4IEFA

Complex of porphyromonas gingivalis rgpb pro- and mature domains
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
197
structure length
192
Chain Sequence
b'RNPQVRLLSAEQSMSKVQFRMDNLQFTGVQTSKGVAQVPTFTEGVNISEKGTPILPILSRSLAVSETRAMKVEVVSSKFIEKKDVLIAPSKGVISRAENPDQIPYVYGQSYNEDKFFPGEIATLSDPFILRDVRGQVVNFAPLQYNPVTKTLRIYTEIVVAVSETAEAGQNTISTFTGFEDIYKSVFMNYEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gingipain R2 Pro-Domain
publication title Porphyromonas gingivalis Virulence Factor Gingipain RgpB Shows a Unique Zymogenic Mechanism for Cysteine Peptidases.
pubmed doi rcsb
source organism Porphyromonas gingivalis
molecule tags Hydrolase
total genus 32
structure length 192
sequence length 197
chains with identical sequence C, E, G
ec nomenclature ec 3.4.22.37: Gingipain R.
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08126 Propeptide_C25 Propeptide_C25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3800 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4iefA00
4IEFA
chains in the Genus database with same CATH superfamily
1ZTXL 4PJAF 3GMRA 4IMKC 3BAJA 1YO4A 4E41D 4JG1L 5K9OA 5HDQL 2AEPH 3C60B 5IR1B 5KS9E 1NC2D 3ATAA 4IRSB 4JEGB 4ZMQA 5I0ZA 4YOKA 5I23A 5LNDA 4PH8A 1SXZA 1N6UA 1TPXB 5ID1B 1DVFB 1IV8A 1NIBA 3NDYE 4LOUC 4Q14A 3TBSA 2JCCE 3HNSH 4XPFL 4Y2DA 4HT1L 4TLKA 1E67A 5J8OA 4JCWA 3F7YB 4LVHB 1URIA 3TO2B 3HG1E 2EDBA 2Z8RA 3QISA 3N44F 2IFFL 4TSBH 5G5DB 1G7QB 2NUTA 3C5SA 4X2UA 5BMFH 1OAZH 43CAB 2AJXH 2CDEB 1QUPA 3L54A 1ML0A 2EIMB 1AGBA 1UUSA 2B59A 1BEXA 5F44A 5IVXA 4ZFOB 5I66A 5I73B 5IVZB 5IW3A 2H26A 1CFQB 1WFOA 2ZX7A 4WKXA 43C9B 1FZKA 1WGOA 2C4FT 5IMKB 3I6SA 2AMGA 2W60A 3ZDXE 1RPKA 4KUZH 3MGTA 1FL3A 3ARGC 4DH2A 3S3BB 3IMBA 1KXHA 3DJZA 3MLZH 1I8LC 1TTUA 1OZTG 3WU1A 2EXWD 4S1DC 1IM3A 3GJFH 5KAQF 2YEQA 4LLQA 4E2OA 1PBYA 4L8DA 5CFAA 4N90D 1XVSA 2X9YA 2NY7L 4H20L 5D1ZA 5AOJA 3FUHA 5I1AA 4WWKD 1IEBA 4OTXL 2QQQA 4QT5B 3C8HA 4LFHG 1ZY9A 3GSWB 1INEH 4DN4L 5CJBA 2FWOA 3CDZA 5DWUL 3BUBA 3EF7A 1F4AA 4IOFD 1BFOA 4QNPF 1NJ9A 1H0DA 1XCQA 4R8WL 4TRPL 4J39A 4QKXB 3HKFA 1BOGA 1EDHA 2GEQA 4JO3L 2E74C 4LEXL 3L3GA 4ZO6A 4EAEA 4GI8A 1VFMA 1HNYA 5ENWB 4MX7A 1JDAA 4FLQA 4OIIL 4XT1C 5LLIC 1KXQA 2HTLC 3C75A 2PW1A 1WDAA 1NBYB 2V17L 5GRXG 4APQA 2IADB 2B5IB 4S1QL 1TMCB 3L48A 5D7LA 3V4PA 3CDGB 5D5MA 1KCKA 4NAQA 1EXUA 4IBUA 4XN7A 1ORQA 2YRLA 5T33L 1TUPA 1GY2A 3ZRCC 1HYSD 1XGQA 1UATA 4KI5C 3IMRA 1KTDB 3RBGA 4G7SB 5EOTB 2TAAA 3W11D 3L3OB 2A6JA 3N2JA 1MCIA 3O4LD 4KTYA 4TKWA 2EO9A 4M7LH 5TJWK 1ZS8A 5FYJL 1S2EA 3R4RA 1UZ8A 5E5MA 2XZAL 4FCHA 3VXSD 5E2VH 3L4UA 4ORGA 3IGUA 4J6IA 1DBAH 3GC3A 3GSRA 3ZL1A 3F7PC 2VMFA 3VXQB 5DJ0B 2FQEA 2VO8A 3F58L 5HGGS 4LSTL 4AXWB 4NRZA 2Z93A 3DX9A 3KPOA 2VO5A 3ARED 1B0GA 3GBML 3MLTA 5JHDB 3NPSC 4R5TA 5EN2B 1OZUA 3AAZB 3MZGB 5DHEA 1JVKA 4QR7A 3PG2A 4FF9A 4BM7A 2EKSB 3FU6A 2NY0C 4K3HA 4YDLC 1R5WA 3HG1D 5A2FA 1BWWA 1P5UC 2XUWA 3Q2VA 1UH4A 3SQOL 5IMLA 1V7ML 2WZAA 3CU1A 4NCC2 1A7PL 1IBDA 1ZOXA 3V4PH 2WBJB 1QBLH 1JD9A 4X83A 5DTFA 4A63A 3BOVA 1A5FH 2X4OB 4K9EL 4OGAD 1WP6A 