4IEFA

Complex of porphyromonas gingivalis rgpb pro- and mature domains
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
197
structure length
192
Chain Sequence
RNPQVRLLSAEQSMSKVQFRMDNLQFTGVQTSKGVAQVPTFTEGVNISEKGTPILPILSRSLAVSETRAMKVEVVSSKFIEKKDVLIAPSKGVISRAENPDQIPYVYGQSYNEDKFFPGEIATLSDPFILRDVRGQVVNFAPLQYNPVTKTLRIYTEIVVAVSETAEAGQNTISTFTGFEDIYKSVFMNYEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gingipain R2 Pro-Domain
publication title Porphyromonas gingivalis Virulence Factor Gingipain RgpB Shows a Unique Zymogenic Mechanism for Cysteine Peptidases.
pubmed doi rcsb
source organism Porphyromonas gingivalis
molecule tags Hydrolase
total genus 32
structure length 192
sequence length 197
chains with identical sequence C, E, G
ec nomenclature ec 3.4.22.37: Gingipain R.
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08126 Propeptide_C25 Propeptide_C25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3800 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4iefA00
4IEFA
chains in the Genus database with same CATH superfamily
3DVFA 2CLVB 2W0PA 3KEHA 2H3KA 3N1MC 4RNRA 3LKNA 3MBWB 4XMXA 2Z1PA 3HG1B 2AVGA 3SBWC 4L4JA 5H8DA 3BZEB 4Q9RH 4YDZA 2Q10A 3VFWA 1ZANH 1I7RB 4U7MA 5E94A 3TBWA 1NKRA 1HEZA 1U91B 1BREA 4AOFA 3TBYA 1CFTB 2W9DH 3BSHA 3KCWA 4OCSH 3VWJB 4HT1L 4X5XA 2WYHA 4PJHF 4W9LC 4WI8A 1TCRB 3QORA 4X6DF 4MAYB 3T2NL 4I3RL 5L7XH 3ILQC 3KCPB 1XF4A 2MHAA 1KJMA 4POZC 4UM9B 5B39A 2DQFB 4UANA 3L4XA 5JORB 2CHZA 4G1MB 2CK0H 2C4FT 1X7QB 5I0DA 2H6PB 4M5SA 4KQ4H 3V6OC 2GBUA 2X0VA 1ESOA 5IF0B 4U6VH 2BDNH 1BFOA 3GSWB 3FCTA 3AACA 1UXMA 3OLEA 5DUPL 2DMKA 3MRJA 4N2HA 1PW3A 1XAUA 3BKYL 4GS7C 4U1IB 3M46A 2IDCA 4XNBA 1W8OA 4R5TA 3A4AA 4GY4A 4AQAB 1CFVH 1PDKA 1NAMB 3R06A 4ZAKD 3DC0A 2YPKA 3GZQA 3QULA 4I18A 1KZQA 3QUXB 1BQHA 2LU5A 3D2UD 1I82A 3ARGD 3M8OL 4M6MH 3MV11 3VGHA 4LLVB 2VQ1A 3H9HB 2XTJC 3P9LA 1T04A 4GI9A 5LN4A 3MNVB 3OAZH 1PD0A 2WXGA 4GSXA 2FCBA 2WZAA 4IK6A 4R4FH 5AVZB 4PJHA 1IGTB 2R0ZL 4L8BB 5DFAA 2JJUA 1MHEA 3HB3B 4A66A 1HX0A 5B1JA 4PRIE 2I9TB 1EXHA 1EMTH 5EZIH 2Y06L 1WZ1L 3A4DA 2DYPA 3QCTH 1KJ2L 1ZT4A 4HV8B 4OGAC 1NFDF 1UC6A 3ESNA 3ZTCC 5FFGA 4C83A 1SYSB 4HJEA 1MAMH 1UM4H 3DX9B 1MFNA 4AIZB 1ITCA 1ZXKA 2WTOA 4HUNB 1CFMA 5JHAA 3SDDB 1ICTA 4OQTH 1W72A 4X4ME 5LCVA 1KWKA 1NCTA 4N2LA 2AJXL 4XNQA 3GM8A 1QWUA 1I1AB 2Z9TA 4FQ2H 4OZIE 1RZ7H 4LHUB 4YL4A 5DMGD 5MENA 2BVOA 3QFGA 5DD0H 3PAVA 3NFNA 1RY7B 3T4AC 4IBVA 4MDJA 3FKUS 2V8LA 1CB4A 1TETH 2V33A 4ZD3L 1AD0B 4YEEA 4I8DA 4X50A 3ZE1E 1CFQA 1DQKA 1XTLA 2ZD0A 2AGJL 4H1LG 5E1IA 5F7BA 2QPEB 3ABGA 3WS3B 1J11A 3BZ4B 4R26L 4UOJA 3FNKA 4X98A 1VFAA 1JIBA 2EVIA 2R56H 1NFDA 4LDCA 5E94B 1HEZB 4DP9X 2WUCL 2YMXH 2VLJD 4I87A 3EZJB 4R4BA 4RISL 3TBYB 4KPHH 3PV6A 5EU3B 4EUPA 4RDQF 4JFXB 1WYJA 1HHHA 3RZCC 3DOHA 3OKMA 2QZ5A 3TASA 3DKHA 4JMNA 4LOUC 2HRGA 3ATFA 1E28B 1XF4B 5GS1C 3VFTB 1RXLA 3ZK0A 1XEDA 4NUQA 3H2WA 4AM0Q 2FJGA 5SX5K 2YAOA 1KB5L 2Y5QA 3VI3F 3SGEI 1OM3H 4HH9A 3U0TA 1QA9A 2Q3ZA 1FNGA 4GXUM 2EILB 5HY9A 5DEZA 1BFOB 4KDVA 3FCTB 4Y4FD 1ZLDA 3D0LB 4J4PD 4L5FH 1MFBH 2EJ1A 3CSFA 2GUYA 3Q8EA 5KTEL 3S36H 2YPKB 3QULB 4I18B 1A6UH 1TG8A 2NY5L 2VIRA 3QG6A 4CN6A 2CR6A 3CH1A 3ZL1A 1TTCA 2VQ1B 3CXHK 1T04B 5E9DA 3B9DA 3QFJB 2JKLA 2QSQA 3WKNA 4ZAKA 5GS0L 1AQKL 1R3HA 3FCSA 4XZUA 5AZUA 5F3BB 2XN9D 5K33A 2Y6TE 4M8UA 4PJAF 2HWZL 4PJHB 3D2UA 2OP4H 4EZMA 2XYBA 3ARGA 4PTUA 4X6DB 4P06A 1QQDB 3IFLL 3BAYA 4KUZL 4Y9BA 3LD8C 4PB0L 1PX4A 5F7LB 2YN5A 3HI5H 1J5IA 2BMKA 1QNZL 2DYPB 1EANA 4WHCA 5KYWB 1XGUA 3VI3A 3HHSB 2WVTA 4ZUVA 5I75C 4K5LA 5DWPA 2FJFB 5A7EA 2X1PA 2E4TA 3EOYG 1QUNA 2BSCA 3PJSA 4MLIA 1W72B 1U8MB 3FPYA 2CUIA 1ZLUK 5ICUA 3GHPA 3NGBB 4BK8A 2IH9A 4U05A 4XMLL 3SJVB 5F72S 5E2TH 4FULA 5CGTA 1MVYA 4ODSH 4MB5A 3NCFB 4FQ1L 2E9WA 5AVRB 1EBPA 5KANG 1KENH 3L81A 3C5ZD 2J55A 4AV4A 4KMTH 3RTQC 1O9WA 3BGFB 2JCCE 4HCIA 2PWEA 1WQVT 1GHFL 2OR9L 3BT0A 4NWUH 3PGFL 5JPMA 2ATPA 4TULL 5C07E 4ESKA 2J21A 1IC5H 2OKMA 2JKSA 4HU2A 5C0BE 1DBAH 3LNDA 1EGJL 3F7VB 1SVBA 3FYEB 4PJAA 4YXKH 2DAVA 3HC0B 4DP5X 5I5MA 5LNGA 1UTDA 4WO4A 2G60L 1DQLL 4C4KO 3T8VA 2VXQH 4Z0XA 4CW1A 1J0IA 3ZKXC 2CO1A 3QI9C 4X98B 3ZL4H 4A55A 1XWVA 2VAAB 4QRPA 3HG5A 1A1NA 4JREC 5E6ID 5C9KA 1ZSHA 3WDJA 1EXUA 1QTPA 3GPEA 3PWVA 5I1IH 1G1CA 4HZLB 1U8LB 2BVTA 3PV6B 3TFKC 4OZGF 3KPPA 4H40A 1S3KL 3V0VA 4K9EH 3N9GH 1MFCH 1VCBC 3ARVA 1JS4A 4KZCA 4RMVA 3KS0H 3CFKA 2Q7NA 2BFGA 3B9AA 3FCGA 3CBJB 2OSLA 1EZSA 1PKOA 3KXFB 4FXLA 2VLJA 3TEXA 3TVMA 4AKQA 5KW9L 4F93B 3NRFA 2VN3A 4YE0A 3RPIA 4XAWL 3OLDA 4A7SA 4HH9B 3N43F 4EXPX 1QA9B 2EH8H 1HK6A 2J5WA 4OY9A 1HHKB 1ONQA 4ZBJA 2AQSA 5IM7A 1Z1WA 1QFWH 2XY2A 5IVOA 2I32A 4AM0A 2XFGB 5FYKU 2LFEA 3LEVL 5TE6H 5E2VL 5D4IA 5DCCA 5EOQH 3FMGL 3RDJA 3TA4D 1HWGB 4HS6A 4HDIA 4AT6B 1F1GA 3BPLB 5ALBH 1KFAH 1NBZB 5EN2A 3CFQA 4ZUTB 5E8NA 1CLOH 5BRZA 3KG5A 4Y4FA 4KMQA 1J9CT 4M5ZH 4G7VL 4IKNA 5E9DB 4J4PA 3QIUC 2FYVA 2ISDA 3V4VA 2D7MA 5I76B 2E75C 2ITFA 3MROA 4G9FD 3FCSB 2VL4A 5D5MF 2B1AL 5F0PB 5FWQA 4G42A 4PW4A 4G59C 4PTUB 3ISYA 4R7XA 2WIMA 1JNLL 3GYRA 5IQLA 3LS4H 3WS6A 2W0FA 4ELKB 3X12A 1INDL 4D9RE 1SOKA 3BP4A 4N0RA 1DP0A 