA 4EKGA 1KJ8A 4IDDA 3GJ0A 4BWMA 4OIFA 4E13A 3UMBA 1TT5B 1H4QA 4UJ5A 4UQOA 3E58A 2EJWA 3LOQA 4ZXPA 1PRYA 1E2BA 4M41A 5B2ZA 3RLFA 1XZAA 4CM8B 1QONA 1N8TA 5IH3A 4MTCA 2GWRA 2YS7A 3Q2OA 4TMXA 4YCMA 1A76A 1R0CA 4GO1A 2IBTA 1UM8A 2B4RO 3C8DA 3FUUA 2Q07A 3WGMA 1FMLA 1XP8A 1M6VB 2YYAA 3OM8A 3LYLA 3W2FA 2IYUA 2JJ1D 2O7QA 4WESA 2IXFA 3G5MA 5LY3A 4YQFA 1HE8B 3HB7A 4AJOA 2GYYA 3M4NA 2NOAA 1XKTA 4MMXB 3IL2A 4X20A 2V9ZA 1OY1A 2VF8A 2QNBA 5FBWB 2OB1A 4C8MA 3K0HA 2O2DA 5CU7A 1YZYA 3P2KA 4KHUA 3RANA 5A4IS 3PUXA 2WP8J 1T6DA 3SQ1A 4R98A 4H7FA 3ZJUA 3W7BA 3B1FA 3LRTA 4QEDA 4B6JA 4P4NA 1RJWA 1HZZA 5HTOA 3OVNA 1QE3A 1V25A 5EKTA 1X1BA 2IITA 3EZ9A 3QFHA 2A7QA 1TAHA 4KAZA 2OAP1 3V7UA 3TW8B 3UJAA 4BFYA 3H1VX 4R2MA 4OLJA 2AN5A 4OKKA 3P9IA 2NVOA 4IH4A 1BQNA 2ZBQA 3D3WA 3PDIB 3MSCA 3OF2A 5D86A 1RYDA 4DNOA 1X8JA 3JQPA 4V3CA 5GV8A 4ROTA 2RHJA 3JQGB 1DJLA 4YRLA 4EVRA 4TWRA 2HVHA 1Z4KA 2XUQA 2MSNA 2VHVA 3VNSA 3D1LA 2A6PA 3X2SA 3UMCA 3LCUA 3EGDA 2HADA 2YXEA 5FPMA 3HP7A 2QNIA 1TM2A 1G6OA 3VKVA 3NUQA 3LT4A 3KLGA 4YFYA 1WDTA 3GR6A 3UG6A 1S01A 2PNJA 5ELZA 3SSNA 3I28A 4G0QA 5KWIA 3K5IA 5TEVA 2Y0PA 4FPXA 3TM5A 1FJ2A 1PEYA 4EHHA 1X9JA 1E5DA 4RM2A 4YDUC 1FX0B 1SHUX 2ZCJA 1KC8O 1GOTA 2GV9A 1A9SA 3P96A 2FUG1 4NMHA 1NI4A 1JT2A 3WWCA 4JLSA 1SU4A 4R8MA 2ONKA 3TLKA 3VNUA 3R1IA 1U0EA 1F14A 4QOSA 2Z09A 4G2TA 3JQQA 4EKYA 1CZRA 3UZUA 2D1KA 2ETXA 4JUDX 3ADOA 2DJ5A 3D0QA 5B1SA 1EUZA 4ZRDA 4IHJA 4TV8B 3RS0A 2Q49A 3QE9Y 4IFIA 1P0IA 1T9AA 1SUEA 5A9RA 2II6A 2J4CA 4DR6B 3O4GA 3LLUA 1GGKA 4UTOA 1IBRA 3VQDA 1K9MO 2XGMA 1IU9A 3EQ6A 1EP3B 4PAMA 2OP1A 2XQIA 3MWJA 5J2NA 1LPBB 4I8DA 4X3OA 3BYZA 3RHZA 4IZIA 2G70A 1QGUA 3FFXA 5ICCA 4GBJA 3GG9A 4JYAK 4KN8A 4RDIA 4DV4B 3SJBA 3U7RA 1EJBA 3EY9A 1R8YA 3ESXA 3NEJA 5DCYA 3B13B 1NGBA 