5IF0B 4BWTA 2UX6A 4EI6B 1E6OL 4YHNB 1GZHC 2R23B 3SKMA 3W39B 4MDIA 3QBTB 4QRUB 4Y88A 2ESVE 1NWPA 4NNYA 3SZ6A 3ZHFA 1F90H 4CGUB 4NJ9H 1IT9H 1TSHA 4PI0A 4HG4J 3KXFD 3L9YA 3FZUD 2X9XA 4AEFA 4FHJA 3T5WA 1N4XL 2Y22A 3GIVB 4M3HA 5KVDE 5I1KH 3UTOA 3JXAA 4TL5A 4WHYH 4U6HB 3QT2A 1BAFL 5TDNA 2BINA 5FCUH 4M8RA 2CPUA 3FOMA 3FSWA 2UWEB 3EH1A 1Z9LA 3QHZH 4HJGB 2AXHA 4AE1A 3IFLH 2QSTA 2W0FB 1PG7W 1LLAA 2XN9E 4AQ8A 1CL7H 3FXIC 2RJMA 3IBEA 8FABB 5KSAA 1T04A 4U05A 5KBMA 3VW3L 2BZDA 3BPNB 2WGNB 1ND0B 4PJXA 5DUPL 4YXKH 1MG3C 3DECA 3ZE0B 5EF3A 1OPGL 3LPWA 2QQLL 3MJ9L 3T2NH 1SBBA 3PDOA 5SWSA 3AU1B 1JZJA 5FHBH 3QUZC 5K9JL 1CFMA 3NZUA 1I8UA 2PNDA 2KDYA 4ICXA 3EJZD 2QFPA 4XVUD 1CDYA 3GLZA 3L4XA 1BYPA 3OMIB 1V7NH 4PJFE 4Q89A 3BP5B 2XV3A 5EU6A 2BMKA 2FAUA 4OSUH 1AACA 3E6FA 2CRMA 4RFOH 3Q1SH 3W5NA 2FX9L 4YHIB 4A2FA 1OSPL 1D9KB 3MLYH 4L29A 1JVOA 4D94A 1BZQK 5ESVB 2NR6C 3P3UA 3O6KL 3VG0L 1ZLEA 2H41A 3EBIA 1WAAE 3VXRB 3EBHA 2J56A 3CVCA 4GKZA 2F74A 3DTXB 1WBZA 3G5WA 3ZPDA 3OKEA 4ODHL 4KQ0A 4WV1B 5AL8A 1GHFH 5F7AA 2D0GA 1FHNA 2IWKA 1OM9A 1LEGA 3CJJA 5J9PB 3VNZA 1G7MB 4AYID 1AP2A 1I8AA 4J3OF 2BIQA 4HFUH 1LP9B 4K7PL 2F9BT 3GB7B 4WY7L 3K81A 3PGCA 5DWPA 4LKCA 3QZMA 4GRLA 5EO1A 4HH9A 4CC1A 4LKXA 4KK6D 1FIGL 2E27H 3I2CL 1SHXA 4R0LC 3TWYA 4ZD3H 2CWRA 3G6AA 4YSUA 2FNWA 5IESH 4OLVL 5F9JB 2P28B 4BQ8A 3QQNA 5DDHB 2WP3O 4V1DA 3RX9A 3V95A 1WF5A 4JVUA 2BSBA 2QPFA 3W9EA 1O7DC 2WWKO 3IWVA 4W9DC 2AJSH 2WQRA 1EAQA 2WN3A 4MZRA 3DRQA 1ZLDA 2KMWA 3NDZE 4HZAA 1U6AH 1IGCL 2A4EA 4LLVB 3DO4A 3OKNA 4PRIB 4Z7VF 2XZCL 5FR3A 2FNBA 3WFDH 5JIPA 1XTMA 2EDQA 2LTQC 2E9WA 3DBXB 3SE3A 1Z5LA 1JSYA 4OQTL 2RACA 1I4FB 5E8OB 3DV6B 4XAWH 1L9NA 4Z7UF 1Y6KR 3OX8B 1F13A 3MO1A 3LQAC 2J6EL 1RMFL 4NGHL 4KZ0A 4TSAH 3VXOB 2DEXX 4I18A 3DX6B 1ZV9A 2ZONA 2H8PA 4JRYB 3S88L 3SHSA 2BSEA 4L4VA 2JMRA 2R0LL 4PRDB 2APVA 5TF0A 3A6CL 4FABH 2XA3A 4Y2NA 4CJ0A 3AT8A 1M6UA 5E1AA 2B20A 5KVGL 2VDKL 1OP9A 2IANA 4K71B 3EGSA 1CDBA 4P5MB 3B2XA 1BMWA 2ZOLA 2G2RB 4JFPB 3ARUA 3ARFC 3FUMA 1NIDA 3SE8L 2ZSVA 2D3LA 3LN4B 1ZLWH 1BQSA 2XBTA 2HTKC 4D0CA 1A9VA 1NAMB 2JIXB 2JWYA 3DNKA 2A5UA 5I6NA 4V2CB 1EMTH 3BDYH 4MDRA 4HJ0D 5HDBE 4CSPA 1U8PB 1JK8B 1THAA 2CG9X 1TEFA 3JV4B 2V2TA 4Y1TA 3HZYA 5DMKA 4OD1H 1M4KA 5CD5C 3HTLX 4M8QB 4LO9A 3BEVB 2ICES 3MRNB 2OKMA 4ACTA 4X6DE 2FBJH 3WENA 1LO4H 4KO6A 5I74C 1CF8L 1W72L 3SCMB 3CMOH 4QY8A 5DC2A 5I17B 1FE8H 4DOHE 2O5XL 3BAIA 1UGKA 3HE7A 3WTVA 1LO2L 1U58A 2XVBA 3VI3A 2J88L 1LK3H 4Y2LA 4KQ3H 1U21A 4LLDA 3BYTA 3DSNA 3L1OL 2YA2A 5EDXA 5HHXH 3ZOAA 2J1WA 2MCG1 5DHXB 1NIEA 2YMOA 4ZAKB 3G3LA 3IFNH 3FQYA 4RGNB 2EDOA 4BQ6A 5ITFB 2Z7ZA 2BPBA 3AVEA 3NJJA 5DGQA 3SQBA 2R1WA 4NZUL 5BV7B 5E1GA 5I75B 2WO3B 1FF5A 1OQXA 2WTPA 4G7YH 1ZANH 5D7IB 3ZR6A 4QF1A 5BNXD 1LO0H 2RCSL 3RFRA 5MHSE 1JXDA 1MI5E 5FUCE 1W0YT 5KSUA 4HJIA 1BVLA 4DZBA 1SDDB 4ZG1A 2CLZB 1MAMH 4QRRE 5LDUA 1MREH 3QH3B 4S1RL 3ATEA 4NN7B 3BZEB 1AVAA 4XI5D 4BK5C 3H55A 1JS4A 2IPTL 4L9LA 4M7ZB 1KOAA 1R24A 1O6SB 5JDSB 1B0WA 3TBTB 3ESMA 3UCRA 2GIXA 5DSCB 1Q94A 4HG4K 4NM4H 4OT1L 3SPGA 3ZTJG 5K1NA 2BIIA 1QRND 4ZMPA 3PNRB 