2MTPA 3EYUH 2JCWA 5ICZB 2QQLL 4GG6F 3RWCA 2X4NB 1JMZA 2G9KA 2Q7AA 1ZS8A 2XN9A 5GIRA 3JVGA 3CLEL 4UTBA 1ZA6B 3OXSA 4F8PA 1HIMH 5INDB 1U92A 2O5XH 4JDTH 1BA9A 4P2AA 4XH2A 5EZLB 3FB6A 1IKNC 4I3SL 4OU3A 5TTRA 1UZ6F 3ZZ1A 1PLBA 1OW0C 2NX5B 2P45B 4KO7A 3JTSA 5KSAC 4DO5A 3S88L 2P4AB 3L3OA 5KVEL 4Z7UE 1JPST 3II3A 1YEFH 2EUVA 2D3NA 2QHRH 2VDNB 3C60A 2XZAL 1CCZA 3FTSA 3H3KA 5FKPA 3EO0B 3FUNA 2BZ7A 2C7UA 1E65A 5JPMB 2ATPB 1ZOXA 2XWTB 5D5MA 3QEGL 1GGTA 3C5ZA 4DP4X 2ENYA 1WHOA 2VSDA 4MNHA 4QRRB 1O75A 5C7XL 2CBTA 2KZ1B 1T0MA 4GG6A 3TH3T 3O3BA 1MFEL 5KN5B 1V10A 3PP3K 2Y1VA 4PJ8C 4PLKC 1EXUB 2E56A 2Q5BA 4Y4KC 1ZV2A 4YWGH 2CD0A 1BAFH 5B4MC 1U58B 3HMXA 4QNPE 4HMDA 4B9FA 5KVFL 1HFUA 3OR7A 3MAWA 2WLYA 1JUFB 2HAZA 5BZZA 1IBYA 4OZFB 2OSLB 3PWJA 5E6IA 3UO1H 1E9PA 1CF8H 3TT3L 4YDLB 2R2BA 1GW0A 2EO7A 5LB1A 3RBSA 2A77H 4O58L 1XZ0A 3UMNA 3FO1B 3VU2A 5D96B 3LPWA 3SCMD 4XVTH 1ONQB 2EVGA 2EIBA 3ILQD 5L4MA 5ICXA 3SPCA 4P04A 4POZD 4AM0B 4HEPA 4B27A 5EIIA 1GKOA 4BKTC 2CRMA 3U30C 4HDIB 2ENSA 1IAII 3U4BH 5INCA 3BGMA 1KIPA 1QASA 4YHPA 2YBGA 3BAEL 5E8NB 1Z0MA 4X9FA 4L5FE 1S9WA 1V3KA 2IV9A 4M7JH 4OJAA 2ZJSL 4M93B 2ZG3A 1XB3A 5DJAA 4KH2A 4HWNA 4MJ6B 4L8SB 2C4XA 2KZWA 2JKRM 2IPTL 4OZGB 1GC1H 4CJ1A 3MUJA 2EE2A 3QQ4B 1ASPA 1FVDA 2APSA 3P3TA 4WCYH 5FAAA 6PAZA 4RFEB 2DQJL 1IGJA 3NIFE 4UQ3A 4ODBD 1S9YB 5K59E 4OAWA 1WUNT 1ZJBA 2D0FA 2WZ6A 4MJID 3QJZA 4ZX5A 3U4EB 3K8KA 4G9FA 1W8EA 1HYSC 1BD2E 2VC2L 3PQYE 5GIRB 1XBDA 2XN9B 1UD4A 5F89B 3N43B 1CR9H 3OXSB 2DLFL 3H85A 3I02A 3FB6B 4LU5L 4J1UB 3B2DC 2CR3A 1KTKE 5CSZA 4ZO9A 3JTSB 4WV1C 3TOPA 1IAMA 3O3EB 5BQDA 4ZMYA 4OGAD 2BHFA 2FVNA 1XIWD 3L3OB 4XBMA 2XIDA 1RK1A 1HHGB 1YAIA 5IWLC 3JWOL 5FDYA 5KAQG 1QFUL 3SQRA 2XX0A 4K8RL 5IB1B 2H45A 4H20L 5DFVC 3D87B 4GKOA 3EYVA 5CR8A 1E4HA 4P0DA 3UCRA 1H8LA 1SY6A 3GO1L 3RWGB 3IMUA 2GITA 4NKQB 3WTUA 1TQUA 5D5MB 5DJ6A 3CSGA 2AANA 3KBHE 3GKWH 4IEFA 4DKAA 3BSZL 5FHBH 1PAMA 2NY4C 4PYHA 1JFQH 1T0MB 4R0LB 4HU8A 2NPLX 3MV01 1QFOA 1A66A 4NWTL 3TFBA 2BNQD 2R1XB 3RLSA 2HYMA 3HLKA 4QY8B 4AQOA 2J6EL 1FVCA 2XG4A 4U4BA 3FFDA 3SGJC 1RIVL 2XZQL 4UNVA 1H3VA 3P02A 2PO6C 3IBOA 1WBZA 1U6AL 1NUDA 4HFWB 4KAQL 3EHBD 4UINL 3U6XS 4N68A 5HHNA 5IHHA 4OFKA 2K3HA 1ZTXE 1Z66A 3PWJB 5C0JB 4KGJA 5D4JA 1MJJA 2YK1H 4I2XA 3LZFL 4FFWD 4LCCB 3UTQB 1A6WH 1XZ0B 1UB6A 4BSWA 3CZJA 4XNAA 2ZNWA 3GBMH 3TIDA 1D5MA 4WFGE 4U1HA 3WTXA 3P40A 2WGXA 1WUZA 4M3JA 4PJ5D 4LOUD 3QZBA 3ZHNA 4LGRB 2FD6H 1E50A 3QNZA 4N2CA 2ZX9A 4L18A 1OAQL 3BH9A 4OM1L 4TQ8A 3VFPB 3CZFA 5FUCE 4D3CL 3BGMB 1QI4A 1SJXA 5C0AB 1DFBH 1A6ZA 4YHPB 4NN5B 5E95B 2Z7ZA 5A43C 1YEJH 1S9WB 2R2EA 3F7PC 3ZO0A 4QRBA 1HSAA 4HCRA 5DJAB 3WIHA 4OLYH 3P0VH 3NA9L 3QYCA 4AEHH 3TT1L 1SBBA 4YSOA 4PVBA 1Q72H 4XVJL 5IB5A 1H9VA 2AXJA 2NNAB 3MRGA 2X3CA 3V6OA 3TBCA 3BPNB 1RPQA 3LNEA 4UQ3B 1GZQA 3S3SA 3DX7A 4YDKH 4BV1A 2AXFA 4UQDA 5GZOC 3X1GA 2W81C 1RUQH 5AALA 1JXFA 4K94C 2HTKC 1AR1B 3BP7A 5C0IA 3HMWH 4ZQTA 4M29A 5KS9E 3VFGH 3P0GB 2E74C 1O6VA 1VEMA 4OVUA 5J6HA 2R29L 3AU1A 3FYIB 4MJIA 2Z8WC 3V4VL 3CFIC 5F9AC 1Z2KA 5FO9A 2ZXGA 5D8JH 3KGTA 3VXTB 1T22A 4XN9A 2OM5A 4Z6AT 2JK5A 3QQXA 5CEZD 2IXQA 3WAJA 3V4LA 3WL9A 4FYTA 5AAPA 3O6LL 2P3YA 4YDMA 3SQOL 1WIUA 2BIMA 4WEMB 2VOTA 5L88L 1OP3K 3MLPA 1BDYA 4MD4A 4TSCH 1M42A 2C26A 4N0YH 1QEWA 3WIIH 1G87A 4XNUH 1KTLA 2VQ4A 3C8HA 4BFOA 1Z9SA 2VO5A 2EXWD 4ODWB 4Z76A 4OKVA 1XIWA 3OWEA 2KYIA 3T9WA 1AO7E 3DJRA 3MLYL 4ACPA 4PHZA 1R9FA 1YNKL 1FE8L 3STZB 3FTXA 5E8OA 3WEOA 4FJZA 4C4UA 2G4EA 5JHBA 4XP6H 5CJ5A 3C8KB 4ZMNA 4OH2A 3KLSA 1JNNL 2XBZA 2DRUA 3H6AA 2LGNA 1P69B 4IBUA 1VLXA 2GK2A 1T7XA 4ZTPH 1EX0A 5D93C 3KAAA 4JHWH 4DP6X 1MHHA 1V7NH 1ZLVK 4KY1H 5AQ0A 4BQ9A 3F12B 4KNQA 1P1VA 1QBAA 4FABL 4X7SL 4BFIB 1OCRB 4HF5H 1H3TA 1JYVA 1AZCA 4XMZA 2BNQA 3FO0L 3L7FA 1QSEE 5EB9A 4BRVA 1MJJB 4Q4IA 3H9ZA 3C09C 4Y5YC 4F7CA 3P77A 5I19H 2EZ0C 4Q6IB 5MHSD 3MRFB 4HUMB 5I8KH 1N3NA 1UYWL 1R75A 2JXMB 3GIZL 1D5MB 3NCYP 3DPBA 5J5EA 2E8ZA 2AQTA 4TVPE 3V6FA 4OT1H 2J88H 43CAA 3GI8L 1INEH 3F84A 3H8NA 4LAQL 3VFNA 3WN5C 4HHWA 1TMCB 4M43H 3MO1A 3QNZB 3K1KC 1C8PA 1XGQA 4GBXC 3EFOB 5FYJH 3SCMB 1KOAA 3QUMA 2VDPL 1B4TA 3AC0A 2JB6A 3DSNA 5L0QB 4PJ5A 1ZEAH 1S5HB 4JCWA 4WJ5A 5B38G 2ADYA 4IBZA 4PJ7F 5F7AA 4L9LB 1HSAB 5E5RB 3KW7A 1S5IH 4FLHA 4D7PA 2WVUA 5IB5B 2GTQA 1MVUA 1UURA 1WBXB 3L6FB 4RGNE 4X6EA 3TBVA 3WKYA 2H41A 4OLXH 3X1NA 1UA6H 3Q6FB 5A2IH 4N0UE 1GZQB 3L5XL 1JRHI 2DQGL 2UZIL 3DX7B 3PXHA 5E2WL 4CVZA 2BSBA 3LCYA 1Z3RA 2F08A 4V11A 3QIUD 3OPZH 2GKIA 1EJOH 2R59A 3L08A 5FECB 3BP7B 4WWNA 3SSGA 5IIEA 4PBWD 4NRZA 5ALCH 1V7MH 4LESA 3C2AH 4DVBA 3ULSB 5DJDA 4Z5RA 4XC3L 5KYYA 5B1BB 3GMLA 4TLSA 4ODUB 1JAEA 5HGDA 3MXWH 1T22B 1R47A 4HXBH 1G7LB 2BW5A 4NO0D 2VITB 2IXQB 3QZOA 3ZPDA 1HXMA 3WL9B 1NMAL 2KDGA 3ZVVA 5AW3B 5T5FA 3UZQB 5F6HJ 1F3DJ 3FBKA 32C2A 3RHWF 4QXGH 4MD4B 1QEWB 2IAMC 5DURD 1QACA 2CRZA 2WXFA 3B3IA 2DMHA 2F1AA 2F1EA 2PW2A 5CCHE 5CZVL 4PJ7A 5A2LH 1YYLH 4CN1A 1KTLB 5TF1L 5D7LE 2DM2A 2JWYA 4Z76B 1XH2A 1XIWB 2WGNB 3BVDB 4ICWA 1WBYB 4HVBA 1ID2A 1IKFL 2J8UF 2G75B 3NSYA 4XMVA 5HJBA 3SD5A 1A7NL 5BQ7B 2QV4A 1IBDA 3HVDA 4U6HB 2ZOLA 3U36A 2EYTA 2V3DA 5F7FA 1MRFH 3GBDA 5DYFA 5D7JC 1OCWH 