4IEEA

Crystal structure of the large terminase subunit gp2 of bacterial virus sf6 complexed with atp-r-s
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
463
structure length
452
Chain Sequence
b'INPIFEPFIEAHRYKVAKGGRGSGKSWAIARLLVEAARRQPVRILCARELQNSISDSVIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGIDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQANVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTKVEMKQKLGIPSPNLADALMMCMHCPALVREETEIYVPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gene 2 protein
publication title Structures of the phage Sf6 large terminase provide new insights into DNA translocation and cleavage.
pubmed doi rcsb
source organism Shigella phage sf6
molecule tags Viral protein
total genus 161
structure length 452
sequence length 463
ec nomenclature
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04466 Terminase_3 Phage terminase large subunit
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4ieeA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ieeA01
1CXZA 1PJRA 4M0LA 1E6CA 2EWWA 4PQFA 1LS1A 2IHBA 1DG1G 5G3ZA 4V0ME 3ADKA 4C0HA 2ZTSA 4UKDA 1U8YA 3QKUA 2AWNA 5C46F 1ZD8A 3KJGA 1KO8A 2O8BB 2YWHA 3BFVA 2JJ1D 4B2PA 3OE7D 3FKQA 4NBSA 4DT1B 2RCNA 3DPUA 4C7OB 3A1WA 4LJ9A 3EPLA 1PZNA 2I4IA 1LTQA 3LW7A 3GJ7A 4FCWA 2J7PD 5CYPA 3KKMA 2FE4A 1CJMA 1YZTA 4S2EA 1ZC4A 3OIUA 2BVNA 4N3NA 3NEJA 1MH1A 2ODWA 4Q9JA 4Q01A 1HEIA 1NLZA 1XX6A 3U7HB 4ZI3A 2NO9A 1OHHD 3BGWA 3ETLA 3IQWA 2V9PA 1E69A 2EFEB 4V0LA 4GDFA 1NG1A 4A36A 1KZGB 2PMDA 2V55B 1K8RA 1RYHA 1TEVA 1W0KD 3EW9A 4G01B 4O2LA 2IWRA 5J4VA 1N5LA 3A37A 3QPWA 5AJZA 4B6FA 4I4LA 2X2FA 1AS3A 4V0MA 4DEXA 4S35A 1ZRHA 4DSUA 6Q21A 1U90A 3EAQA 5D3QA 4EFNA 3CUEF 4C2UA 2RGEA 2ZETA 5J5CA 2QY9A 4EPXA 2J0QA 3M1IA 4RZ2A 5GADl 1MO4A 4C0KA 2FJUA 2OESA 2O0KA 3N5CA 2HJGA 5M1KA 1YRAA 5F98A 3EX7C 4ESVA 2ZI4A 1F2UB 5EXSA 4RD6A 1T6NA 5CJPA 4MQBA 3AF0A 3GJ5A 3RS3A 2FG5A 2Q0HA 3QJYA 4UNPA 4JIMA 4YLGA 2BBOA 1DE0A 1XPOA 1AGRA 5EE1A 4MDEA 5AUQA 2P65A 3SZRA 1KJWA 4TLDA 3VR3A 2VF7A 5JS8A 3Q3JB 4OI1A 2OILA 4BWYA 1G8PA 3TAUA 4DCTA 4F4JA 1XEXB 4B47A 3X1WA 3FPAA 1KDPA 2E9SA 1JNYA 3A1SA 3QBVA 3VR6A 3LVQE 4NONA 3K1JA 3VR4A 1XBTA 4JLJA 3AP1A 4QHSA 2EFHB 2JIZA 4EQ6B 1XZQA 1X3SA 3QG1A 1BKDR 2UZ3A 1Q57A 5M1OA 3D6TB 1LF5A 1F48A 2ZYUX 3OEEA 2CLSA 3UXMA 2PMKA 3JZAA 4TLCA 4BRWA 1IONA 1QHHA 4GRAA 3U6KA 4MGKR 2PT7A 4HLUC 1CTQA 1PLKA 2FFQA 4IVPA 3LRPA 3T1TA 1XCPA 3TW8B 5JSZA 3QF4B 5IK2A 4OKSA 1HYQA 1W2HA 4KXFB 2ZRBA 3GMTA 4WXRA 1AQYA 1ZINA 3RRNA 3TSOA 1Z28A 1R7RA 4CEIB 2WAYA 1K5DA 1GL9B 4LBYA 2ZRCA 2DB3A 2CMKA 4FW9A 3K0CA 4IEEA 4KSBA 4JBXA 3AGQA 4O0MA 2HEIA 3KXIA 4YQFA 5TXGA 1W1WA 4BFSA 4NCIA 1UEJA 3B1XA 1XRJA 1GUAA 3EASA 4ZV4A 1LNZA 1ZUNB 2CVFA 2ZJYA 1FZQA 1P2SA 2O0JA 3IILA 1R8SA 1N6OA 2JJ2A 2H18A 4L4UA 1AS0A 1IM2A 1F6BA 3KTAA 2IF0A 2JLSA 2O8EA 3KKOA 3QXXA 4FI3C 4QC2A 2ZR0A 2ZVQX 3B9QA 3LD9A 2AX4A 4Q4JB 1H8EA 4BFYA 4QGFA 2IF2A 3GLGA 4MYHA 2AXNA 4OL0A 4TYWA 5HKKA 2J0UA 2RGDA 1U8AA 2VHTA 3GLHE 4HAXA 4R98A 1G5TA 2WMOB 3UWKA 3U61B 2GAAA 2HUPA 2XGJA 2CL7X 3L82B 1FP6A 1S0UA 3BD9A 3DZDA 2JLRA 3U7FB 1OFUX 4L9WA 3TVDA 3K0EA 2VSOA 4A4DA 2VYFA 1VG9B 3U7EB 4DKXA 4DWJA 3RS7A 4HAYA 3I8SA 2G9NA 3W90A 2WJHA 2G0TA 2YC4C 2C77A 4EPVA 2C78A 4PZYA 3WP1B 3SNHA 5KTYA 1ZW6A 2OXCA 3L8YA 1KK1A 3T5DA 2LKDA 2QAGC 3EZ2A 2VP6A 3T06B 2QBYA 1XXHE 2GCOA 3GEEA 2B7CA 1QF9A 4RD4A 1RKBA 1CR2A 1YJ5A 1G3RA 2C9OA 2ZSAA 3O8DA 5EE0A 1GKUB 1XD9A 1DELA 5FFMA 3TVTA 821PA 1S8FA 5CYOA 2F1RA 1OIWA 4ZDJA 3WNBA 1KSHA 4LBVA 1Z0AA 4DLUA 3K53A 2GZHA 4XH9B 2ZRHA 4B2IA 2ZRLA 2E87A 3HJNA 2IA5A 2E1RA 3GLHA 1VMAA 3U4QA 1NJGA 2HF8A 3RSOA 2ZROA 1XD2A 3RDPA 4PANA 3QUSA 4ZPXA 3IKJA 4K81B 3WYGA 1QG4A 1HTWA 4DUGA 4D26A 3FKSA 4H9GA 1Z29A 2OV2A 3K9LA 1GM5A 1J7KA 2OSBA 3AF4A 4X8LA 5FTMA 4DEYA 1W36B 2VHQA 3AH8A 4MUBA 4NE2A 4TYPA 5GJVC 2H8KA 5JSZB 4MITA 3VAAA 3ZZTA 1YZKA 3R9XA 3U3OA 5G40A 4HLDA 3C5HA 4PAQA 5TMPA 1XXHA 1N6NA 3NH9A 3NKVA 3CRQA 1VHTA 3BH6A 1Z0FA 2Y8EA 4JVSB 3RAPR 1GL7A 3NC1C 2XB2A 5CK4A 1BIFA 5JEDA 1N6PA 3B13B 2IYRA 4QXAA 2QA5A 3DHWC 5LB4A 1G7SA 3LQQA 4JVMA 3IO5A 3OEHA 1LY1A 3TUZC 4LYAA 1MO3A 2C99A 2IHYA 3KTAB 3CF0A 3K70C 1YZNA 3B6EA 4JLAA 2GXAA 1RFLA 2G6BA 3NBZC 4LX0A 3ZIAA 5JMTA 2GILA 3BORA 3K9GA 1XD8A 3KQKA 1E9DA 3HYTA 2IEZA 3EZFA 5IF9A 5K8UA 4EDHA 2J46A 2DHRA 2QMEA 2ZUCA 1G9XA 1Z5ZA 5AJWA 3LH5A 1DO0A 4JVLA 2J0VA 2RGBA 3A36A 3LVRE 3QXHA 4QBHA 1UJ2A 4PX9A 4CEJA 2FU5C 1UPTA 2DPXA 5M1QA 1L4UA 4PXAA 1NLFA 1E1RA 4A2PA 3H2YA 4JJZA 2BEKA 2R6GA 4TLAA 3GPLA 4C0LA 3SBEA 4TL8A 3AVXA 2OUKA 4BLOA 1HQYE 4AD8A 3MAAC 1T91A 1E2MA 2A5FA 2C95A 4WW0A 3KJHA 1OJLA 4Q1EA 4GOKA 1NIPA 4BLRA 1HA3A 4C2TA 4JT2A 1KAGA 5HZKA 1Z07A 2RHDA 3ND8A 1F3OA 2GCOB 3UPUA 4TMTA 1AK2A 2ZR9A 3AKCA 5EE5B 4W5HA 2OCBA 4DDTA 1DADA 4NU0A 3JVVA 4Q4HA 3PEVA 4JL5A 3VR2A 4A92A 2NMVA 3C4JA 3SFZA 4Y0VA 2CE2X 2FWRA 2WWFA 3NG1A 1R10A 2PCJA 2ZUBA 3HR8A 4JSYA 4IFBA 3VTKA 2XTZA 4QNMA 1XD2B 3L43A 3LBNA 1N25A 2FMXA 2ONKA 4XTRA 4D81A 3PFIA 1XTKA 2H5EA 5TB5A 2VRWA 4AYXA 2FPLA 2Q3HA 2JDID 1E9SA 4A0GA 4OI4A 4PTLA 1EFRD 4MYCA 3HP1A 1E1QA 1OPXA 3SOPA 1DAHA 3R7WA 