3N91A 2YAQA 2Y6SC 4XNXL 2PLTA 4MXQC 1P7BA 4P2OC 4NAMA 2C3WA 2FWUA 1A1OB 4JRFA 4MAYB 4X6CE 3BH8B 3TBCA 4UB0L 2EINB 3EO9H 3O6FA 4WDIB 3ZVVA 1VZGA 2N3JA 5C08A 1OTUD 2UY7A 5EZLB 3LEXA 1U95A 5J1AA 3VJ6B 1LQBC 3RU8H 1U2YA 1QHOA 2V7HB 2KLTA 1CD1B 1BF5A 3BGAA 4UF7C 1ZEAH 1UVQA 3QNXA 4A2MA 2PCPB 3EYVB 4PM1A 5CN2A 3RTQD 1YAZA 3K4AA 4K94H 1C16B 2AXFA 5CGMA 1TQCC 1BJ8A 1EJ8A 1JDDA 4JPVH 3NZHL 4ZMNA 4XVTL 3IJEB 2N7SA 1MFDH 4GI9A 2JI1A 2KC0A 3HHRB 1CD9B 4W70A 4JRWA 1Q9KA 1AGEB 4IGBC 2Y1YA 4AEHH 2WUBL 1ZGLA 1FC2D 4X8JB 2IH8A 1J9CT 4HF5H 5EU5A 4CVXA 2C1OA 3C2AH 3GGWB 5EEVA 3MJ7A 3VRLE 3U4BH 2OAAA 1AGFB 1WBYB 5EOQL 4GINA 2VDOL 5C0DB 2K6ZA 1VENA 1R4XA 4WU7A 3V52L 3VXPA 1GW6A 5JA8B 5A40E 3KGSA 3SO3C 1AYOA 1FNEA 1NLBH 2DIEA 4XNUL 1IGMH 3QJXA 2NNAB 3CQFA 3OR7A 4G8FB 3RY5A 1E50A 5AOKA 1RURH 1A4CA 4QTHA 4LAQH 1YYLL 4HD5A 1P5VB 4I0KA 3SDDB 3WXVH 3CSGA 4G42A 4NB7A 5ETUB 3PP3H 3BCFA 1V5JA 5IMOA 2GAZA 3FQ2A 2VDRB 3GHPA 1IM9B 4NUJB 2OMBA 5B1AB 1Y07A 4LXFA 2VL4A 1KN2L 3UMTA 1I3GL 2UZXA 4LSSL 5FWQA 3AT0A 3IXAB 2HVJA 3CLEL 4EOWH 2BRQA 4FFYL 2OA9A 1F1GA 4KNUA 4WEUD 3NYKA 1MI5D 1LM8V 2JELH 3HI5H 5IGXL 3ZL4L 4N8CL 4X7DC 2ADYA 1WRFA 3DHMA 2ZF8A 1DN0A 4QRRD 4Y5VC 2I07A 2DIJA 1I1YA 2ICWA 3ZSSA 2WO4A 2BFVH 4IHOB 4WCYL 1DJGA 1SOSA 4BFKA 3IM1A 4D9LH 4JGNA 1T5XA 3EYOB 1P7KA 3HPJB 5FDWB 4IDLA 3S4SB 4H2CA 4Q2ZB 3EFDH 1EO8H 4RIRB 2H1LM 2X0VA 2ZX5A 2YOAA 1NBQA 4E9RA 4ODWA 1XT5A 2KZKA 5HHPA 2W95A 3NVQA 1FFTB 1XF5B 4R4BB 5JUEH 5KVFL 4XOBA 1HVXA 3GKZA 4JDTH 3VXUE 4G9FB 1UOWA 1T2JA 3WNOA 4G8EB 2ZOTA 3NOIA 1U8IA 1A9EA 5D93B 1T5KA 1A9BB 3FU9A 5C6TL 3V7AG 1UJTA 3WGVB 5T1KA 4QHMB 1VDGA 1IAIM 1USQA 3MN8A 4Y16A 3O9WB 2GBUA 3EFOB 1J7VR 4JJ5B 2NY4C 3MMEA 3STLB 4X6EA 2O5YL 4CRPA 1DEEB 1ICTA 3QXAA 4LRIC 4XH2B 5JXEA 5ICYA 5I8CB 1I8MA 2A74C 3S98A 4AIOA 4ZFZA 4Y2DC 3KPSE 1MCPL 3FT2A 4FEMA 2YGNA 1CFSB 5DK3A 3B7YA 4JFZL 4ODVL 3D50A 1T0NA 3CVHL 3UYOD 2ARJA 2VABA 4U3CA 1BZOA 3IAQA 2Y1ZA 1A7QL 4XMPL 2LAGB 1FORH 2OTWA 4HK3N 4C56A 3TBSB 4JPWL 4P2QE 3X1FA 5KBNC 3PL6A 6CGTA 4RAVA 3GIZL 5HPOA 4ODXB 2C8NA 2D03H 4MJHA 3VWJC 1XIWA 1MNUH 1NGQH 1VEOA 3HFML 3C5SB 2WXNA 5GJTH 2LLGA 2FEEL 2JJUA 3OMAB 4M93C 1AGBB 4MJJA 3JZYA 4NN6C 2DQHL 5T5FH 1OSZA 3L9EA 4JR9L 5I5IA 3PIQB 5IVXB 1N0XL 3BLBA 5I66B 4FFWD 5DLMH 2NSXA 5KANG 2H2PC 2H26B 5FF6B 2WMPA 4YHLL 4XX1E 2IGLA 1FZKB 1NCCH 4UBDC 5D1ZC 2QTEA 2VXVH 2ZUYA 4D8PA 2F08A 3MGTB 1FL3B 3QFDA 5K1VA 3KXFA 5F1KC 5F72S 4HUWB 1J5CA 2C7FA 4NUGL 1IM3B 4GAJH 3P77B 4L3CA 5HI3D 4EBQH 1ZWIA 4LLQB 3ZXAC 4LOEA 5IQ7H 2NMSA 1MHCB 4DQOH 3GO1H 4X5WB 3UTSA 1D5ZA 3HZMA 2NT0A 4H7VA 1AXTH 1IEBB 2QLVB 3QPQC 5I1AB 4Z7OB 3MLRL 3LMJH 4AQEA 3FB7A 4WNQA 4XWGL 1MFVA 3KYOA 3CDZB 1KDJA 1ZV2A 3JBG7 3DO7A 2DAVA 3C6LB 1T89A 2ITCA 3QK0A 1UXWB 3O6MH 2CJTA 1H0DB 1XCQB 4TUUA 4TQEL 3TYGH 3AWEA 2EUVA 2XVGA 1UFUA 3MQIA 1BOGB 5AYUL 2J1XA 5MENE 4QEGA 5F8QC 1ZT7B 3L3GB 4LLAA 1MW0A 5CXPA 3NSFA 3QFJA 4MX7B 1EHLL 1CYWA 4WTZA 1LDPL 3ARYA 1DBBH 4XMVA 4I87A 2D31A 3EDEA 3P2BA 4XPBL 3VVWA 4APQB 1TQSA 2YGVA 1SF3A 5D7LB 2CBQA 4OGXH 3TN0D 3DXAA 4O5LL 1EXUB 1QABA 1Y7VA 