2RIKA 3IMSA 4FKKA 3JBG7 2XQYA 3PHSA 4FHKA 2ERJC 1ZV9A 4UZGA 4H4NA 1FNHA 3S35H 1ZLSL 4WGVB 4OTXL 1AQDA 1MHHB 2HT3C 2GEQA 4HW6A 1JZIA 1SY6L 5IVXA 3FT0A 4APXB 1HXKA 4GJTB 3B2UD 5HSFA 2H47C 1QVOB 3BAKA 1AXSA 2VB5A 5B3SB 2PR4L 5I74C 4PJ8D 4TNFA 3AM8A 4KK6C 2ROYA 2EDTA 3IDNB 1WISA 4F7CB 3NCJH 1NKGA 2C9VA 2V2WA 3BN9C 3P77B 3ZGIA 4AZUA 5A2FA 4DPBX 4ONGH 1BM7A 1IBGH 3EHBB 1LO0L 4CMMB 5HD8C 1G4MA 2BXZA 3W39B 3HE6B 3FU0A 3W57A 4HWZB 5DJ2A 4MA8H 43CAB 3VFNB 3E6FB 2ZX7A 3D50A 1USZA 1JXDA 4JKWA 1HI6A 3QQDA 3CLFL 4NAJA 4WHDA 1KLUA 1LEGB 1RERA 3DSNB 5D7SH 1N6QH 2ENPA 1Q9LB 3F05A 3RWJB 3RFZC 5DJYB 1S7XA 4HKBB 1MIMH 5AWNL 4ZTEA 1NANH 1AGCA 5C6TH 3V79C 4NQUA 4PGEA 3CFBA 4MNQD 2WP3O 4P2OD 5JMRA 1RJYA 4HQQL 3DI2B 4NJAL 1QR1B 2H7WA 4AYBA 5CS7A 3VAEA 3DWTA 4MZRA 4A63A 1TYEB 3CXDH 2CUMA 1JYNA 4QTIL 4FADA 5C3TA 3BD5A 5I18H 4JZNA 3U1SH 4JPSA 4NSKA 4LARH 5IIEB 4NQEE 1WLHA 1QLRA 1YEDB 1YDPA 3KGRA 3GEWB 4XNXH 3NZHL 4HCRL 4AENB 2DICA 3UCQA 3TWCL 1AFVH 2P46B 3QIUA 4NAQA 5HGDB 1OALA 1P0SE 1ZCRA 1LNUA 5H2BA 1HYSD 4YS4A 4IKKA 4RDBA 2FB4H 4GQ9L 1HXMB 3OAYH 1NL0H 3VXRB 1RZKH 2J1KA 3HN3A 2ITCA 2GW5A 3DA0A 3TWYA 1GSMA 2V3EA 2DQTL 3QO0A 2PW2B 3IFNL 3IMTA 4OUUB 4QYOA 5DD5L 4WI0B 4NO0A 3TTSA 3BYTA 1MRDL 4WI3A 3RY6A 3H42H 2DV6A 5ITFA 4DPRA 1CGSH 2X5PA 3U2IA 2KDYA 2BIHA 2XKNA 3C9NA 1IKNA 5DFVD 2HVBA 1ZA3B 5LDUA 1OW0A 3EH4B 1A6AA 2YN3A 3U36B 4MS8D 1RZIB 1VENA 1BZ9A 3IDJA 3WBDA 4HWBH 4HIXH 5GRYA 1CDGA 1N19A 5ESAA 4GEIA 1II4E 4X5PA 3LH9A 4FZ8L 4FG0A 3PPSA 3EYOA 3OR6A 5G4MA 4YZWA 6TAAA 1KEGH 3LS5L 3DVNB 2CBQA 3L3JA 5M95B 1C5BH 2VDQH 4EAEA 1CL7I 4KC3B 2B2XH 3EJTA 1AXSB 1QR4A 2C3VA 3EDKA 4F58H 1PFCA 4DERA 4HLJA 1GGUA 1EWHA 3C5SB 2ZSVB 4OZHE 2DWTA 2OMWB 6CGTA 2V2WB 4KRPC 2PO6D 3S4SA 1X5HA 1BVLB 4RMWA 4G82A 2H0FA 5D7HA 1JZEA 4RFOH 4CVXA 4WGKA 5ECJE 4PRID 1FG2B 5C86A 4PJ8A 2J8UB 3HAEB 2IWFA 4LOEA 1U3NA 3EJPA 4XC1L 1XGRA 3ZZQA 3RU8L 3VX1A 3Q43A 1WD8A 3IDMA 3VDBA 3G5ZB 5AYUH 4R9HA 4UUJA 1IBBA 1HI6B 2DQCH 4ZMXA 5I73B 1E27A 1M2VB 3QQDB 3S8WA 2IIJA 1KLUB 3FU9A 1OSPH 2OI9C 1L7TH 4FQIH 1HESA 2CA4A 3I9IA 4QJ3B 1XFPA 1BPVA 1S7XB 1EAPA 4J5VA 3CFBB 3CPLA 3EUUA 3KPMA 4QKTA 5DMYA 1RJYB 2LFGA 3ZTEA 2DB8A 2YSTA 2GVYA 4ODTL 3F83A 1ACYH 2B5IC 2WWKT 1OQXA 5IT2H 2EIDA 4IHOA 4CJ0A 1BLIA 4R5XA 5DQDL 3T0EE 2WQAA 1M05B 4HLZH 1JWSA 1F4XH 3L45A 5C0EA 4MNQA 4P2OA 3I6GB 3QUML 1S7UA 4D9LL 4CMHB 1IC7H 4QOKE 5FK9A 1NBYA 6FABL 3M1BB 4F7MA 2F19L 3HN5A 1HT6A 1EHAA 1U8NB 5E5UB 3SHSA 5M94B 4NT6A 4LSQH 2FX8H 4M8QB 3CFCL 2HPTA 3JTBA 4NRXA 3FFCE 3ASWA 5GZND 2PYFA 2A74B 1AGBA 1YY9D 1CDJA 4UB0H 3UJJH 2ITCB 1BMWA 4K9EC 2KBGA 3PABA 4X8JA 3EJUA 2LTQC 4QYOB 4NO0B 3DRQA 1A6VH 3U2SA 3L9RA 2C9AA 3BYYA 2UZXA 3IAPA 5EO0B 1NC4D 2AXGB 5DS8B 4AJYV 5ENWA 5I71B 3S96A 5F44A 3LZNA 3FTVA 1CT8A 5DZJA 4JVUA 3T77B 3C9NB 2CHNA 5IJKC 5DJ0B 2VMFA 1TXKA 1A47A 3RAJH 4X42A 5CIPB 3D4ZA 4D8PB 3MPCA 5BW7C 4JKPH 4IYKA 4F3FA 1BZ9B 3AB0C 3MJWA 5HYJE 2AJ3A 3X3GL 4GPVA 3I9GH 3I75A 4KDTA 3SIKA 2XX1A 5IWLA 2ADFL 1RZFL 3MX0A 3DYOA 4ZFGL 5CKGA 4D0CA 4NJ9H 3QJFA 2ICEA 1T5KA 3WJMB 4WW1B 2L7JA 4H8HA 4OFYD 1X4XA 4JFHE 1FORH 3VXPA 3AS2A 4NAMA 5HJ3A 1BIIB 4N1CA 4QF1A 1HCZA 1HU8A 3S4SB 4JFFE 1MW3A 3GHBL 4H8UA 1QFWM 4KY2A 3MRKB 2NQ3A 4IGBC 4CVXB 3UYOD 2A6IA 3UTSE 2ZQKA 4PWKA 4OD3L 1L5GA 4Z78B 1CD0A 3BIKB 3IDMB 2YD7A 4NO5A 1C5CH 1DN2A 2IOIA 3SGJA 2PO6A 2EZ0D 3NZ8B 4GO9A 4UUJB 3ZE1F 2J4WL 3MNMA 4K55A 4MDIB 3J8F7 3T3MF 4ZT1A 2ED6A 2YPVA 4MX7B 3GRWA 4PRIA 3R7RA 2WN2A 3UIZA 4GQPH 1OSEA 4H2CA 1IAKA 1LP9B 3JV6A 4GBXD 2ZF8A 1CGUA 5DC0A 4S1SH 3LPOA 3GT6A 4XBEL 1CFSB 4IHOB 5AW2B 4XNZB 4AZ8A 1QKZH 2YD1A 2K8MA 3K8MA 1FIGL 3D0AA 2JMRA 2P9RA 2ZXCA 3KYOB 2ATKA 5C0EB 1KWGA 3ZDYE 4X4MA 2PTTA 5IEHA 1AGEB 4MNQB 2NXYC 4P2OB 5DZAA 1S7UB 1KELL 3V0AC 2HUEA 1JV2A 2H32B 5C07D 1I9JL 4UT6A 1CD9B 4OLVL 4GEJA 3SGDI 2XQBL 2YRLA 5C0BD 2AI0H 4U6XA 2W94A 2NYZA 3HI1A 1SXAA 4HK0B 3CZNA 2WINB 3CN1A 4XO4A 1TVHA 5FOBA 3T2PA 1U95B 4U1LA 4YZFE 3MRQA 4IS6A 4U1JA 1I9IL 3ZYJA 3IKCB 3OKDA 4S1RH 4P2QB 4TNVF 5D1ZD 3VQLA 2VDMH 3BZFA 4BGLA 5JNYA 4ANKA 2VZOA 4Q4EA 3DOIA 1EJFA 5I1JH 3QPKA 3MOAH 1MAKA 2UZXB 1NGXA 5GZNA 5ENWB 5KZCD 1ZHBB 3T2OA 3VB8A 4DN4H 2XXFA 1YQVL 4KHXH 2IAMD 4JY6A 3JUYA 4BH8A 3QCVH 5IOKA 4TF4A 4HHAA 4N25A 1NC4A 3N91A 3SO3B 4IKLA 3MX0B 3DUSA 4W9CC 2DPKA 4JPKL 1T5WB 4M7ZC 4NYLA 5H35A 4WW2F 3QJFB 2ICEB 3UG3A 1D2OA 4S2SB 4WO0A 1GY2A 3I3DA 1PD1A 1J8SA 2GJJA 2ZKXA 4RGNC 2Z31C 1L6ZA 1JGUL 2C5DC 4GLRI 5D7JD 4P23C 5I5IA 3LV3A 1KEML 3V4PB 1FFNB 4NN6C 5L2KB 3QHFH 3OKEA 4G6KH 2A6JA 1PL3A 2FH6A 1SJVA 1GC1C 3PP4H 1QBMH 2EICA 2HT3D 5FYKH 2NR6C 2Z0BA 3P1VA 2FHCA 3BDXA 3GJFA 3IS1X 4OFYA 1H3PH 3IETB 3OMIB 4TQEH 1HVXA 2ORBH 1TQTA 1UWEL 3CHXA 2F5AH 4NKIH 1IV8A 1L5GB 4KK6D 4NZRL 5D1XE 2OMBA 5IFJA 4W9FC 2Y36L 3RWDB 3BN9D 3EZ8A 1G6RH 2WZ0A 2HJKB 1KMGA 3BOVA 1DBJL 1SUJA 5HYSG 4PRIB 4L3FA 1TZGL 2GJRA 3P30L 2ICWJ 1T1YB 1G9MH 3QE5A 1YUKB 4Y16D 3FQWA 3JV6B 4WW2A 1NMBH 1O7VA 1DTUA 1RAMA 2CO3A 3MV8E 4GQZA 4O51A 2AJSL 1PKQE 3VVWA 1BEXA 5AB1A 1YYMH 4LCWE 4OUOA 4M3HA 2ATKB 3WN5A 2P1YA 3FF8A 1D5XB 1RHFA 4P5SA 5IEHB 25C8L 4GBXA 4FLSA 1JV2B 1DBBL 2R2CA 1BYPA 4YPGA 3V5KB 4FXKB 2GC7C 