4ZIRA 2B21A 1FOEB 3Q85A 5DI9A 3UMFA 3MUFA 5H70A 2BJWA 3NXSA 1J90A 1XXHB 3IHLA 3KJIA 2IUSA 2QGZA 2XITA 1RYFA 5FL7A 4TMZA 4PPFA 4QG7A 4QKQA 3TK1A 4EJSA 4DLZA 3GQBA 4BE7B 1OXTA 4ZCIA 1VYVA 1KDOA 4HLCA 4I1UA 4LCBA 3EPKA 2FV8A 2WJJA 3IEVA 2CLDX 2QP4A 2VSXA 3D31A 121PA 5EUMA 2BMEA 3BJIC 5G3YA 5J47A 2X8AA 5IRCD 2J45A 3MWJA 4NCKA 1KAOA 5CM9C 1N5JA 2WSSA 4P4SA 5E7IA 4AK9A 2Z5FA 1L7VC 5BQ5A 1N6KA 4M4SA 3ZQJA 3NBFA 2QE7A 1TF7A 4G5SA 4A0HA 4DVGA 4CEJB 1IN8A 1NSTA 2JCSA 4LV6A 1R8QA 2W6IA 2D3WA 3M4YA 4RKFA 3FTQA 5ELXA 4B3DA 4D82A 1P4SA 3QXSA 5C1BA 3AUYA 1TPZA 1E2PA 1AIPA 1YVDA 1Z6AA 3OAAD 4PC3A 3SJCA 5DISB 1SXJC 2VP5A 4BLTA 3F5FA 1E79D 3SE0A 4M1WA 3RWMB 3CM0A 3TR5A 2JLVA 3T35A 2O52A 4Q4HB 2XNDA 1CS4C 4HUQA 3CNNA 3CIOA 4JL6A 5JJLA 2IYWA 2NIPA 2NO6A 2YWEA 4DRZA 2FEOA 2O0HA 4XWOA 3C15C 2IYYA 1P60A 4ZDIA 1SKQA 1VCNA 1CLUA 4M1MA 4Q1DA 3UKDA 2JLWA 1QVAA 1NMZA 4Z8YA 2GZAA 3IDQA 5EUQB 2IS6A 1ZYUA 4IDOA 2MSCB 4R7ZA 4RJLA 5C10A 3O8BA 4NH0A 4DB2A 1IJEA 1H8HD 5TV2A 1N0WA 2J87A 4EAQA 1S4QA 1JR3A 1OE0A 1OFHA 2J59A 2R8RA 2ZRPA 3HPQA 4XTCS 3LV8A 5B2ZA 2FEMA 3QE0A 3VX4A 1T3HA 1GAJA 3RRYA 1QHIA 2PLFA 3R7WB 2PX3A 2ZJZA 4ZIRB 1SVMA 1UAAA 2J7KA 1VG0B 5JWHA 5FUWA 3A4MA 4JBYA 2WWXA 3UG7A 5AK0A 3CX7A 1I4DD 2JEOA 3TUIC 4RD0A 4FMBB 3BAFA 1IY2A 1QHGA 4GSYA 5A0FA 2NZ8A 2BKUA 4HUTA 4BPBA 2AN9A 3I92A 1XTQA 4AI6A 1XEWY 3NIBA 1T0JB 2RGCA 5AJVB 2PH1A 2JLYA 2PEYA 2BMDA 3U5ZB 2GRJA 5KHOC 1WMSA 3W8RA 2IS4A 4PO1A 2ODEA 3IO3A 2DYKA 3CX6A 5E4FA 1AJEA 2W2XA 4HB3A 2BIFA 3P1JA 3TMKA 1G291 4I1VA 3EXAA 3EWAA 4M1SA 3TRFA 2R9VA 2WPDA 4P4SB 4B3GA 3D3QA 5CK5A 3TSZA 1HURA 3WNCA 4K8OA 1OLOA 4CDGA 3SHFA 1OH8A 3SYKA 4CT4B 1TTTA 4BLQA 1Q20A 2B8TA 2ZRNA 4AKEA 3IGFA 4PR0A 2IXFA 1J8MF 1VTKA 5A5GA 3ZDQA 1RIFA 1HY3A 3L2OB 1W46A 4PHFA 4ZDKA 2YZ2A 2GZDA 3O8CA 2GTPA 1US8A 4G1UC 1M7HA 3ZGXA 5E95A 2C9YA 1G8YA 2VSFA 1S1MA 3L0PA 3P32A 1NN1A 2ZQ5A 2W6JA 3ZJYA 3UANA 4KFSA 1ODFA 1U81A 4Z51A 4EPRA 1SHZA 1P9WA 4G3XA 4PSKA 2IYZA 1OSNA 3SN6A 3TGPA 3K0AA 5EP2A 5GJWC 3AF3A 4E22A 1GZSA 1E2QA 4TL6A 2WJYA 3H4MA 4MGZR 1G3UA 3AP3A 5DHFA 3TH5A 4HUQB 2KBEA 4ILEA 4PC6A 2JA1A 3BB1A 2ZJ8A 2OG2A 5JCZA 1HE8B 3EIEA 1DAFA 2VHCA 4KBFA 2Z83A 4DT1A 1E99A 3UK6A 2ZRIA 1WDTA 4C7OA 1ETUA 1TF2A 1XFAA 3BERA 3U3KA 2I1VB 1G4UR 1U8ZA 2EFGA 3RRMA 1DEKA 1Z0JA 4MRNA 4PPNA 3T61A 1S2MA 2P6UA 2N1BA 2YINC 2BJVA 3EIQA 5EP1A 2P0EA 4QOSA 1KI9A 1W4RA 4IVQA 3ICQB 5KSPA 3NDPA 3AEZA 4ZCLA 4YMUA 2JJ1A 3IUYA 5F3WB 3OE7A 3ASYA 1JAHA 2D7DA 3RNLA 1NMXA 4QJ5A 1XDBA 1I4LD 2JJ8A 3IIMA 3X1DA 4YONB 4YMTA 5HE9A 1L8QA 1CJKC 4LHWA 4NYJR 3BOSA 1GFIA 1UBFA 3KQLA 1LVGA 2GDJA 1E2IA 3QENA 2GJAA 3GCGA 4TYYA 4M2LA 2DWQA 1MO5A 3I32A 3BB3A 2OBMA 4LJYA 3T1QA 3VR5A 3WBKA 2QMOA 1BS1A 2QI9C 3SC3A 2FSHA 1AA9A 3ZS8A 3W6NA 2IT1A 2IXGA 1NP6A 3GFTA 3SJBA 2IYUA 1IJFA 1EFTA 1IXZA 1V5WA 3CF2A 521PA 5CB6A 3QVVA 2ZRDA 4PZLA 5EE9A 2WV9A 4PZZA 2DCUA 3GLFE 2WICA 1HQCA 3I72A 5HCNA 4JZKA 4JSTA 1K6MA 2OLJA 3EZ7A 1W0JD 4GPTA 1US8B 1XMJA 2FNAA 2XZLA 1E2DA 1KK2A 2IYQA 1XJ0A 2YVUA 2ZRFA 1PUIA 4G5RA 3K9HA 4TTPA 1EX7A 4A0RA 5C2JB 3ZD7A 1ZU4A 2CVHA 4B34A 4Q1BA 2ZS8A 5JJKA 2HLDA 4I81A 1ZD9A 1NVXQ 3B5JA 3O47A 4EQ6A 2N46A 3VR1A 4AG5A 5EXTA 3KDSE 4MRVA 5BWMA 4UXHA 3R9IA 4A8JC 3QPVA 2GBLC 1SZPA 4OQXA 3QEOA 4WXPA 5M1PA 1YZLA 2OFWA 3A6PC 4JJKA 2ZS7A 1HT2E 3KFVA 2FFAA 5FBRB 2HDNB 2ZYWX 1I2MA 3SFVA 4B3FX 4G5GA 2ZYTX 2ATXA 2XSZD 4X8MA 3QF4A 1NVUQ 1PVOA 4Q1CA 1VG8A 2WOJA 4CEIA 1TAGA 3QKSA 3QOFA 2IL1A 1TU4A 1ZIOA 2GBLA 3PR1A 4LI0A 5G53C 4YXWD 2QP9X 1FX0B 3WRYC 4Q4AB 4OI0A 1DAEA 1OKKA 2P2LA 4QNRA 4DCUA 2XXAA 1XMSA 2CHGA 4FMCB 1CULC 2H17A 1GDDA 3N2IA 1KSFX 1S96A 2A5GA 1TADA 2Q3MA 4KCGA 4PAOA 3MMPA 1G19A 4R9UC 3SDZA 3PEYA 3I62A 2C96A 3QPUA 2C8VA 4MKIA 2ZJOA 1NBMD 4H1VA 4LHXA 2ZAMA 1KTVA 2QM8A 2I3BA 2V3CC 1YR9A 2FFBA 1G1MA 1E4YA 1Z6XA 2QQ0A 3M6AA 3PEUA 4IXNA 3LY5A 1XZPA 1E9AA 3P26A 3J81k 4Q4JA 2EVWX 1IXSB 5FH9A 4LHVA 1FP7A 4DJTA 4Q7KA 4IDNA 1ZM9A 2GWHA 1R0WA 4XJXA 5DI3A 4HAUA 2MSDB 3PJRA 3MWKA 4DLWA 2BBTA 3AVUA 3SS8A 2PZFA 1W2GA 3DO6A 4LBWA 2FSIA 1VKJA 2UKDA 4JLVA 2R6AA 1CEEA 4A9AA 4IVRA 1Z0IA 1ZBDA 1CR0A 1EG7A 1II0A 1V43A 2OM2A 2QGNA 2ZRMA 4RKEA 4YMSA 3T5GA 4C0JA 2NO1A 1GWNA 3DVLA 1GTVA 1FMJA 2J9RA 1M7BA 2PL3A 3KL4A 3AGPA 4KAXA 4L5BA 4W9MC 2G1KA 1R2QA 1NRJB 4ASUD 3REFA 1BO6A 3FFBA 1MOZA 3K9NA 1HUQA 4URUR 5EZ6B 4EIWA 3DOFA 4TMXA 4BLPA 1CR4A 2REBA 3KB2A 3VX3A 4DLTA 3UWOA 4OHYA 4DCNA 1E9RA 2OT3B 2LCFA 2AD1A 2DR3A 1T0HB 1ESNA 1E2JA 2OCAA 1N5IA 3GJ4A 4ABYA 1E9EA 1P2VA 3ZVLA 2ZVPX 4IXMA 4HDQB 4C0SA 1DS6A 1YR8A 4Z1MA 1BYUA 1KNQA 5DE3A 5IT5A 4FXPA 4NYMQ 2R6CA 4E07A 3TKLA 3PVSA 5DN6A 4Q00A 2CXXA 2OFXA 5L3RA 4NPHA 1E2NA 2VO1A 2BM0A 1S1CA 4UQOA 5FOSA 3CR7A 2GETA 4XWAA 1YU9A 5M04A 3GLFB 4W5JA 2ZI3A 2Z43A 2TMKA 3PITA 3WMFA 4A8JB 3QKSB 2QTHA 2EQBA 2CLCX 1MKYA 1WE2A 1Y63A 2FF7A 3JVUA 1GL6A 1I4TD 2XXAB 2V4ZA 2CHQA 3MWLA 2X77A 4HLUA 2D4HA 4TQUS 2UVQA 1QHSA 2VLIA 2GF0A 5JZVA 5F9FA 4B32A 1SULA 4MKGA 4LJ6A 1FW6A 4HDCA 2VA8A 4EPTA 2OCYC 4L9SA 3AUXA 4NYIR 4BFWA 4QJ3A 2SHKA 4LJAA 4OQFA 3FYHA 3C5CA 3AP2A 4RD1A 1VCOA 3E1SA 4M1OA 4DBLC 2MMGA 4PC1A 3RSLA 3FB4A 1ZP6A 4LWZA 1RVDA 3WMEA 1NSFA 4BZQA 