3RYIB 2X15A 1ZXBA 1W1WA 4BFLA 1T8PA 3JWGA 3AVUA 2I03A 4G56A 5JCXA 4FYDA 3OUZA 4CF1A 3HFRA 2QL6A 2NT4A 3O1WA 4QA9A 1U5BB 4WL0A 4BGBA 1Q7YO 4MW0A 4MKZA 5HIAA 3DB2A 1HQCA 5EY4A 4DTSA 4WNIA 2HWUA 1B15A 4Y6GB 1XLUA 5TGDA 3BRWA 1W0CA 1X38A 3DBLB 4YS6A 3TVTA 4H0OA 3VQ5A 2ZE2A 3PNKA 5AP9A 1O6FA 3PHLA 3U5ZB 2BE9A 4IDNA 5JSUA 3X0DA 4FM1A 1NXSA 3FZGA 4B9VA 1WLSA 1J23A 1XWLA 3PQ2A 1VTKA 1QG4A 4ASUA 3L7BA 3V2UA 1BGWA 1ULTA 4ZAFA 3V4ZA 2ORIA 3ITKA 2XBMA 5FUWA 1Z5GA 3CLVA 3LIIA 2HNAA 3EPLA 7YASA 5AQNA 1P4JA 1HWYA 3W9UA 2CVPA 1WZEA 1NG9A 5A2QA 3LS2A 1V47A 3D3KA 1D2CA 3DOOA 5IAEA 3H17A 4QS9A 5A4MS 1XZMA 4BAGA 2HRZA 2G82A 4KXUA 1ZJZA 2NNWA 3R5SA 1S2IA 2ILVA 1Z0AA 1UXJA 4MRNA 2G71A 3CZRA 3B82A 3BRWD 5U4XA 3VRHA 1E2FA 2UDPA 1W87A 1XZDA 3T5DA 1DBQA 1GXSA 1J9ZA 1Y9ZA 1M2VA 2ECQA 5CXUA 1SUBA 4JCOA 3EYWA 3QA9A 3O82A 3W2TA 1HDIA 2HCJB 2WWTA 3UK1A 3MGGA 1FJXA 2BFCA 2YYYA 1BS9A 4JK7A 1U7XA 2CB9A 5ICEA 2QKYA 5ALDA 4ASUD 3N2KA 1DKUA 5A4KA 1M1UA 1KOFA 2POQX 2XA1A 1Z2EA 4D3XA 3N8KA 4JR0A 2H4FA 3CUWA 3O5BA 3LVBA 5G1PA 1YS7A 3GLVA 3H4TA 5GMOA 3I58A 4DN6A 5D85A 5LD2B 2ZRFA 5I5EA 5LDHA 4G1MB 3P9XA 3FB1A 3AP3A 5DX8A 4G0UA 1RYNA 1PJRA 4GX0A 3A4MA 2VXYA 2HF3A 5DNYB 3KKEA 2VTKA 4J9VA 3RAEC 5LXTA 1CLUA 4ON9A 1ISRA 2X1VA 3FDIA 3O95A 2O6LA 1QVRA 3WP1B 1TK3A 1C3OB 3QLEA 3KYJB 1EXQA 3BY5A 3D3EA 3CS3A 4EJ0A 4MPRA 1XA4A 1ZWKA 3LZ6A 1Z7YA 1IOWA 3MWFA 1A1VA 3CXRA 2QRNA 3EXIB 1XQ9A 4ZT7A 2G04A 5I7OA 3R0JA 1QG2A 4BRGA 5JJLA 5I51A 3GMSA 4G0WA 3HA3A 2HU5A 4MS1A 5EZQA 2F43A 3HP1A 5GOTA 3VOTA 1ONBA 5JFTA 1FNNA 3L0YA 1SIUA 2H8KA 2VLIA 3D6NB 5DT9A 1FPQA 3CHYA 1K6JA 4IDKA 3GYBA 5ALPA 5A0VA 1YITN 2H57A 4BLPA 2ZIXB 1NW6A 3D2BA 3HSSA 1RPZA 4Y18A 3HMQA 2IOQA 4M0EA 5AQIA 4GU5A 5EIBC 2QD1A 1NJ8A 2O59A 4AJJA 3HV2A 1CBUA 