4IEEA

Crystal structure of the large terminase subunit gp2 of bacterial virus sf6 complexed with atp-r-s
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
463
structure length
452
Chain Sequence
INPIFEPFIEAHRYKVAKGGRGSGKSWAIARLLVEAARRQPVRILCARELQNSISDSVIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGIDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQANVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTKVEMKQKLGIPSPNLADALMMCMHCPALVREETEIYVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gene 2 protein
publication title Structures of the phage Sf6 large terminase provide new insights into DNA translocation and cleavage.
pubmed doi rcsb
source organism Shigella phage sf6
molecule tags Viral protein
total genus 161
structure length 452
sequence length 463
ec nomenclature
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04466 Terminase_3 Phage terminase large subunit
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4ieeA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ieeA01
4PZYA 1T5LA 3IBYA 4BFSA 4AYTA 2HLDA 4LC1A 3BWDD 2JLSA 4AWXA 1KI8A 1NVWQ 3JVVA 5SZIA 4BLOA 1HEIA 4IOMA 1F5NA 3GLHE 1R0YA 4HAVA 4KLNA 2NO6A 4LK2A 1PLLA 4KFUA 1UDWA 1CXZA 2WWFA 5JSZB 3TR0A 4GRAA 4XSGA 2ZUBA 3BD9A 3K09C 3CW2A 2BHRA 2PMKA 2ZREA 3TVTA 1H8HA 3QKTA 1PLKA 3GPLA 5AJZA 4TN1A 4TLBA 1EFCA 2OV2A 2J5XA 2WM9B 3CM0A 3K1JA 4KV9A 3UMFA 5JLJA 3FTQA 2WPDA 4I4LA 2EFHB 1NLFA 2PX3A 2ZROA 4OI1A 4JBWA 1HA3A 4UNPA 1ZM2A 3A1TA 1X86B 1NY6A 4IKEA 3PCRB 1CR4A 4C7OB 4D80A 2BIFA 2FMXA 3LVRE 4XJXA 5FL3A 5FOWA 1W4BA 4ZDIA 1LNZA 2ZUDA 2WVJA 5G3YA 4A0FA 4ZCIA 2ZSDA 1R5BA 4M21A 4TMKA 2ONJA 4XWAA 5K8TA 1R0ZA 1UBFA 3Q5EA 5KHOC 1TQDA 1S9DA 2FSHA 2J41A 3EIHA 4KLZA 5G3ZA 5HTKA 3TUZC 5M1KA 4URZR 2R6FA 2D2FA 3X1DA 3GLHB 4AY2A 4W9MC 4B44A 3A4NA 5C4MA 1ZM7A 2SHKA 3ZQ6A 1ZRHA 4B35A 4YQFA 1YJ5A 1VG8A 5DI9A 2AHOA 3SFZA 4JS0A 5CDFA 3TW8B 2EYUA 1MT0A 3PUYA 4WOPA 1JR3A 3W34A 1E9BA 2DWQA 1RPZA 2AWOA 5H68A 4QNMA 3LXXA 1OE0A 2BEKA 1PVOA 4OK5A 4YMVA 1NG1A 1G8FA 4KXFB 2MMGA 1A7JA 2ZAOA 4JT4A 4M4SA 4M1OA 3MWJA 2JDID 1DO2A 2ZQ5A 3KUDA 1CU1A 2QMEA 3H86A 2BKEA 3OEEA 3CBQA 4PHFA 1NP6A 3EASA 2C8VA 3U2QA 4B76A 3KX2A 2QENA 2MSEB 4DDVA 3GFTA 1W0KA 3AVQA 3DDCA 2ERYA 4JLVA 4HAZA 3A8TA 1G291 3WHKA 4MYHA 3ZD7A 3PQCA 4YXWA 4RD0A 1ESMA 4U02A 5JJIA 2WJHA 1G7RA 2G9NA 4O0MA 4D81A 2I1VB 4Q9IA 4WZAE 5IK2A 3CIOA 3T5DA 1FW6A 4MGKR 5TB5A 3DL0A 1HE1C 1VYVA 5KYKA 3RABA 3M0EA 1R5NA 1GNRA 1PUIA 2EYQA 2A5GA 3IHLA 3K0AB 4I1SA 3FDIA 4M2LA 4B3XA 3EWAA 1O87A 2DY1A 4TQ9A 1OJLA 2IF0A 3EWSA 3B2EA 1QHSA 2J45A 2EWVA 4Z8XA 5KSYA 4R71A 3CX7A 1XF9A 3ADKA 3AQ4A 4F4JA 4CEJA 1D2MA 2IYQA 3PITA 1LFDB 3AP3A 1F6BA 4LJYA 1OPXA 5EE0A 1KY3A 4P32A 2RHDA 2PL3A 2GBLC 4L5BA 5EE9A 2NTYC 4HLUA 4DKXA 3TNFA 4XD7A 4BFTA 4TZ6A 4CVNA 5AR1A 1I4LD 4TMXA 3G0HA 1KI3A 4PO1A 5GVSA 4P0TA 1RVDA 4RCZA 3U44A 1FP6A 4Q01A 4ESHA 4D26A 3AUXA 4C0SA 1MKYA 4MQBA 5C10A 2EFEB 2NPIA 2ZRFA 2V8OA 1TTTA 2RGEA 3MWYW 3CNLA 1AS0A 2FPMA 2AXNA 4CT4B 2FE4A 4RJLA 5TDHA 2F1HA 1IM2A 2DYKA 4BQSA 4MDEA 3J81k 2JIZD 1UAAA 1VMAA 1VIYA 2RB4A 2PLRA 5L3RA 1HT2E 4LI0A 1CS4C 1NBMA 3KKQA 4QM7A 3CPJB 2AFIE 3TAUA 2HJGA 5JJKA 2VEDA 3KXKA 2VH5R 4FWIB 2DCUA 5E4FA 4HUQA 4A36A 1KIMA 1KK3A 5FTMA 3R9WA 1Z0FA 3K9LA 4LJ8A 3IHWA 4JVLA 3IQXA 3DEFA 2DFKB 3TSZA 2WWGA 2Y8EA 4A1FA 1VTKA 4DZZA 1ZNZA 3LBIA 2HF9A 2J7PD 3EW9A 1N2CE 3QPWA 3KB2A 4DEYA 2EW1A 2YC2C 2AL7A 3KJGA 2IYZA 2P6UA 1A2BA 3AP2A 1IJEA 2EFCB 3NHAA 4JT2A 4WZ6A 3VFDA 4HDQB 2GAOA 1NG9A 3KQLA 1G6HA 2WSMA 1YHNA 4LCBA 3BAFA 4UXIA 1UBGA 4WXPA 4FWTA 3NTUA 1NMZA 4P31A 2O8DB 1NKTA 3NHBA 4CZ2A 3UWOA 2OBNA 3H84A 3UMSA 1T0JB 4D82A 3IO3A 3MJHA 3O47A 8OHMA 4RD4A 4PC1A 1VCOA 3FMIA 3AVYA 1KY2A 4HEJA 2NOAA 4Q5IA 1L4UA 3QSYA 1CTQA 5F9HA 1WBDA 2QN6A 1TQ4A 3VR3A 4OI2A 1EFRD 1A1VA 1N5LA 3IO5A 4QBGB 5B57C 5F3WB 1US8A 1XPRA 1EX7A 4NMMA 1RE0A 1PLJA 1ZBDA 4DLXA 3NG1A 3SN6A 1DG1G 1XEXB 1XZQA 4Q7JB 3THYB 5TARA 1RC8A 1NN5A 2ZRDA 1VHTA 1Q1BA 3PVSA 4NKRA 3OE7A 4LJ7A 1KJZA 1ZP6A 4TYPA 2VBCA 2YNMA 1S2MA 2JDIA 2R6DA 2WIAA 3THWB 2HT6A 1D8TA 1VG9B 1PZNA 4QJ3A 4Q1EA 3K70D 4RZXA 2C5LA 3CRW1 2ZRMA 5SZJA 4Q21A 3P20A 3GEHA 5GJBA 3BORA 1SVIA 1XMVA 4AIIA 3X1XA 3OAAA 3QPVA 1G21E 2JCSA 4YMSA 3PUXA 2C99A 2HEIA 1DADA 3SNHA 4IEEA 2ANBA 1E3MA 2QG6A 5KUTA 2FPLA 5DH9A 2P2LA 1SVKA 3R7WA 4FCTA 3VR5A 4DCNA 5JRZA 1JPJA 3VHLB 3W8NA 3GJXC 3A1WA 5D3MA 3TQCA 2N46A 1E9EA 1FX0A 2JGNA 2NO7A 1T9HA 4MGIR 2ZEJA 2JA1A 3K70B 4PXAA 4UNQA 4HB0A 4B3BA 1E2MA 2A5JA 3ADDA 4K8OA 4B3DA 2IEZA 1LF5A 4M1KA 2ZS8A 2BBSA 3CRQA 4OKSA 3B1XA 1P62B 3RS7A 4KVGA 5KSZA 5M1QA 2OG2A 3C8UA 3N5CA 2OO7A 1SXJA 2C78A 2VSFA 4KFRA 4JBXA 1RJ9A 2V1XA 2CVFA 2KI5A 4OQMA 2XOKD 1IAQA 3EG5A 4BLSA 2ZI5A 2ZE7A 2GEVA 1II8B 3QXSA 4Q47A 1S3GA 1XMJA 5EXTA 4C0QC 5AUPB 1JECA 4MYTA 4M1MA 821PA 2OLJA 2CHVA 4URYR 4PO9A 1ZCAA 2FFAA 4PTLA 1R0WA 121PA 1E4YA 1YZUA 1ELOA 4JL6A 4CYMA 5K8LA 3VAAA 5HCIA 1G8PA 4C0JA 2OM2A 4AKHA 3AEZA 1TQ6A 1Q12A 2IC5A 4PHHA 2XNDA 3R8FA 4C0HA 2QTHA 1UKZA 2AWNA 2CCJA 4UNNA 4B48A 1QDEA 4A4DA 5E95A 3TIFA 1E2NA 4TTRA 5KSPA 4D0GA 4Q9JA 5AUOB 1ZM3A 4OHXA 4XOIA 1ZUIA 2WBLC 