3L8ZA 5EZ5A 4A2WA 5EJEA 5JI2E 1QZXA 3CKLA 1MR3F 3AM1A 2GESA 1WP9A 3AKYA 3QNUA 1G3MA 5DI3B 1VIYA 4G0NA 5HTKA 4XSGA 3B78A 3LLMA 3TQFA 5C18A 1XU4A 2C04A 3N70A 4V02A 2XJ4A 3AQ4A 2EYQA 2OCPA 3BE4A 3FDIA 2JLQA 1UDXA 1X86B 2IS2A 1XPUA 2GJ9A 1JQJC 3IIKA 4II7A 5HPYB 1D8TA 3QSYA 3RS4A 4FCVA 1KO5A 1SVOA 1SVSA 3A1VA 1OH6A 3KKNA 2PZEA 5FR1A 1Z63A 3B8HA 4GZMA 3L0SA 3FE2A 1F5NA 3PCRB 2ATVA 4XOIA 4OJKA 4XIGS 3V4FA 2WAXA 5J4YA 3OHMA 4TN1A 2XZOA 5FR2A 3NWJA 1N0VC 1E94E 2GKSA 4B44A 3PG5A 3O8RA 1FQKA 1XCMA 2XOKA 3B82A 3FVQA 2R2AA 2XNSA 4TSFA 1E3MA 4Q47A 2JIZD 2YYZA 3NHAA 3A1TA 2CL0X 1KGDA 2ZJ5A 1J8YF 1WBDA 3BB4A 3GJ8A 421PA 2HYDA 4CZ2A 2QAGA 4BFXA 1KZ7B 3GEIA 2Q3FA 2ODBA 5AJYA 2F9MA 5KUTA 3OEED 3QY0A 5DGXA 3KQNA 4LK2A 4M22A 2YNMA 1NF3A 4JKYA 2FZLA 2GVZC 4BZPA 2P6NA 5C4MA 1MRNA 3DM5A 3H84A 3HU1A 3HYRA 4Q9HA 2NPFA 1W36D 5IK2D 2AWOA 2IWHA 4Q48A 4EUNA 2RGAA 4NL4H 2DY1A 4B43A 4LBZA 4IDQA 5EQTA 1KSJA 4LPKA 2IC5A 3EC1A 1RW4A 1VIAA 3EG5A 1N6LA 3MCAA 4KYUA 4DUGD 3KUDA 1NN5A 4JLKA 3KZ1E 5HCIA 1VYTA 3B1ZA 2R6DA 5JECA 2X2EA 2IXEA 2IX3A 4FWTA 2EYUA 1ZJ6A 2CK3D 1JI0A 2JDIA 2ZR7A 4Q7LA 1G20E 4OK3A 1X1RA 4B75A 2ORVA 3VKWA 2OAQ1 4GOJA 2QRNA 1XTSA 2BCJQ 4GMXA 5HR5A 3KQHA 1Z6GA 1IY0A 1E2KA 4DDWA 5P21A 1GNRA 2C2HA 2JJ2D 3SYNA 5CIWA 3QKRB 4TYNA 1P9RA 3PIRA 2XJ9A 1D5CA 3K09C 3ZZUA 3UMRA 1IN4A 1PV4A 4A15A 5FTKA 5DLQC 1H8ED 4BFUA 4Y0AA 2P67A 3GJXC 3VKGA 1IN5A 1AZSC 4M9SA 3WNDA 3ZLJA 2GK7A 1G6HA 5L3VA 1GNQA 2NTYC 3RS0A 3ADDA 1Z0DA 4C4PA 3CZQA 3THWB 3OZXA 1FFHA 1TUEA 1W5SA 3Q7QA 1Q22A 1NKTA 2QU8A 1D2EA 4KLZA 2OLKA 1A2BA 2DWOA 2A3RA 4Q9KA 5CLLA 2WBLC 4US0R 2FX3A 4NMMA 1P5ZB 4WOPA 5L3SB 2PCLA 1AZTA 4OQLA 1R0ZA 4LHZA 3EIHA 5E7JA 5AUNB 1OB2A 3TAHA 2YWFA 3CX8A 4MH0R 5FBWB 1LB1B 3CH5A 5BN4A 3ONWA 2CE7A 4XVQA 1G6OA 1YRBA 4HDOB 5JS7A 5DYIA 2VQSA 5CITA 5JCPA 2EFDB 4TZ0A 1CF4A 3CWQA 4ERNA 2K5UA 3A58B 3C14C 2FDCA 2W0MA 4JMPA 1OT3A 3NHBA 1OXSC 4WVFA 1U98A 3U6BA 2VF8A 3NBXX 4GNKA 2A7QA 2V7QA 3GFOA 1Z83A 3AF1A 3NBYC 4NDZA 4D4KA 1P61B 4LYFA 1M2OB 5LD2C 1XMVA 3A1UA 1Z3IX 4B73A 2IBMA 2XX3A 4M53A 1QBKC 2JGNA 2GCPA 5SZIA 2QAGB 1G7RA 4Q7JB 1N6IA 3TSWA 3PUWA 4XD7D 1ZM3A 5GVRA 1CRPA 1T5LA 3B60A 1E2HA 4AY2A 1GSIA 2VHJA 1G7TA 2A9KA 3DL0A 4IOJA 1T5IA 1VCMA 3QG5A 1GNPA 2ZU0C 1KI3A 2P5TB 3MJHA 2JLZA 5JLJA 1Z6YA 2I1QA 1GKYA 1ZUIA 3BFKA 3T34A 1KK3A 1UM8A 1JB1A 1ZNXA 1HE1C 3I5XA 2XAUA 5KOYA 1E9CA 3W3AA 4DXAA 3ZVNA 1DTSA 1OV4A 2FSFA 5CIQA 5HZHA 1NVVR 4L15A 2Q9BA 3D7MA 2VTKA 1JAIA 4EPYA 2CL6X 2GA8A 2Z4RA 1FUUA 4JYCA 2F43A 1LV7A 2ZE6A 4UJ3A 1ZCAA 1SGWA 3BH0A 1WRBA 4I99A 4KODA 5GJCA 2VIIA 1RZ3A 4EFMA 4MYUA 5FPTA 2YHSA 1ZM7A 3PUZA 2O8DA 3TUJC 4PPQA 2ZANA 4Q21A 3K0FB 1EFHA 3OEHD 3ZVMA 4QGHA 5BN3A 1E0KA 1BMFA 3CR8A 5J4HA 3F8TA 4ESHA 2Z0MA 2VP4A 2QP3A 3V00A 1DBSA 1KNXA 1P2TA 2CCKA 1R5BA 4G5QA 3F3YA 4JS0A 1KI1A 1UADA 1G41A 3AVYA 3PEWA 1KMQA 1KOFA 2OBNA 3B7GA 2QTVB 3DEFA 1R6BX 3CBQA 1SXJE 3IEUA 4AYWA 1XTRA 3K70B 1NL3A 1E2LA 3KXKA 3OFNA 2IEYA 4PQRA 1OH5A 1DAIA 1P75A 1E1RD 2IYSA 2OXRA 1QHNA 1KYIA 1O3YA 2F3RA 3HU3A 2BBWA 1GVNB 2IYXA 5FBQB 1X8LA 4HAWA 1P6XA 3Q9LA 4RSGA 1E96A 4JBWA 2CCJA 2EW1A 4P31A 5BXQC 2DWPA 4U5XA 5E7MA 3LW8A 3GJ0A 3SU8A 1ZD1A 2C03A 3TBKA 2RGNC 4YMWA 3C6AA 2PZGA 2WKQA 3LXXA 4HB0A 4BFVA 4QBFA 3DKPA 1KJZA 4AC9A 2G83A 4BGDA 4IJMA 2ZEJA 3CONA 4EPWA 3L0IB 2B8WA 3TNFA 1G8FA 1NIJA 5LDDC 2FPMA 1P7CA 4ARZA 3X1YA 1II8A 1TF5A 2GJKA 2ZE5A 3HDTA 1U9IC 5J4KA 1FPMA 4CT5A 1WQ1R 1YE8A 4F91B 4PO9A 4NCJA 2YOFA 3B85A 4M9ZA 1KY2A 1OYYA 1SXJA 4XVRA 3QIAA 5GJBA 4D6PA 3THYA 1W47A 4TQAA 3IQXA 5FPHA 1YZGA 5ANRB 2D74A 4A6XA 4MRPA 5CJ2A 1JEDA 2ANBA 5B58C 5FUXA 1X8KA 1OXXK 1P73A 2JATA 1Q1QA 3OF5A 5LD2B 1E1QD 4YDHB 2YKGA 4FMCF 3V9PA 5FOTA 1YHNA 1R0YA 2YOHA 4NCHA 1Z06A 4DCSA 1L4YA 2F43B 2FA9A 2H16A 3Q5EA 4WBSA 3VU9B 5FL7D 3DDCA 1M8PA 1IY1A 2GHIA 5F9HA 4JLDA 3LNCA 3PUVA 4DLRA 4JLOA 4L16A 4WIAA 2ZREA 1SVKA 1X6VA 4OK6A 4RD2A 3W34A 4AG6A 4BECA 3SQWA 2O8DB 1COWA 3P27A 2QMUA 2WJVA 5EP4A 3SJAA 4IFEA 1NNEA 4NYIQ 4TT3A 1FQJA 2HCJB 1E0AA 5JEEA 3LWNA 1NI3A 1N3BA 2WSSD 4ZI2A 1MABA 3RLFA 3CH4B 4A2QA 2J3EA 2A30A 2QQEA 3QBTA 2OZEA 2QE7D 2ZJAA 4RZ3A 4N0EA 2RGXA 5KNBA 1JPNA 1TQDA 2W6ID 5JI3E 4RY2A 3FWYA 1PUJA 4H1UA 4L8GA 2LWIA 1Q0UA 2P3SA 1U0JA 3NTUA 3JZMA 2VP2A 2QSYA 3MJRA 4Q18A 4CEHA 4OBEA 4D4JA 1CR1A 5JHHB 3OIVA 3GEHA 1YZUA 1IAQA 2AK2A 3BFXA 3KX2A 3D8BA 3IIJA 3M0EA 3RS2A 4Q19A 1A2KC 4C3ZA 3TLXA 4QJ4A 2HJVA 3G5UA 4UJ5A 4DLSA 1RC8A 4WA7A 1W0JA 4MYTA 4E03A 1NG9A 2RHMA 2UZIR 2YWGA 4Q5IA 3CLVA 2P6RA 4DIEA 3WHKA 3FGNA 4CGZA 1ZMXA 2XNDD 4ARZB 4F4IA 1II8B 4JVNA 1SVLA 2OFOA 1N6RA 4FD2A 2CCGA 2PBRA 3X1XA 1DO2A 1GRNA 4KFRA 4URWR 3CWZA 4ZO4A 4XWKA 3RABA 2XTMA 2H92A 1D2MA 1NBME 1SXJB 2QROA 5B57C 3THYB 5AUPB 1X8JA 3WP0A 1WA5A 1Q1BA 1FX0A 1PLLA 4Q4AA 4B2LA 1FUKA 3LFUA 1ZNWA 4E5UA 3QVUA 2ZRJA 1JR3D 1Y3AA 4TLEA 5FBVB 2GK6A 3WYAA 2XSZA 2NOAA 3CRVA 1OIXA 3VMFA 3C6HA 4HSEA 1GP2A 4P4UA 5DIFA 1P62B 4HB4A 2ODNA 3SQXA 4GOXA 4LJ8A 2RMKA 2C5LA 4LOAA 4E09A 3R9WA 4CRWB 4O3MA 1OXUA 2J7PA 2CNWD 3NEYA 2D2FA 1UEIA 5CM8B 2QPOA 5L3QB 1KI8A 1M1YE 4JLMA 1M6NA 1W4BA 4FINA 1JJ7A 5SZKB 4OHWA 4P32A 2ZM5A 4QHTA 1OW3B 1E98A 3T1VA 1OHHA 