4R5HA 5AVXA 1VQLN 5FI3A 3BSWA 1VP9A 5SYMA 3RS9A 5BV2P 2GT1A 4G0PA 4FKBA 1T8SA 4DC1A 3UY4A 2WWFA 1TQ8A 2FZ4A 2GPWA 1EKXA 3H7AA 3WKAA 1H2ZA 2DX7A 4WJKB 3SIXA 1WS6A 2R62A 3PHJA 1RJFA 3IIEA 1F8GA 2VCHA 5M7EA 3S7ZA 2ZSHA 2A9VA 1HC7A 2J0QA 3RWOA 3QXCA 1G8SA 1QVAA 3G2IA 1JX6A 3NZEA 1XDZA 4H31A 4IKFA 2I8LA 4EP5A 3FTFA 2O8BA 4JKIA 4BO2A 1VSHA 4UMEA 5AWFC 3PDWA 1SAYA 4TYYA 5THQA 4ENWA 3B89A 4J6EA 4H4EA 4PLCA 4N12A 1DRWA 3N7TA 1GAEO 3H0CA 2BHTA 5B64A 4H6VA 1LI4A 3ILHA 1PZXA 3G02A 2RBEA 3OZEA 2C0CA 3KQPA 6GPBA 5A02A 1YCDA 1R6BX 1AUQA 2X40A 4M98A 2R00C 2WSIA 2B4TO 3HYNA 2O7NA 1ILEA 2WP0A 1RXVA 1CVLA 4ZJPA 1DWPA 2PSJA 3K0SA 3OKPA 4FFBA 1KC1A 2ACEA 3L4EA 3AL3A 2XB2A 1PD1A 1W96A 4UCXA 4BVBA 5IZCA 2QTZA 2V6IA 3B70A 1PQPA 3TR6A 4RS3A 2ZUTA 1Z37A 2NXNA 2G1JA 3K20A 2IUTA 4FW1A 3DNFA 1JSCA 2VTBA 4ZZIA 3FGPA 4I99A 5HPYB 3PPIA 1B1AA 5EERA 2WG1A 3HYSA 3QVVA 4JELA 4RU1A 1QE0A 2AFHB 1PUXA 4E7HA 5K8CA 5JEDA 4RXUA 3A1WA 2XMDA 3ISTA 1GQSA 1Q1EA 4N54A 3WXMA 3VNVA 2CV2A 5TJHA 2A14A 1S1XA 4ZI3A 4HDKA 3AR9A 4RH3A 1WP4A 4R2HA 4KQ1A 2YJGA 6Q21A 5IT4A 4PLWA 3A1FA 2P2DA 5G40A 3ZWCA 4NJEB 3QXXA 4JSTA 3TKAA 2NUAA 1JQ3A 3QBTA 1RBMA 1DT5A 1T6XA 3SY8A 4WCFA 2LCQA 3SQNA 4BNMA 4YR9A 1W49A 3LT2A 3VQPA 2H00A 2XZOA 4LJ5A 4JV5K 4HN9A 4V0ME 1WNSA 3N87A 1DUSA 4MP3A 2A94A 5CFNA 3D4IA 5CEJA 3AJEA 4QG3A 1Z74A 3I04A 4ONEA 2PT6A 2C9BA 3D2LA 2ZUDA 2HM7A 1RCTE 1JKFA 2VP6A 3TEFA 2A0KA 1Q14A 3VO8A 4D4KA 1ASVA 1BVHA 3TGWA 5E4YA 3PICA 3N58A 2IL1A 4EY8A 5I7VA 2FZKA 4XDGA 5E6RB 5E1DA 5DLQC 2R8ZA 4X8OA 1VSKA 5JNUA 5CDTA 3EC2A 1FNSA 3NDRA 2YWDA 4X6XA 3INNA 3LUKA 4B45A 2AOTA 4DT1B 1M2OA 1NKSA 5KWSA 3WGUA 4U2BA 4B7AA 3QRWA 1CF2O 3RGGA 3CJTA 1U7WA 3IKMB 4MULA 3M6FA 4EPRA 3IFRA 1T7PA 2CDCA 4G1QA 1Z0IA 1VQKN 3M82A 4QUEA 4I46A