5ISZD 2F7IA 3HAEG 3NRPA 3B3IA 2B1HH 3EJYD 3Q6FB 3VXUD 2VN3A 1DQVA 1K2DA 2YGOA 2YARA 4DP5X 4W6WB 2A6JB 3H7BA 3FCBA 1KCBA 2O6FA 1MVUA 3BFWA 3PHOB 4KROD 3RRQA 4YWGL 3RUGA 1ZVYA 3ZT5A 2F7RA 1NCTA 2F58H 1CXFA 1P4IL 3CUPA 3KH4A 5E5MB 3FNKA 1HHKA 3HBZA 2A38A 3A67H 4ORGB 1OIOA 3RNKB 2BSSA 3GSRB 4FNRA 1SLWA 2ZQKA 4XC1L 1KPUB 3HC2A 3TF4A 2WKLA 3GXNA 3SOBL 3T4AA 2PO6A 1JZFA 4Q9BA 1TQTA 2LFGA 3KPSD 2XWJB 1ZIAA 3FHEA 3DWTA 4GSUA 5CFHA 4N8PA 4K5MA 3VFUA 1G5AA 4NRZB 4C54A 2Z93B 5A6MA 4Y5YC 3QWNA 2XTSA 1UFGA 4FFZL 3LEYH 3I75A 3MLTB 5I76A 3GZKA 3OHMB 3IMVA 1PDKB 2X1PA 3UMNA 5JZ7D 2BNRA 2HG0A 1YYMH 3QGVA 5L6YH 4FTDA 5I1EH 4P2QD 4N8VG 4PJAE 1GH7A 2W07A 2DYPD 3TA3C 4Z5RB 3FN0H 3D8MA 4I0PA 3WY4A 5KBPA 2HJFA 4M5SA 5TPWH 5AB2A 2QZQA 1TZAA 1U8OA 1H8OA 3QULB 1U42A 2J3SA 5I1DB 3F6LA 3GXFA 3JWOL 2JF1A 4R4ND 4DZ8A 3CFEA 3HC4H 5DTFB 1KGCE 1N8OE 3A6BH 4WO4A 3SDAD 1MCEA 1OHQA 2K0RA 1NDGB 1D7DA 1WFUA 3QRLA 1JGVL 2YEVB 2VLRE 3BSHA 4GQRA 4HEMA 4NKIL 4MDIB 4A7VA 2CZNA 1A8ZA 3WIHL 1CXHA 2Q2LA 5CJ8A 4JBSA 3X3GH 4FA6A 3DX8A 4HWBL 5FCSH 1F4XL 1JIBA 3PV7A 2RQ8A 1QNIA 5HHOA 5GZOC 2IFGA 4M9PA 4EVNA 1XMWA 1OXYA 3GPSA 1CGTA 4W81A 2YZ1A 4BKTC 3LJ3A 5F9AC 2BNUA 2QHLA 2QJDA 1K3IA 4JDEA 3CDYA 2AQ3A 6FABL 1KXTA 5TDNB 4Z7QB 4YSOA 3VXTA 3TEYA 1B6DA 4OUUA 3FOMB 4UANA 5JPMC 3UTTE 3L6FA 1H3PL 3CPLA 3BKJL 3GXMA 1VFAA 4TNFA 4X99B 4HJSA 3I9AA 2G60H 3NABL 4UNUA 5KSAB 4HCRA 1T04B 5MEND 5DURD 5KN5A 3H2QA 1C1EL 3BESR 5FUOH 4PJXB 3GSUA 3TV3L 2FO8A 4TOYL 4PS7A 5I1CL 4IRZA 1QVOB 2AEQL 2VXTH 3FMGH 4R90H 3RX8A 3PDOB 3QDHA 3LQAL 4F9LC 1NCJA 4P9HH 4QNPE 5LGJA 3HKZA 4GMSH 3WIIH 1C12B 4RDQF 4FA7B 2DH3A 3VGBA 1NCDH 4ANKA 5ANMA 4JLRA 3TH3T 4OUOA 4G6JH 1AR1B 4U4IA 2Y25A 5KJ7E 2BMKB 2GVYA 3C9NA 2FEDD 4N0UA 1QO3A 4HV8A 4PGDA 3F7VB 4EQ3A 3KWUA 3P54A 4L29B 3CTTA 4UM9A 5KVDH 2WQ8A 3LZNA 4A7GF 1HI6A 1DQKA 3JVGA 1E4JA 3HNTH 1AZZC 4QHPA 4FRWA 4GKZB 4NKMA 4NS0A 2HH0H 1WBZB 1KGWA 4WWNA 3SDXB 1J1PH 2JKWA 2ZJSL 3TIEA 3OHXA 4GRLC 4HIXH 3THML 5HXMA 4NCC1 5IBTL 2HRPH 2VL5A 1I1FB 3OZLA 4GUPB 2WBWB 4TPRL 3ZYZA 2F8VA 3UJTH 1AP2B 3NSJA 4NUPA 1I9JH 3HG5A 4HCRH 2EXYD 4ZUSB 4MHHG 4YMPA 3PREA 3PGCB 1MCWW 4LKCB 5EO1B 5DK2B 4HH9B 1X5JA 4N0CC 2R2HA 4XNDA 3IB4A 1K6QL 5CCKL 3CFCH 3G6AB 5C09B 2ODHA 3O2DL 2P42B 4NZRH 4WFEE 1Z1WA 4RMTA 2OYKA 2WVVB 1O9VA 1XL4A 3S35H 4ZX3A 1KGCD 1T0PB 3U46A 4TNGA 4O02L 2EYSB 3NCFB 3SE3C 5E00B 1WA2X 2E86A 4R2GB 1TMQA 1XL6A 1T7WA 2VLRD 3W9EB 1A3RH 4DNLA 2XWCA 3DRQB 2PYFA 4PJ9D 3WDHA 4B6ZA 4OI7A 3B56A 2OCCB 3PWPB 2DWSA 4I18C 3TA3D 2AMUA 4R96A 1D7BA 3PAVA 3V7MA 3MXVL 1Z5LB 2EDFA 5FB8B 4DP7X 3A4DA 1GOFA 5ITBL 1C8QA 2G5UA 3BZ4B 4UI2A 5KG9A 4KPHL 4KJPD 2EIZA 2FLBT 3MO1B 1AZRA 1KFAL 1MZYA 4KXAA 4W93A 5EULV 3BRDA 4L5FH 2DLFH 3GHEL 4G80A 4YSTA 4AGPA 3QDMA 3OAUH 1A4KB 1K5NB 3UTTD 4FJZA 2H8PB 4Y7OC 3IVKA 1NCBH 3RWIA 4L4VB 4PJCA 4KMTL 3TWCL 1JMZA 2XLLA 5EO0A 4LSVL 3TGXA 2I7OA 4FXLA 1ZIBA 4AWJC 5E1AB 1P7QA 1KLGA 4FNSA 4O51B 2VKXA 4HW6A 5FPIA 3GDBA 3II2A 4Z7NF 3EGSB 1NLDL 4WI2A 4MXWH 4AKQA 1SLXA 1GSMA 2A73A 4RDBA 1BD2E 4F91B 4OGYH 1Q1PA 5DGRA 2D7TL 4HJUA 1FP5A 