3RRMA 1U9IC 2ZRAA 4DLVA 1DARA 3MSXA 2C9CA 3U6KA 2CLCX 1R4AA 1UADA 3LW8A 3B1WA 2YWGA 1R0XA 5FPSA 3T34A 3QXXA 4LUCA 3AKCA 5EJEA 2AXPA 3ZD6A 4P33A 3L8YA 1GNQA 1OT3A 2IUSA 4XVRA 4C3ZA 3CF0A 3U3RA 1TF2A 2IYWA 5DI3B 3CF6R 3KZ1E 1H8EA 4NH0A 1G5PA 3AVUA 2IUUA 4EPRA 1L7VC 3C6AA 4PSVA 4B74A 2AX4A 2IYVA 4KJZA 2FEMA 5CM9C 3HDTA 3UG7A 3OHMA 1CF4A 1KJWA 2RCNA 1YRBA 1PUJA 3FHOA 3HU1A 4PSKA 1K6MA 4Q7KA 4RD1A 3GMTA 4ASUD 3K70C 1KZ7B 3I5XA 2D4HA 5CJPA 3FKQA 5FUYA 1U98A 2XZPA 3ASYA 2Q3FA 3GQBA 4L16A 1OH8A 3JZAA 2G77B 4B71A 1GOTA 4D4LA 2ZE6A 4PC7A 3FB4A 4TYNA 2YWEA 2F3TA 3B9PA 1W44A 1EGAA 1FP7A 5C1BA 1N3BA 4M22A 1XB2A 3SOPA 3KTAA 1L2TA 1U99A 1IONA 2FSFA 1NN1A 1S4QA 4PC6A 5SZKB 1BMFD 2RGNA 3KJEA 2AKYA 2ZYVX 3WP0A 1IN6A 4JVMA 5FPTA 2P5SA 3DM9B 4TMVA 4IJMA 521PA 5E7IA 3HU2A 4KFTA 1TQ2A 1UBCA 1J2JA 2CHQA 2GJSA 1VG0B 4M8NE 1L8QA 1M8PA 4YDHB 4HZIA 3A4MA 5FI1B 3DMNA 1JXOA 1XMIA 1IQPA 1IHUA 4KHZA 1GG2A 4BLTA 2J0UB 4RD2A 3EAQA 1FUKA 5E7MA 3I8SA 3C5HA 3RNLA 4Q4HB 2GJ9A 3SBDA 1TU3A 4ZI2A 1GL6A 3GFPA 2OXRA 1E2IA 5J4HA 2B92A 2XTNA 3D7MA 3T1VA 2JJ1D 3PUZA 4JLOA 2BBOA 4M1YA 1WRBA 2YHSA 4AG5A 1SVLA 3TRFA 1II9A 5BQ5A 4DIEA 5FTLA 2VF8A 2BCGY 1JPNA 2BM0A 1P75A 5JHHB 2PX0A 3FE2A 3OIVA 4HB2A 1ETUA 2QZ4A 4BFYA 1NLZA 2QY9A 3HP1A 3HPRA 1XTKA 1QVAA 3K0CC 1V5WA 4P4SB 1Q3TA 1C4OA 1GTVA 2ZRCA 1HURA 3QEJA 1RRPA 3NIBA 4TLDA 1E9CA 4QBFA 4X8LA 3WNDA 4KO8A 4US0R 1R5OA 4BECA 2YKGA 1KJYA 1OF1A 2P65A 4Q4AB 1W2GA 4Q48A 1KDTA 4NBSA 5JFGA 1QHIA 1XCGB 1UM8A 2GAAA 2FGKA 2MSDB 4ZDJA 1ONBA 2OLKA 4IRUB 4UKDA 1N6IA 2D7DA 2HLDD 4ACAA 1KI6B 1KKMA 5JI2E 3ND9A 1CLUA 1HH4A 2QRZA 2XSZD 5CLQA 3RWMB 2CK3A 1E2KA 5GADl 5M1NA 2CJWB 2GILA 5B2ZA 5SZHB 2QBYB 5GVRA 2ZI9A 1S3SA 4C4PA 4CRWB 4DSTA 3VR4A 2HCJB 3UMRA 2VP4A 2ZR0A 1H8HD 3S1AB 1FPMA 3ZIAA 4UXHA 5KO2A 3CPEA 2FSGA 2EWWA 1Z29A 2HXSA 3RWOA 2WICA 3W5IA 1PV4A 1R6BX 5L3SA 4NHOA 1KSFX 2GDJA 2GTPA 1G17A 2FEOA 4DEXA 4PPFA 2D2EA 1XXHA 4DDWA 3U7EB 4G5OA 2C2HA 1FTNA 4NTZA 1DAHA 3FOZA 1GAJA 2Q0HA 2ZUCA 1UKEA 4PAMA 4DT1A 1X8JA 2F3RA 3BXZA 1XTIA 3FKSA 3O8DA 3NEJA 4IVQA 1KI4A 2FG5A 4D4KA 4NP6A 5DN6A 2FDCA 2WWHA 1N5IA 1XU4A 4NE2A 3DZDA 5P21A 1S1CA 1Q0UA 1JR3E 4D0LB 3KFXA 3PENA 4ASUA 2JLXA 5FI0B 1GRNA 4US2R 3BIFA 2WKQA 2CL7X 1VPLA 4KBGA 1XDBA 3EA5A 5A0FA 1NN0A 4M1WA 4R98A 3SHFA 1HUQA 3TKLA 1OH7A 4MYUA 1X3SA 1ZINA 3EA0A 2OCBA 3AF0A 3GJ8A 1KNXA 5EQTA 3HYTA 3A1VA 4Q03A 2ORWA 3ETLA 1ZU5A 1AK2A 3LFUA 5JWOA 2XNSA 1S9HA 3QJYA 2E1RA 4GI7A 5KNCA 2WWIA 4D4MA 1JR3D 4DRZA 5L3QA 5JRJA 5LDDC 2BOVA 3VNVA 1DS6A 3RAPR 5KTYA 3L2OB 4LHZA 4K46A 2ZIAA 2UKDA 2O8BA 4GOKA 1TMKA 3D8BA 3MFYA 3TQFA 3MJRA 3TK1A 2ZYWX 4I1OA 4U00A 3AUYA 4LOAA 1JALA 3P32A 5JMTA 2NPFA 3OEED 5AJYA 1WA5A 1NY5A 2QPOA 1K5DA 1N6KA 4PANA 2R6AA 2QMHA 5HKKA 3M4YA 2IYSA 1Q3HA 3ZGXA 3IPYA 3X1YA 2HV8A 4IDHA 3SJAA 2OFXA 4PHTA 4HDOB 4YXWD 4C2TA 4YDSA 4PQYA 4BRUA 4GZLA 4CF7A 3WMEA 2H57A 3CRMA 4UXJA 3RS4A 1FMJA 4RCYA 1DAIA 1LF0A 5IK2D 3FFBA 4TYQA 5EXPA 3ZJYA 4F92B 3EZ6A 4GSYA 2W2XA 1AS2A 4B73A 4MYCA 1IN8A 3EZFA 1XPUA 1DBSA 3BB4A 3GJ3A 1BKDR 1GKYA 4LY6A 4LBVA 4TSFA 4DCSA 1ZC4A 3ZS9A 2DR3A 3QUSA 2D62A 2Z0MA 3KUCA 3VTKA 4DC9A 3V9PA 3X2SA 4XWKA 4B32A 3GLGE 1E2HA 2O8EB 2NQ2C 4R7ZA 2JJ2A 3KFVA 1OSNA 4XD7D 3EIEA 2XGJA 1E6CA 2GHIA 5C2JB 1NBME 5AJXA 1AZTA 4KITB 2XSZA 1GITA 3IEUA 4FMBB 1UPTA 1E0KA 1FZQA 1UKVY 4X8OA 4JYCA 1CKEA 3R8CA 2FGJA 3UWKA 4EDHA 3LVQE 2Z5FA 4JLNA 3IDQA 5JEDA 3GJ7A 2V54A 1EFTA 2L0XA 2GJAA 3TH5A 3W6OA 1G18A 4EFMA 1X1SA 2QGZA 3FYHA 4EFLA 2ZM5A 4O25A 2P0EA 5DYIA 2QAJA 3P26A 1RYFA 1NBMD 3RC3A 1D9ZA 2ZJBA 2ZR9A 4OI4A 4AURA 5BYJA 1U2RA 2BJWA 2GA8A 3WNBA 3U44B 2WOOA 1G8HA 1ZVQA 3TSWA 4TYYA 4MKHA 2W58A 4L15A 1FFHA 4Y0AA 2PT7A 4B2LA 4BFXA 4N3NA 5DISB 1EG7A 1COWA 1X1RA 3BJIC 4KAXA 3SE0A 2WWYA 4DLWA 1P7CA 4H1UA 1OXVA 4LBYA 4TWZA 4F4IA 4XH9B 5LB4A 2VYFA 3IILA 3NBFA 4BZQA 4A0HA 3DPUA 2GKSA 2ZI3A 4C0KA 1L4YA 2KWIA 4B6FA 1OIWA 1B23P 3MG9A 1TADA 4HUQB 4QGHA 1E98A 1G7SA 4ON9A 5C12A 4JYBA 5DO9A 4JVNA 5H8WA 4I1UA 4GZMA 2E9SA 2YC4C 1Z6TA 1ZM9A 5KOYA 1O3YA 3DO6A 2YZ2A 4A8JA 5JS7A 2UZIR 1IY2A 3L0SA 4O2LA 4MUBA 3UIEA 2XEXA 3RHFA 2QP3A 1VIAA 1WCV1 4A0GA 4Z51A 3O8BA 1KHTA 5M04A 3NXSA 2OFOA 3PR1A 3I1FA 3C6HA 3CB4A 4HYYA 4F91B 4FMDF 1D2NA 2Q21A 4A2QA 3VMFA 3OE7D 5EP3A 3CWZA 2BM1A 4JZKA 3AB3A 2ZRBA 4NCIA 3B13B 4Q7MB 3FMOB 1W36D 2KE5A 5BWMA 3LA6A 1M74A 1GL9B 2NO9A 2A5FA 2GEUA 3MRSA 4DHEA 1OYYA 2FN4A 4TTQA 3SQWA 3UG6A 1G3RA 1ZNXA 2JEOA 1W0JA 2PH1A 2B7BA 1US8B 2VHUA 3OAAD 5DYGA 3KQUA 2JATA 4TL6A 1SXJE 2IXFA 1KAGA 2BMEA 2G6BA 3GFOA 2WJVA 3KL4A 4HLUC 3UPUA 4M0LA 1KO7A 1QG4A 1QHHA 5C4GB 4URWR 4NCKA 1CBUA 3JVUA 4DB2A 1TL7C 1W36B 5H70A 1KNQA 2ZI6A 4S35A 3CNNA 4AKGA 3WRXC 1IXSB 3H2YA 1J8YF 1YZGA 2GZAA 3NBYC 3JZMA 4D0NA 4F38A 3T15A 3TLXA 1KK1A 2OBMA 4YLGA 1P61B 2IS1A 5CB6A 2JASA 1GVNB 2XAUA 1EX6A 3LBHA 4IFEA 3HWSA 1S8FA 2A7QA 4HZUA 4PSAA 1SXJD 2HJVA 1VYUA 4LGMA 2VO1A 4G01B 3W3AA 2IX3A 2HYIC 4PZLA 4OQNA 2A30A 4KYUA 3CR8A 3R7WB 3ZS8A 5A4JA 4GT1A 2HT1A 2O0HA 5D3MB 3EZ2A 3U3OA 2B6HA 1HQCA 4L9WA 1FX0B 3L0PA 4W5JA 3CR7A 1N5KA 1KI7A 3N70A 4LYFA 2P6RA 2H5EA 2OXCA 3QVUA 2WHXA 5J4LA 1ZCBA 4M1TA 2ZJZA 5IDVA 1YKSA 3RRYA 