1YSOA 2OXHB 2X4QA 4FFYH 4OF3A 3VNYA 3ZX1A 1M9SA 4G8IA 1XGYH 4PJBF 2BVQB 1PJWA 1NCDH 3TNMA 2QSCH 2HLAA 4ENZA 3GSNH 2BNUB 2JJSC 2CKBL 3EOAA 5FOBB 1PLAA 4FG6D 4BWTA 4GRMA 3MRQB 4IS6B 3QZWG 1G0YR 5C07A 1A14H 5FFLA 3ZE1B 2K78A 4OGQC 4LCYA 2NYYC 5C0BA 2W5PA 3T3MB 2X4OA 3KLHC 1KJVA 4PVNA 1AIZA 2Y7LA 2BCKA 4E36A 4NPYA 3LNGA 4BUQA 5JW5B 2VLRE 4OCRH 5I6XB 3N6YA 3US9A 4JJ5A 5D1ZA 1XBRA 4NHUB 2PPFA 4NN7C 2NZIA 2WCSA 3KLDA 3L13A 5JW4Q 2YC1A 3KPLA 4AC2A 2YLKA 4WFHE 2X9ZA 3LDBC 4PRAA 3CSPA 4ATWA 5F8RC 2I7OA 1MRCL 1V3MA 3M86A 1L9OA 3R7QA 4HHAB 5MP6H 4QTHB 4KZEH 3CK0L 5DGQA 4IU2A 2E5EA 3QJXA 3TV8A 3IFOA 1D3CA 3VFMA 1BP3B 2IAMA 2Q9OA 3MHZA 2V2XA 1RULL 4EDWH 4F15B 1KCSH 4TVUA 2M26A 4P05A 4DJMA 1FPTL 4NOBA 1TQVA 5DHDA 1BWMA 3G7TA 2A2QT 3LV3B 5IEKA 2CALA 4PJIF 2VDLL 4D9QE 4LPWA 5JA9A 3FB5B 2ICCA 3MBXH 3QT2A 1T89C 3OMZA 5IROC 4WK4B 1RFDL 3GXDA 3QUZD 4CDHA 1OE2A 4NENA 1BGXH 2IANE 4Z7UF 1GJWA 3NACL 5E6YA 5D7JA 1IJNA 1U3JA 2IAAC 2NY0C 2BO0A 4PP1D 4FXGC 2IPKA 3CC1A 4XPTL 1NEZB 3W3BA 3AG2B 4OIBA 4F2EA 1DE4A 3TU6A 3U7YH 1I7ZB 2CH8A 2P80D 4ENEC 4ABUA 3T4YA 2ARWA 5KUMA 3BAIA 1B0GB 3CTTA 2BNRB 2VUKA 3SPIA 5BXFA 3QDAA 4MXWL 5EWIL 4HHGA 1B88A 5BVJA 3CBRA 2WO4A 4M48L 4H8PA 2HSIA 4WW2B 1TU2B 4W4OC 3SDAD 5DSCA 5DUML 3VFVB 2PP9A 3WY2A 3ULVF 1T7VA 2B9BA 3JTTA 5LAXA 2J72A 1MF2L 1SHMA 3SDYH 1QLEH 2Z8SA 4TLUA 1F6FB 2OTUA 4PJIA 4TNEA 5JPNB 1H5BC 2CO7A 3MC0A 1BBJA 1UD8A 4X9IA 1FVEA 4Y16A 2A83A 1BFVH 3MGTA 4YH6A 4GAYA 1MHCB 4FC3E 2X4QB 4Z7UA 3OQ3B 4X5RA 4PV9B 3RFZA 1YN6A 3IJEA 4V1DE 2IGLA 5L4FA 5E6UB 3I6KB 4BCZA 2XQYK 1PF3A 3NSJA 2YD9A 4R7DA 3GXTA 5F88B 5C07B 3QJRB 1ACXA 1PNCA 1S2EA 2PCPA 3L9EA 3UXFA 2X4OB 4DTGL 2D03H 3FRUA 3E8UL 4XVSL 5CILH 2BJML 1KJVB 3LHPL 3EO1A 2D2OA 4PRPB 3A6BL 3K5RA 2EABA 1KGJA 3QJOA 4UT6L 1F6AA 4MZ3A 3UGXA 4U3XA 5D1ZB 3WNJA 2EH7H 4LAJH 1A8ZA 3RHWK 5EH1A 4I9WE 4AVIA 3OGCA 3GUTB 4NNPL 2E7LC 1KN2L 3KPLB 4MNGB 3RB5A 3MRDA 3ALPA 2P26A 3NDZE 3OLIA 4HD5A 3AJ7A 3NIFF 1EA9C 2LU7A 4WFGD 4RGOL 5AKTA 4Z7NF 5D2LF 4PH8A 5C7ZA 3F62A 3MRIA 3GF8A 5DMKB 4M9PA 5JXAH 5I15L 4HIHA 4K94L 2NCEA 3QUKB 4PJBB 3S2CA 1VESA 1ANUA 5D7IF 1L0XA 12E8H 1BM3H 2A99A 3N55A 4XNYH 3VMPA 3DARA 2IGFH 4JRYE 2FSEA 1XHHA 4WNSA 1MCPL 1PS3A 4M6OH 5D1ZI 1OSYA 3BLBA 3VJ6A 5IEKB 1ED3A 3VXOB 4UQBA 1NFKA 1NMCB 4QHLB 3QDHA 2WQRA 1RL1A 1U8OA 3T0EC 5I66A 4J23A 4YK4C 5HHXH 3ZHFA 5FF6A 4LHQB 4NENB 1GOFA 1QTYT 3CIAA 1QG3A 1JGEA 3RWEA 4A7UA 4PB9H 1LO3L 4PI2A 4HUVB 5I5JA 2XRAH 3L1FA 5FYKE 5A6MA 4ZMOA 4YHYC 2VMEA 4ES9A 2IPKB 2EQDA 4GP4B 4AIOA 5I6PA 3QUZA 5J1AA 1I3UA 3U82B 2VDKB 3H6JA 4KK9D 1YNTB 4ZMZA 4HGMA 4NNXA 4JFOB 3CXHJ 1BQLH 3Q8CA 4YHMH 5GRWA 2CIKB 3DRTA 1KXQE 1YECL 3EW3B 3I6LE 3FN0L 4IGBD 5BXFB 3KYKL 4JS7A 4IRJC 2DS4A 4KFZC 1R3KA 4HD9A 3ZTNH 3WUZA 4NO2B 4CSTA 3BWAB 4P59H 2P80A 5F1IB 4YSRA 3DJSA 2Q20A 2R0WL 5D7IA 5SX5H 1UASA 2H8PA 2ZPKH 3L5WA 4IRSC 1NFIA 3GSOB 3SDXE 4U1GC 4F33A 3DVIA 2V8MA 3K6SB 4CU7A 2OTUB 4PJIB 2DKMA 2CO7B 1BBJB 4Y16B 2QLVB 2NDGA 4Z7OE 1JVLA 4Y9FA 2KT6A 4ZMAT 1KCUL 1H6TA 3SDAA 4PY7A 5DVPA 3AT8A 4Z7UB 1AO7D 5E23A 5H94B 1YEEH 5TQ0H 2ITDA 3V2AR 3HOGA 3NJXA 5AL0A 5I16A 1MLBA 4N8VA 2D7NA 1RVFL 3OSKA 1JBJA 3D48R 1FFQA 1S9VA 5C97A 1SXBA 3AS0A 1MDAA 2PCPB 5I1DA 3OKLA 4K3DH 3VTMA 2ZKWA 4U1NA 2HZHA 2ADGA 1QUPA 3FRUB 2J7LA 5F7EH 4N3TA 5ESQA 2BS9A 3EO1B 3KBEA 1DBKL 4EIGB 3JV4A 5AZ2L 3QAQA 4Z3EA 2DL9A 4HCFA 3V52H 4DZBA 1DANU 4CC4C 1JPTH 2W07A 1FUNA 4Y1AE 4YX2L 2FX9H 5BUAA 4OGXL 1NGZA 2OQJA 1A3QA 2VXQA 3T8XA 5BRQA 5DZOA 2BERA 1E2WA 4HIPA 3KPTA 5F6IC 3FSZA 1KCLA 3T0VA 4GSRA 4FQQA 1U42A 4IW4C 5FX3A 3CZUB 3LQZA 1JK9A 4KKQA 2YPLB 1EHLL 2QQNL 4E2OA 1G6VK 4G1EB 4TVPD 4LEBA 3MRIB 3CN2A 5EUOE 3G5XB 4AJ0A 1IM9B 4Y1SA 3WNOA 4MMZB 3NABL 3MSPA 3IPEA 5KS9F 2TSAA 4PJDE 1EUUA 1R5WA 1K6QH 3K1DA 4DESA 3CG8A 3V9EA 2FSEB 3VJ6B 2PW1B 4HJUA 5ETUA 2LR4A 4QJ5B 3EOTH 1U8OB 4H5SA 4LSRH 3K71A 2WWNA 5I66B 5EFIA 1HOEA 4Y5XB 4Q9RL 3CZKA 5KSVB 1ZANL 5IJKA 1XGTA 4P8QA 4HUXB 2Z31D 3BT2H 2W9DL 3CN0A 4P23D 4OCSL 4XBGA 3WEXB 1PG7W 3FH7A 2BP3A 4ZOAA 5L7XL 1FYTB 3BKCH 1VPOH 3QUZB 3NSDA 3N41B 2DQIH 2IDSA 3QNYA 2F7OA 5DRXA 1P6AB 3WLBB 5LG1A 3TBSA 3ESOA 3G5YA 1CXKA 4QXWA 1HNYA 2CK0L 2UY6A 2FBOJ 4KX7A 4N5UA 4RWYH 1MH5A 1R46A 4Z7NB 1F4WH 5D2LB 2CIIA 1QRNE 4KQ4L 4MMXB 3TA3B 4GRWH 1S7RB 3ROOB 4U6VL 2BDNL 1RZKC 1FV1A 4LLWB 4OV5A 5AOZA 5D7IB 5KS9A 4NBZB 2J2ZB 5F21B 4IGBA 3X3FH 1CFVL 1NFIB 3BFQG 4FQPA 1OAXH 1XCTA 3KLKA 1KTCA 1WTGT 5KSBE 4JY5H 3C8DA 4TL5A 1E4XH 1JXJA 1HC1A 4PJEB 4PG2C 4BH7A 4M6ML 5D7LD 3B9KD 4QCIA 2M2DA 3SDAB 1EAQA 1NJ9A 1D5BB 4U2ZA 5H37G 5MEOA 3N85H 4X8XA 5C09D 2YGQA 1E5AA 4UBDC 3NESA 4R4FL 2X2JA 1MLBB 4NXSA 3ZE0B 3II1A 2KMWA 5DFWH 1T6BX 4MD5B 2N1KA 2GK0A 4U2YA 4B7IA 1S9VB 4YHIB 3B7UX 1J9QA 5SV4A 1JGDA 1AO7A 1EMTL 4LASH 4Y9EA 5EZIL 1FNEB 2J8HA 3MCKB 1EH9A 2ADGB 3QCTL 5MI0B 1FZOB 5ESQB 4Q56A 4FL4B 2BHUA 1MAML 1UM4L 2EDMA 3GMOB 2ZUXA 1SFHA 1MCNA 2FWOB 1MNNA 5T1LD 5IOPB 1SXNA 1GSKA 4XX5A 4GXVH 4OQTL 1NDMA 2NYYD 3LKOB 2OQJB 1FGVH 1QW9A 2VDRB 3RVWD 1LILA 3JWNH 5D1XC 4Z3GA 1J1XH 4FQ2L 3KLHD 2GI7A 5LGKA 1RZ7L 1BVZA 1IO4C 1WT5C 4PJCB 3QR1A 5DD0L 1JK9B 1U8QB 2XZCH 4ADJA 1N7MH 1NICA 3GBNH 