1I1CA 1D5IL 2BP3A 3F85A 1QOKA 1IGTA 2L8AA 4S2SA 1XH0A 4FJYA 4M43L 4WW2B 1KULA 4ZFGL 4X4MA 1MCLA 1GGIH 4PVMA 5B1JC 5AWNH 3VA6A 4QCIA 5IJKC 2ATKB 5MEOA 5T3XH 4ORZC 2YXVA 2V2TB 2NTFB 1RUAL 1CB4A 5LNGA 1SFHA 1IZJA 1OB0A 2JJSA 4P59L 5FO8A 5I0DA 2H0EA 5F0MB 4AZ8B 3NIDF 2VXQA 2VZ1A 2Y1VA 3AB0B 5I1HH 3SYQA 4G1MA 3ECVA 4POUB 3MBWB 4IDJH 3FQ4A 4QY8B 1BM3L 7FABH 2AAAA 5F9OL 3HE7B 5DVKA 1U58B 4DW2L 3L45A 3VI3B 4PGCA 3T0EC 1HHHA 4R7NB 3ILPA 3ZX1A 4CJ1A 1DR9A 3Q1EA 2XTJE 1L6PA 2Y0SA 2Z91A 3ZHDA 3ILQD 1KELL 4K94C 3EOBB 3MSPA 5FLUA 5LCVH 1SY6A 1FFRA 4RMBA 2LGNA 1JGUH 4EI0A 4G6MH 2OCJA 2R1WB 4P4RB 4LSQL 4PJ5A 3W0WA 2DWXA 1HOCB 4WFED 5KVEE 1C8PA 4LESA 2LFEA 4HCFA 3U1SH 4C58B 4DEUA 2PPAA 3MRMA 2APWA 5FECB 5KSUB 4DZBB 5J7CC 4IJTA 1HN1A 1UENA 1OAKH 4JPKH 4L9LC 3V0DA 2AEPL 5JQHC 3TEZA 5TE7L 2VUKA 3LXCA 3OC5A 5J4MA 3QJVB 3MJGX 2W5PA 1FGNH 1ETJA 1YQ2A 4BCYA 2MIZA 1BECA 3H9HA 3HNSL 3ULUH 1E8ZA 1R24B 3F3HA 5I6MA 1T5WA 3ZDZF 5HSFA 3BWAA 1RHFA 4J3WA 1O6TA 1CLVA 5SWZA 5J56B 2VXQH 5BMFL 1OAZL 3O6FC 5E4EC 2AJXL 1Q94B 1RIUH 5AOMA 4OZIA 4OKDA 4FOMA 4BJLA 1UXMA 2ZPKH 4Z7VE 2GK2A 3VUAA 3RWCA 2OYMA 4KX7A 2HMID 5FYJU 1RKRA 1H6TA 1FG9C 1JFHA 1CQYA 3FQNA 3RVVD 1Q8MA 1H6FA 4P2CG 2YXWA 3N0AA 2WXIA 4OCYH 5TK2A 5KYWB 1PCSA 2Z65C 1E42A 3HBGA 1O9WA 4Z7UE 5E5UB 1GS6X 3CQPA 1JXKA 3RY6C 4U3SA 4KUZL 1M1XA 5DFAA 1RZJH 2WXOA 3HPLA 3BH4A 3UIZA 5I9QB 2UY7B 3MLZL 1Z2KA 1WFMA 1ZT1A 3LEXB 1U95B 3L81A 4WNJA 4G8AC 1X5GA 2ZXBA 4KFZC 4N22A 2EDDA 1AR2A 1BD2D 3B1UA 2QT6A 3IN0A 2CGYA 1UVQB 3QNXB 1U33A 3FSOA 3LIZH 1CN4A 3LKQA 2K4AA 2AXFB 4J4PD 4Y4KD 2ZWLT 3MCYA 3WY1A 4LCIL 1INEL 1NC4D 3K8MA 2FR4A 5EF2A 3ZK0A 3ET9F 5JTWA 3CFTA 4P2AA 3KVQA 3MI6A 1RU9H 4J3SA 4UT6H 2VXUL 1ZGLB 1BDYA 1NFDA 3HC0A 3N41B 4XXCA 1M05A 2C3VA 3SB3A 4CVXB 5EEXA 3RVTD 1LDSA 4WK0B 3MJ7B 5CZRA 3U7YH 3FJTA 5CP7A 2EXWC 4UU9A 4J12A 4PV8B 4AW7A 4WHYG 4HAGA 4WU7B 3S7GA 3IBOA 5E7FA 3ARDD 4OCLC 4YPGA 3WS3A 4E36A 1FNEB 4MSWA 3CPUA 3QIBB 1PKOA 5AW7B 5HYQA 1B4RA 3WN6A 3OPUA 4WWKC 2VDMH 1P2CA 2OL3L 1F3DJ 3IS1X 3ULAB 2OFQA 3CFIC 3UGXA 1M7XA 3OR7B 1CLZH 2AJYH 2F54E 2JTYA 2FLMA 3L3KB 2ICWJ 1SDAB 3FO0H 4GB9A 4JREB 3H6JA 2XTJD 4IOFC 4YLBA 5GRVL 4NIYE 3UDWA 4BK8A 2OR9H 4G42B 3IRPX 4PRPA 4XPAH 5IMOB 2GAZB 3EOYG 2HX7A 5F7KC 3NN8A 2PYEA 4M7LL 1HYRC 2R39A 4YPJA 3SYOA 3H3BC 1TVBA 2BSDA 5E2VL 1GGBL 3OSVA 4J3OD 1DBAL 2ZG2A 1CFTA 1DE4A 4KKAC 2P5EA 1DVUA 1X7QA 2QKIA 1KCSH 4A66A 5LDSA 1OLLA 5BVPL 1HYSC 3QIUA 5IB5A 2I07B 1I1YB 2ICWB 2UX7A 3AMKA 4AL8L 1T22A 2MEJB 1T5XB 4YBLB 3W11C 1P7KB 3IJ8A 1BX2A 1RZFH 2EIBA 3S34H 2Z8WC 3FO9A 4YL9A 2CCWA 3UTQA 1IQWH 3LPPA 4Y16C 5KYUA 1C5BH 1RPQA 1RLBA 4N2OA 4MD0A 4ODWB 4PUBH 1SEBB 4RGOH 4Y1AA 5HHPB 1G4MA 4WEMB 1DQJB 4L37B 4PN6A 2AJVH 3TPKA 5L4IA 3B2VH 2AERT 2N01B 3HA0A 1AY1H 4OVVA 1A5FL 1FNAA 1A9EB 5I0VA 2AS5M 1OAXL 5T1KB 4QRFA 1VCBC 2ENPA 2NXYC 3F84A 2RTTA 3EHBD 5F7MC 4NO2A 1NKGA 1SZNA 5INDB 3QI9D 1N5AB 1PY0A 2GI7A 3MMEB 1FLRH 2X7LA 3MRJB 4MZ3A 4NQEE 4X6EB 1VGEH 3QXAB 4NJ9L 1I8MB 1IT9L 1MFBH 3RNQA 3NIFF 3C6EA 5E6ID 3PL6C 4MD5A 2P4AB 5AYQA 3QWQB 4N2FA 3WUZA 2I27N 4CC4A 