4GBMA 1ZUHA 2ECKA 4IHQA 2XNDD 4LC0A 3WMFA 1SXJB 5FFMA 3VKGA 3ZZ0A 4LX0A 1RJ9B 1GNPA 1UKYA 4LV5B 5CYOA 3QG1A 5K8UA 3RVBA 4POAA 3TSOA 3GLGA 1OXTA 1P73A 1T8TA 3WRYC 4ILEA 2CE7A 2GVDC 1NVXQ 1YZKA 4DCVA 3NH6A 3TGPA 1C1YA 4ARZA 3MWKA 1P9WA 1YR6A 2C9YA 4NYIQ 2WV9A 2YOFA 2XJ9A 2J0QA 5FPKA 5DIFA 4OHZA 2XITA 1WF3A 4NYMQ 3NWJA 1UEJA 2IL1A 2QNRA 1H8ED 2GXUA 4P3YA 1DE0A 4MKFA 1G7CA 2IA5A 4DSOA 5EZ5A 4BZPA 2JLVA 2GEDA 3H1TA 4QNRA 3G82C 1W36C 5LPNA 1K8RA 1OV4A 4HSEA 4WA7A 3RRNA 3SYNA 2O8CA 1LTQA 2PMDA 3QNUA 5KU1A 1E9SA 2CXXA 2FOLA 3T35A 2QSZA 2C98A 5CITA 4UJ3A 1ZUNB 2CCGA 1VKJA 2EFDB 2J1LA 2OE2A 2IW3A 3PUVA 1W4RA 1BO6A 3EARA 2VIIA 4OHYA 3AKYA 5FOXA 1FL9A 2ZPTX 1OYWA 5B58C 4TL9A 1KAOA 3LAWA 4R2IA 1QVRA 3QKRB 3A6PC 2DFLA 3AH8A 4JBYA 3IEVA 3W90A 3QF4A 4OK6A 3BB1A 5JECA 1YU9A 1G6OA 2ZJ2A 2C95A 1NF3A 2GESA 4BZXA 1E2QA 2PT5A 4IDOA 1GWNA 2NG1A 1RKBA 5BN4A 3F3YA 4OYHA 1G64A 3KKOA 1RFLA 2NZJA 1Z0AA 4MUAA 3T06B 2YYZA 1W48A 1IXZA 3B6EA 3QKSA 4C30A 3B78A 1Z3IX 1K5GA 3KDSE 4M9SA 4DLYA 4HUTA 2FJUA 1SXJC 1TF5A 1B0UA 2GJ8A 2GZHA 3KTAB 1N6PA 2X2FA 3K0SA 1D2EA 3THXA 4ZDWA 2BJVA 4MA4A 4WAUA 4GP6A 4KI0A 1OFHA 2CNWA 3IIMA 2R6GA 2ZANA 4OQFA 3R20A 2ORIA 3WYGA 4EPVA 5KNDA 3RS5A 2CLDX 3CH5A 1XEWX 3GJ6A 4FCVA 5CJ2A 1E1RA 2Z4RA 4OI0A 5DLQC 2REOA 2OCYC 5UKDA 3UKDA 6Q21A 1WBBA 2WAYA 4JKIA 2ODWA 4E03A 5BW8A 2GRJA 4NDZA 3SDZA 1JEEA 1MH1A 1WQ1R 3SQXA 4EPWA 3Q7PA 3TAHA 1CEEA 3U7FB 2XX3A 4DSUA 1NRJB 1CRQA 4D4JA 3HYRA 1Q1ZA 2FV8A 3QXJA 1DELA 2PJRA 4CGZA 2BDTA 2IEYA 2PZGA 1BS1A 1ZC3A 5KDDA 4W5WA 2IS4A 1SHZA 5JCPA 1KSJA 3K9NA 1AIPA 1XPOA 3Q85A 3UK6A 3W9YA 4TLAA 5EUMA 2ZJ8A 2DHRA 4BWYA 3TMKA 5AUNB 3CO5A 3GCGA 1IN5A 4D25A 2XB2A 1MRSA 2ZRKA 5LD2B 3T1QA 4Z1MA 1P3JA 5DE3A 4OHVA 4QKQA 2QPAA 3HR7A 3BFVA 2CK3D 3QPUA 3A1UA 1BYUA 1XXHE 3B85A 4LJAA 3DKVA 1UEIA 1HQYE 1NL3A 4IXMA 3CH4B 4URVR 4O3MA 1E2DA 1FOEB 4LJ6A 3LLMA 2HCBA 5FOTA 1PJRA 5DNYB 2QAGA 2IXGA 5EUQB 3ZIAD 5L8VA 4DLZA 3ZVRA 3I61A 3UXMA 4LDJA 1AJEA 4LBZA 3SZRA 1S0UA 4GMDA 4HDCA 1CIPA 4G1UC 2RGGA 1Z22A 2QT1A 1GKUB 4DXAA 2WKPA 3A4LA 2FF7A 5GJWC 3NBZC 3NH9A 4QGFA 3ZZTA 3WBJA 3SFVA 2RGNC 4XVUA 3R9IA 4W5HA 1DPFA 2GVZC 2VL7A 4FXPA 2FSIA 4LYAA 4ZCLA 2GCPA 1DG3A 1M1YE 3FKSD 1Q1QA 2F55A 2XB4A 2O52A 4ZDKA 5DN6D 2N1BA 2YOHA 2KSQA 4KFSA 3ICQB 4G3XA 1XMSA 5ANRB 2VP2A 3B5JA 4JKYA 4NZYA 5CLLA 3QENA 4B6EA 4GDFA 4OHWA 2GJKA 3ND8A 3X1WA 3EC1A 4XTCS 1XZPA 1E9AA 3AF4A 5L3SB 1SKQA 4I81A 3SI7A 4C9BA 4UNSA 1TU4A 3CZPA 4GOJA 1XXHB 3GLIE 1DAEA 1G7TA 2J7KA 4NCHA 3PXGA 3RRZA 1R8SA 1GZSA 3BC1A 1NN3A 4US1R 3H4MA 4DT1B 3U6BA 4ZIRA 1T8UA 2QEQA 4G5QA 3QF7A 3K9HA 4DDTA 3IKJA 1OXSC 4RKFA 3DOEA 1NJFA 3RSLA 1VG1A 3U60B 5JEEA 3LNCA 3NDPA 4IFBA 4A2PA 4LZZA 2RAPA 2FX3A 2W6JA 1E0SA 2OSBA 4B3GA 2NO0A 4K81B 1IBRA 2IT1A 3I4LA 4U5XA 1AM4D 3I92A 4HAXA 4XSHA 3RDPA 2ZJAA 4IW3B 2O8FA 1KMHA 2I3BA 1KDPA 3RS0A 4OK3A 2O0JA 5LD2C 2ZS7A 3E5HA 4N0DA 4JJKA 1GSIA 2ZITA 1KO4A 3BFXA 3HR8A 3MLEA 1J99A 1OHHA 3Q7QA 2VF7A 4JLBA 1Q20A 4AK9A 1UJ2A 2OCPA 4CIDA 5A5GA 1GDDA 2WJYA 5CIQA 2IYYA 3F8TA 4RFSB 4A2WA 3T1OA 3I32A 2YVUA 1GL7A 4FMDB 4V0OA 1RW4A 2VHCA 5L3QB 4CEIA 3U4QA 2HYDA 3F0TA 4LJ5A 5G53C 3Q9LA 3E2IA 1KI9A 3C4JA 3FMFA 2E87A 3TE6A 5HKKD 3AF3A 1U0LA 4A0RA 2H17A 2YINC 1W4CA 1XCPA 1YQTA 2QSYA 2F43A 1X8KA 2FWRA 2VLIA 3THOA 2O8BB 3CX8A 2IYRA 1MV5A 2LKCA 4D6PA 1NSTA 3I62A 1BYIA 5C15A 1G3UA 4B2PA 4BRWA 4L8GA 2CBZA 3VR6A 4OJKA 1II0A 2G3YA 1P2TA 2DWOA 2GXSA 5KDOA 1E94E 1IXRC 1AQYA 4IOKA 1XEFA 4C2UA 2W2TA 5FBVB 3AKDA 4AG6A 4ZI3A 1E32A 4A6PA 1QG2A 4DUGD 1Z2AA 1JBKA 3AP1A 4TSFD 4V0MA 1OH5A 2ZRPA 4FW9A 1P2SA 1WP9A 1DAGA 1SQ5A 3IPXA 1UBEA 4WXRA 2GCOA 1XWIA 2ZAMA 1OW3B 1XJ0A 2CDNA 3HJNA 2JJ2D 3CKLA 1G3IA 1FUUA 1NVUQ 2J0SA 1MABA 3BGWA 1MR3F 1P9NA 1UFQA 1U0JA 3VX3A 4HLCA 1KSHA 1T3HA 5J40A 3ZYCA 2AK2A 1N6RA 2H18A 5BXQC 1YR8A 4DLUA 1TNDA 1E1QD 3X1ZA 4A6XA 1E2EA 3T12A 5K8IA 3C7KA 4UJ5A 3PG5A 1DVRA 1T3LA 2ZJ5A 1KTVA 5EE1A 1MRNA 2HDNB 2RGBA 1G16A 1I4TD 1KO8A 1HV8A 1OXUA 2IS2A 4HI0E 4L9SA 4O2RA 4C0LA 3H0KA 2LWIA 4L4UA 2GZDA 3I73A 4Q4JA 4MKGA 5CK4A 4YMWA 3SYKA 3AF1A 1QHNA 3V00A 3TJZA 1HY3A 4NYIR 2IF2A 2BCJQ 3TUJC 1XD2A 5FPHA 2J9RA 3KQKA 4GP7A 1COWD 3B8HA 2D06A 1QHXA 2AR7A 2V6JA 4RSGA 2XZLA 2VHQA 1OFUX 3QVVA 2NMVA 5TV2A 4HLDA 3M1IA 1S1MA 3I72A 4RD3A 2ODNA 3GJ0A 2ORVA 1DAKA 2FH5B 4RZ3A 2IK8A 4Q1CA 3L82B 3RANA 2W6ID 3LDAA 4DVGA 3I5YA 1W7AA 1IOZA 1X6VA 2ZR7A 3P27A 4DDUA 1Z5ZA 4J0QA 4II7A 4DCUA 1AKYA 3GEEA 4LRWA 3WMGA 3W5JA 2IS6A 4BFZA 4JL8A 3SEAA 4C0BA 3FMPB 1E2LA 1GIAA 3KJIA 1E4VA 3EXAA 1N6HA 4GMXA 1G4UR 3LY5A 4WBSA 4MDFA 4NL4H 4AI6A 1W46A 3HPQA 3K8YA 5FBWB 3LLUA 1IN4A 1N5JA 2CEAA 3T5GA 3EPJA 1SHKA 2VSOA 4YONB 1ZYUA 1G19A 3RC8A 2ZSFA 3IIJA 4R2HA 4TT3D 4QRHA 3GLIA 5M1OA 4GFDA 1Y63A 2FZLA 3EX7C 4M9ZA 1JNYA 4D2IA 2QL6A 3KQNA 3WYAA 1ZU4A 2J87A 1CULC 2I4IA 4TQUS 3DMDA 2X1VA 4FINA 4V0LA 4G5RA 2O5VA 4A8JB 1CJKC 4DLTA 3OESA 1W5SA 4B33A 1W0JD 1M7HA 2FU5C 2NIPA 1W1WA 4RZ2A 1I2MA 1GILA 4V0NA 2ZE5A 4Q1FA 2ONKA 1IY0A 5C46F 2WTUA 2XXAA 5H1YA 1E2FA 3GEIA 1GUAA 1M34E 3QE0A 3FWYA 3KB1A 4Y0VA 1RZ3A 3IIKA 1U8AA 4JJZA 2BV3A 4X8MA 2XJ4A 5EP4A 3D6TB 5FOSA 4DCTA 4PFSA 4DLSA 1W5TA 2CMKA 1QHGA 2WJJA 