1GILA 4KSCA 1D9XA 2KSQA 3HWSA 3T12A 1W0KA 2PLRA 4Q03A 3GLIE 1Q3TA 4Q9LA 4RVCA 5IHPA 3EPHA 5LBIA 3OESA 3QI2A 3ADCA 2WPDD 1FNNA 1MABB 3U2QA 1OYWA 4D0NA 3S1AB 4IKEA 4D4LA 1VPLA 5E3HA 4F92B 5LB2A 721PA 5KU1A 2A5DA 2ZYVX 1Z6TA 1QVRA 5KYKA 2DFKB 2XB4A 1QDEA 4DIDA 4V03A 4OHZA 2QN6A 1LF0A 1IN6A 3CRMA 3I8XA 3MRSA 4D0GA 2QORA 3R20A 2F9LA 3RWOA 1ZCBA 1XJCA 2IK8A 5IDVA 2Q6TA 3EA5A 2JAQA 3Q7PA 4DSOA 4CEHB 1FMLA 2O8FB 5B64A 4QFMA 4BFTA 2FGKA 3UATA 3UMSA 3CRRA 2H1LA 2AL7A 4HZUB 5KDDA 1I2DA 2VH5R 1WF3A 2REXB 1ZC3A 3U7GA 1G18A 4ZCMA 3AVQA 3BIFA 3PUXA 4PSVA 4BUJA 1A1VA 4TL7A 2AKYA 1SQ5A 2WSMA 5DSZA 1CJTC 3EZ9A 4BLSA 2WWHA 4CF7A 1P3JA 1P9NA 2OE2A 3FHOA 1RRCA 3GLFA 2NG1A 3N2EA 1G7CA 1UFQA 2DFTA 1E4VA 5FPSA 2O8CA 3R8FA 4IW3B 4FMDB 1N5KA 4A8JA 2IUUA 1M7GA 1SVIA 2Q9CA 2HXYA 4JT4A 2NGRA 2NZJA 3BC1A 2QT0A 5EP3A 2IUTA 4DSNA 4MGYR 1ZUHA 3CO5A 3AV0B 1MRSA 2BHRA 1DVRA 4A82A 4FIDA 5M1NA 2RAPA 1W7AA 2C9CA 3GP8A 3OIWA 3KQUA 3FMIA 4F93B 1GOTA 3HR7A 3DOEA 1XEWX 3GFPA 5FTJA 2X1VA 1ZVQA 1NVVQ 5J40A 2D7CA 1VHLA 2GXSA 4LY6A 5FOXA 2IYLD 2WKPA 5DH9A 1QRAA 3SJZA 3KFXA 1NN3A 2GF9A 5H8WA 2G77B 4V0NA 3E2IA 1UF9A 2HCBA 3B1YA 4BQSA 1E32A 4HAVA 3DKVA 1Q12A 1XEFA 1D6JA 2HT6A 2BC9A 1XWIA 1SHKA 2Z6VA 4RFSA 5AR1A 2AR7A 1OH7A 1ZNYA 4OHXA 5FBLB 1S9HA 2WHXA 2F3TA 4KITB 1QG2A 3B9PA 1JXOA 2WWWA 1OXVA 1YR7A 4LJ7A 5EXXA 2KE5A 4LDJA 1TU3A 5KSOA 1BOFA 1R5NA 2A5YB 2WWIA 1XB2A 1RJ9B 1W49A 4RFVA 4KHZA 4JLPA 4HAZA 1KIMA 1WXQA 4DLVA 2WZQA 4CIDA 4PO8A 4URVR 8OHMA 1KKLA 3RANA 2PX0A 2HLDD 1G3QA 4OI2A 3QF7A 3TIFA 2P5SA 1GRRA 2D2EA 3THXA 1UKEA 3RVBA 2ZU6A 4W7SA 1Z8FA 4EFLA 2QMHA 4BASA 4IOMA 1G4AE 4CYMA 3GLIB 1F2TB 4HEJA 3VFDA 4Z54A 1G64A 1NLYA 2DFNA 2BMFA 4M9QA 1XMIA 2AXPA 5TY0A 1ONBA 2IYTA 2WWGA 1W36C 3ICEA 2J0SA 2QPTA 2QTFA 3P20A 2O8CB 3BS4A 4A1FA 4M1TA 4W5WA 5K8TA 2BBSA 3E70C 5C2FA 2J1LA 1XJQA 2IS1A 1JJVA 3CPHA 1MV5A 2OAP1 1UBEA 5AWFC 4B6EA 4KFUA 1UBCA 1ZM2A 3K0CC 3F0TA 4PHTA 4AYTA 621PA 3WMGA 1D9ZA 5KPJA 1OKKD 1TX4B 2PJRA 1C4OA 4KVGA 4Q1FA 3CNOA 5C12A 1IN7A 4JYBA 4D4MA 2ZAOA 3GLGE 1WB9A 3GJ3A 1P2UA 3AKEA 2FGJA 5C4GB 4BEBA 5KDLA 5JWOA 4Q4LA 4GZLA 3Q72A 2IYVA 4KV9A 4RCYA 2BWJA 4POAA 4NCNA 4DLXA 4NZYA 1EK0A 2ZS9A 2BM1A 3QKRA 4NKRA 2PT5A 3MG9A 4Q1AA 4LYHA 5HE8A 5BYJA 1KSGA 3SBDA 4MDFA 1B0UA 1TUIA 4D80A 3LX8A 5FOWA 4MRSA 4IDPA 3AVVA 5EE3A 4A6PA 4HB2A 4BFZA 2CK3A 2REOA 2EWVA 5KNCA 1G5PA 2ZE8A 3W5JA 3PV0A 3LBIA 5TARA 1CRQA 1JALA 4P4TA 4LRWA 4F38A 4RFSB 3G82C 2QT1A 3THWA 4LUCA 2WOOA 2GNOA 3NH6A 2GEVA 1JR6A 5FTNA 5TVKA 2HF9A 5JFGA 3T1OA 2HYIC 1G8HA 2OEPA 1A4RA 3K0SA 1VECA 4KI0A 5L3SA 1JXMA 3WXMA 1RRGA 5FPKA 1O87A 3EA0A 2Q9AA 4XSHA 5J4LA 1ZNZA 2V54A 1KI7A 1Z2AA 1XF9A 2VP9A 3AF2A 3QXCA 4AKGA 4QM6A 1CJUC 4IRUB 5H1YA 3W6PA 1Z08A 2B92A 2XZPA 3Q5DA 2CJWA 4KBGA 3ND9A 4LSGA 4QGAA 3RC3A 4C0BA 3IHWA 1RRPA 2ZUDA 2ZE7A 4D2IA 1W44A 1YQTA 4OYHA 1W4AA 2AFHE 2ZI7A 4UNRA 3THXB 1W5TA 3EC2A 4JKIA 4B71A 5DNYB 2QG6A 1UKZA 1XCGB 1NMYA 3IPXA 3LBHA 4O2RA 2ZSEA 1D2NA 1G5RA 3NC0C 3EPJA 4PSAA 3TQCA 4CVNA 4Z1MD 5FI0B 2R6FA 1E2EA 2CDNA 1E2FA 1G17A 2NO7A 2ECKA 4ACBA 5DN6D 1ELOA 3I61A 1VDZA 2A2ZA 2MMCA 4O25A 2LKCA 2JLUA 2Q21A 1Q21A 4TL9A 2QNRA 3HU2A 2N42A 2GJSA 1K5GA 4RD3A 4UNSA 5BYKA 5G41A 5JRZA 1G16A 1KDTA 1NY5A 1R0XA 1N2CE 5C15A 3EZ6A 2ERXA 2ZI5A 4XD7A 3VQTA 3CB4A 4MRRA 4I1OA 1J99A 1TEXA 3KJEA 2KWIA 1QHHB 2J5XA 4KVAA 2CEAA 4ZKEA 1IBRA 2R65A 3PQCA 4IEIA 5BN5A 4TTQA 1EFRA 2WWYA 3P4XA 1EWRA 2G1JA 1ZIPA 1KI6A 3K0FA 3VNVA 1DG3A 2WVJA 3AVOA 3IBYA 4US1R 4C30A 1UKVY 4AIIA 5FTLA 3TE6A 3LA6A 3R8CA 4R2HA 1KI4A 1DOAA 2ANCA 3PUYA 1S3GA 3TJZA 3WBJA 4MA4A 3C16C 4NYJQ 5DO9A 1AS2A 2ONJA 3CRW1 1TQ4A 2V6IA 3H0KA 4LJ5A 3EARA 2RB4A 2H7VA 4MUAA 4C0AC 5HKKD 4ON9A 4TLBA 4RZXA 1QHYA 4RCZA 4R71A 2V8OA 3G0HA 4TQ9A 4US2R 4K46A 4NP6A 1UDWA 5CLQA 4OK5A 4V0KA 4KJZA 2O8EB 4IOLA 1EXMA 2BMJA 3K09A 5JBQA 4UXIA 1DAGA 2VEDA 1Q1EA 2DFLA 5UKDA 3H1TA 3GLGB 1S3SA 4BRUA 2GEDA 3ZQ6A 1ANKA 1FTSA 2QPAA 1TNDA 2J0UB 5AUOB 3ZD6A 4HLQB 5FOUA 2VBCA 4G5OA 4URXR 2WTUA 4B3BA 1G3IA 4Q66C 1KDRA 221PA 3RRZA 2CJWB 1Q1ZA 2F1JA 4LV8B 1U2RA 4D25A 4GP7A 2ZJBA 1KO4A 1WCV1 2XOKD 3C7KA 4TZ6A 4FWIB 2NO0A 2WIBA 3H86A 1AN0A 3NVAA 4HYYA 4X8OA 2AKAB 2CBZA 4OQNA 3OAAA 4TSFD 1UBGA 4M1YA 4R2IA 4HI0E 4IDHA 1ZAKA 4KU4A 4LGMA 4KLNA 1YKSA 2OHFA 4LHYA 2QBYB 1E79A 1KO7A 3ECCA 1HT1E 1RE0A 1A5TA 1N0UA 3TR0A 3KXLA 1X1SA 2YV5A 3P4YA 3FKSD 1M74A 1II9A 3QKTA 4PC2A 2KJQA 3C8UA 4BZXA 3UIEA 2QEQA 4PQYA 2KB0A 1DPFA 4DZZA 4B3CA 3SR0A 3SHWA 1E9FA 1LW7A 2QM7A 3GLHB 4JLBA 1U99A 1XTJA 3QQ5A 3ZVRA 4DLYA 4B3XA 2QSZA 2VL7A 2W83A 3U4QB 4C9BA 2ZITA 4YMVA 1FL9A 4V0OA 1VCIA 3KKQA 3VU9A 4TMKA 1U0LA 1JBKA 1H8HA 4DB4A 1NJFA 4EJSC 1LS6A 5JJIA 3CZPA 4AURA 4TMVA 3PXGA 4N0DA 5SZHB 4F4CA 3MWYW 2IW3A 5SZJA 1KI6B 1KMHA 1BYIA 4M9XA 2VP0A 4FN5A 1EESA 1E0JA 2FFHA 2QRZA 2V1UA 1CKEA 1T3SA 4B33A 2X19A 3BBPA 3GD7A 2D62A 3NDBB 4B48A 3ZIAD 4GI7A 1KY3A 5M1FA 1GRQA 2D06A 3PENA 1LFDB 5JWRA 4AWXA 2FOLA 4GFDA 3SI7A 3ZZ0A 4UXJA 4LPSA 2G0NA 4FCTA 3FFAA 1B23P 4MKHA 4HATA 3A4NA 1NKSA 5GVSA 1UKYA 2GAOA 2R62A 3QXJA 4QRHA 4UNNA 2W00A 4M21A 2V1XA 2KBFA 4OHVA 4QHYA 3AVWA 3K70D 2ERYA 3X2SA 1T8TA 2VHUA 1TQ2A 3ZH9B 2B6HA 