1D5MA 5ALBH 2G5RA 1F58H 1T0NB 2VSKB 4DVBA 5I1KL 3AMLA 2G4GA 3IDJA 4BZ2H 4XN8A 1Z9MA 2ARJB 2A77H 2VABB 1Z5YD 4OGAC 1MAKA 3F7QA 3SQRA 5FCUL 4ERSL 2OTWB 4GQPH 3BRGC 3QHZL 1EK3A 1WT5A 4AYFB 4PJGA 5CSBA 5JHBA 3IFLL 3W3BA 4F33B 4RAVB 1IVLA 4LARH 4OAWA 1PNCA 1XSIA 5H2BA 3QUYB 1XIWB 2FO1A 4YUEH 1QMUA 1YZZA 2F1AA 4ES8A 3US1A 4OFVA 5IG7A 2KQMA 4YXKL 1TU2A 4IYKA 5DHDA 1A1NA 4IK6A 3T2NL 1OSZB 2C9PA 4OF0A 4O2CA 4LSDA 4PG2C 3QCVH 4PY7A 3GRGA 5FHBL 3GSXA 4DP2X 5JIKA 4J28A 4D0DA 2ZYSA 3IDIA 1E5YA 2HKFH 5D7JD 2WMPB 4NN5B 1BXAA 1DQMH 2F54D 5D7KE 4N0RA 1KBBA 1GTNA 1TXKA 3QFDB 1KV3A 2HVKA 1JWUB 2AJ3B 4Y4FD 2WJ5A 1DVSA 1IKNC 2X3CA 3MXWH 5DUMH 2BVOA 3V6OA 1V7NL 3UBXB 2TSBA 2EILB 4L3CB 3LH8A 1BYNA 3QAZC 4GQ9L 1MCNA 4H8WH 4OSUL 2Q9OA 4RFOL 1YMME 4KMLB 4NNXA 5C0AB 3MLYL 4L3EE 2X6VA 4I1RA 2HA1A 3CFJB 1GRWA 3UP1A 4R4FH 3KYOB 4G72B 4MB5A 3QP3A 3K6OA 3PF2A 5DZAA 2FYYA 3MNWA 5J89A 2ITCB 3FQTA 1N59B 3U2JA 3EJZC 1GHFL 3ZRFC 1YEKH 4XVUC 2VN6A 4MVBD 3K2MC 1IAOB 1I7TA 5DJXA 2NXZB 5IJVA 2CA3A 5ANHA 4JM2B 4HFUL 1E43A 3KAAA 3L95B 2E9GA 3DOSA 2HXAA 4BA8A 2D31B 3Q2LA 2PXYA 1MCDA 1UASA 2FH8A 2VDOB 2E27L 2TRHA 2NW2A 3FUFA 3MGOA 4ZD3L 4JE4B 1V3JA 3S3PA 2K7QA 1CG9A 4G8GB 4PJDE 3U2IA 1WC7B 5IJCC 3B3IB 3GRBA 5IESL 3BIBX 4OLUH 1RUKL 4RX4D 2X3BA 3VFPA 3SGJA 3H7BB 4BELD 3UXFA 3EYQC 4NP4L 3RUGB 2WVUA 4NRYA 1TFHA 2AJSL 3G5YA 4ETYA 1JGDB 4XPGH 1S7XB 2N7BA 2WHVA 3CUPB 4NQED 5GIRB 1HHKB 3A5VA 4JHBA 5TDPA 3T3MF 5EIIA 1U6AL 3BXNA 1EFQA 1F5WA 3WFDL 4WUUE 2PO6B 2QVFB 4Q52A 3T4AB 1EBPA 1UD3A 4YAQA 4Y5XA 1WZKA 3WDJA 5D2NB 2BOBA 2PR9A 4XAWL 3VFUB 4QD2E 5TE6H 3RX7A 4F24A 3OZKA 3DBSA 3I75B 2RIKA 2VDPB 5GGSB 5I6OA 5I76B 2CIKA 1BXUA 3O2VH 4P9HC 3GPEA 1AANA 5IW6B 2CHWA 2J21A 1OARH 2EQDA 4WO4C 3FTVA 3WAKA 4AUYA 1UYWH 1WCBA 5IKCA 3MLXH 4R26H 4I0PB 5I18H 1X7TA 4JRXE 4FABL 1BAGA 2YWYA 1U8OB 3CFDA 1X9LA 3D69A 1QHQA 1NCHA 2W0KA 5B8CB 4AJWA 4L05A 4K8RH 2OI9C 4AT6A 1YMHA 3NACH 4OAWB 1OOWA 1YG9A 4YE4L 3D0VA 1RZ7H 2G5BA 2PWGA 2DKMA 3V4UL 5LG6A 2MCMA 4U6TA 1VHPA 3V4VH 4EXPX 4ZOAA 3UH8A 3TEUA 4GS7B 4NC2B 4EVNB 1EMTL 3LH2L 2VSDA 3U0WH 1X9UA 4Z77A 1UXSB 4L3ED 5F3HA 4M1CC 4CA4A 1KXTB 2Q0ZX 4OD1L 4XR8C 4HWZB 3VXTB 1HZKA 1YAIA 5SWQA 3CPLB 3VO0A 1LO4L 1VFAB 3MUZ1 3HRZA 3HS0A 3HMWH 3ARPA 3BVVA 4J23A 4OFYA 5DVOA 5KN5B 4KI5F 4DETA 3LRSB 4JFEE 4XMWA 4XO5A 3UAJA 1G6VK 3GSUB 4JVWA 5HHXL 1JCKA 2QVIA 5CCHE 4NQCD 3WL9A 1XGPA 4HJ0C 1U8CA 4LLMA 3R19A 2PUQT 3D4CA 4ZXBA 5I1JL 5GRUH 3B9EA 4PJEF 5T1LB 3CLFH 3QEQA 4JVPA 1UXLA 5DZPA 5CGTA 3L5HA 1ZANL 4RVBA 1LO0L 1LGVA 2B1AH 3MC0A 5BXFB 4Z76B 2EXSA 3BT2H 2WPGA 1H3WM 1TJHL 1XCXA 1HCVA 3DTDA 5A7EA 3C9NB 2CCLA 1MAML 1TLMA 1X5IA 4Z0XA 1LVEA 3MVSA 4PGDB 1QO3B 4HV8B 3P9MB 1GAFL 1JV5A 3ARQA 2VWEE 5HDOA 5EU4A 4LQFH 1GZQA 2DQUH 5HGHB 3L3HA 1UM4H 4JW3A 4NKMB 3MRDB 2ZKYA 4WUUD 3TTSA 2Y36H 1QWHA 3TIEB 1YY8A 2ITEA 3OHXB 3QUHA 3JVFC 1QATA 4PYHA 3VXMA 4KTDH 5LGHL 2LLLA 4BFBD 1NGYA 2NW3B 4MNQE 4Y2OA 4NM4L 4OGQC 4LDCA 1XZWA 1S9YA 3EBGA 4PP1C 3BO8A 1KGYE 4H1LH 5I1GH 4DTGL 2R29A 1MCBA 5AKTA 2ZAIA 3LB6C 1EO7A 5FM4A 3GLEA 4FP8H 4L23A 4NO0A 1F86A 