3QY0A 1C9KA 3AV0B 5FBQB 3KQHA 4AKIA 1M7BA 2KJQA 3D31A 1E2PA 1U8YA 4C0AC 1KDRA 1GKIA 2VP6A 3T61A 4ZPXA 1KI2A 2QROA 4BFWA 4PQRA 3AKEA 1OFIA 1Z08A 2B8WA 3L0OA 5B30A 3QI2A 3SBEA 5J4VA 4DUGA 4QOSA 4WW0A 1XJCA 5M1FA 5FUVA 3LH5A 1G9XA 3BB3A 2D3WA 4LHVA 3GD7A 1TEXA 1YRAA 4N1AA 1DEKA 4PAQA 1VYTA 3GLFA 4B3FX 1P6XA 3W6NA 4PC2A 5TVKA 4NONA 3QBVA 1KI6A 1W49A 2VSXA 2R9VA 3NBXX 1Z6AA 4RZUA 1UDXA 4NYJQ 5EXXA 1QRAA 2HUPA 2JLUA 5JI3E 4JLKA 1MO5A 2Q6TA 2ZVQX 3KKNA 3P4YA 1CR2A 1E2GA 1E99A 2IYXA 4HZUB 4PAOA 3ZVLA 1E1QA 1D5CA 4CEJB 2G83A 1CP2A 2D74A 2REBA 4UNRA 5C2DA 1U0HC 1I4DD 1Z28A 4JMPA 2QRNA 2RGCA 221PA 1A4RA 1EXMA 2YV5A 1OB2A 3IGFA 5EP2A 1EK0A 1XX6A 2QM8A 1OFTA 3C14C 5G40A 1P2VA 2A5YB 3G5UA 1FMLA 1KDOA 2WAXA 2F9LA 4PPGA 4Q7LA 1YZNA 2IHYA 1AKEA 2ZSEA 4A8JC 4DSNA 1Z0JA 2PEYA 3RSOA 4EJSA 1Q1EA 2V55B 3BH7A 1HT1E 2GCNA 1KO1A 4F4CA 2EU8A 3P1JA 4MKIA 1Z6XA 1OIVA 4JLJA 1T4GA 2I1QA 2P3SA 3GLGB 1E9RA 1KZGB 1Z0DA 3EPHA 2WIBA 2QE7A 2F1RA 5JJLA 4DBLC 2W2VA 1NJGA 3GJ5A 3K9GA 1XJQA 4QG7A 4BLRA 2ZRHA 5HE9A 4NU0A 3A37A 4ARZB 2QUZA 3OIWA 621PA 4LV8B 1GFIA 3BK7A 4EQ6A 4QHTA 4KVAA 1HTWA 2B8TA 3ZVMA 1NSFA 2W6IA 2V9PA 4HAYA 3REGA 1Z63A 3BBPA 3ZQJA 5FUXA 2RGDA 3PUWA 1XCMA 4M1SA 4B2IA 5GJCA 1MOZA 2XZOA 1CR1A 1DOAA 3K53A 3ZDQA 1JEDA 3T1TA 3SR0A 4A9AA 4F93B 3K09A 3OFND 1G4AE 2WSSA 5EXSA 1OB5A 4KBFA 1Z07A 3ICEA 1M2OB 3ADCA 1NMYA 3IQWA 4TT3A 2O8CB 1XNJA 3SJCA 1J8MF 3VQTA 5FR1A 4DB4A 5FR2A 2IHBA 3FPAA 1KMQA 2IXEA 4LHYA 5FBLB 2X8AA 3ZVNA 4A82A 3MUFA 1G5RA 2PLFA 4QHYA 1J70A 5DGXA 1XFAA 3DVLA 1NIPA 421PA 3AVXA 1SVWA 1VDZA 1KYIA 1F3OA 2OBLA 4JL5A 3VU9A 3OEHA 2A3RA 1OLOA 3DOFA 3PEUA 1NMXA 4MH0R 5JWRA 4Q1AA 2N42A 4LBWA 3VNUA 4LSGA 1KK0A 3BH6A 2CNWD 4WVFA 3QF4B 4A92A 4CEHA 4RY2A 1JAHA 4IEIA 2NO1A 4RVCA 3FVQA 4XIGS 4YC7A 1F2UA 2CVHA 4BEJA 2F7SA 2OFWA 1FQKA 3EZ9A 1E1RD 1EWRA 2CE2X 5EZ6B 2H1LA 4GL2A 4N0EA 1F2TA 2P67A 5F2EA 4B3CA 5CK5A 3MCAA 3QKSB 2IWHA 4ESVA 1CJTC 2ZRJA 2WZQA 5E3HA 1OKKD 4LHWA 1W2HA 2OILA 2W83A 1LY1A 4Q18A 3WXMA 1RRCA 3THXB 5FL7A 3TVDA 1F60A 1RRGA 2IYUA 4S2EA 2WJGA 3K0FA 3CF2A 3U5ZB 2G1JA 2YWFA 2J0VA 4MITA 2OEPA 2W0SA 4TYWA 3BRWD 1E0JA 3B1YA 2Q3HA 2AK3A 4QGAA 1BOFA 2O8EA 1Z0KA 1XRJA 1YZTA 1SVSA 1AS3A 4FI3C 4KODA 2VPPA 4ZKEA 3QXCA 1WMSA 2PCLA 2RKOA 2QA5A 2V4ZA 4LYHA 1N0WA 1G41A 1XD8A 1KOFA 5CIWA 4P4UA 5C18A 2NGRA 5C2FA 4Z1MD 1T6NA 5JSZA 4EPYA 1HYQA 1M7GA 2O0KA 2VA8A 4KYIB 4HB3A 1QHYA 3MMPA 4Q00A 1FNNA 2JLWA 5J4YA 5ELXA 2QP4A 2WWXA 5FH9A 2PJZA 1FTSA 4Q02A 4G0NA 1LW7A 1E79D 4MRPA 1EFUA 1N25A 2GK7A 2OCAA 2QQ0A 1BH2A 4XWOA 5TY0A 2ZI4A 1P2UA 4C7OA 1P4SA 4JSYA 2DB3A 4QGGA 3C16C 4BUJA 4FCWA 4QJ5A 3TW4A 1YR9A 3CRVA 1V43A 5EP1A 1Z6GA 2R6CA 3PV0A 3QXHA 3PJRA 5DHAA 4RFVA 5BN5A 2VTKA 4IDQA 5AJWA 1A82A 1E9FA 4Z8YA 2VRWA 2Q9AA 4BEBA 2ODBA 1GRQA 1VCIA 2CLSA 2QAGB 2QP9X 2RH5A 2ZTSA 1ZD8A 4QBHA 1CR0A 4TTPA 5KPJA 3GLHA 1P60A 4V03A 4AD8A 5FTJA 2Z4SA 3MGCA 3U3KA 2GBLA 5BYKA 5IT5A 5IF9A 4LJ9A 2FFBA 1J90A 2BMFA 3M6AA 4OQXA 1DAMA 1SZPA 2QM7A 3KXLA 4TLCA 3SU8A 4X8HA 5BN3A 3O8CA 2GK6A 1FQJA 4EAQA 2FFHA 1S96A 1YZQA 4I99A 2A2ZA 2YOGA 3V4RA 2K5UA 4DWJA 4LPKA 5FBRB 1YR7A 3A1SA 4XVQA 5CM8B 4BASA 3AVTA 1W4AA 3FFAA 4V0KA 1TAGA 1EESA 3OFNA 2XTZA 4LYJA 4JVSB 1A2KC 1SGWA 4IOJA 2IUTA 1Z0IA 2GF0A 1P9RA 5EE3A 4ITRC 2JLQA 2W6JD 1Z8FA 4Q9HA 4QL3A 5AWFC 1E0AA 2ZU0C 3C41J 5J4KA 1SULA 2H92A 3QIAA 4Q1DA 2VP0A 1NVVQ 4JLMA 2VHJA 2OHFA 2ZXUA 1IN7A 1G8YA 1DAFA 4ZIRB 1OHHD 1SVMA 4MGZR 3TR5A 3U3JA 2Z83A 4BLQA 2MSCB 2GWHA 2AD5A 2WMOB 3PIRA 4FN5A 1JQJC 2MMCA 5KNBA 3U61B 2LKDA 1VECA 4MRNA 1NKSA 2BMDA 2R2AA 1W47A 2C96A 2QGNA 1N0VC 3MAAC 4AYWA 3LW7A 3FGNA 3ONWA 4QBIA 5FOUA 5TXGA 2ZRLA 1IJFA 1RYHA 4JLAA 3AVVA 3VKHA 2P5TB 4EPXA 2DBYA 2O8FB 4OQLA 3KXIA 1KMHB 4V0ME 5LB2A 4W7SA 2PCJA 1OKKA 2C9OA 2ZS9A 3K0AA 2RGAA 2J46A 3ADBA 1MO4A 4BFVA 3AM1A 5HR5A 1G20E 3IBGA 4RKEA 4FMCB 2HF8A 1KK2A 4E09A 1LVGA 4ZCMA 4CEIB 1GP2A 3RLFA 3U4QB 1NIJA 1LS6A 2QAGC 3KJHA 3W6PA 2J3EA 2EVWX 3ZZUA 5JCZA 2JAQA 2WWWA 4M9XA 1E69A 2F43B 721PA 1WB9A 1YVDA 4HLQB 1WE2A 2CL6X 3BS4A 2QMUA 5E7JA 1JB1A 2UZ3A 1XD9A 2OT3B 1TPZA 2PBRA 2QI9C 4TMZA 3CLVA 2R44A 2EQBA 3AVOA 2KB0A 3QQ5A 5LBIA 5CB8A 4JSTA 4GPTA 3NDBB 3QOFA 4B75A 4H1VA 3SS8A 4WZBE 5FTKA 1U94A 1RIFA 2R62A 3MWLA 3B60A 3AGPA 5EE5B 4NYJR 3AVWA 1UF9A 3VKWA 1Q44A 3WP1B 1XTJA 1Z06A 2BBWA 1D6JA 1WXQA 4JIMA 1G3QA 3R9XA 4HAWA 4TL8A 1E79A 2H16A 4PR0A 2OAQ1 3EPLA 3NC0C 1ESNA 2GCOB 4GNKA 5TMPA 2WMNB 5HPYB 2GETA 1ZJ6A 2ERXA 3B1VA 2BC9A 1MABB 1AZSC 1KGDA 3SJZA 2BVNA 3NEYA 4U7DA 1R10A 1P5ZB 1NNEA 4HAUA 1T0HB 4LJ4A 2IBMA 5G41A 4AKEA 4ABYA 2VP5A 2RHMA 3Q5DA 3EZ7A 2FZ4A 1EWQA 2JIZA 4TMTA 5JWHA 3LD9A 1U8ZA 2AKAB 2ATVA 3ECCA 1LV7A 3B9QA 4OJQA 2O8DA 3ZLJA 2R8RA 2X19A 1R7RA 1N6NA 4PZZA 3KKPA 5HE8A 2AFHE 3WHLA 3BFKA 3EPKA 4Q4JB 5B64A 3B82A 4OBEA 1AQUA 4FIDA 4TZ0A 4Q1BA 2JLRA 1ANKA 2TMKA 2KBFA 3FHCB 4AC9A 4IVRA 1CJVC 2QPTA 5FOVA 2J7PA 2AN9A 2QTFA 4AYXA 2B7CA 4QXAA 3QKRA 4PPQA 3WBKA 1XD2B 2VQSA 2IYLD 3DHWC 2BKUA 3L43A 3N2IA 4Q19A 1XEXA 1YE8A 3THYA 2JJ8A 4KSCA 5J47A 1JJ7A 1TEVA 4E22A 4LV6A 5JZVA 2OAP1 3LQQA 1NI3A 2EFGA 1TUEA 3QBTA 5HCNA 4GOXA 1U9IA 3SJBA 1LB1B 3THWA 2ZU6A 2Q9BA 2H8KA 