3A8TA 2BOVA 2GJ8A 4PC7A 2R44A 3X1ZA 3CW2A 4PFSA 3U44A 4PHGA 4LC0A 2ZI9A 3CF6R 2ZXUA 3AB3A 4LC1A 3CNLA 3BWDD 4B35A 5KDOA 3I5YA 4I1SA 4X8HA 4EKDA 2QZ4A 4ZDWA 2BKEA 5K8IA 2BEJA 5BW8A 4WZ6A 2WJGA 1FNMA 3FMOB 4P33A 2F7SA 4JLNA 5C2DA 2ORWA 3CPEA 5TDHA 1OFIA 2EU8A 3E5HA 1C9KA 1GKIA 1JR3E 3I1FA 3KB1A 4N1AA 2ORIA 4LYJA 2W0SA 4QBIA 3RYTC 1NN0A 1AQUA 1T3LA 2AD5A 2V7QD 4RZUA 3THOA 3V4RA 2A5JA 2J41A 2WKRA 4Q02A 4TTRA 3MGCA 1EGAA 2ASEA 1PLJA 2RGNA 4P3YA 3ADBA 4B76A 4LV5B 3VNUA 3TW4A 2EFCB 1W48A 4NYMR 3W9YA 3C41J 3T15A 1ESMA 1R5OA 3GJ6A 1GITA 4PHHA 4FMDF 5KSYA 4GP6A 3I4LA 1HV8A 3VHLB 1RPZA 2C98A 3MSXA 4M8NE 3W8NA 5FOVA 4UNQA 1U9IA 2HV8A 2WM9B 1IHUA 2H57A 1NVWQ 1NY6A 4GMDA 2F1HA 4NTZA 4MGIR 3IPYA 2VPPA 1CIPA 1YZQA 2RGGA 1XTIA 1Z2CA 5DYGA 2PJZA 3BH7A 4DDVA 1TQ6A 2FH5B 2G3YA 5L3QA 4U02A 2ZRAA 2BV3A 1KMHB 1IQPA 3QEJA 4OJQA 1GG2A 3WYFA 5KPDA 2A78A 2WMNB 3CPJB 2XTNA 1H65A 1CP2A 1Q44A 1EWQA 1BMFD 4NHOA 1JPJA 1JQLB 1E9BA 4URZR 2CNWA 3U3RA 3EWSA 1KHTA 1Q3HA 2GEUA 3DMNA 5F2EA 4EJSB 5KO2A 4IHQA 3LO5A 4P0TA 3S1AA 1YR6A 3DZ8A 4M1KA 1U0HC 1T8UA 1KK0A 2KI5A 4TYQA 2V6JA 3U3MA 2W2TA 1Z47A 4IOKA 2AFIE 3REGA 2OBLA 4Z8XA 5KSZA 1F60A 2QENA 1A7JA 1SKYE 1BH2A 3OFND 4QBGB 1KO1A 3RC8A 2Z4SA 4DDUA 2ZRKA 3LQRA 4BEJA 4JL8A 4QL3A 3VKHA 3U44B 2W2VA 4PAMA 1VG1A 1IOZA 2O8FA 1XPRA 4F7WA 1DARA 1CJVC 2F6RA 1G21E 2GXUA 4ITRC 4AKIA 5H68A 1EFUA 4LZZA 2NQ2C 4HZUA 3OIYA 4TWZA 3AVTA 3ZS9A 3ZYCA 1MT0A 1C1YA 1AKEA 3AKDA 2XEXA 5D3MA 4B74A 4QGGA 5JHGB 1WBBA 1S9DA 1DAKA 3UG6A 4GBMA 4Q9IA 2QUZA 3BRWD 4WAUA 2ZSFA 2HT1A 4AKHA 3MLEA 2RKOA 5FUVA 4DSTA 3Q8XB 1T9HA 2HXSA 1DAMA 4ZKDA 1SXJD 3MD0A 5LPNA 2QAJA 1VYUA 2QL6A 5FI1B 1KI2A 1RRFA 5A4JA 1EFCA 1KKMA 2DBYA 5AJXA 3FHCB 3FOZA 2FSGA 3VHXA 1N6HA 4U7DA 3FHTA 3MFYA 5FL3A 3RS5A 2MSEB 3I3SR 1OB5A 1W4CA 1CU1A 2O8BA 3DM9B 2GXQA 4YDSA 1IXRC 1E2GA 3IBGA 3FMFA 4YXWA 4XVUA 3FMPB 5B30A 1XNJA 3A4LA 4HZIA 4U00A 3I73A 4KO8A 1CBUA 3LDAA 2WIAA 3LXRA 2G88A 3LLUA 2BDTA 4CW7A 4QM7A 1SVWA 3SYLA 2B7BA 1COWD 5KNDA 4LJ4A 2CHVA 2JASA 1NBMA 2YC2C 4ACAA 1TMKA 5CB8A 4TT3D 2RH5A 1M34E 1XP8A 2GVDC 5JRJA 2FZ4A 5K8LA 2F55A 3DMDA 5FPYA 4J0QA 1E0SA 2AHOA 5L8VA 1OFTA 4URYR 1QHXA 5FUYA 1OIVA 1P72A 2ZPTX 2ZJ2A 1HH4A 1A82A 4OQMA 2GCNA 3KKPA 3WY9A 1J70A 4WZBE 2ZSDA 4D0LB 1R4AA 2F1IA 3W3ZB 5CDFE 3BXZA 3K8YA 1RJ9A 4Q7MB 2L0XA 5EXPA 2AK3A 2W58A 1G8GA 2FPKA 2WJIA 1F2UA 4PPGA 2W6JD 1MO6A 1AGPA 1AKYA 3AVPA 5DHAA 3W6OA 4A0FA 4KFTA 1ZU5A 3U3JA 2BCGY 3LX5A 4C0QC 4GL2A 3ASZA 4ASUA 1AM4D 3L0OA 1JEEA 1EX6A 2NPIA 4DC9A 4DHEA 3KUCA 1ZM4A 3SEAA 4DCVA 1Z22A 2O5VA 3B1WA 3GLIA 1F2TA 5D3MB 2ZIAA 3BK7A 2ZRGA 1XEXA 3W5IA 2YJTD 3HPRA 1J2JA 1L2TA 2OO7A 4MKFA 2FN4A 1OF1A 1Z0KA 3B2EA 4KYIB 3U60B 1U94A 4WZAE 3B1VA 4YC7A 2PEZA 2YOGA 4GT1A 4TMWA 1GIAA 3WHLA 2ZI6A 2ZSBA 3RHFA 3WRXC 1TL7C 3K0AB 1JECA 3LAWA 2JLXA 1SKYB 5CDFA 1KJYA 1T4GA 1FTNA
chains in the Genus database with same CATH superfamily
2AH5A 3QMVA 5ITZB 1KVSA 4B83A 3RVCA 3CMAN 5B1HA 2ZQBA 4DGQA 1POWA 3SS9X 3F6PA 3VQ6A 4OL9A 1Y1RA 5CYPA 3QEKA 1ZC4A 2Q6LA 4UVIA 3JS5A 2DPHA 4P7KA 4PS1A 3RCBA 4W1PA 4AJEA 4R40A 1YH3A 3ZETA 2Z5GA 3ND6A 3UT0A 3ZZ1A 1KZGB 1RYHA 1C81A 1N5LA 4B6FA 4QOEA 4DSIA 3CMEN 3OLZA 4UASA 2GBIA 3ZYZA 3UKUA 2F1KA 1ZH6A 3G2NA 3T5MA 5M1KA 3EX7C 4IPTA 4BAUA 4JIMA 1DE0A 1XPOA 1AGRA 1K92A 4BNDB 3MTDA 4TLDA 5JS8A 1EA5A 4QXQA 3LL4A 4F4JA 3TXAA 2JFBA 1JNYA 3VR4A 3UJPA 3PBKA 2R84A 1GY8A 2J6CA 1XF1A 4JITA 3O9SA 4D42A 2ZYRA 2BZSA 1I0IA 1XL1A 2PT7A 3C7TA 2Y66A 5JSZA 4DTMA 5KIAA 1W2HA 1R7RA 4CEIB 4M37A 2Y05A 3AK4A 1PFGA 1E6UA 5DNUA 3FM9A 3ZETB 4LF7K 1BEZA 3FJOA 4KAAA 1BG3A 3C3YA 3ORRA 1SCJA 3H45C 2C4MA 4DWIA 2BGIA 3UV7A 1Y89A 3DZDA 4K26A 1MJGM 4G23A 4OHKA 3KBOA 1HO3A 3EZ2A 1V45E 2AEFA 2XOEA 1RKBA 1YJ5A 2ZSAA 5FFMA 1G98A 3T1HB 3IT2A 5LMZA 2IA5A 4CQJA 4B1VA 1HYEA 3P19A 1B0PA 4Z9YA 1XALA 3E8MA 2HF7A 3I2HA 5HXAA 3E66A 5JSZB 2VHXA 5CVEA 1YZKA 4XLZA 5K45A 3IERA 2ST1A 3KPVA 4B3SB 3A6GA 5D86A 1GL7A 1KIAA 4I55A 2YV2A 2BTOA 5KNCD 4ZEOA 3INTA 2I4TA 3O2JA 4UHCA 4LNUB 3OEHA 2Y27A 5J1EA 1PSZA 3RIMA 1Y37A 2B5JA 4JLAA 4BO1A 2XB9A 4B3TB 3D0KA 1O54A 3T69A 3OZUA 1Q6YA 5GQSA 2Q3LA 1LVHA 1UPTA 1Y3IA 2QYTA 5FEUA 2H7CA 3QIOA 3PEEA 5D87A 3ZCMA 4JT2A 4OFZA 5AK3A 3VF4A 3NHFA 4W5HA 4M0KA 4Z4CA 5IVKA 3QKWA 2BSAA 4OXRA 3ZX4A 4E7HA 2FWRA 3PXAA 1TQ8A 1QFYA 3Q8KA 3O7WA 1O94D 1M5TA 3FRJA 1CUAA 4PBSA 1JIIA 2WQZA 3KU4A 2YXBA 4MB0A 4UZSA 3P39A 4F3YA 1VQPN 2YY7A 4WN9A 1PK8A 1GPBA 3IHLA 3K7EA 2R66A 1SOUA 2QGZA 2BMVA 3A6LA 1Q1AA 4QG7A 1OXTA 1Y3FE 4IV0A 4A26A 1DMSA 2J67A 4E94A 4FFSA 2YY6A 1NBWA 5J47A 1SUDA 5K01A 5BYBA 3F90A 3OZBA 4DPLA 2LBPA 4RKFA 3M4YA 1QV9A 4KQXA 1AHIA 3NX4A 1YJBA 1RTTA 4OB7A 3UAWA 4L3VA 5EPOA 5FLKA 4M0DA 2HHLA 3TL6A 3ZE1B 2WUEA 3CM0A 4RTLA 2FPIA 4PFKA 5DHTA 2IYWA 3IS3A 4HQKA 4MWDA 5I8ZA 3G8YA 3SR4A 5DM4A 5C52B 1ZYUA 2HU2A 1UOEA 3E9RA 1U3WA 1IJEA 5JT1A 3L2UA 1NW5A 1UPCA 3QGMA 2BFNA 1ODTC 2B1JA 3OZ7A 5KYVA 4ZCTA 3O8QB 3ORQA 3ANLA 4UATA 3RRGA 3QSGA 3H1FA 4KGDA 2ODEA 2X14A 4KQ2A 3K2IA 1NBWB 3G0CA 5I5GA 5JV5A 2IZ5A 3RAEC 1P0IA 1CDDA 4LF8K 1ZG3A 4JKGB 1Z75A 4BLQA 5IT0A 4AKEA 4PR0A 4W6ZA 2NPOA 3RJMA 1US8A 3TTXA 1SAYA 1RYNA 1VL6A 1S1MA 