3SBWA 1K85A 1G9HA 3KCWA 4JY6B 2APXA 3EO9L 1T1YB 1RVFL 1AJ7L 1XBDA 3F12A 3TC9A 3ZIMA 4D0BA 3U46B 1LO3H 3S2AA 3VQ2C 1MF2H 4NRXB 3RU8L 4BRJA 2APFA 3K71B 5T1DH 1ZEAL 3RVXD 3VFGH 4K94L 3WKPA 4JKMA 4JPVL 5IEKA 1UA6L 1MFDL 5JLZA 4FTVE 4R96B 1XCTB 1KEML 3F65A 4LCWB 5DLLA 5K9KA 3BC9A 2XVKA 3H6AA 4BUGA 5I5RA 5J3HD 4HF5L 1DUYA 3ZGHA 2EIZB 1OTUC 2GABA 3C2AL 4XWOD 5I30H 1K72A 5D1XB 3RIAF 5IMMA 4G80B 1NINA 1KCLA 2WZ5A 3QDMB 2WK2A 4KKZA 2E9IA 4K3EL 1BZEA 3QUXB 3IVKB 5K59F 3NCCB 3RWIB 4UZUA 1NLBL 4JFDB 3AQDA 2IGTA 4PJCB 3RTQC 3RZCA 4JX0A 1IGML 1R47A 2R29H 1DCEA 1A4BA 1HZHH 3AUWB 3CVDA 4JFED 4R9HA 1BF8A 4XE5B 1WE5A 3U25A 1RURL 4BSWA 4GBXA 4LAQL 1KLGB 1FL6A 2PKDA 5GGUB 3GMPA 3WXVL 1QUNB 3DMMA 5HGAB 1KDIA 3N9GL 5C07A 5DD0H 4XMTA 2DJSA 3B5HA 4EIUA 4UILH 2AJUH 4XN2A 5AAMA 5DD3H 1UTDA 3HFFA 1QTPA 4G59C 5I15H 4MMYA 3WTWA 1KGJA 3ATDA 4BFFA 3ULUC 4HHGA 1CMOA 4R7DA 1IGTB 4S2SB 1IGIH 1KN4H 2IBZY 5E4OA 4L1SA 3ZKXC 3D4ZA 4PRHA 4GG6B 3UZEA 2YQ2A 1MHEA 5GGQH 2C9VA 1R17A 4N2HA 1B90A 5MEOB 2BFVL 3WNPA 4LPUA 4TVPH 5CR1A 4D9LL 4Z7AA 4H88H 3ARBA 4K15A 5ILTH 2AITA 3RGVD 3UC2A 5FO8B 5BQ7B 3VFWB 3EFDL 3EDDA 1M71A 4NOBA 4QXUL 1RZJC 4G1MB 1HESA 3GLDA 1NKRA 1DJXA 1VFBA 4ZMWA 4EI5A 1WPCA 3HI1B 4MNQD 2VMDA 3NFPA 4LVEA 1HHHB 1AO7D 4JDTL 3ILPB 5ACMA 2F53B 3AG1B 3WKMH 4N5UA 2QSQA 2EIJB 3W37A 4Z1PA 1P9MC 1U36A 1BVKA 2GJ6A 2ZX8A 5FV2A 2VLME 1SYSA 3U9WA 1M7UA 3HB3B 3RE0A 1AKJD 3QFGA 1IAII 3U2SB 1GGTA 2BWQA 1T80A 4PJ5B 5E4AA 1TFPA 1NM4A 2SEBA 3MV8E 4MQXD 5E8NB 4KTGA 3MRMB 5C2UB 5IT2H 2L04A 4NZTH 3WEXA 1NUFA 2IDFA 2LU3A 1DJZA 1KYAA 4ICWA 3CNKA 1XXFC 2GJPA 1R3HA 1INQA 1R3JA 1E6JL 4LK4A 1A47A 1J9SA 2PETA 3FFCE 4K07A 4ABUA 3FUJA 4N3UA 3VWKA 4TXVB 1FORL 2Y3NA 4FTVD 2WBKA 5HBBA 2X12A 3NPZB 4IJ3C 1AZVA 2CLVB 1T5WB 2AV7B 1DJWA 2DEYX 4AITA 5GS2H 3BWAB 1GGCH 3QC6X 3VTTA 3GSNA 1QZ1A 4GP4B 5AW2B 5BOJA 3NJIA 3Q7JA 2K8QA 2ZOKA 4ELMB 3ZKND 5T5FL 3FQNB 1XR8A 5DLML 1MZZA 5CAYB 3ZQXA 3MV9E 3TVMA 1A6ZB 4XO4A 1TZOA 1NCCL 3KLQA 3LNHA 2A9BA 5IB2A 4U3SB 4WTZG 2K3TA 3HPLB 1IL1A 5FYJE 3WIAA 5KVEH 4GO8A 3VGAC 2EC8A 2YR3A 1U8QA 3TT1H 4J3OH 1ZT1B 1H6EA 4LPXA 4GAJL 2F5AH 1JRHI 4EBQL 4P07A 3TCXA 1J5OH 1L7IH 2GJRA 1BQHG 3NJKA 4G6FB 4IOSD 4LU5L 4PS4H 3UL4A 5IQ7L 1HEZA 4DQOL 4XXCC 5HYJE 5FLVA 4O02B 5GGVL 5E8EA 5JORA 3LKQB 1NAKH 1AXTL 3TO4D 1MCCA 3N6YA 3LMJL 3MZTA 1KNOA 4NC1E 3T1FB 4WWID 2FR4B 2JNZA 1KB5A 3RDTD 4FE9A 4A68A 4FQJH 4Z7NE 3O6ML 3U48A 5JIIA 2QGBA 4QRQA 2XWXA 3CFQA 4O2EA 1A1MA 2P48B 1M05B 3JT2A 4U1HA 4Y8AA 5FKAA 2EVHA 4X50A 1G9EA 4C57C 4QYOA 4C47A 1EDQA 4W9IC 1TCRA 2IPKA 5CEYA 4F27A 3UDWC 3IE4A 5EOCH 1QBBA 4QJ4B 4PVLA 3GSNH 1MDTA 3DJTA 3WS3B 4D7BA 4YPGB 5HYQB 2D0HA 1IRAY 1OTTC 4MSWB 5JIMA 4U0RC 4M6NL 4OGXL 1P2CB 4HAKA 2E7LA 4ZO9A 1BBDH 1ODAA 3NJHA 1RH8A 3UGUA 1NSNH 1A0QL 2B1HL 2PPEA 3K0YA 4I48A 5D6CA 4DFIA 5FGCE 4PRPB 3NIDE 2VLMD 2WLHA 5BOZG 5CJXA 1U8HB 3IDNB 2E5EA 3KGUA 2CDGA 1OGSA 2WAHA 3QIUC 4XE0A 5M94B 1A4JA 2FECI 1T3FA 2IH9A 3H9SD 1TVBB 4JO2H 1YEEH 4JUSA 3A67L 3CWGA 3LXUX 1R3LA 2B39A 4ZTOL 3V0WH 3WNNA 3KLAA 3MV8D 1AD9A 3K46A 1JGIA 3TN0C 4CVZB 