3Q72A 1EFRA 4B47A 2IYTA 1Q22A 1QZXA 3AVPA 1AGRA 4CDGA 1G8GA 4KU4A 1VCMA 2ZRGA 4JLPA 1G5TA 4ZV4A 4G5SA 2X2EA 3OF5A 2V1UA 1JJVA 3LX8A 2JLZA 3UANA 2WJIA 2VP9A 1M6NA 3WYFA 1ZNWA 1FNMA 3K0EA 4M53A 5D3QA 4E07A 5KPDA 2CL0X 3U3MA 3CRRA 4EPTA 5F98A 3F5FA 3NC1C 1TF7A 1T3SA 2JLYA 5AUQA 4B43A 1J7KA 4ZO4A 4NPHA 3OIUA 4B34A 3GLIB 2RGXA 4TQAA 3REFA 4BGDA 2C03A 4PO8A 3NVAA 3GLFE 3NKVA 1R2QA 5HZKA 2V7QD 2KBEA 4IXNA 2ZJYA 3I3SR 4LPSA 1N0UA 1KSGA 1GRRA 1ZD1A 1G1MA 1XBTA 3EC2A 3B7GA 1TUIA 3CNOA 2IWRA 5DHFA 2FNAA 4E5UA 2CHGA 2ZETA 3A58B 1QBKC 3L8ZA 1T5IA 4R9UC 1II8A 2DFTA 2XXAB 2ZE8A 2AD1A 4P4TA 1A5TA 3Q8XB 4QM6A 5JS8A 1AGPA 2GXQA 2OUKA 2GNOA 4HB4A 4MRVA 4KCGA 4DLRA 3BH0A 5FPYA 2V3CC 2QMOA 5F9FA 2F9MA 4XTRA 5KSOA 1JXMA 4Q9KA 2C77A 2REXB 4UQOA 4NCNA 3CUEF 1E96A 2XTMA 1VHLA 1EFHA 1JQLB 3PEVA 2ZJOA 1U81A 2XOKA 1RRFA 2BEJA 2D7CA 3DZ8A 3LRPA 2ZYUX 2F1JA 2ODEA 2ZRNA 2ZSAA 3BERA 4IOLA 1JI0A 2CCKA 3TUIC 4RD6A 2PZEA 3OZXA 1D9XA 4H9GA 1NLYA 3WY9A 3A36A 1Z83A 1WDTA 5GJVC 3GLFB 4BPBA 3CONA 4PX9A 1ZIOA 3EIQA 2QQEA 4OL0A 4MRSA 1ODFA 1E2JA 3VX4A 1SKYE 4EKDA 1XTRA 2RMKA 3RS3A 4TL7A 4BE7B 4YMUA 2GF9A 2WOJA 5DI3A 3LQRA 4Q9LA 3RS2A 3LBNA 3MD0A 1GM5A 3CZQA 4F7WA 3K0CA 1R8QA 2V6IA 3U7HB 1N6OA 1BIFA 2W00A 2F1IA 1ZMXA 2HXYA 1Q21A 3CPHA 4Z54A 4A15A 1QF9A 2FFQA 4NYMR 3RYTC 4FD2A 3C5CA 3U7GA 2WPDD 2QE7D 2ZYTX 5FTNA 4QHSA 1ZNYA 3TBKA 4EUNA 1ZAKA 4IVPA 1OH6A 2G88A 5FUWA 4QJ4A 4ACBA 2UVQA 2YJTD 3AGQA 2DPXA 3SHWA 2NZ8A 1OIXA 1XTSA 4HATA 1CJUC 1HE8B 5J5CA 3LO5A 2ZVPX 4CT5A 4DIDA 4EJSB 4TLEA 1E9DA 3QG5A 1F48A 2A78A 3GJ4A 5CDFE 3LXRA 4QFMA 3SYLA 3DM5A 3CWQA 3PEWA 3PEYA 3VR2A 4LWZA 1H65A 5JBQA 1VCNA 4TMWA 3GP8A 1N6LA 3QEOA 1KKLA 4IDPA 3KKMA 2G1KA 2WSSD 1SKYB 2Z43A 1CJMA 3UATA 2ZSBA 5M1PA 3I8XA 1YZLA 1P72A 3N2EA 5HZHA 4EQ6B 2X77A 4M9QA 1Y3AA 3ASZA 1ZM4A 1AA9A 4PHGA 1DO0A 2ZI7A 4JLDA 2P6NA 2B21A 3C15C 4BFUA 4RFSA 2WKRA 1BMFA 2Z6VA 3LWNA 3VHXA 2G0TA 2FA9A 2J0UA 2QT0A 2DFNA 2BMJA 3P4XA 3OEHD 1NVVR 1Z2CA 4URXR 1X8LA 4G5GA 4Q66C 4Q4HA 2GXAA 1LS1A 1MO3A 5L3VA 2QORA 1TX4B 1JR6A 3L0IB 3D3QA 1XP8A 3OIYA 4ERNA 1U90A 2A5DA 4FMCF 1MO6A 5IRCD 4MRRA 2Q3MA 3LV8A 3O8RA 2ZRIA 4ZKDA 4EFNA 2PEZA 3PFIA 1Q57A 3ZH9B 2BBTA 2PZFA 2V7QA 3AF2A 1ZD9A 2Q9CA 4IDNA 1XEWY 3E70C 3VU9B 3QKUA 1JAIA 3BE4A 4P4SA 2F6RA 4PC3A 5FL7D 4YMTA 2VHTA 1XTQA 3VR1A 2A9KA 1W0KD 3IUYA 5DSZA 4CEHB 5IHPA 3CX6A 3FHTA 1AN0A 2YWHA 4V02A 2ATXA 1T91A 2DWPA 3W8RA 4DJTA 4BLPA 2ASEA 1ZW6A 2JJ1A 4LHXA 3E1SA 1F2UB 4Q4AA 1CRPA 4QC2A 1SVOA 1QHHB 5AJVB 2BWJA 2R65A 2H7VA 4PQFA 4NCJA 2G0NA 1I2DA 4CW7A 1KO5A 2LCFA 2OZEA 1KI1A 1ZIPA 3HU3A 4MGYR 1F2TB 2W0MA 4Q4LA 5JHGB 1Z6YA 3BOSA 3DKPA 1G3MA 4PPNA 4EJSC 4WIAA 3WNCA 2ANCA 2QTVB 2J59A 5CYPA 5KDLA 4EIWA 2CJWA 2QBYA 3W3ZB 1DTSA 3SC3A 2OESA 2QU8A 3K0FB 4I1VA 5AK0A 4KSBA 3Q3JB 2C04A 2FPKA 3LX5A 3V4FA 3S1AA 4URUR 1OXXK 1IY1A 3B1ZA 1Z47A
chains in the Genus database with same CATH superfamily
2YMLA 1DKQA 4PZYA 4LC1A 2GKGA 4UEKA 4WACA 2PUJA 5EMJA 3I0SA 5JIBA 5AFUH 1DWPA 3BD9A 1X3MA 2ZREA 1ORIA 3KZVA 1PJBA 4KV9A 2VTEA 3GAZA 1P18A 1YE3A 3D3JA 4X9XA 3SBGA 4CBWA 1OZHA 1Y34E 1PGPA 2G82A 3HB1A 3RSEB 3G8CA 3AARA 1E60A 3MN5A 3RJ9A 3C3DA 4LRXA 1K9MO 4TMKA 2Q45A 4EGFA 1XTTA 2OQVA 2UVDA 4Z86A 4YOUA 1CUUA 3ZQ6A 4JS0A 1I7DA 4Q3DA 4QBKA 3VXKA 3VR3D 1N7HA 1V8BA 4WJKB 4NSNA 2N1MA 4FB4A 1WMDA 1HORA 4OKEA 2I1LA 5HUHA 1XDSA 5T4EA 1CNEA 4IQ8A 1S5PA 4X97A 4C43A 4HTAA 3EMVA 4X90A 1B9DA 3GFTA 5KJCA 1DTEA 1JFVA 1UPFA 3WHKA 1NLUA 2HNYA 1ESMA 3U4CA 4WZAE 4Q9IA 2UAGA 3TCXB 3DWFA 3ONVA 1UMDA 2GV9A 4LIPD 1OJLA 2P68A 2CF6A 2COKA 3AP3A 4LJYA 5G4KB 5E0OA 1QZ3A 1D6SA 2VK1A 4DKXA 3TNFA 4GVEA 1I4LD 2NZUG 2QUJA 1QQMA 1RVDA 4EYEA 3DM2A 1PIWA 1N77A 2V8OA 1K8KB 4YV1A 3FYDA 2NV0A 4MDEA 3K6RA 1BVUA 3B36A 2PDAA 1NYRA 3CPJB 3TAUA 1Q7TA 3KXKA 1DO8A 4FB5A 4ARIA 1KK3A 4AP6A 1ZBSA 1ULHA 1SM4A 4PBSA 3LBIA 1SIOA 5J2NA 4HPJB 2EW1A 2Y67A 5LLDA 3TABA 1Z37A 2GLXA 5EQDA 3BAFA 3H8WA 4P31A 1ZMBA 2OBNA 1Y1QA 1M2KA 1HFJA 1U0BB 4WNIA 5F9HA 1Y8ZA 3E3AA 3SNKA 4ZZIA 3SN6A 4QELA 4Y9SA 1DG1G 1NN5A 4JBNA 4GOND 1S2MA 2PQMA 3ANXA 2WF8A 1VL2A 1YF3A 2X6QA 3X1XA 4E7JA 2C5BA 3PUFA 1NF2A 3GGJA 3VR5A 4DCNA 5KEIA 3ETNA 2NTVA 1RFGE 4M1KA 2LZ0A 4GM0A 3K5NA 1UBOS 4JD2B 4AJLA 3AX6A 4QRIA 3ABQB 1EX4A 3ABSB 3VDRA 1II8B 3QXSA 4QVKA 4U2BA 3NNDA 4NULA 3RIXA 2JFQA 4TUYB 1IBLB 4JH0A 1N92A 5IKPA 1QIIA 1A8HA 1TKRA 4HH0A 5IT4A 4N47A 5K8VA 1ZM3A 2UUAK 1ZUIA 1I7LA 5EWMA 5HJ7A 3T3PB 1UADA 2EJTA 3B1WA 3W0LB 4JYPA 3I9FA 1JEJA 1I14A 3URKA 1IRIA 3QOWA 1PHRA 1LNSA 5BW5A 3EZLA 3SJUA 3D0OA 2D4HA 4WKGA 4DN6A 2WF9A 4BR4A 5CD1A 1FP7A 1OZGA 1N3BA 1BHJA 3E3LA 3CSUA 3GLKA 4OBWA 4MWTA 3S2IA 1O08A 2X14A 1U1CA 2AC4A 2GSDA 4EYGA 3ZU6A 1G4HA 3GN2A 4HN2A 2JVJA 2C9MA 4M8KA 2VSYA 2XUGA 3RRFA 4ROTA 4L3VA 1V95A 1WJGA 2RC5A 3PWZA 1GY8A 1VRCA 1E2IA 4UCFA 5DK5A 1WM1A 3PUZA 4ZAVA 1A2OA 4IINA 4H4EA 4K9NA 1JPNA 3E9DA 3STHA 5K0BA 4HXEB 1NC3A 4BO4A 3K0CC 1V5WA 3TLGA 5HZGA 2AJCA 4UMFA 3OQ1A 4G4GA 4F86A 3I1IA 3NANA 2IGIA 1W2GA 1ONBA 3TSYA 1GV1A 2W2NA 3I9OA 1U2VB 3L4QA 2OD7A 1J0CA 1JIVA 3T3DA 3HRKA 3A2LA 3DBHB 2GB4A 3S8EA 1KGSA 1H8HD 1U3TA 1QFYA 1B8UA 1EHCA 4IIEA 2RHGB 5GINA 1J4AA 2Z56A 