3U48A 4JRXB 1TETL 4FX5A 1J10A 4PGDB 5K9QI 3SB3A 2KQMA 5FYLH 1U33A 2X9YA 3KL5A 1R5WB 1YNLH 4GAFB 3D2TA 1CUOA 3TO2B 3IPFA 3ABZA 3EFDH 5ETUB 1UZGA 1CMOA 2X05A 4LMQI 3K71B 3HE7C 1BQSA 4Y2DB 2OYKA 4KUCD 3LN4B 2AJZA 2R56L 4OSUH 5I1EH 1XGTB 1F13A 5BS0B 2P8PB 2YMXL 4OZFG 5B8CC 4KPHL 1V54B 4E41E 1EQWA 5ADOH 1U3HD 1Z9PA 3QHTC 4H0IA 3MUUA 4LLDB 4MCZB 4LLAA 3SBPA 2Q2LA 4MJ5A 3BP5B 1D9KB 2H3NA 4FCAA 1CE6A 1OPGH 1P84K 3DXAB 2HRPH 5DRXB 1XL6A 4MBRA 4JJHA 2XZZA 3PPEA 1H15A 2Z31A 1G7JA 4GRLC 4ZI8A 4ZZKA 4P23A 2Q8BH 2NY0D 2UY6B 4N0UA 1MH5B 1CDIA 5TDNA 2D7TH 1OM3L 3UBXA 1SN0A 5EUKA 5FCUH 1P7QB 5AAWC 2HPOA 5KS9B 2VE6B 4L5FL 3LSOB 5MERA 1MFBL 1FZJA 1P5VB 1EJ6A 1EBAA 2WD0A 3GBEA 5F1NB 3EOBB 3S36L 4WSJA 3BIBX 1SF3A 1U8CB 5EIQA 1A6UL 3B3BA 4RWHA 5LBSH 4QRFA 3BP6A 4UTCA 5EU5A 1BXXA 4UQ9A 1G7HA 4R2GD 3CQQA 1I9RH 3DETD 3MLUH 2HJFA 3L4VA 1UHVA 2R4RH 4ZS6C 1KCBA 1JNJA 4WKZB 3SZ6A 1YCSA 5HI5C 3AGVA 1AIFB 2OP4L 1ZSDA 5D7LA 3B9KA 3BDYH 4ILDA 4JQXC 1JGDB 3HI5L 5B22A 5C09A 4P3CH 3CN4A 1C08B 4HEME 4JKMA 3UP6A 2APWA 4JFYA 1B3IA 2ZXBA 3V5HA 1SUHA 2KL6A 3RIFF 5DJCA 2BOCA 3DDGA 5FGBC 4TNVK 4UDUA 4AQ1A 5JOFA 3IXTA 1NDMB 4KUCF 1YPZE 1B4RA 2FBJH 5F9WC 2Z7WA 4LRIC 3KDMA 4CVUA 2YGNA 2JLPA 5IB4A 2XOTA 1AXTH 3GJFK 5K9OA 2JJSA 4ODSL 2NY3C 4LPXA 1KENL 3G5VB 1I7TB 2ETWA 5FGCE 3WELA 4BFGA 1M6OB 1P6WA 5T1LA 3O4LB 4KMTL 2BVUA 5A2KH 4K15A 4KJWD 1DVFB 4YHZH 4U7SA 4OF5A 4OBRA 4W9EC 1PZCA 4NWUL 4YDIH 2EAEA 4EN3C 1XSIA 1IC5L 3TEUA 3RX9A 1DBAL 2G3XA 4YXKL 4RMRA 1E8WA 1WFNA 3BCFA 4RX4D 3DIVA 4RGMB 2VXQL 4RVBA 2O30A 3TEYA 3VWKD 2A7BA 1FO0B 5KSUA 4DSYA 3Q9QA 3ZL4L 3UGUA 3W56A 4KKAD 2G2RB 4BFEA 1RLBA 2NOYA 4PWIA 4JCMA 2C3HA 5A7BA 1BLNB 3FT2A 4IDLA 5I1IL 3VH8G 2GAZA 3QDGB 1AZRA 3U0WH 1TJGH 3KPOA 1E6OH 2QADC 4N85A 4K9EL 4PR5A 3N9GL 1J9RA 1MFCL 5IQNA 1HINH 1AY1H 2IALA 2XLLA 3WFBH 4PSPA 2PPEA 1NAMH 4DN3H 1H15B 4JQIA 1SJMA 4QOKD 1NGPH 2AEPH 2EC8A 3SYAA 2BCMA 4N0UB 3LNIA 3ARQA 2K45A 5HGHA 2Y1YA 5TDNB 1C5DA 4NKMB 3UBXB 4LLYA 2EH8L 1T89A 4BDVA 5EUKB 2YS4A 1QFWL 3QGVA 1W6LA 3KWXA 4PSRA 1K8IA 1S7WB 4IBSA 5TE6L 4B7LA 4UILH 3JYBA 1C8QA 5EOQL 1LWHA 2C1PA 3JV0A 1TENA 4GRWE 4FXGA 4HETA 5ALBL 3BVTA 1KFAL 3BLPX 4JNXA 4CL7A 4FYSA 2F68X 1CLOL 2E7HA 1NH6A 1N18A 5EU5B 1H3WM 1L3NA 4M5ZL 1Z5LA 2DQDH 3X11B 3QDJE 5IVNA 4IRSD 4OFVA 5DS2A 1UGKA 3B5GA 3QNXB 4IOFD 2Y22A 4MA1C 2A0LD 3SDCD 1MQKH 3SE3A 5GGUB 1ZSDB 2GBTA 3B9KB 4Y5VC 2L7EA 5FO8B 1KTDA 2X4UB 2DW5A 3LS4L 5HYJD 1TQBB 2I24N 4HIEA 5C09B 1SXSA 2OMXB 5DZVA 2BIIA 3EYUL 1AD9A 2A9NH 1SGKA 1VFOA 3KLQA 4H1LA 4HUWA 4HIQA 3V5HB 2CLRA 3HUJB 2P7TA 1H5BA 4K23H 4UTAH 5AW8B 1HIML 2NY7H 2O5XL 4JDTL 1NCNA 1WCQA 1SLXA 4KH9A 1LK3H 4UDUB 4AQ1B 1JDCA 3HG2A 5LQBH 3ZKMD 3IXTB 3OSVA 4O9HH 4JFHD 2FNWA 1K3IA 4E9LA 1YN7B 4J3OH 1AMXA 1MZYA 4TTDC 5IB4B 1YEIH 3V0IA 1RPKA 1AE6H 5LGHH 4MZIA 5HVHC 2R23A 2X1WL 2R83A 3SGEH 1YEFL 4L8DA 1N59A 4U1MA 2QHRL 3JWNE 5I1GH 2FECL 3UTPD 2YFOA 3MV9E 3UTSD 4FYRA 2Q7YB 4N20A 1PFOA 4OZHA 2H2SC 3FDWA 1CVSC 1RSYA 4P5RA 4BFJA 1V8HA 3DMMC 2ESVE 4N5ED 4ONHA 1KLGA 4WU7A 1YO4A 4EI5B 2D3JA 3NG5A 1G9MC 5FYLE 4HSQA 4R97C 5DK0B 2JLLA 5KSUB 4YC2B 4EIZC 2E7LA 1EFXD 2EYRA 4A37A 2DI8A 3BD4A 1MELA 5A16A 4NC1E 4X5LA 4QHNA 3WMPA 4FTVE 2DEXX 5C9JA 4OCNC 3KPOB 1K9TA 4RX4A 4YWGL 3IU4H 4IBTA 1BAFL 1XEUA 4PR5B 3RY4A 1OWRM 4KI5E 4XAKE 1DQIA 3NQIA 3VWKA 4A39A 4PIBA 2IALB 3MLTB 5HTSA 1WA2X 2XCMC 4YBQD 1AKPA 2YXFA 3UO1L 1ZLVH 3ARYA 1CF8L 4RBPK 2PWDA 1MDTA 2IH3B 3HC3H 1U3HB 1BQKA 1HCFX 3PL6C 3O4OC 2A77L 1X5KA 3RWIB 2OZNA 4GFXA 1M53A 4LLYB 3LRMA 5I1LA 4XVTL 5T1JA 2QTVA 3M7FB 4L3CB 5AKSA 5DFTA 3IEAA 3TO4C 1UM5H 4QOKA 4YGVA 3VDAA 1VADB 5HHPA 3VGAC 1QI5A 5LWYH 4TUOA 1F8TH 4G43A 4HBQA 2BIOA 3U4BL 4UIKH 3CHSA 3HPJA 4YR6A 1QTSA 3WEBA 3KPQA 3CGTA 4XN7A 3VFUB 4M7JL 1Z5LB 5DT1H 3DTXB 1MWAB 1CDCA 2OMTA 3VXSD 2YMOA 1GC1L 3NQKA 3NFPA 1DO6A 1H6UA 3W9DA 4WCYL 3O3UN 2DY2A 4CRPA 1W72H 5LCVH 2ARJA 4R2GB 4JG5A 1JERA 2LVCA 4AKOA 2R7EB 4IRSA 4RA3A 4UBDD 4HUWB 2CLRB 2HJLB 3OX8B 1SF5A 1CR9L 1K8DA 2E6JA 2F53B 7PAZA 1IZKA 4JFQB 5EBLA 2C9RA 5HYJA 3HFMH 3RDTB 3MDJA 2N4IA 2HTLD 2VISA 2Y2TA 2W91A 5JDJA 1NBCA 1NIAA 1WFTA 1YMME 2YAFA 2C1OA 4NQDD 3EBIA 4IOSD 4J3BA 1IBFA 2TAAA 3U0PB 1A64A 4M61B 3BQUD 3AWFA 3ZDYF 5CFHA 3MRHA 5JLZB 4NFCA 1G1OA 1YUHB 5D1XD 1T03H 4G11A 3HG1E 1EO8H 2CDGA 1XF3A 2ODHA 1F2QA 4JFFA 5MEPA 3GKWL 2X10A 5IW3A 3SYOA 2WV3A 4ONHB 3THMH 5I9QC 5FHBL 3CU1A 4CC4A 1T4WA 1BXAA 3EH1A 4E5XG 1JFQL 4M00A 3UTSA 3MUY1 4QPEA 1NUGA 3J07A 2EYRB 1W0YT 2MKLC 2HXAA 4PJFE 3S98A 3G6AA 3NJIA 4G5ZH 4PREA 4ZSOB 3TPUB 1Z0NA 3WKMH 1KPVB 4AGPA 3MV8D 3OG6B 4JPVH 5FW6A 4ABVA 3VB9A 1ZGLA 3P4NA 3VWKB 5D70H 1TITA 2ZG1A 3HPLB 1MAJA 3ZIYA 3LKPA 3MYJA 4WI5A 4V33A 1T2XA 2UXGA 2YK1L 2RFXB 3PWUA 5TDPA 5J9PA 1CBJA 1KBKA 1D5RA 2E9BA 5LO7A 5LJYH 1A6WL 4BCXA 1SDYA 4HJIA 4RLDA 3GBML 3FU7A 4K71C 3K72A 3T08A 3CHQA 1PY0A 3WKQA 1OK0A 3ECBA 3WFHA 3CFJA 2ZOTA 4PJ9C 4HJGB 4RESB 4YGVB 4GRLD 4PV8A 2FD6L 2W95A 1QD0A 3IGAA 1E7VA 5HHPB 3SPVA 4Y4HC 3BN3B 1MW1A 4X7EC 4MJHA 4WRLA 1DFBL 5EOTB 3IWUA 1CICD 2XA8H 3MXVH 1MJ8H 1OO2A 1YEJL 2CO4A 3WOVA 2VLRD 5GSRA 4L4TE 4DGUA 2HG5A 4OLYL 3P0VL 1URIA 4AEIH 3V4UH 4AEHL 