4Q37A 1BWQA 1FY2A 3OLWA 5FTWA 2EZ9A 1J0BA 4KWTA 3CJRA 3R0ZA 2FPIB 1DJMA 4H0VB 1JG7A 3DTVD 2Z83A 4YNBA 1JX6A 1E99A 4R8RA 4M98A 3A5MC 1UWVA 4HPXB 1JDBB 1GYRA 4QAQA 1TW2A 2XGMA 3AEZA 3ID8A 3ZSWA 1V3TA 3RLIA 2PUFA 3RNLA 2FZCA 1U6KA 3IPLA 3QENA 3MMZA 4Y6QA 3GCGA 4BQLA 4DR2K 4FZ3A 3HBAA 1WXEA 2UZ0A 3W6NA 4CLEA 1X70A 4GXQA 1S1TA 2LE0A 1SR8A 1TC1A 4IWXA 3U56A 4TRNA 2NSJA 1W0JD 1US8B 1VB3A 4FR0A 5ITSA 1XJ0A 3ZD7A 1BUPA 1OOEA 1FJGB 3TLGB 3VTFA 4KHNA 4M1QA 4M8SA 4J3NA 4M0MA 2D3TA 3KHKA 4W8HA 2ATXA 1C7FA 3TW8A 4X8MA 4F6LA 3HDGA 5EJ2A 4TKLA 2P2LA 3V1YA 3TQRA 1PWEA 1SOMA 2XUOA 2C96A 2W2OA 1NBMD 2I3BA 1NUSA 1H2YA 2ZCUA 2PL5A 1XZPA 1DG9A 2R87A 1GG8A 1ORRA 1Y5RA 4I5GA 5DI3A 3JRWA 5DSXA 4Z9XA 1H2BA 4JAVC 3F6RA 4UHHA 2QB5A 1S6QA 1II0A 3QI7A 2QGNA 2ZB8A 3ENNA 2HWYA 3WMWA 3DVLA 1FMJA 4AHCA 1S2DA 4X45A 3DOFA 2ILVA 8GPBA 1HDXA 4MXDA 1CR4A 2B1GA 1HFJA 1ZGZA 4DCNA 3UV3A 5M29A 4KB5A 4KLAA 3RIYA 3NJRA 4PZDA 2ZVPX 1DS6A 5CDHA 2NVBA 1OFUA 2CXUA 1R16A 4IIJF 2KX7A 3FFKB 4Q34A 3GLFB 3NT5A 4M9RA 2ZI3A 1XCLA 2TMKA 5TE9A 3NBPA 2FF5A 4ZAFA 3MW8A 3FFXA 3O73A 3MWLA 3HA2A 3NGMA 1C0LA 4RK6A 4HH4A 2UVQA 4PR3A 4FJ8A 2EEPA 2OCYC 3AUXA 4TXMA 2SHKA 4Z0PA 3ENWA 3FAKA 2GO1A 3QM1A 4UOZA 1Y8RB 1RVDA 1MR3F 5DI3B 5HTKA 3LLMA 3H2GA 4ERXA 1F0NA 3QVSA 2GPAA 4CVNE 5K0LA 4IDFA 1WZUA 3TLYA 2JLQA 1CJCA 1JQJC 1FXXA 3D54D 3KKNA 4CLRB 3PIPL 1R9NA 3PCRB 4MEJA 2C88A 3T9EA 4B44A 1FQKA 1BCRA 3IPCA 1ULAA 5M34A 3R3SA 1J8YF 2NACA 2W2KA 2IV3A 5ILGA 1GGHA 2ORYA 1IKWA 1VQNN 3MSCA 5K3EA 3EGDA 1W36D 1QH8B 2GYVA 4TKMA 4TUYB 4CJ4A 4M3XA 1S2GA 2AF4C 3DEYX 5TMEA 4UHJA 1N32B 4FBMA 2WPNA 2YHAA 1A98A 1G20E 4YMHA 4N7MA 3EISA 1GA1A 3L2WA 3SJUA 2VQ6A 5EFZA 4IJKA 5JVHL 3C3XA 2UV8A 3AVBA 4RW7A 4A8TA 5EIEA 1U8EA 4DQUA 1FFHA 3F4BA 4F2GA 4J8PA 2EZUA 5SZTA 1P19A 4LHZA 2G63A 5AUNB 1HNZK 4WHMA 5DASA 5BN4A 1CFZA 1X15A 1W1UA 4JI5B 2K5UA 4PX2A 4GMJB 1DQYA 1NC1A 1NMSA 5AKIA 2V7QA 3K4QA 3NBYC 4K7JA 2ZJFA 1ASVA 5CGQB 3CLTD 1DRUA 4M53A 3EZGA 1P4GA 1E3JA 4OM7A 3CI5A 4FUTA 1A8PA 3V34A 1GKYA 3IVXA 5J2MA 3W3AA 4JYAB 2WJZB 3OOHA 3SVZA 2B4RO 1I14A 4DMGA 3QIVA 3IJPA 4RGYA 4IGAA 4MLCA 3JYHA 2XCRB 1EK1A 2YHSA 1L5YA 2XRYA 2WFZA 4J43A 4O4HA 2OV1A 2B82A 3WLAA 1Q82O 3HBNA 5DBEX 3HRIA 2MYTA 1NONA 2C42A 4DNFA 3LSYA 3QYJA 1SXJE 4WK2B 1XZAA 5EJ5A 2OXRA 3HU3A 1MDBA 4RK7A 4HN2A 4IV5A 1M6VA 4UHEA 1ZD1A 2GHRA 1K7XB 2WKQA 3LXXA 3KD2A 4LTNA 4CBUA 3DW3X 2JFPA 1TF5A 4D56A 1U0FA 2FKNA 3VVLA 4XVRA 3OJ0A 3THYA 2QMYA 5FPHA 4FHZA 1GZDA 4R54A 2NU7A 5FX2A 5K0FA 3KVRA 1LBHA 3V2GA 4LJKA 1E1QD 2Q8PA 3G0BA 1FYEA 4HBGA 5FPQA 3KYDA 1FU4A 1ZHFA 4RKWA 5CVUA 1ESZA 3RR7A 5F9HA 5CTJA 2JGAA 3W34A 3Q3VA 5ICFA 1VJRA 1SOWA 4O4HB 5LUBA 2IXTA 3WWOA 4JELA 3IB6A 2V5VA 1UODA 3O9QA 2OP0A 4L9AA 3DE7X 4NXMK 5JI3E 2OYRA 4Q18A 1SCBA 3F73A 3OIVA 4HNTA 1GTJ1 4Q19A 4BDTA 4JB3A 3TQIA 3ZKWA 5KMGA 3UEOA 1U80A 2H92A 4F7DA 5JPDA 2VNIA 3RROA 3THYB 5DLEA 3RUCA 1PGOA 4LMBA 3LFUA 4F0JA 1ZMBA 5TT0A 2EJVA 3B70A 1F0KA 3ANNA 4HX5A 3SICE 3VMFA 1VSUA 1PJ4A 3RFUA 3KYDB 3R9WA 3NEYA 2TMGA 3CXUA 2I5PO 2O54A 2P9FA 4P32A 4V2UA 1QTMA 3CIFA 3T12A 1Z74A 3U4AA 1VP3A 5AOBA 1T5TA 4F6CA 3FWKA 4F04A 2B69A 3T7CA 1FNNA 1VPLA 2HK9A 5AQHA 1X87A 4X0EA 2A5DA 4RZSA 5BMVF 4P36A 4GVLA 2OWDA 2NVOA 2CD9A 3SM9A 2QWXA 4PV7A 4B85A 1Z6PA 1QUEA 2YR0A 4RGQA 1U0OC 4P34A 4LQDA 1RNLA 3TOSA 2REXB 3IP3A 1F12A 3KQVA 2A35A 4BCDA 4H0NA 2WFLA 5TS2A 2H2GA 3QICA 5IPFA 4YP5A 1SQ5A 3AZQA 5KMGB 1RBQA 3VA3A 2P9KA 4P3PA 3CC8A 1C1XA 1UBRS 2Q9CA 4FWQA 2QSJA 3FZEA 3D9QX 3T1NA 2NZTA 4RU1A 3OIWA 3WB1A 3AGKA 4LXHA 5J40A 1VHLA 3VYRB 5FNVF 1YRWA 3AXSA 3VJLA 2QXYA 3U8XA 3ZSYA 4BQSA 3FUXA 4AW9A 3GA5A 3WDMA 2A86A 3DL4A 3NXKA 1XEFA 1ZIYA 3H04A 3PC3A 4G24A 4H7KA 1L5QA 1NJWA 4N5LA 1D8AA 4OGCA 3E53A 4LDJA 4BMDA 4CBWA 1RAGA 1MORA 4MDBA 3OW2M 4RFVA 2H7XA 4C5AA 4CZIA 1KIMA 1WXQA 5E8RA 3TZHA 3H5IA 4PO8A 1XI2A 4YDQA 3BXOA 3ZT2A 4WQ5A 1UOPA 4H27A 2CSXA 5EYPB 4ZXPA 3D8RA 5T8KC 1JDZA 1Q50A 3TO5A 3DLLL 2P9KB 2IE8A 1YI8A 1LVUA 4BR7A 4GVXA 4U7WA 4Z0NA 3E03A 1UBEA 4PY5A 3BRSA 4EG3A 1HL3A 5KPJA 2EWSA 4YXFA 3HGTA 4M88A 2PX5A 4JYBA 1XTUA 1FXUA 4HOYA 4ZAYA 3GG2A 1XDZA 2IJGX 5PNTA 3K05A 3RS9A 5DCYA 4LYHA 1KSGA 3SBDA 2AF3C 2WTEA 2H63A 2LV8A 2RI0A 5JMWA 3A10A 1PZFA 3K72B 5JAIA 1GDHA 1IE3A 5KTMA 2V54A 1LEHA 3K1TA 1Z2AA 5AXAA 4ABTA 2BFCA 2ASPA 1C7RA 3AF2A 3WO1A 4KQ1A 1NVKA 3NF8A 4U7GA 2CUZA 4JC5A 2B92A 3OMXA 4KBGA 2HF4A 2QVGA 3IE2A 3KB8A 1MZPA 2Y6VA 3P97A 2O0MA 1U2GC 3EC2A 4JKIA 4RMHA 5BRAA 2YQ5A 4CHOA 1ZITA 1D2NA 1IVSA 5IKOA 3O82A 4KIFA 3LBAA 3I5UA 2HFJA 4BO7A 3HU2A 1GCOA 3CE9A 1U28C 5JRZA 2BZ0A 4UUOA 3ZSQA 2IOQA 4I1OA 1R0BA 4CEQA 3DRPA 3KDPA 1DG3A 3WL3A 3TE6A 3LA6A 2DQKA 4ND1A 2V6IA 2E5LK 2V8OA 3DH0A 3DYIA 3UOAB 4V0KA 4XQCA 4ZI7B 4KMOA 4TVKA 2BMJA 1B1CA 4MWEA 4UXIA 5DW3A 2FPXA 4ARBA 3V7UA 1C50A 3SV4A 4B3RK 2YDYA 2TMDA 1TYDE 1LPNA 1CEYA 1BC5A 4D25A 5K4GA 1N7IA 1NATA 4HYYA 2CBZA 2Z6QA 3VTHA 2IXDA 2Q50A 1CQJA 4JGGA 3M6MD 2PD4A 1MVOA 1WU8A 1KO7A 1EIZA 3TR0A 1W29A 4KP7A 1JFSA 4WN3A 3BMNB 3UIEA 1AVTA 3OUUA 1PR9A 4JDUA 1O13A 3DLTA 4YT5A 1DI0A 5HFNA 3PXGA 3JPYA 5SZJA 1NRXA 5MFZA 1T1IA 4WASA 3RUDA 5IZCA 2RHTA 3IQEA 3QK7A 2KLBA 3SI7A 5HIKA 