2C2HA 3J7ZO 4PAMA 3V4IA 5LXTA 4IVQA 1B0PA 2D8AA 2B4AA 1F2DA 3ZSYA 3BIFA 3FYUB 1QGYA 4RZQA 3EA5A 2P41A 5A0FA 1L3TA 1MG5A 4K5QA 3VI3B 1XQVA 2NTNA 5A6SB 3A1VA 3ZUPA 3LFUA 1ORRA 4FFOA 1S9HA 4NU8X 1BMTA 4PGAA 4RJJA 2O5EA 1Q95A 3NDJA 3QVGB 3D81A 1JHRA 2CDRA 4RFLA 1ZQ1A 3WGGA 4CIVA 3H2HA 2CZGA 3L46A 3FF1A 5C32A 2EZTA 1Q3HA 4NU6A 3F6YA 4ZOEA 1LDMA 5EYPB 4KXQA 1FMJA 1I32A 4F2PA 4TYQA 4F92B 5KOHB 1IN8A 1NFQA 3EZFA 4TSRA 1IL0A 4LY6A 2O4UX 4YOTA 3FB1A 3NUZA 3K1AB 1CUAA 2O2YA 4UCWA 1LBEA 2CB0A 2D62A 2Z0MA 3V8PA 4C1NI 1PG0A 3C6YA 4MR7B 3NTQA 3EIEA 2HBRA 5ELMA 3RUPA 2H7CA 3H1AA 3IEUA 1OT5A 1WCIB 3NMUF 4RSHA 3PC8C 1HPMA 2BP7A 3FOBA 5IJWA 1YDGA 3I05A 4AHSA 4MEBA 5KTRA 3DT6A 2QGZA 2ZYDA 1HNXB 3F5DA 3MT8A 1MUUA 4R3UC 4IR7A 4C0WA 3DMYA 2IE0A 1BRMA 3OZVA 2ZBVA 2HNBA 3GCXA 4GEGA 4BX0A 3CJAA 5JISA 3GPBA 2P1JA 3DPUA 4DNOA 3C74A 1EDBA 5ESWA 3UJNA 2DTXA 1N8NA 4I1UA 1XT6A 3L0BA 1BD4A 2Z30A 3LRXA 3NXSA 2A9OA 2BMAA 4WOKA 3OE7D 1FDVA 4RKQA 4DCMA 3CWZA 1PE0A 1JYSA 1BOOA 5HP4A 2V6BA 4KXNA 4CEZA 4U0KA 2NU8B 1QIGA 1P4AA 4DQDA 3PX6A 1VQMN 1US8B 3AIIA 1MB3A 1L3VA 2QHXA 1NGIA 2PZKA 4S35A 1IEWA 3AZPA 3H2YA 1U6IA 1YL6A 4QLOA 2QRUA 4AJ2A 4BQEA 1P61B 2F9FA 4ROSA 4A26A 4MEAA 2A59A 1QQAA 1VE9A 2O0HA 4NOKA 2DE0X 3GGPA 4IRXA 1M1ZA 1J06A 2F64A 3F71A 2WHXA 4REOA 1ZCBA 4JCOA 1C29B 2QRMA 2X5XA 4NNJA 1SXJB 3OVNA 1JQ3A 4AS3A 3DCJA 4Z9AA 3WRYC 3N3BC 3EGXB 4ARZA 2ZZNA 3OETA 4GZ5A 2QB5A 1Q0ZA 5FA6A 1K6EA 3S2SA 5K6AC 1E5XA 3E18A 4ND8A 1K7CA 3QH4A 1W52X 4QNRA 3G82C 3YASA 1K8RA 3QNUA 4BRKA 4DV6B 5LP1A 5G1OA 4FWNA 3CUWA 2IW3A 4GX0A 4DQIA 1UJNA 4NB4A 3CFYA 1RZUA 1D7AA 4TV9F 1IPHA 2ZJ2A 4BZXA 1POWA 3KAQA 2Z1JA 5LQDA 1ACMA 4BVGA 1LWNA 5JAZA 4D9KA 4DLYA 1OI3A 3BSSA 2RKWA 3VQ6A 3THXA 1UXGA 3NHPA 3RVQA 2JH9A 2J07A 1G9SA 5DHQA 3GJ6A 2XNJA 5E1OA 6Q21A 4RS3A 4JWTA 5IT9A 3QW2A 1WBBA 2WAYA 3K9QO 4IV0A 3N2KA 5HEKA 5ECDA 3UAVA 4S04A 1ZICA 2BE7A 3QXJA 5AVSA 3TO5A 2I2AA 4OO3A 2CFTA 3K9NA 4KWHA 3GGGA 2BUCA 2UVPB 5AUNB 2AUNA 3ETCA 2NTEA 5EPEA 1TYQB 2CK3D 4BNDB 2Q5CA 1NL3A 2D13A 3H3OB 4J2TA 1SBZA 1NAIA 4D9JA 1NGBA 5A5DA 3IUCA 3ULDA 5E41A 1S0UA 1GSAA 3EQ9A 4CCHA 2WKPA 5GJWC 3NBZC 4LYAA 2J9FB 3QLJA 4LY7A 3E22B 3NIWA 4DV1K 2C7BA 2MDTA 1ODLA 1RC0A 5ANRB 4OHWA 4KG7A 1G7TA 2D1RA 1O9GA 3BC1A 2FZEA 1T8UA 2B8NA 2QEQA 5JV5A 4A5SA 4EJ0A 2BH1A 4IKOA 3TTTA 3LNCA 3M49A 4R1OA 1QC5B 1SU6A 2X42A 2OSBA 3TSUA 1EVIA 5F2RA 2O0JA 3DBVO 3E5HA 3CUSA 1JEQA 3NBKA 1Q20A 4IKFA 1ZWKA 5CUQA 1YTUA 2A67A 2PKXA 3SHVA 5CDGA 4JK7A 1PK7A 2I2BA 3TE6A 2WFLB 2H17A 1W4CA 3IAFA 4XR4A 1NBIA 4ZHSA 1U8TA 1YB4A 2WHRA 3TNJA 2W2TA 1X77A 3AKDA 5GAEP 2XKJE 4DJJA 5B5SA 3TJMA 4NNPA 1Y5MA 3DJFA 5JC8A 4E3WA 2CDNA 1NVUQ 2BL4A 1Z4OA 2OWDA 3H11A 1WWKA 4N7JA 4HLCA 1YR8A 2VVTA 4KQWA 3X1ZA 2ZJ5A 1GXSA 1WMBA 5JCOA 2EKBA 2LWIA 2F1OA 4JWKA 1ZBIA 5AQVA 3A1FA 4OM8A 4X41A 4XX0B 1MVNA 3TB4A 1TMYA 1UM9B 3AMVA 3RK0A 4MIYA 3QVVA 4K42A 3E9PA 1KXZA 1PTJA 1DAKA 4Z3DA 4FIZA 1M8FA 1Z5ZA 4FC6A 4J0QA 3W5JA 2FSVC 1AD2A 4BQRA 4BY9C 3SF0A 1VDMA 3IT2A 1B0AA 1SHKA 5KB3A 4DFPA 1G19A 1IBCA 4QRHA 3ANYB 3BMCB 5ICCA 1GTZA 3HBFA 2VHYA 4REQA 1UWBA 3A6HA 4OKJA 5ALOA 4V0LA 3HB0A 3IP1A 3NHGA 4GPD1 4B08A 1SEPA 4Y2XA 4H5WA 2XJ4A 2PH5A 3MJSA 4AKIA 1E2PA 2Q5JA 4CHPA 2UUCK 5JAUA 3EXIA 3W5SA 3N8NA 4HCJA 3ZT0A 4LHVA 1IRXA 3IE0A 4E4YA 3E9RA 1G8MA 5TEWA 4NYJQ 4M6WA 4UPVA 2IYFA 3TINA 1PNQA 1ZGHA 5KPZA 4NPCA 1EM6A 2J9XB 2RGCA 221PA 2BFCB 1KQGA 1S1TA 2G28A 4MB2A 3NBMA 5EKDA 4JK9A 3HY3A 4CQMD 1HYBA 1UINA 1JR2A 1M2NA 2F1RA 4MP8A 1WZNA 3E53A 3N2NA 5ADWA 4MW4A 2LDXA 2XZOA 4EA8A 1M66A 2Z2KA 3SR0A 3K09A 1NJ1A 3PPIA 1ZJ5A 4MMXB 1Z07A 4R40A 3OYAA 1FB5A 4DIUA 3UAXA 2IHBA 1P0CA 3AEUB 3MUFA 4C88A 1U9ZA 2OBLA 1RBMA 3RRGA 4J6EA 4L3QA 2ACVA 2NO1A 3DW1X 1JG6A 2LP4Y 4YC7A 1F21A 1FQKA 1DJQA 2HGSA 1XLUA 1UOOA 5EIAA 3TCNA 3EC7A 3AR5A 4TVKA 1M2VA 2YWFA 4CZEA 1JR4A 2C0CA 5MGBA 3VAYA 4NAUA 1F7VA 3QXCA 1UJ6A 2ONCA 4JUAA 2CJYA 1GTRA 2O0KA 4KYIB 4EOGA 3WLKX 4FX2A 1VBKA 1SY7A 1YDFA 4U2DA 1GAEO 3E15A 1JIJA 4JYAB 2ZI4A 4E3ZA 3ZT3A 3ANTA 3VUEA 4OHOA 4X6LA 4IDQA 3VBCA 4Z53A 1M2JA 4HNSA 2XF8A 3MGCA 4C7MA 3OZUA 1JHZA 1T3GA 1ZGGA 4E89A 1C4WA 3P2OA 4URFA 1FBNA 1RHUA 3G5MA 5AQGA 2DFVA 3JQ8B 2IUTA 3TMAA 1Z0IA 1E66A 1Q0TA 4COKA 5J4KA 4W8GA 3DRRA 3M8PA 3UB2A 3A2MA 4V19S 3BMQB 5ARBA 3CX4A 2I7DA 3VF4A 4D9CA 4ISBA 1NKSA 1IJFA 2X9LA 1MQ9A 1Y7PA 3VO2A 5BW6B 4W7SA 4MHOA 4FKBA 2K2WA 5EHIA 1Z4JA 3PDIA 4O4HB 4BFVA 1G60A 5HR5A 3LYUA 1PJAA 3L02A 4DL9A 2HIMA 4GI2A 1KK2A 5JASA 3U4QB 1NIJA 4B3MK 3JQBA 4O33A 1WXDA 1U4SA 4HAOA 4UMDA 1YVDA 3ESYA 2UZ3A 2Z57A 4UARA 5AKXA 1JG2A 2WVHA 5LBIA 1K2VN 2YR0A 3TX2A 4WZBE 4U3JB 3C6QA 5DULA 3C3PA 1E79A 3Q87B 3DV0B 2GCOB 5AOVA 2XOXA 2DAPA 3UHJA 1ZJ6A 4RTQA 1NNEA 3W8DA 3IJEB 2WTAA 4XE5A 2W71A 2W41A 5JWHA 3LD9A 3ECCA 1A8UA 2O8DA 3ENBA 2AFHE 5B64A 1CVRA 4Q1BA 4EEZA 3NV9A 2DHEA 1PR6A 4TKMA 4YAEA 4QXAA 3QKIA 3MA0A 3T9CA 3QU5A 2WSLA 4TTJA 3IP3A 4EABA 1SG6A 3EEQA 3QLHA 3UMJA 1G5TA 1LLFA 1NLMA 3DAGA 3ZJ5A 4WQ5C 2AYZA 2CMDA 1U80A 3KD5E 2COUA 2O4CA 3DT8A 1M8JA 4YGYA 3O90A 4QDJA 4IBNA 2DHDA 3REFA 4FGZA 5I7EA 3WGOA 4KQ9A 1WZ2A 1P1RA 3DYVA 4N7RA 3WWZA 1QQTA 5I9MA 4I7FA 3KQSA 2Q6LA 5BR9A 