4EPSA 5J13C 3U6RA 1A22B 1OAKH 1Q72L 2WC7A 2YXMA 2YXWA 2X4RB 2OSYA 3W9DB 3X13A 4WFHD 4ZDHA 4AK2A 3HRZC 2B0SH 3PUCA 4YDKL 2QKIC 1JD9A 3IMRA 1RUQL 2FWSA 5BVPH 1SHSA 1JPFA 2WQSA 1MREH 4P4RA 5I1HH 1QZNA 3HMWL 3SDCB 4WU5A 2CXGA 5F1OB 3QXTA 3VFGL 2VDNH 4N9GB 3GNMH 3HTLX 4UV4H 3UG4A 3WY4A 4UNUA 5D8JL 5EU6E 5ID0B 3STLA 3CBKB 1KGXA 4D9QD 5KANI 2C1OB 3AREC 1DJHA 1YZZA 3WJLC 4IKIA 3WG7B 2IAND 4FP8H 2Y1AA 4TSCL 1B2YA 4N0YL 3H0TA 3WIIL 2G3NA 5CCGE 4OI8A 2YUZA 1U8IA 4XNUL 1NQBA 2B4CC 4F7KA 3MRHB 4O2FB 4UAOC 2WQXA 4NQDA 2XVKA 3EIFA 2MSPA 1AQ8A 5DYOA 4IOSA 4LKCB 2X40A 1J8HB 5F71A 1OZTG 2NY3D 2FQEA 2R51A 1IAIH 4M7LH 5GRZA 4XP6L 2QGDA 2GTZB 3KLLA 4MFHA 3LRHA 3BQUA 4GKNA 5BV7H 2NLJA 4OZFH 2QL1A 4UOQA 3KYAA 1M56B 4N8UA 4KQ3H 5D1XA 3LH8A 3BH8A 4ZTPL 9CGTA 4YE4H 4JHWL 2XWRA 3IGFA 1VFMA 1HILB 3VACA 1IZJA 1V7NL 2YAEA 3QJHA 1F6LL 4KY1L 5KAQF 5L8LB 4L0YA 3DURA 4F8OA 1AR2A 1MEXH 3B9VA 1ZGLB 1R5IA 2VL5A 4AVKA 1XR8B 3QNFA 4RSVA 1ZT1A 3GDBA 1PG7H 4AGNA 1EFXB 4F9PA 4HF5L 1BECA 4NQVB 5EBWA 4R4NC 3LKPB 4JLRB 4OF6A 2WTRA 4IU3B 1UQSA 2XI9A 4DQOH 5TDPB 3HAEG 3MV8A 4P2RD 3MRCA 4QHMB 1PKQA 5I19L 3EDDA 1EEZA 4FNUA 5I8KL 5T1MA 4ALAH 4FNRA 1A1MA 5FA3A 4BZ2H 1UUSA 3K72B 4V1DD 3LRGA 4K3JH 5FUZH 4OT1L 2J88L 2X70A 2HN7B 3CFJB 4NS0A 1INEL 2XY1A 2EDXA 5B8CA 4PV8B 3IBEA 2GTWA 4M43L 3W11C 2DEYX 3IGAB 2JV6A 5JHLH 1EFQA 1CK0H 3N1QC 5C0ND 2OYMA 3QFJE 5FYJL 1T3FB 1E2ZA 2DOCA 3FU6A 3PV7A 5D6CA 4WF7A 1ZEAL 4PJHE 3KVPA 1I8KA 1KJ3H 3WUWA 1X4ZA 4I1NB 4GRLA 4X6DE 3NBNA 1S5IL 3DIFB 4UTBH 3U6RB 3TJEH 2VDOB 2R9HC 1RP9A 3FOMA 1WICA 2IQAA 5KOVC 3FTZA 4OLXL 1UA6L 3WU1A 5DRWA 1CICA 5BZDB 1P1ZA 3FHEA 3WEAA 5AAWA 5FLVA 2VLRA 3L16A 1J05B 1MCWM 3OPZL 3VXSB 1EJOL 1SEBA 1JPFB 4P4RB 1J9SA 3L3GA 3MRLA 1ZT7A 3FONA 4G9DA 5KSAB 1FZKB 5ALCL 1LVEA 4UWQB 5D9SA 1UXSB 3DHJA 1V7ML 3KJ4C 1F3JB 3C2AL 1JXKA 3SJVE 3EG9B 4XP5H 4NZ8A 4MWFA 4B96A 3MXWL 4G6JH 2YUVA 4HXBL 4A7GA 1E9QA 4ZXBC 4ICXA 1IJ9A 4KHTH 4WIQA 5T5NG 4QXGL 2CGYA 2XBDA 1I3RA 2XG5B 3H0TB 1J1PH 3VXQA 4JQXA 2ZUQB 3P3YA 2L04A 1U8IB 1YYLL 4FQHB 2BP0A 5FYKD 5I8EB 2MCPH 2Z4TA 4NQDB 5EF0A 1LE5A 2BOLA 2CO6A 5AUMB 1IGIH 3BXNA 5DYOB 1IIKA 1UFGA 3HMXH 4PRDB 2IANA 2VUOA 4M1DH 5LNDA 1P4LA 5ANMB 1KCKA 3F7QA 1ZE3H 5PAZA 3RKPA 3ALXA 2ZG2A 4ETQB 3U9WA 3I6LD 3H1ZA 1IAOB 3BQUB 1REIA 2EDDA 3H53A 1MRFL 4LRIA 5IB3B 1OCWL 4UU9B 1NCBH 2H2SD 3BVVA 3S35L 4JFZH 2BFVH 3PGDA 1OGTB 1KTRL 5GGSA 1SJHA 4TTGA 3KXFE 4LXFA 1F00I 5EF1A 5B1AB 3KPRB 4M1GH 2Q86B 5EBWB 1TSRA 1K85A 5CJOH 1TVDA 5TFSH 4EN3A 1B0WA 3I3BA 5FW7A 2KZBA 3UAJC 5DVOA 1UQSB 5SWSD 1T21A 1B4LA 1E5CA 3LIUA 3LZPA 3QAZB 5DLLA 2FO4B 2WYTA 2JVUA 3MRCB 3NCJL 1PKQB 4K3EL 5IB2A 3KJ6H 1EEZB 3FQTA 4OW6A 1X5IA 3NN8A 4ONGL 1IBGL 4HISA 4OGZA 1OPOA 5IBTH 5K69A 4NUGH 1AI1H 1WG3A 2W88A 3EJYC 1V3LA 4QKXB 3NCMA 1GYUA 2X70B 2K9FB 4MA8L 1UKQA 4I3GA 5I1AA 4MXVF 2OXGB 4O2EB 4WSGA 2X0WA 2GTWB 4P2RA 2BVPA 1MNUH 3KM1A 4ISVB 3QIWD 4APQC 2CCLA 4UNTA 4V1DA 5DJZA 5D7SL 2FQGA 3DVGA 1N6QL 2MOQA 3TO4D 1N8OE 2EDYA 1EVTC 3BMVA 2FLBT 4PLNC 4O4YH 3GXUB 1MIML 4J8RA 4JO3H 2CJUH 3JWNC 4BHUI 5C6TL 4FA8A 4DGIH 3RWHA 4Y1AD 3ZSSA 1WEJH 5EZJA 1VB9A 1OT2A 2RH0A 3MRNB 5D7KE 1CICB 1Q9OA 4AMKH 3QIBC 3QUYB 1X3DA 3CXDL 4FD0A 2O26U 2XWJA 1WFIA 3R4DA 5B7EA 4I0PC 3FBQA 1SEBB 5I18L 5AKRA 3U1SL 1TZHB 3L3GB 5HI3C 5IJCC 3FONB 2NX5E 3NPSC 4LARL 4DK5A 5IHBA 3EXJA 3W38A 4TN9A 7CGTA 1RIHH 2EVJA 4XNXL 1ETA1 2QHLA 1WE5A 4ODVH 3BRGC 3JSSA 4IJ3B 4JG0H 1IKOP 1DYZA 5E24E 1AFVL 4FQCH 4LDEB 3NVQA 4MDRA 1E9QB 4NPKA 2FB4L 2EDEA 3VRLF 3RIFK 1NL0L 2V3FA 3RPBA 2DI9A 3Q2NA 4KJPC 1RZKL 2CM6A 1UH3A 2L8AA 4Z7WE 4CU8A 4DP8X 4Y5VA 1I3RB 5E4EB 3REWB 1GXEA 3L1GA 1AS7A 2VO8A 4H88H 4F2MB 5I17A 2O61A 4C54A 3WE6A 2AV7A 3FW6A 1JHLH 2FEEL 2LLLA 4QRRE 4ZOCA 4L0ZA 4AV0A 3BXNB 3H42L 1VAHA 1AVAA 1CGSL 2PUQT 4F37F 1P4LB 4YHNB 2WCPA 3PYCA 2OPCA 2A9MH 3BHBB 4U3SB 4HKJB 1F5WA 1Q1JH 1QRND 1WAEA 1XH1A 4HWBL 2VABB 5A2CA 3TIEA 3GMPB 4HIXL 2K1MA 3IJSA 4N87A 2W9LA 5GGSB 5CEYA 1KXQA 1F18A 1T7WA 3BUYB 1H0DA 3BIAX 3BW9B 4DOHB 5HYQB 1KEGL 2V5YA 3ZT7A 1C5BL 2GIMA 2VDQL 2VZVA 3MLSH 2B2XL 4AW4A 2ZYIA 3DX8A 5JA8B 4F58L 4FOMA 4MYWB 4L3AA 3KYMA 1XZWA 5CP7B 4EOWH 5F9OH 3FU3A 3MJGX 1N70A 3MN8A 3IN2A 5KWYC 1N26A 1Q94A 3SDXA 3NN8B 4RFOL 3U9UB 2HFFA 1A9EA 3ME0B 3WIHH 4C58B 2TRYA 2JKJA 3GSUA 2OULB 4P2RB 5EUOF 3GZKA 1F86A 3VFOB 2ZONA 5DUBA 5AYUL 2DQCL 1WO2A 3B8SA 5F7HA 1U41A 5EBMA 1OSPL 4OZGE 1EDYA 1DEEB 5ABAA 1L7TL 5TF0A 4FQIL 4U0RC 2EYSA 4N6RB 4FFYA 3T0WA 5BNXD 2AEQH 3RWHB 5IFAH 4EI6B 2ZYSA 1CLYH 3QIWA 2R2HA 3RGHA 5EZJB 3CC5B 2XQ0A 2EDHA 4Y2NA 5EO9B 3STBA 1ACYL 5IT2L 1A1OA 2XN9E 4NB7A 4Y88A 5IGXH 3TO4A 5DZPA 5GISH 3BO8B 2Q76B 4F8LA 2ICWA 4YSUA 1BZOA 1F4XL 1IBZA 4OJEH 1RMFH 4Y1AA 4JE0A 4NQCB 3VWJC 3IDGB 1IC7L 4GSQA 1OGPA 5D1QE 4MAYC 1X9RA 4ZFOA 3U6XA 3UL4A 1M4KA 1QYGH 4EZJA 5E99H 3PHQB 3FOLA 3DUUA 4LSQL 2FX8L 2C3XA 3DYMA 1BF5A 5EUOA 3TYGH 2Z7UA 5C6WH 3RL1B 1OHQA 2DH3A 4FI7A 4UB0L 3P11H 1J9TA 5CINH 2A73B 3UJJL 1FC1A 3F6IA 1VEPA 5D5ME 1CD8A 2EXYC 2O6CA 1OP9A 4E41D 5AYTA 3OC8A 5C08B 4HPYH 3NJMA 4U1SA 4NGHH 4JY4A 5KSBF 5DEFA 3OF6D 4GO6B 2F5BH 5I17B 1A6VL 2O61B 3FK3A 2AV7B 4XR8C 3L1EA 5IMLA 2F9BT 2NUTB 