2WG1A 1NX9A 3FFAA 2D5CA 4EEKA 1YB5A 2ZBDA 4MR9B 3ZV6A 2W00A 1QX4A 4PFSA 2ZI9A 1JEQA 4NO7A 3JWIA 5EHXA 3LK6A 2ZIEA 3BWDD 1WB4A 5K8IA 3OLXA 1MG0A 4HDNA 5ARDA 4WESA 4QBIA 4DLBA 2D0BA 4JX9A 4MYDA 2HLPA 4B82A 2WK1A 1TL3A 3WBBA 1MEJA 3EXHA 3C41J 2I6TA 3F2KA 5EN4A 1U11A 2UYHA 5SYAA 1GAEO 4EHJA 4HCCA 2W2LA 3N4QA 5AVYA 3C48A 2VJYA 3BIXA 2Q5OA 3KR0A 3L3UA 4JOQA 1IFXA 4PLPA 5JAUA 3PPXA 5KU7A 1RYZA 5EEGA 2WQ7A 2XT6A 4IWVA 3NHSA 3DMNA 4FW8A 1E3QA 1RI2A 3G13A 2OBLA 1SKYE 4UPEA 4ZYVA 1JEQB 1Q0LA 2VG6A 3B2NA 1ZLYA 1DARA 4BVGA 1PK9A 1OBHA 3L6BA 3NOVA 4WESB 2Y92A 3ZW9A 4UQPA 5CT5A 1WSHA 3AZPA 1TI7A 1DP4A 1Y7PA 2VJLA 1WMAA 1FUIA 2G25A 4LD0A 2DQ4A 2C4WA 3PQ2A 4P3OA 3AYXB 4UEWA 3MEGA 5J3JA 5IZ4A 2PKWA 1USVA 3HDVA 1NJ2A 4X62B 1DIOB 4RK0A 2D0AA 4R05A 3HXLA 5K03A 1OPRA 2QMQA 1GZ4A 2YC2C 1BE0A 5K8LA 5FPYA 3FUTA 1E0SA 1P72A 2NSDA 4FJNA 3WLEA 4JA0A 2BMAA 1QLWA 5G0VA 2W58A 2BGUA 3KKSA 1C41A 3IH5A 4TTAA 4JXJA 1CUWA 2G7ZA 5KQ8A 3OOYA 3M9LA 3M8RA 3B1WA 3BK7A 2EQAA 4MKFA 4LTMA 3AJAA 5LU8A 1T4GA 1GT6A 3PGXA 2XY7A 3LPAA 1LS1A 5E1DA 1E5VA 1P3DA 1NWHA 2XA2A 2ZAYA 3EW7A 5C46F 3H99A 2PZBA 4QTUB 4YMLA 3PHIA 3G71N 1O4VA 3CQ9A 3INGA 5AKKA 3BZKA 2R11A 1MH1A 2QG4A 1OHHD 4TMFA 4YRZA 1RT3A 3EIXA 1I6MA 5KX5A 1SBNE 2CEKA 2CLEB 1ZRHA 3RRJA 4EPXA 4YUXA 4HVTA 2W41A 5LMCA 4M41A 5JAMA 1G2IA 1UFOA 3QJYA 1YCHA 2IH4A 2VF7A 4XQGA 3Q3JB 4NXNB 3BHIA 2J9FA 3MZ0A 2K87A 5BV7A 4PGMA 4RTNA 2E9SA 3A1SA 5ALYA 2PX4A 1B9DA 5H81A 5CFQA 3KSAC 3GAAA 5CFZA 4KO1S 3RJ5A 3I0RA 4ZTUB 1F48A 4GBGA 3F98A 5JMVA 4GRAA 2QTNA 4HLUC 1CTQA 5CLIA 4OREX 4O4IF 1I94B 3P5BA 3SMVA 1KYXA 4BR5A 3F5QA 2Y76A 4FW9A 1YAJA 3K0CA 4IUDS 2VDMB 2E4VA 2JARA 1CY1A 1PEYA 3C24A 4ND6A 4L4UA 4LVUA 2JLSA 3PFHA 1Q74A 1B14A 5KX5B 1FSPA 4D4GA 1RQPA 4PG8A 3L2QA 4TYWA 1U8AA 4DMHA 1Y6ZA 3QBJA 5AVXA 2ROQA 4FYPA 1LBTA 3EH1A 2ZATA 2HD4A 1LFAA 3OYGA 4O5FA 1Y9EA 3JQAA 4ZYXA 2Z1DA 1APBA 2K4MA 2Q28A 1FB5A 1L5OA 2Q49A 2FRDA 1O9GA 3EDMA 4HNRA 1AC5A 4LFBK 1A4UA 3CLUC 1DBWA 1RMQA 2CXQA 2GD1O 4O55A 3CRNA 3QUSA 3N7TA 2CBGA 2AW5A 3KLEA 1GM5A 4CEDA 5FDLA 3OPYB 4IIFA 1K27A 1T8EA 2WQ6A 4ZGBA 4PXYA 3N58A 2I78A 1RQ2A 3FYUB 3FKJA 4XEIA 2C0CA 1BIFA 4KR2A 5AQXA 3DHWC 5F7OA 4D57A 4JVMA 2KLHA 2JPDA 3TUZC 1NQTA 3T0FA 4LC9B 2N75A 1YZNA 1HM5A 2GXAA 3NBZC 3N1UA 4CM5A 4P0QB 2P3QA 1A2OA 1J9ZA 4W7HA 3ZWBA 2Q7XA 2UYQA 4HL6A 1Z8HA 2HBQA 3ZCUA 2A9OA 1XNRB 1FSSA 4PY2A 1HLDA 2HHHB 3EH2A 1HA3A 2CN1A 1YIDA 1U2ZA 2WF8A 3WR5A 4Y2HA 3URMA 1DADA 5EHZA 3R6MA 3IDFA 4C3UA 5CLHA 4FP9A 1K08A 1ZBQA 4BMXA 4GMFA 1V3QE 4GHWA 2FMXA 2PGNA 2CY0A 4XTRA 1OA1A 1D1TA 1A8SA 1JG2A 4PCAA 1DNPA 3HP1A 5BP7A 3LXMA 5DHPA 4NRDA 4RW9A 2PL1A 2MSNA 4D9EA 2XRZA 1EXVA 4RPHA 3TFQA 3K0KA 1YR3A 4HLCA 4V2IA 1DQZA 2WJJA 3BF8A 4ZHRA 2ZSUA 2HHAA 4RACA 3M81A 4CM3A 1IN8A 1DX9A 2W6IA 3BA1A 4XFJA 2O5CA 4DG5A 1KPHA 3FDXA 1WPGA 4E1BA 3R5TA 2XBLA 4UUPA 1OX4B 4LNAA 5LKAA 3KKZA 2CFSA 1FLDA 2CLFB 4AVYA 1H0RA 2XXJA 4JJAA 3CNNA 2KQ2A 1SKUA 3ESAA 4DUZK 4DB2A 1YS6A 4EAQA 2R8RA 2RK4A 5H0IA 5E4JA 3E2MA 1QSLA 2HIGA 2ZYAA 4RMNA 3NCIA 1P8JA 1IY2A 5A0FA 1D4AA 5F73A 4E4YA 3JQ7A 1WMSA 4AHVA 2DYKA 5E4FA 1QQAA 3M3DA 3TMKA 2D54A 1CEQA 3GFSA 3HUUA 4M1SA 4LE0A 4CG3A 5LC1A 1YQGA 5JNWA 4K8OA 1OLOA 4CDGA 3BP8A 4MO2A 1JXBA 1R6XA 4ICIA 5AQSA 3NFYA 1VLJA 3DFFA 3UANA 1VKOA 4PSKA 2B98A 1Y3BE 2QWLA 3WC4A 5CX1B 1FBNA 4KI7A 4TL6A 5B37A 3HABA 2XECA 1HMPA 5I9TA 1MTZA 3K1YA 1TF2A 2Q6IA 1F7UA 1V5IA 2HWWA 5BWCA 4RS3A 1KC3A 3MXMA 3ICQB 3HXOA 3ELWA 4JRQA 2H54A 3CZRA 3OA0A 1NMXA 2YJ6A 4YMTA 5HE9A 5KVAA 4OGEA 1OVQA 1MWMA 1UBFA 4ARCA 4ETWA 3GPDG 5A9RA 3JQ7B 4O02B 3I6BA 4FLFA 4CJVA 2V9CA 4ZYUA 1FQOA 3DEJA 3E5RA 5L45A 2YYAA 2XY5A 3BGSA 2HZ7A 4K9LA 1KJ9A 2J08A 2L82A 1LZLA 1TT5A 5HS4A 3K20A 3COZA 4NBRA 4FJ9A 5JYEA 2OCEA 1NZFA 2DPNA 4CNBA 2IYEA 3R9IA 2GBLC 1X8XA 1W97L 1YZLA 4FHDA 2O57A 1ZA2A 5FBRB 2Z95A 2X3YA 4IIGA 3KUUA 1C30A 2Q1YA 1NVUQ 3RSCA 3AJDA 4DLNA 3QOFA 2ZJ3A 4RZIA 4OI0A 2QHXA 3I5AA 2GARA 2WD7B 3TF5A 4YJHA 1M8JA 2H17A 5C5EA 1CIJA 1N5YA 2WD9A 4ZOLF 1KTVA 2GLUA 3DQZA 1WXGA 1YR9A 2QQ0A 4A6DA 5FH9A 2EVWX 2XH8A 1A50B 3O9MA 4FLEA 4I2NA 3PJRA 5F1PA 1TW3A 3NAMA 2J8ZA 4B4KA 1E5QA 1EG7A 3IQIX 1LSUA 4IFIA 2CL5A 1YDWA 1TT5B 5BQPA 4EGCB 3SJHA 1J33A 3KJFA 2OM6A 4E46A 1N5IA 1M8KA 4GZ6A 3FCSB 7ADHA 1KNQA 5IT5A 4FXPA 4NYMQ 4PLZA 3BWMA 2CNNA 4WINA 3FH0A 2KZMA 2Z43A 2X0NA 3WMFA 2GR9A 4R1MA 1GL6A 4JBGA 4YJHB 3QLUA 4QIHA 2VLIA 2GF0A 5F9FA 4FE4A 4N41A 1THGA 5EJ4A 1D03A 1ZEMA 4OQFA 2UUCK 2WJ3A 4FN4A 3E1KA 1U3GA 3N6VA 3CCCA 4GPIB 5SICE 1U2DC 1GLVA 3QNUA 2M6KA 2VPTA 2OK8A 3B78A 4Z49A 4K41A 4NPAA 3ZHRA 3SBGA 4V02A 4EHUA 4EABA 3FDIA 3ZH2A 5E84A 3L6RA 4JCCA 3DUFA 2WM8A 3BTVA 4DU1A 4CJSA 3FE2A 4HDRA 2I4MA 4WL0A 4ID3A 1TMGE 3T3MB 1Z4NA 4OP1A 2HNKA 4UEKA 2OHGA 4KE6A 3HYFA 4I7EA 4M22A 4KVZA 4D46A 1BFDA 2C0PA 3AM3A 1FQWA 2IWHA 1CUUA 1U0BB 1MN6A 4YJKA 4DCHA 1YL6A 1GTZA 5JFTA 4L02A 2Q7DA 2BTQA 3FPKA 2R6DA 2EYUA 1FP4A 2OAQ1 2QRNA 2X5JO 3KQHA 1E5TA 2GELA 3QMLA 1N5RA 4P9NA 3ROQA 5JQGB 1P9RA 3C97A 3CHYA 3K09C 3UMRA 3GJXC 4DA9A 2I3DA 3WVNA 1UWLA 2VYQA 1GV0A 4AKSA 4CMGA 3GU3A 4UHBA 3JSXA 2X0JA 2DWOA 4JI3B 4OHUA 2FX3A 3DUFB 3HK2A 1SCIA 3BMCA 5IASA 2OYSA 