4Q15A 4BKPA 3U81A 5KSOA 1PNOA 2VZ9A 4KXLA 2XTMA 4GYWA 2XNKA 5KOJB 3T38A 3AOEA 2FR1A 2Q41A 4GWLA 4LD0A 5JSKA 4ND2A 2G40A 3GP3A 3TX6A 1WMEA 2H08A 5LCXA 2RMKA 3NUGA 2ZB4A 4HDAA 4G5FA 3DFZA 1JLGA 1R8QA 2XUQA 1BIFA 2W00A 3BGSA 4B79A 4L2IB 1KEVA 1HRDA 3HVJA 3TBKA 1Q11A 3SHWA 2BYTA 2PLWA 4RTRA 3LQ4A 2F9TA 3OTQA 4JNKA 3OKPA 5CYFA 1Z62A 3KKMA 2G1KA 3E9EA 2UYCA 1BFUA 3N2EA 4S1VA 4IDAA 4WJZA 2Q6OA 4BEVA 1ISMA 2VHEA 3AOGA 3CCQN 3GEGA 1BMFA 4IJ5A 3VHXA 2ZKLA 1CV2A 2DFNA 4FYHA 2BMJA 4G5GA 2WTMA 3SKVA 3B5IA 1XL1A 3ZDXB 2IPXA 4FMCF 3Q4GA 4MRRA 3LV8A 4KWTA 4YASA 2P9FA 1JAIA 2UZAA 1HE5A 2FPWA 4WNYA 5DSZA 3BL8A 4JUCA 2CUKA 4LHXA 1F2UB 1QP0A 3M7IA 4QC2A 1B43A 1TK3A 1RBQA 1NRIA 1CG6A 2O20A 3DYIA 1TGYA 1F2TB 4GM1A 1Z6YA 3M1FA 2HJRA 4MQMA 2FAXA 2ITGA 3PY8A 4LYEA 4E2XA 5AK0A 3GT3A 2JJMA 2JWKA 1V11A 1Q6ZA 3P5BA 2HLDA 3OQ6A 1NW4A 4KLNA 3ENVA 3EW7A 3OA0A 3DLPX 1OZAA 4IHJA 4XSGA 1PWEA 3VVCA 4OYYA 1JDJA 4DA4A 3L6CA 1B6TA 3RFUA 2OV2A 4G09A 5BUZA 4KHUA 3GVHA 1H3FA 1LFAA 4I8XA 2FMXA 3I6QA 3OQPA 2ZUDA 1E7QA 3CF4A 2C4VA 3I6ZA 2B4KA 3QX7A 4NCGA 1EJ6A 3Q5EA 1Z34A 4DR2K 1NI4A 4FJNA 3MEQA 4EKNB 2QA4N 4YQFA 1YJ5A 4OHUA 3LF1A 4HGZA 3BF7A 3WEEB 1TC2A 2QJWA 3KAPA 4BREA 1YACA 2XGOA 1OKJA 1Y7IA 3PHHA 3W34A 3LCVB 1DC3A 4L85A 4F85A 5DJ5A 2BEKA 2YY6A 1XAHA 1C80A 3E9MA 3DL2A 1DX4A 2NRXA 2CYAA 3MTBA 5CB4F 4YOWA 5FAKA 3MWGA 3O3NB 3RUDA 1I2BA 2GO7A 5IVKA 4FLXA 4WY2A 4YLEA 1TYCA 3JAKB 3RABA 5DLEA 3A9WA 1RBSA 3EWAA 4RKYA 3M5CA 4YRMA 4R8VA 1C30A 5IAKA 1UOCA 1OX4B 2V0GA 2JBAB 4F4JA 2ZKIA 5LYJB 2GBLC 4DPLA 4EUHA 2FPPB 1NJ6A 1MKYA 4XOUA 4XUGB 1PFKA 3ZEAA 4MW7A 4CMIB 4A59A 2DYKA 2RB4A 4PCLA 3C3YA 3IDOA 2WWTA 4QM7A 3AHDA 2PAFA 4MB0A 5E4FA 1KIMA 1O95D 3PKIA 3DEFA 3Q3CA 1GKKA 2V7PA 5ALYA 3QLVC 5I7UA 4AULA 3EW9A 3QPWA 2VNKA 4DEYA 3GOQA 1ZLXA 5C24A 2GAOA 2WSMA 2IVOA 3IDSA 3F9CA 2WDPA 3OQHA 1V37A 1ZOOA 8OHMA 4JEIA 5E38A 3HB4X 4QPNA 4FZ3A 4NMMA 3IB6A 1VGVA 3DE4X 1EP9A 1ZH0A 3REQA 3NGMA 1AUPA 4IIFA 4BQOA 4B3TB 2VWKA 1TDJA 1LK0A 4NS4A 3O0TA 1TCVA 1JMYA 5SZJA 4KYTA 4YIKA 3PUXA 3N53A 5JAPA 1A7AA 4RQTA 1LK5A 3LTEA 1SVKA 3CC2N 2N46A 1UWKA 3VUFA 1PK8A 3GZNB 1FX0A 1T9HA 2ZEJA 3ZX0A 3I30X 2G4VA 3ZU2A 4OKSA 3RS7A 2FMTA 3L8EA 3N0TA 3N59A 4JBXA 1WTAA 2P51A 4DMGA 4UAGA 4JIGA 3JD2A 3ERCA 4B8WA 1PR3A 3FF4A 2FFAA 1R0WA 2H9IA 5DWVA 3BD8A 4RQAA 1I2CA 3R8FA 2GJ4A 5GWXA 3CEPB 4WY5A 3CR3C 3O4NA 4RPGA 2DBZA 4WXMA 3SYMA 4A4DA 3RQIA 4D0GA 4HDKA 4Z49A 4R0MA 4P38A 5FPSA 1NJSA 3A6EA 2RK3A 4WK0B 1T2EA 3L8YA 4WZBB 4DU4A 3DLHA 1NW9B 1GLCG 3TG2A 4PVCA 4JUDX 2WMDA 2FEMA 4ND6A 3HFGA 1YZHA 5IABA 1ZCFA 5ALRA 1Q2UA 4W9RA 3RU9A 2QS9A 4C5AA 2VDNB 1IJBA 1N2CA 1BCRB 3VGLA 4D6XA 3UK7A 3U4LA 1WHSB 4L0MA 1CY6A 4MP3A 2HHAA 1WPGA 2AFHB 1MB0A 5DVZA 1J2JA 4CJ4A 3R3JA 1R9NA 1L7QA 4YY3K 4X71A 5ITWA 2V9ZA 2P5OA 1ZRMA 1LEHA 1UC8A 4Y9RA 1VGQA 2OM6A 3P38A 5TQ2B 1K3TA 2ST1A 3IDFA 1SQKA 2WTXA 3HYCA 1A7KA 3V1TC 2YKGA 4E1JA 2X2PA 1XI2A 1JA9A 4IRUB 3OZBA 2YJEA 2FFRA 2DY4A 2FPGB 1H05A 5DT2A 5C25A 1C0LA 3JQAD 4J1SA 4FJHA 2HCJB 3G0DA 2YL2A 1AB6A 2P7IA 1FPMA 4UMEA 2O2GA 1CJSA 1RI3A 2VBIA 2ZWPA 4CEOA 2Q0HA 1ORDA 4DT1A 2C07A 1KI4A 5DN6A 2FDCA 1JR3E 3OM8A 3S2EA 2GEBA 3F9IA 3WKDA 4M1WA 1HUQA 4RW9A 4MYUA 5C0YA 1N36K 4Q39A 3HYTA 3NRJA 1M1YA 1NGEA 3L3VA 1PR1A 3TTCA 1JR3D 5K0ZA 5EHXA 2BOVA 1ZBFA 4E14A 1H2WA 1B14A 3Q3IA 5ES3A 4K46A 4HX2A 3LQKA 1VXOA 3P32A 5IT0A 2WIDA 4KGVA 1K5DA 1C1XB 2WHPA 2EKDA 3M4YA 5JANA 1KTIA 3SJAA 5EI5A 1LW2A 5C35A 2G1AA 4PQYA 4GZLA 2IU3A 1HFKA 4QUDA 3OLCX 1VI5A 3OBBA 2QW0X 1XPUA 1ARZA 1KPGA 2ZBDA 4Z4IA 4DA8A 2B3DA 2XHEA 2IXBA 2RHOA 1SUFA 3KUCA 1E2HA 4F11A 1I9CA 2JJ2A 4DGQA 4PG4A 1E6CA 3TD9A 5JNRA 4FMBB 2NVUA 3OC6A 3DOJA 3KC2A 1DEJA 3WISA 3AVHA 2CXRA 5A7HA 3PKZA 4DSFA 2VPZA 3R0JA 2ZR9A 4RAOA 3I9MA 5BYJA 1J9ZA 2BCEA 2BKAA 3OTOB 4N3NA 1K4KA 3G7UA 3R6DA 4TWZA 3U49A 1ONPA 4WWHA 5DU2A 4IUYA 4MI9A 4M3WA 1UBUS 4WX2B 1R0RE 4QUJA 1GQSA 4WINA 4V24A 1LQTA 3QFFA 4Z51A 4DPKA 3I1FA 4I6MB 4QPPA 2NO9A 2ASOA 4UPEA 3F4BA 2FN4A 1NXOA 3PDCA 4UBJA 1W5AA 3UPUA 3HGQA 4MW9A 5I9EB 1QG4A 1UWLA 1XK6A 3ZT2A 5JD3A 4V1CI 5EKTA 1U8FO 2GZAA 4QEKA 4D0NA 3LDHA 1T8SA 4BQQA 1U3CA 1MPTA 2HM7A 1EX6A 3KQWA 3LBHA 2A7QA 1X7GA 3AJEA 4X1KA 3VQ9A 3BCSA 3U80A 3EZ2A 1JFFB 3N70A 4OHPA 4MAFA 4DNQA 3FOEC 4E2YA 1V25A 5ERYA 2QOEA 3AVBA 1T8TA 4FPBA 4CM5A 4F3YA 3TGPA 1L6IA 1UP4A 4MV7A 5DTQA 4DF3A 1DUVG 3CNHA 4NYMQ 2D0CA 2Q3LA 3P83D 3DMGA 3M5WA 2AG0A 4YT4A 2ZPTX 1V3TA 3VO9A 1YK0A 1YU9A 5F7ZA 5HROA 5BOSA 1HSOA 3UXEA 2X2OA 1MRZA 2R6ZA 3B78A 4CMEA 5DYYA 3FDJA 3RRXA 3B6PA 5HK8A 2R6GA 3RS5A 3UC9A 2DRIA 2REOA 4LJLA 1UBJS 4DEVA 3RBVA 3Q88A 3BEDA 3RSCA 1WQ1R 4GGPA 1WEHA 3DO5A 1K8XB 1K8QA 1XEAA 2IYAA 2VFAA 3ZX2A 1HDCA 2ASVA 3FW1A 3KLPX 4GP9A 1S02A 5K8CA 4DRXB 1KSJA 2FETA 1XPOA 2ETXA 2ZBQA 1FVHA 1RVV1 4XEUA 2IVNA 1JEYA 3OLVA 2DUUA 1TK5A 1HETA 1JVSA 1FOEB 3IPAA 1L7DA 2OVBA 1GN8A 1QH8A 4NMWA 3ZVRA 5TT0A 3AJRA 1GYPA 4GUDA 3SZRA 1G8AA 2Z2ZA 2MCFA 2C7RA 4GMDA 4IQ4A 4G1UC 3ZJVA 3KZOA 5CZ2A 3CS3A 3A1EA 3MWEA 2O7SA 2NNWB 5CCDA 4LSWA 1A04A 5ADVA 2WUFA 1I94K 4ZDKA 5CLLA 4PG7A 3T9EA 1JA1A 2QYTA 2YMMA 3N2ZB 2J7KA 4CKWA 1PX2A 5HBMA 4G5QA 4I9GA 3VRHA 3RSLA 2ID9A 2N47A 1WVGA 