3QUXC 3TF7C 3V0DA 5DZNA 3UABA 3D33A 2FZ3A 4OF0A 5F7KC 3SKJH 3RAJL 4I7ZC 4JKPL 4NKDB 4JZOB 4HCGA 1XF1A 5JO5A 3OV6A 1UZ6E 4KO9A 5T33H 3K2MC 3R0MA 3I9GL 2V17H 4L8CA 1LD9B 3HB3C 2LAGB 2WBWB 1D6VH 3SBQA 5E08H 1OP4A 2ROXA 4NJ9L 2AC0A 3FN3A 4WK0B 1DJIA 1H0DB 2ZXAA 3CX2A 3JWDH 1AGFA 3Q48A 4PJGB 1TQWA 4Y5YB 5TK2A 1R0AH 1IFRA 5B38B 5A3IC 4C56D 1AKJD 5IMMA 1QRNA 3IMVA 3GHEH 2HLEB 1RZGB 1FORL 5AVYB 2R1YB 4YHLH 1S7QA 2CUAA 3FB7A 2N7SA 1SZNA 4LPCA 1NEZG 4XOBA 4LPYA 3SDDC 2KKQA 4PCSA 1XF5A 3VMNA 1GGYA 1XO8A 5I6OA 2QSVA 5KSBA 1M1XA 3QXDA 3KNBA 1A9EB 4R4ND 1I1AC 3H2QA 5C0AE 3P4OB 4JVWA 2AJVH 4KVNH 5SWSB 4MD0B 1OTUC 3FRPG 3QQ3B 1MFUA 4BE5A 5CU5A 4WI9A 1C5CL 2VLKB 3GMQB 5AL8A 1LM8V 5DK2B 2WCGA 2Y2WA 1GYAA 2CGZA 2D7QA 2EYSB 4UMGA 1IB5A 4MTMA 4N0CD 3V7AG 4J3OC 1FNFA 2OTWA 2FJUB 2WNWA 2PPAA 3PF2A 5T1KB 5DEGB 2BK8A 2R2HB 3HI6H 2NTSP 2HVJA 3ZMRA 2YRBA 1THCA 3D09A 4S1SL 1MG3C 1UOWA 5GGRY 1BX2A 1DDHA 2AABH 2Q8AH 1QKZL 2BY3A 2WLLA 1RPUA 2VZ3A 1KIUB 2L7UA 2EIEA 3B4NA 3SY0B 4WUUB 2ZWKA 5T5FH 4Y1AB 1WGOA 2YD3A 4W81A 2K70A 4XO9A 1DLFH 5F8QC 1XGZA 1LGVA 2FO8A 1TF4A 2HX7A 1CDUA 1QPKA 4N2GA 2AI0L 4PLJC 5E7BA 4F92B 1OIOA 4G8AC 1CL7H 5DI8B 1OF0A 3ZN6A 5CEZH 5J6HB 2FIKB 5FV2A 3DUUB 5DO8A 1PVHA 4DUVA 1J5HA 4WDIA 4N9OB 4A6YB 5EMYA 1HQRA 4S1RL 2WB1A 3HRZA 2VDML 3ZKND 1S7VB 1U8JB 4LSSH 2PCYA 1VJSA 4IM8A 4R6UA 1SBSH 5CSGA 4PU2A 5I1JL 4OM0H 5DEFB 2X1OA 3D18B 4F7TA 1G7PB 3MOAL 4ZXBD 4HGWA 2CR0A 4YUEH 4I18C 4KK5C 4NM4H 2H2PC 3DV6B 1NEUA 2N59A 5D71H 5B39G 2K7PA 5DQJB 3C6EA 4DN4L 3HCVB 4KHXL 4E41A 3B34A 1IEBA 1M3JA 3OF6A 3QCVL 4JFWA 3UPCA 5LGYA 1BCIA 3ZMNA 2WQUA 5JO5B 1CLVA 3RJDA 1OKEA 4QR7A 1MSPA 2R69H 4D0BA 4HOWA 3WJLA 4PS8A 1JF6A 4HOXA 2Z6FA 2G30A 3H9YA 4JFPB 4X6BA 2DYSB 1V5JA 1NTDA 4N2AA 1I85C 4XB7A 2O5YH 3VSQA 3HAEH 5IMMB 2JI2A 1LEIA 4QD2E 1WWAX 2YKLH 3FFOA 3QHFL 4G6KL 1GKEA 3EJJX 3M1CA 3PP4L 1QBML 1NPUA 1S7QB 2A4CA 5HGBB 2ZCZA 2FUQA 5FYKL 3QDJD 4YMPA 5L9DH 3MU3A 1ROCA 2J1WA 2EDLA 4AH2B 2WJ7A 2P8MB 4PTTA 1AKJA 4C56A 5FFOA 1M1XB 1H3PL 3NGBC 3T04D 3KPSB 5DU7A 4TQEL 2R1WB 1NM9A 3UAJD 2ORBL 5CN2A 3C6SA 2F5AL 2ZAIA 4N6QA 4NKIL 4RAVB 1CXHA 1BVOA 3IF1A 3NCEB 2APBA 1G6RL 5CP3H 5IK3A 3W1ZA 3BGFC 3HG0A 1IEHA 5KOMC 1HHJB 2QVIA 1XB8A 4MB3A 3EJYD 5GXBB 4LB8A 5L4IA 3GTVA 1R17A 3IK2A 1E4KA 4ES8A 2OTWB 3S37H 1G9ML 4DUWA 4HEMA 2OSXA 2ZWNA 4APQD 4JK0D 1A6TA 1NMBL 3CQPA 4X4YA 1FFPA 4IK7A 2GHWB 4RMSA 5SV3A 2A5UA 2UZYA 1FFOB 1YYML 2OZ4H 4Z18A 3VRJA 3GK8H 3MV9D 4PGBB 4PP2A 1OF2A 3O8XB 1VGKA 1BJ1H 4FFYL 5DZ9A 5ICYB 1SXCA 1G1YA 3MQIA 3QIBD 1XGYL 5KBLA 3TV3H 5D2NB 3WDIA 1NCDL 5JIKA 4NUJA 2QSCL 5KJRH 2V2TB 2ID5A 1U0QA 3GSNL 3HS0A 4UZUA 4I0PD 3T8MA 5I1KH 2IJ0C 4RQQA 1LE9B 3T6WA 1A14L 5LLIC 4H25A 2B14A 2DWEA 1BXUA 4AG4H 4GT7A 4FTVD 4EUPG 3ECQA 4GRWF 4KOBA 4NI3A 2BY2A 4UOW0 4F7TB 4KI5D 4XAKD 4UQIM 4HGWB 5DDHB 4OCRL 5IW1B 2LLNA 2KHAA 2Y2YA 3BPLC 3BVUA 4KJPD 4M3KB 4ZFOL 3ZTJG 4YO0A 3APNA 4QHPA 3O0LA 3PNWA 5AVUB 4K4KA 4ZXBA 1PMYA 5MP6L 4KZEL 4K5PA 3QH3A 4D0BB 2NW2B 2FR4B 4KMLB 2RA1A 2AFNA 1B0RA 2ENQA 2L4OA 3ARGC 4YNYB 4Z95H 4GW4A 4W9JC 2XKUA 4EDWL 3GB7A 3ARUA 4I4WB 2X4SB 2P5PA 1KCSL 2BH0A 3QEUA 4TMPA 3ETBJ 4M02A 3FO9B 4NUMA 1LEIB 5IMOB 3RA7H 1X5MA 1Y1DA 3HNTH 3MBXL 5EO1A 1NBVH 3Q9PA 3SGDH 2O4EA 4JRLA 1BGXL 2NY6D 1MCRA 4C56B 3R8QA 3K74B 1AKJB 3BWZA 1TJMA 4MQ7A 2VXTH 4AXWA 5JW4N 4X6FB 1NC2D 1ZDQA 1BG9A 1J0JA 1KYFA 1X5FA 2DQUH 3QDJA 4AUYA 5FB8B 3I74A 3U7YL 5LGJA 3E6HA 5IK3B 4CNIA 1WFJA 4UZSA 2W8CA 4ZMTA 3GLAA 4I13B 5IQ9B 3PDOA 5BZWB 5JPMC 3UAJA 1Y7VA 5DMGC 2AQPA 2CDFB 1BZ7B 3RTLA 4GFTB 2J1YA 5J1SC 4MKMA 2E6QA 2WXHA 5D4QA 3E0GA 4EN2A 4G8EB 3S3DB 1V3JA 1DVQA 1FFPB 1I1RA 3GXMA 1K4DB 1OAZH 4HJJH 1DUZB 2D7PA 1S6NA 3AQYA 4P99A 4HWUA 3VSTA 4IRZH 1IFHH 1P7KA 1URZA 2UZYB 5A2JH 3SDYL 1QLEL 4XTRC 4KI5F 3C6LB 3VRJB 1JFHA 1BFVL 4APQA 2OTPA 1NLDH 3ECWA 2F0CA 5KBPA 4X4ZA 3HG1D 1KGYE 3EBAA 1ERNA 3RWFA 4G70B 3VXRE 5CMAB 4GLRH 1OARH 1VIWA 2VXVH 3CVHB 4YDLC 1EEYB 3DV4B 4BQBA 3MV9A 3BUTA 2YD2A 2FT7A 4RQQB 5F7DB 2B3IA 3DX6A 3MRPA 3EH3B 5D96C 2F8IA 5AAMC 1JZ2A 4MAYD 3QIBA 2ESVA 2D03L 5J12B 5CILL 1HAWA 2FGWH 2VKXA 5FXCH 3P3RA 3QC6X 4LSVH 4ZFFB 3BEWA 4I0PA 3KPNA 4P3WA 4TUJA 3B5TA 3D4YA 5L4JA 2EH7L 4EE2A 5I24A 1KNOA 1N5AB 2J5LB 4FTVA 2MFNA 4YO0B 2NQDA 3Q8AA 1F4YH 3GXNA 4OZ4A 1CXFA 2EXYD 3F6LA 3O6FD 4YQXH 4ALAC 5IR1A 4M93C 4QRTB 4R7NA 3V4PH 4L8SC 4U1KA 2DQ6A 1NGYA 2PXYD 4IOIB 4E9YA 3QH3B 3T3PF 3DBXB 3QUXD 2AK1H 1T1XB 4YHKH 5JXAL 3HS8A 4GW4B 4BQ6A 5F3HB 3M17B 3GB7B 1WWWX 3LYRA 1P84J 3FT3A 3H4HA 12E8L 1BM3L 1XGPA 3LIZA 4XNYL 5HYSA 2VR7A 4Y8AA 4LEOA 2IGFL 4M6OL 4WLCA 5HHOD 3HN8A 5DD3H 4NCC1 4FE9A 3GSRA 3HB3D 5HHXL 4GIOA 5CZRA 4L4TD 2J8UE 4G8GB 2YPVH 1RHHB 5IBUG 3GRWH 4E0RA 5DQ9B 4GAGH 4HFUH 3L8QA 1X5GA 1VKXB 3AZUA 4PB9L 3VXMD 3L3OC 4NQXA 1OSZB 2XRAL 4WHYH 5E1AA 2K4WA 5C6PB 3ARDD 2VJ8A 1L0QA 3V0JA 4KKNA 4LCIH 2EUZA 1BQ5A 3BAXA 5LGJB 3F6JA 3E6HB 4LT7A 5LBSA 3SDDD 3WNNA 5JHMA 1BQLL 4YHML 2KLRA 3DHUA 2PKDA 4MGXA 4YDNA 2QVTA 3S34H 1OD7A 3A4EA 1I1AD 4N86A 3MGOA 1ORSA 4EDXA 3GGWB 5HVFB 1NC2A 3QZWA 4A7TA 4UT7H 5CR1A 2EE6A 5EU6D 2OV0A 4JN1H 3ZTNL 4PJFF 3BZ5A 2YJQA 4P59L 1Y6KR 2PMZA 4FAAB 3NEOA 