4OAPA 1LB1B 3O1JC 1YRBA 5JAPA 1V6AA 1VRWA 3UJ3X 3N05A 1R37A 3NKLA 1FFAA 5EJ8A 3WGKA 3CJQA 3OQBA 1ISSA 4S1WA 3KQMA 2E2WA 4K42A 1RLOA 3DP9A 1Z6YA 2AHRA 5JCOC 3N4PA 5DV9A 1NVVR 2JAXA 1Y8ZA 4EB0A 1HZJA 4BREA 2Z4RA 2E7ZA 1ZCAA 3S8YA 1FP4B 5CLGA 1UOOA 3WL4A 3UICA 4F3CA 1ZM7A 1X1AA 2O8DA 2ZANA 1ADGA 3K0FB 2J5RA 4FDAA 5BN3A 2Z0MA 4DC0A 4IJ6A 4H3HB 4MGEA 2GBFA 3DLKA 1GUYA 3B7GA 1N2CB 5F51A 1QZZA 1XTRA 2ZZMA 2PKRA 5H3LA 2R1TA 4KUGA 1SO8A 4W5RA 2Q6KA 3BMCB 4RSGA 4JBWA 3FLEA 2HNZA 3CCJN 1R5JA 4J3FA 3LW8A 2CWWA 1KDZA 4PKIA 1FS4A 2YN2A 2PZGA 2D5BA 4HH3C 4GVEA 2G83A 4BB5A 5L6LB 3X1YA 2GN6A 2JAUA 3G49A 3EFOA 4NNOA 3O5AA 5F7XA 1KY2A 4D6PA 2AB0A 5AKLA 5ANRB 4MUNA 5EOVA 2PPLA 4WBNA 3C5VA 2ANBA 4IFTA 1M2VA 2HTFA 3QYFA 3BDIA 3IPAA 4M87A 4NCHA 1Z06A 4CR6A 3GRRA 3Q5EA 1J9AA 4X90A 1M8PA 3L04A 3WLSA 1KJJA 5LN1A 2O8DB 4M3ZA 5EQDA 5BREA 3G0GA 2DMRA 5D7BA 1VL8A 1CUZA 1NNEA 2QA4N 4DU3A 3AIKA 2EF1A 1LI5A 1P1JA 4O4GA 2OZEA 1QQTA 1BDIA 1O89A 5CFMA 4OH7A 2IHVA 4RS4A 1B9FA 2QI9F 1HE4A 2XCUA 2D0OA 1XAIA 3VV3A 3KLBA 3SVTA 4D9GA 3FHLA 2YHWA 1QGDA 4WA7A 1GZ7A 4FM2A 3A6HA 4R9RA 5B7GA 3CLVA 3GCDA 3WRVA 1L5RA 2AJ8A 3OQNA 4XGRA 4ENPA 4RC9A 2P90A 3W3DA 3LDHA 4QATA 4EY7A 4NZMA 4WBNB 1DRJA 8AT1A 1M2VB 5K3FA 3CINA 1KPGA 4OV6B 4P4UA 5I4CA 5KREA 2C5LA 3WLMA 1V26A 1AQIA 4BX2A 1U7HA 4K9QA 4FWLA 3AEQA 4HTAA 2R0QC 1U0EA 1QQOA 2VAPA 4UM8B 3QI2A 4MARA 1I33A 721PA 1GPAA 4BC0A 2XB4A 4XB2A 3HEMA 1J53A 1IN6A 1HOXA 3K6SA 4AS1A 4PX5A 1QMPA 5EEHA 3IOYA 4PG4A 1FMLA 3H46O 4NJEA 1D3AA 3DKRA 1ZC3A 2HNAA 4ZCMA 4PNHA 1KVCA 4TSXA 3IKMA 2NWQA 3PUXA 1A1VA 4TL7A 1Z5VA 4ISEA 3N2EA 3JXEA 1WKVA 3C1OA 4A8JA 1C9JA 3SZUA 4YR9A 1UH5A 1FJXA 3TRDA 1YACA 5K3FB 3HI0A 5AW2A 4D0RA 3EEQA 5ALLA 2J3QA 5M3BA 1EX4A 3VNBA 2R7MA 4O2BF 1M6EX 2A0KA 3PC8C 3AEQB 1A9XA 4HAVA 4DMMA 1O95A 4ZEVA 5KWJA 5KYNA 2Z6VA 4K0KB 3J80O 1S9HA 1IEWA 2WHXA 2DUMA 1POXA 2OWEA 4D3XA 4INZA 4IUYA 5L95A 4ZA2A 1GUBA 4GL4A 4J1TA 2JGUA 1UQRA 3H5RA 4OSEA 4ZQFA 3K6SB 2GEJA 1F8XA 4KHZA 5E6RB 3VSAA 1UPXA 3JD2A 4NJEB 3DA8A 2AZDA 4DARA 3FBTA 5LP6A 4HNHA 2D4AA 5K8VA 3T4UA 1ECPA 3TD9A 5JOQA 2VCPA 1VA4A 1UBCA 5JS6A 1U02A 2PDAA 3UGJA 4EGAA 1JW9B 3O31A 3H8SA 3F5MA 3QU9A 4KV9A 2Q5HA 2P2DA 1AD2A 1U0GA 3WLOA 3RWBA 1A9XB 3LDNA 2ZWHA 2O7RA 4P4TA 2HO4A 2VPWA 4QLOA 3F2IA 1GU7A 5JATA 4KI0A 3WAGA 3UKUB 3LUJA 1JS1X 3QPDA 1XF9A 2NN3C 4LOIA 4RW0A 1L4HA 2G36A 2XZPA 3MK6A 3VR6D 1DX6A 4C6SA 1SVNA 2ZJ1A 1Z0SA 4DWWA 4LW8A 1RM3A 5BWBA 3RYFA 5LP6B 5JAZA 2BPOA 2R6FA 3BULA 2NO7A 2ECKA 3WICA 1VDZA 3I4CA 2W40A 4MJ7A 4YRIA 2NLXA 3KG2A 1QZ3A 1SHJA 1KORA 4MW2A 2C7GA 3AQIA 4KVAA 2OC9A 3GGGA 4TTQA 5DLDA 1IZ9A 3ESBA 3OFJA 4DG1A 1SQGA 4C30A 3KOOA 3L7NA 4R2HA 4X41A 3QFTA 4GLBA 4LRYA 4QOJA 2JH9A 1UPFA 4IH4A 1AUQA 3QVWA 4AN0A 5JBQA 5D3KA 5AVKA 1S3SA 1TNDA 3D1LA 2GTDA 2ZT5A 4X3CA 3U3YA 4MQ5A 1JHDA 1A8HA 3KNZA 3OYHA 2Y67A 4OQNA 4A5OA 1MPXA 5A5VA 3RYFB 5EHNA 4EF4A 2YV5A 2OG1A 1IIBA 3ETCA 4PQYA 1P7ZA 3AIIA 4OXNA 5EFOA 5ENZA 1P2BA 1Y4SA 1U99A 3VH3A 3ZVRA 2WWVD 1VCIA 5AFUH 2VPIA 2C4NA 3RV4A 3TTYA 4MI9A 4FN5A 2QRZA 5BPFA 2C1ZA 1EIWA 2X19A 3O4WA 3MT0A 8LDHA 2BH9A 5JDCC 1QJ4A 4LGYA 4KRGA 4I55B 4UXJA 4CM8A 2EFYA 3CT4A 3A4NA 3E8SA 1BCSA 2W6MA 5A6SA 4RZHA 3AVWA 1EZ1A 2ERYA 2GRAA 1PQ4A 3N8KA 2RGUA 2F67A 3CUVA 2XO7A 2I76A 4ZDWA 5K51A 3O90A 3OBYA 3DE4X 2FMKA 4F1KA 1L5UA 2ORWA 3GROA 3IAYA 3R6DA 4UEOA 1ODIA 4YHHB 4GKJB 1DKLA 3T15A 1Y9JA 3WAKA 3N2GA 4MQ6A 3D0QA 4HDMA 3DWIA 1FFXA 3I4LA 4GP6A 1YA8A 2F1HA 1ID8A 4FLVA 2JRLA 3CUSA 5H16A 2G7MC 3ZGNA 1XTIA 4OKJA 2B83A 1U8TA 1H1VA 2OQ2A 3HSSA 3MLBA 3QEJA 4YYZA 3NEPX 3QVGA 1X3NA 5BWOA 4WN9B 1JR2A 1BMFD 4URZR 1KHTA 1Q3HA 2GEUA 3NT4A 3EPPA 4CM8B 3WNGA 1KK0A 5GM1A 4U1RA 4W63A 4ELUA 2FSVC 3D6VA 5A6SB 1ID1A 1BS9A 3NYRA 1EUQA 3SSAA 2C4HA 4FJ5A 1UJNA 4F7WA 4OAOA 2HA7A 1HNNA 5H83A 3SMQA 1NXOA 2JGKA 2LUOA 1FMFA 4WAUA 2I2WA 2FG6C 2AFIA 3N2GB 1FFXB 4W4TA 1QB7A 1GCIA 1D1PA 2YBEA 3GYGA 1FKOA 3K2EA 1BL3A 3GFBA 1QIIA 2BDTA 1SVWA 2VZ0A 2AJLI 2DPGA 4DSAA 1ZMOA 4ZJZA 1A82A 4J4TA 5HMMA 2V7UA 1FBTA 2F1IA 1L7DA 3HCNA 4HGZA 3HJRA 2ZB7A 5EXPA 2JFHA 4NMWA 4DCJA 3Q40A 2QU7A 2W6JD 1ZU5A 1XZGA 4BTLA 3ED1A 1ZSYA 4UFOA 1GGJA 3RI3A 3GLIA 3VR4H 4MV3A 2OO7A 3I2JA 4QUBA 3WHLA 1VOTA 2AFIB 1JECA 4L8VA 4B84A 1DV2A 3FY4A 4JJ4A 1SFRA 3SI6A 4UVEA 2IHBA 1RC0A 1U8YA 3DLCA 4FVTA 2M32A 3FUUA 3GJQA 1YF3A 3A1WA 3Q8MA 1FZTA 1NQWA 3KKMA 4S2EA 1ITGA 2GZ3A 2WRZA 3C8HA 4DR7B 4EG8A 2Z1GA 3ETLA 4Z0HO 4LYYA 4V0LA 1BVYF 1NG1A 5JYDA 4GDFA 4A36A 2Q5IA 2R8YA 2MR6A 3WQBA 2WA1A 3ALYA 2GBPA 1SIBE 2F2TA 2ZKLA 4C22A 5J5CA 3KV1A 2UU9B 1TAQA 2GYYA 2RSLA 4I14A 3BMXA 2HSZA 1SUAA 4ZICA 3S28A 3OQVA 3M6FA 3A1FA 3DW1X 1H6BA 3TAUA 4DCTA 1K8KA 1Y82A 4B7UA 4I19A 5AHOA 3DEHA 1ZNQO 4R2WA 2JIZA 2IZ1A 4LY9A 1EM8A 3E9YA 3NASA 3QG1A 1J8QA 4LH4A 2PMKA 3V7WA 1YNSA 4Y1CA 1LU9A 5ICMA 3TW8B 1J97A 4KQ9A 3D5EA 1CZBA 4JBXA 2NRHA 1LDBA 3UYLA 4EHKA 4BFSA 4MUFA 1IG3A 4RYDA 2XGSA 1MOPA 3CSUA 1DRKA 3UWDA 1XHEA 3IILA 2JJ2A 2IF0A 3AVCA 1E77A 3QXXA 4OKNA 2ZIVB 4RG8A 4A3SA 1DJQA 4XM1A 3HKDA 5HM8A 3EAFA 3F96A 4DABA 4OVKA 2GO7A 3K6JA 2GAAA 1A9PA 2NZXA 3DXKA 1P17A 1JKHA 2WF9A 1QVWA 5JSHA 3INRA 2WJHA 4O33A 4EPVA 3I6QA 2YZNA