3VPGA 1KYQA 1U4BA 1D1PA 3HXKA 1IKXA 4Q3CA 1E89A 5A2QO 4TRNA 3CCCA 1YCGA 4N0DA 3RLIA 2L19A 1KO4A 1J99A 2OA8A 4OXNA 4BRSA 5CIQA 3F8TA 3F7TA 2HCTA 1AO0A 1PT7A 3Q9LA 2E87A 2ZIFA 5HKKD 1GZHB 2WIGA 4RGVA 5CVJA 3M6XA 2VLIA 4D6PA 3LYAA 3LUDA 3UK1A 1DEXA 2X0IA 3HCRA 3QUBA 4LE0A 3PQ5A 1PJ8A 4LRQA 4FW9A 4FSXA 1VQ1A 2OV3A 1OW3B 2EWSA 2GEJA 4N9QA 3WI7A 3DB1A 1M2WA 4RLHA 2WPNA 1UMCB 1DVRA 4CK3A 1JIXA 2BFEA 2W6ZA 4MLDA 1Y9JA 1SC1A 3H04A 4K6GA 3JQAB 2OCKA 4D6YA 3ZCPA 5TPWB 4C07A 4YRFA 2C2XA 1COWD 3GAFA 5KYWA 2AUTA 4IWNA 4IF4A 2IUYA 2N9UA 3RANA 2B61A 4YP1A 2QLFA 4M55A 4EHAA 1PAUA 3DEHA 1A98A 1NURA 3QFRA 3O38A 1E3TA 3FR8A 3TFQA 1VSJA 4GPBA 2ZSFA 3DI6A 2PWBA 3W5BA 1ZU4A 2ES4A 2PV7A 3DMDA 5E3JA 3N0VA 1W1WA 1VAZA 1YBHA 1GILA 4CIGA 4JJZA 1J2EA 4YJ3F 5LVAA 4EJ2A 1YOBA 4DLSA 4N54A 4WKBA 3KE9A 3RROA 4GOMD 4BFWA 2JS7A 2I66A 5D84A 3HEMA 3WSWA 2XY5A 3FNBA 4O1HA 3O9UA 4LSNA 3EL2A 1QRAA 4UM9D 2GDZA 1E2GA 2OC9A 1OWOA 2E4ZA 4HH1A 4I5GA 4PU0A 1NULA 3HXTA 1I4DD 4CZHA 4OB7A 3WHPA 2PD6A 2YBDA 1P2VA 2GCGA 3HEBA 1M72A 3GGSA 2RAFA 5BSWA 3K59A 2NO4A 1ZWLA 1Z0DA 5F9MA 3HCPA 5HE9A 4CE6A 3VTHA 1V1JA 4G84A 4HAYA 1Z63A 1CYEA 1J2YA 3U56A 1CZLA 4M1SA 4W1PA 2FR0A 4WQMA 4BN0A 1QJ4A 2W93A 4TT3A 2O8CB 3HJGA 2QR5A 1VI2A 5TVGA 2EF1A 2X86A 5JWRA 5K8JB 3ZU5A 5ALLA 3BH6A 2PBFA 2REQA 3ER8A 1ZRSA 1PQPA 1LPAB 3UZUA 1IG3A 2DT8A 5E3HA 2J9ZB 1FUEA 2B5OA 4C05A 1YKFA 4LFCB 3VPXA 4BIMA 5FADA 3MGBA 4QGAA 2VAPA 1YZTA 1SVSA 5DASA 3QYAA 4JUFA 5ILQA 3CIFA 3MAGA 5L51A 4RH3A 1TL1A 4LRYA 2XMBA 4DA9A 3WFIA 3EVNA 1FNNA 3HL0A 5AQZA 5AVUA 5FH9A 4DTOA 2IGTA 4ENUA 4CEEA 2R1TB 4W5TA 4C7VA 3VJKA 4PS0A 1GFZA 4DHYA 3TEMA 4NENA 4DDHA 4DLNA 2RH5A 1CNMA 2CVPA 3ISNC 4HS9A 3GLHA 1YDEA 4G0YA 5IT5A 3V8EA 1U2GC 4OQXA 1SZPA 1DV2A 1SA0B 3TW8A 4BR5A 5AKLA 4I99A 4YYEA 3IJ5A 2JFVA 4MA5A 4A2BA 1K1EA 2Y71A 3G9TA 4QL3A 1H42A 2ZU0C 4IL5A 1OUMA 4QYWA 3PXEA 2R4QA 5JSHA 2VHJA 3V4PB 4NXMB 3HDGA 3HK2A 5ALFA 3EGCA 4BLQA 3UXHA 2AD5A 3PJEA 5AW2A 1W47A 3LW7A 1QGED 4RMHA 3HPGA 2WHQA 3OZTA 1TU0A 3IMEA 1A77A 2PCJA 3UJDA 2RH4A 3N0RA 3UKUA 3K7EA 3QTBA 4WJLA 1BGWA 3IA2A 3K5WA 1D1QA 2X9VA 4CF2A 2BEUA 4AS1A 2WUEA 3GUUA 3WV5A 1T4CB 1YMQA 1HNVA 3D2FB 2FB9A 2E0IA 3GBVA 3GJQA 4GPTA 3SZGA 4O2AB 5I8PA 1KU6A 3VKWA 3HO1A 1VJDA 2H1WA 2PSJA 4HAWA 3X1KA 4D9EA 3MXJA 2FJPA 4GNKA 1I1OA 3K30A 1XLTC 3P2YA 1T0HB 1ZC6A 2FZ4A 5AK3A 2DLDA 2O05A 3VZDA 4P4LA 4AJ1A 4AO7A 3G1TA 1V9CA 3JRXA 2Z58A 3EKUA 3WHLA 4J2HA 3H17A 3MJDA 5CDHA 4AC9A 2QPTA 1RCFA 1YB6A 2IIBA 4KIJA 1VPWA 1OI4A 1VMKA 3RKRA 3EDRA 1GTSA 1CZ9A 1GUFA 2V52B 2JZOA 2HPHA 1U9IA 4A23A 2EP8A 5EEGA 1LV8A 1YC2A 4G5SA 5FWYB 3OYIA 2WJIA 1R16A 3EG9A 1V2GA 3II6X 1E6WA 1S9EA 3VU8A 1XMOB 1J7KA 1ZH8A 3KJFA 4OLBA 3EC2A 2NLOA 3L8ZA 3DTVA 3GXOA 4I4NA 4QDOA 3QETA 2G6TA 2CXTA 1Z2DA 1WY5A 2GPBA 1L4GA 4IO8A 3WZ2A 3WA7A 3DE1X 4CJEA 1NXSA 1Q0PA 3TUIC 3KOXA 1JI0A 2H2HA 3OZXA 1D9XA 3CNBA 3NCIA 3A36A 5GJVC 2JVIA 1K66A 1WVMA 4PX9A 1L7OA 1ZIOA 3LCJA 5KWJA 1SKYE 5IJ0B 3K2BA 3R0QA 2I3AA 3RS2A 4ELTA 1PSZA 2QW1A 2P1RA 5ALDA 2C00A 1Q21A 4I5IA 3OMWA 3S3MA 4OA8A 1QVZA 1XTSA 2ZJ1A 2R00A 4DIDA 5JROA 5BMOA 3DM5A 1YK1A 3PEYA 3B3QA 1NM5C 5BYBA 5JZBA 5LMUK 4IDPA 3OJ0A 2FW1A 2CJFA 2O54A 1YZLA 3IKTA 2KMLA 4M9QA 3SGLA 1TW3A 4M3NA 4JJFA 1DO0A 5IPFA 1I4OA 1LV5A 2B21A 2ZXEA 5BSHA 2Z6VA 4CWAA 2QT0A 1JN0A 1KDYA 3T1YB 1LS1A 5KPTA 4IXCA 1Y3IA 2OORC 3OW2M 2DTUA 3PFIA 4RM3A 3AF2A 2XAAA 3ZNQA 4G0WA 1XEWY 4PBTA 3H97A 4P4SA 4F6RA 3AEQB 1W0KD 2HHWA 1VE7A 2DWPA 4MO5A 3H1FA 1RNLA 1TM5E 2G0NA 2RD2A 4YCLA 1MO2A 3AUKA 1ZJYA 4BE0A 2A4KA 5GAGP 2YHWA 4QYMA 2QWMA 3DDOA 5KWVA 1SKAA 4BAZA 1I9GA 3V4FA 3VEYA 3UT5A 1PQUA 4Y2VA 4IOMA 4XAQA 4Q6BA 1AKRA 3PNKA 1QU2A 1G66A 2PMKA 4HFRA 5AJZA 1GPKA 2DWUA 2J5XA 4LVUA 3GUYA 1P74A 3VEVA 3TGWA 1IN1A 5F2KA 1X39A 3NWPA 3CLKA 3QNMA 2VTDA 5L4SA 4LNUB 4YCDA 4IEFB 1X92A 2JAHA 5KHOC 3HSTB 1TQDA 4FFBB 2R6FA 4B44A 1T13A 4B35A 4TWIA 3MNFA 3ZJ4A 2JD1A 3U17A 2EHGA 4ZJZA 4QNMA 2C8JA 4OKIA 1TAUA 1NVMB 5GV7A 2GBGA 1NU0A 3CBQA 3VGKA 1NP6A 3F2VA 1WW8A 4HAZA 2IOHA 4RD0A 1M2EA 4WYBA 2G9NA 1G7RA 3OO1A 1HE1C 5CCEA 3GLUA 4EUEA 1PUIA 1HOTA 2ZCJA 4I9UA 1UKCA 4WESB 1LFDB 3SWWA 4Y2TA 4OIFA 4H15A 3ZCTA 1YCDA 3SZ2A 5LBUA 1J7JA 3T3MB 5KTOA 4TZ6A 1ONOA 5JZMA 4HO1X 4C4YA 1QOZA 2HFJA 2YJFA 2JF0A 3MOSA 1EAYA 2G80A 3AUXA 4C0SA 1ECLA 4KNVA 5LYYA 2EFEB 2ZRFA 4ALLA 5DLYA 3OQNA 3MWYW 3CNLA 4CT4B 5JLAA 1QNLA 3BF1A 4WZAB 5L3RA 3F6CA 1NK5A 4XDYA 1JEOA 1LRLA 1IBMB 3IHWA 2IJGX 4P5PA 1VP9A 4RIIA 4NE9A 1XOIA 3CMAN 4ZCSA 3H84A 2I7NA 4RD4A 4X62B 3CCSN 4Q5IA 3LPNA 3DP7A 1RLUA 1CTQA 3LKBA 3JQDA 4KQJA 3WJ1A 4PV7A 2WONA 4CEBA 4H0CA 3SEQA 2E4XA 1D8TA 5KNLA 2WQ7A 1G21E 5IKMA 3EWNA 3RMCA 5AM3A 4DR3K 3KZNA 4FCTA 4DE5A 2QM1A 1O5TA 1QYRA 3LCUA 5EQFA 1GLEG 1IZYA 3NLLA 4YRAA 5B1EA 4C06A 4B3DA 1CXUA 3C8UA 4KN5A 1RCTE 3DLEA 2C78A 3VVMA 3C6TA 1N32K 3MCZA 3LZDA 1KD1O 4FNOA 2KFZA 3PHCA 3VH1A 1R8YA 4B46A 1RT5A 1BMQA 4P5EA 2GA9A 4FOIA 3DZGA 4FJKA 4C0HA 5AMXA 1Z8DA 1VJ5A 5DGIA 1ND5A 1J09A 4H6WA 2A9VA 2NYUA 1VMEA 1HE2A 2QF7A 1QGUA 2QWPA 4ZOLA 3ZD6A 4MUIA 5IULC 3KZ1E 2NRVA 4U6NA 1JLSA 4GX1A 3T19A 1K6MA 4FFVA 1BL3A 3EQZA 4O5AA 4JI4B 3BCUA 4HG2A 4B71A 1GOTA