4R0LC 2ZTBA 2AV1B 2WXRA 2ZPKL 1S7TB 4HX1B 1P7KB 3B6SB 4J3OD 1D7BA 3DROA 4MQXC 4D0DB 4XP1H 2ZNXA 4FZEH 3WJJC 2NZ9C 4XO3A 5E56A 2V9RA 1NDGA 4AYDC 5CXPA 4FI8A 1WS7A 2AERT 3VRIA 1ZE3C 1S9XA 4Z9KB 5D6DC 1A2YB 2C3GA 3RWFB 1YEEL 3T65A 5TQ0L 4Z7IA 5JW4R 1EVUA 3OLGA 4V2CB 5IQMA 3WTTA 2E9GA 4JN2B 2CLVA 4LCCC 2HMIC 1KC5H 4TKWA 3MBWA 5DVKA 3OXRA 3HG1A 3QWRD 4F1ZA 2WQVA 4K3DL 1I7RA 5F7EL 2C9QA 3V0WH 1FNSH 1U91A 3VD4A 2YO3A 3ESUF 1N4XH 5GGVH 2CZNA 1DQQB 2E8YA 2FL5B 3KPNB 3VWJA 3K5SA 1IU1A 5F7YC 4GI6A 4PJFA 3V52L 1PY4A 1KNOB 1PGRB 1JPTL 1TCRA 3D69B 5GSVA 4TUUA 4MAYA 5C0FA 2FX9L 4NN5C 1FRGH 1M9WA 4OZ4B 1EHKB 2CM5A 3KCPA 4RFNC 2XA3A 5IR1B 4JEGB 2D0GA 3AG3B 3CWGA 2DQFA 4CVWA 3MGAA 3AG4B 4KXZH 1EZVY 2Z3FA 3DX2A 1X7QA 3MJ9A 4KK5D 2H2PD 4F37K 4HEPG 5EIIG 2DF3A 1ZIAA 3BPNC 4C57C 5J4MA 4ZOEA 5IF0A 3O6FA 1A4AA 1J0KA 3GSWA 5E5MB 5FKAB 4X6CF 3WXWH 2A9BA 5DA4A 1VSCA 4U1IA 4Z23A 1XGPB 4GSUA 5E9DD 3QFJD 1K6QL 4FS0A 4NZTH 3ZTDC 4AQAA 1AR1C 2FT8A 3GSQA 5H4ZA 3EOTL 3QUXA 5DHEA 3ZZLA 4LSRL 3QA3B 4QWWC 4LLVA 4KITB 1WK0A 3L54A 4P46B 4E0RB 2X3BA 4ZUWB 1N0LA 3BT2L 3SBRA 5HHOA 2W38A 4J3OF 2NYKA 4NQXB 4O02B 3ESVF 1IGTA 1PX3A 4L8BA 2F8VA 3ARWA 2NNFA 4L4TA 1E8ZA 2I9TA 1MCCA 1VPOL 3BKCL 2HH0H 2DQIL 2DWSA 2A6KB 2NY6B 2PPCA 3KLAB 3VXUD 1KIRB 1NIDA 1YC8A 5BUPA 3D85B 3ZHLA 5BO0D 1LP9E 3ULUD 2D7OA 4HV8A 3VXMA 3W2DH 2CBMA 1WIOA 2HLFD 1SFDA 3F5WA 4RWYL 3T3PB 1SYSA 2YD0A 3MGOB 3ARDA 2UUDH 1F4WL 1DUYB 4EDXB 3DYPA 3QZWB 1OP5K 4AIZA 5HPMB 1EDQA 2WQWA 4CC1A 3QBTB 1OCOB 3I50H 3N44F 3SDDA 4X6CA 2VH5H 2QVKA 3IJHB 3NIGF 4MNQE 2FO1A 4MHHI 3X3FL 1TYRA 4S1QH 1I1AA 2BP8A 1EAJA 1FI8C 2EIKB 3NJJA 3WKPA 1OAXL 4LHUA 5JZ7C 4IMKA 1DQMH 4KKCD 4JY5L 3DROB 3ROLA 5EU6A 1E4XL 4EXKA 4UTAA 3VMOA 2EE0A 3UIYA 5ESVA 2WO3B 2ZCHH 2CPUA 3N85L 3KEDA 1FN4A 2D2CC 1AD0A 3NEXA 4P2QE 1NOFA 4UT9H 1AHMA 2IMNA 2I60H 1KBVA 1MVFA 1NFAA 4O2CB 1D5IH 2WMPB 3WS3A 4Q6IC 3RPKA 2FX7H 5FPIA 3BZ4A 1T66D 3OXRB 4LASL 5J6SA 2YEVB 3DGDA 1DL7H 3CZGA 1MHPH 3KXFD 3T0AA 2AJUH 5EU3A 4S0HA 4G71B 2FT6A 4JFXA 4LVHB 4PJFB 5CLWA 5GSVB 3QWRA 4GXVL 3SCMC 1NUNB 5C0FB 4XX1G 1FGVL 1DSYA 2WBXA 2HKHH 1J1XL 5L0QC 2V5MA 2YGOA 2OSWA 3VFTA 1E28A 5HVGB 3VQMA 4C47A 4L9LC 1O7DE 5T3XH 3TBTB 4FTDA 1SOSA 4R96A 2KS0A 2IVFC 1A4JB 4ZFZA 2XZCL 3V10A 1N7ML 1IGYA 4WTQA 3I3EA 3GBNL 5ITBH 5EORH 1TR7A 1Q0XH 3O6FB 5FYLL 3D0LA 5L2KE 3ULUF 1YC7A 2PXYB 1NWOA 1YNLL 2DLEA 4EIUA 3EFDL 1QSFD 5ERWA 3GSQB 3GS0A 4JAMB 2QMKA 2VDKH 3LRSA 1LHZA 3FSAA 5DS1A 4MRCA 4OSUL 3SY6A 3FQXB 5I1EL 3K46A 3QFJA 1OTTD 4U6YA 1N0LB 4UQEA 5HHOB 5JHDB 5ADOL 4X4XB 3L5HA 5D7KD 5F3BA 4PGCA 4Z7QF 1RLWA 2ZUVA 4X6DA 4L4TB 1QQDA 2H9GA 1OPGL 4LF3B 1PAZA 1GGCH 3VM5A 5FEBA 2HRPL 4MMYB 1I85A 2BSTB 2NX5D 3KGUA 1QFHA 2Q8BL 3RGVD 1AACA 3VXMB 1MI5D 1XIWC 3F5WB 5KYWA 1R34A 4U33A 5CO1A 2N1TE 3ARDB 3REVB 2HVKB 3HHSA 1H3XA 2D7TL 1TKWB 3TF4A 4NM8H 4XCEB 1TZ8A 2YEZB 2DIEA 2FJFA 1PTZA 5FCUL 5A6IA 4RBPH 2J1ZA 4X6CB 1U8MA 3EGSB 2XV2A 3FN9A 5IP4A 4F80A 1T0PB 2BP8B 3SJVA 1QLFA 4BSJA 4GAJH 2Y7SA 1RH8A 1Z9OA 3QDMD 5E70A 3MKKA 3ROLB 5EU6B 3TZVB 4I48B 5LBSL 4J39A 2ZWYA 2F74B 4X2UA 4QRRD 5ESVB 2ENJA 3MCYA 1I9RL 3MLUL 3P2TA 4EZLA 4KFMA 1FN4B 2R4RL 2LOEA 4ODHH 1Q8MA 2DN7A 5B3JE 4AJVA 4XTRD 3T3ME 3F7VA 1CQYA 2G5RA 3QS3A 3HC0A 5GJTH 2QFPA 1XD0A 2G5BA 1SJEA 2MRYA 3ULVH 3BDYL 2WNGA 2ZCLH 1EPFA 2QMJA 4F2FA 3EHBC 4P3CL 2AS5M 1RUMH 1A8JH 2VAAA 4MA7H 4N0FB 3HE6C 3JWDC 1XH3A 3P3SA 4N2KA 2I07A 4MAUH 4Q6KA 2NSMA 2ADIA 1CVRA 4EKXA 3N06B 4HZLA 1U8LA 4FFWC 1MXDA 3W9EB 4Q14A 2MKWA 3N44B 1G1KA 4MJ2A 1U30A 1USQA 1M2OA 3IAGC 3NIGB 1YEGH 2FBJL 4B9IA 1L0YA 3UOAB 3UAEA 1DHKA 1AXTL 3KXFA 1JVOA 1IEAA 5GRJH 4R96B 1IQDA 2Z1KA 4OKDA 4ZFZB 5T3ZD 1IGYB 4AYID 4X7FC 4YHZL 1HHKA 3K6DA 3HKFA 3ZW3A 2H6UA 4YDIL 2A3TA 2ALAA 4BK4A 4XOAA 2G5UA 1BFSA 2X6CA 2FLRT 3HC4H 4NP4H 3S35X 3ZRFC 2VRKA 1J48A 1U3ZA 4X4KA 5ERWB 3IDIB 4PS7A 4BD4A 4AT6A 1Q9KB 1NBZA 3KW8A 1W80A 3LRSB 4MQTB 1M7UA 1E2VA 2Z35B 3GZPA 4ZUTA 2PP7A 5I6MA 3HR6A 3NCXA 3RUGF 2OL3B 2FHFA 2XVBA 3BKMH 1XTMA 3MJ9L 4U6YB 3U0WL 1TJGL 4Z7WF 5I76A 2V37A 1E6OL 1QSFA 5FM5M 3X2QB 5HDOA 4L37A 2Z34A 4IIQB 4PGCB 1ZV5A 1OOAA 1HINL 2Z8RA 2BNRE 1AY1L 3MNDA 5C70A 2H9GB 4IIZA 5H37A 1Z9LA 2YWZA 3WFBL 4R8WH 4EVNB 3VVVA 4ELKA 1NAML 3VD1A 5BJTA 5ICZA 5SX4I 4DN3L 1RZPA 1FSKB 1NGPL 2AEPL 2X4NA 5D1QD 4RCAA 3BQVA 4NUPA 2C9SA 2AMGA 2CRYA 2VXUH 3UAFA 4DZ8B 1FDLH 4XRCB 4DT2A 1MFAH 1ZA6A 4U1GB 5INDA 2YQGA 3V7AE 2NW3A 4F1SA 1QZ1A 4JO5A 5EZLA 2JKIS 3VXUB 2OR7A 2NX5A 3HZ3A 3W0WB 4F8QA 3P73B 1UG9A 3RGVA 2EXWC 2EXSA 1MI5A 4HA1A 1SQMA 1WCBB 2GT9B 4UILL 4XN2A 5SWZB 3T2QA 1QLFB 2Y6SC 3SKNA 4ZUSA 3KS0J 4OIFA 4PGJA 3EBHA 4HS8H 1XCQA 1ECYA 4N2NA 3QG7H 3SPJA 1CXIA 4LQFH 4RRPA 2FGZA 4ZW8A 3B2PA 4OBSA 4L2YA 4CSSA 5DHMC 3EO0A 4I0KA 2DQDL 4WWKB 1R24B 1IVLA 5TGBB 2ZF9A 4Z7WA 5BZXA 2YRZA 1ILUA 2XWTA 3CN3A 3ZDWA 4NQTA 4Z7QB 1MQKL 1YMHA 3AM8C 4MQXD 1XF2B 4P2YA 2G5BB 1SJEB 2NZ9D 2VDRH 4E9QA 4QRRA 3ZT6A 1XXFC 4PRPE 2XQYG 5E4AA 5ISZB 2WXPA 3EYFA 2ZSWA 4UV7H 2A9NL 5KN5A 5CFAA 1XH3B 2I07B 5I28A 2R0LH 2ADIB 3QR2A 3EFFA 4UTAL 1ZTXH 3KE0A 4FEMA 1JWUA 4K23L 2C9XA 5AFAA 3DUHA 2NY7L 4WI2A 5HHQB 4MNGE 1LK3L 1U58A 1H8NA 4W1TA