1X7QB 3B6SA 5IHUL 2QKIB 3SKUD 1EJFA 1QSFE 1RUPH 2CBTA 2FJFA 5DRZA 5IB5B 2HAZA 3DIFA 4NKOB 5DMJB 3SY0A 3QRFM 3NA9H 1I85A 1T22B 2XXCB 1BX2B 1YEWA 5L6YL 4KROC 4F7PB 5AVZB 5I1EL 3FO9B 3UTQB 3QZWB 4UM8A 5EEZA 5C0CE 2JB6B 1F4WH 2JK5B 1EFXD 2VR5A 3TZVA 3KLDA 5KYUB 3QG6B 4MD0B 1YHPA 3H3KA 4Y1AB 4P5TA 2FL5A 5C71A 4AYDC 1FFNA 4YZFF 2AXJA 2ZUVA 4H8WC 1DTUA 2NY1B 3HC4L 3PV6B 4WWOA 2X28A 3A6BL 4H4NA 4F7MA 4ZUUA 4WI3A 4K3GA 5DS1A 4XMLH 4AMXA 4CC4C 3S6CA 4NO2B 4I13B 3MV9D 3DIDA 5EBWA 1KJVA 1RJCA 2HX9A 3ZDZE 1SOQA 4GRWB 4G6AD 4Z6AT 5JZ7C 5CP3H 2HKHL 2ODIA 1ACYH 2AABH 3GSQA 3X3GL 4FADA 2YAMA 5D2LB 4JFOA 3RNQB 4JFSA 1TZIA 4KO5A 1YUHA 3ZYIA 4UT9A 3EF4A 4MD5B 4PW3A 1MCQA 3N1FC 4ALAH 3STBA 5ADPH 3NGBC 25C8H 4R6UA 3UTZB 2DY2A 3MRRA 4B9PA 5GXBB 1OANA 7TAAA 1D5MB 4DVBB 5HYJD 3DKHA 4R4NC 4XCFH 2H6OA 3E6HB 3JWDH 3MCG1 3QEHB 1OF2A 2Z0BA 4HK3J 3SDAC 1BW8A 2YO3A 5IK3A 3UEQA 1NCUA 3BSZH 5CR8A 4J3BA 4HUUA 5KYXA 2JKTM 1YNKH 2X2HA 4MNGE 4CL7A 2X42A 4LNRA 4DUWA 1YRKA 4PCKA 1ROCA 2G60L 3O8XB 5H2BB 1JPSL 2Q8AH 2MCAA 4CSZA 1IAKA 2BIHA 2O5ZL 3DUUA 5TQ2H 4BV1A 5FUOL 4FXGA 3RPKA 4M61A 4Z3GA 1OCWH 3B9KD 1A1NB 3FMGL 2G3XA 3JUYA 4R90L 2HRLA 4WFFE 4O2CB 2D9QB 2X1WL 5E51A 1CGSH 4F8OA 3P4LA 1U4EA 2DQMA 3GSXB 1QFPA 4I3GA 3IDIB 4GMSL 3II1A 3WIIL 1DVQA 4OZFA 3QXWA 3CSYA 4XXWA 4CMMA 3FTUA 2BSRB 1A3LH 2HVKB 2CKBA 3QIWA 3BGFC 1FZMA 2XT1B 3G5ZA 1AD0B 3FT9A 3MR9A 3MYJA 5BRQA 4AJVA 4P2RA 2BVOB 3OZ9H 3BPOC 3ISWA 2VN4A 2XKNA 4YK4B 2X5PA 3HLKA 5SV4A 4FYQA 3AS1A 3FCTA 3SPHA 3EFFA 3SIKA 4NNXB 3UYPA 5GRJH 4MMZB 4AEEA 4DGWC 5KVDL 2EH8L 3T0BA 4UTBL 1FNSH 3WYRA 1OGPA 3HNTL 3LRHA 1MPAH 2HH0L 1JYXA 2WKGA 1BJ1H 1CE1H 2FYYB 1J1PL 1QSFD 2UUDH 2V33A 1NMAH 1SOKA 4PCTA 1GSKA 1EUUA 1MLCA 5C92A 5AD0A 2X1OA 3PAUA 3Q05A 4K8RC 4UAOB 5DJXB 3ZR5A 3UJTL 5K9QG 1I9JL 3WFHA 3RP1A 5F7WC 4KKNA 2NT1A 3DOSB 3VH8A 4ZNCD 2PXYB 5C0CD 1H6UA 3PHQB 2ZX6A 4PLJD 5KVGE 3VI4B 1PKQE 4GMTH 2NW2B 3MGOB 3AZUA 1Y0LA 3CFCL 1CG9B 1OV8A 4NZRL 4JG0H 2OL3B 2VC2H 1BYOA 1UQSA 3S35L 2VDQH 4ODTH 1DUZA 4R5XA 4YGVA 2ZXGA 2VERA 5DU7A 4BZYA 4Y5XC 4N68A 5E9NA 4CW1A 2FZ3B 3WKNA 3QDGB 3HG2A 4QRAA 4YHPB 3ETTA 1A3RL 4GXFA 5DQJA 1FYTE 3G5YB 2RQEA 1FIEA 1YVLA 1ACCA 3GK8H 3GRWA 5LAXA 4EO5A 1EEZA 2ZUQB 1SUHA 4WFHE 1BZ8A 4X5LA 5TDPB 2EEDA 2EUWA 5IVXF 2ERJB 1D5BA 3BXNB 3IDYC 2DPKA 2Y06H 4ZS6C 2VSMB 2ZG3A 1H3VA 3Q2WA 4PJBA 2HT2D 4XP9H 1Q9LA 2IMMA 2X44D 4KAQH 3EG9A 3QNYA 4YQXH 1TJXA 4L5FL 5IT2L 2CIKB 2DLFL 4OIBA 4RA0C 3OAUL 4MA8H 4YDIH 3ZTDC 3NIFE 1JZ3A 3RL2A 5IKCB 4L1DA 4KJWD 4Z7OF 4EN3D 4X8GA 5F7LB 3ZE1B 3D48R 3FO2B 3CFDB 3GMOB 3D69B 2Q7YA 1JUFA 4IBZA 1L5GB 2NUPA 3X12A 4IOIA 3VFOA 4WFFD 1OF0A 1XD1A 4MA1B 1WUZA 4KJPC 1E4KC 3P9LB 1MCSA 4MXWL 1SHSA 3PABA 1F2XK 4PRNA 4Z7WB 4JZJA 4M3JA 4KI1A 4OGYL 2EZ0D 4NQDB 1KCVH 1BQKA 4KJQD 4ZYKB 4GAYA 5DJ8A 5HJBA 1CXLA 2WYZA 4W9GC 3GRWH 4KGJA 4FHKA 5D5MF 2J8UA 2VLKE 1HXYA 1GGIL 3DURA 3GJEA 5AWNL 3GI9L 3VYNA 4PREA 4OKVB 3D85D 4ENEC 4TUKH 2BSTA 4M9OA 4UOZA 3UAEA 2X4PA 4LCCA 3O2WH 4TLUA 3MJWA 3OGOE 2XQ0A 3HC3H 4HHAB 4WJG3 3BAKA 4XCEA 5CIPA 2QQNH 5EZPA 1PY9A 3SJVA 1FGVL 1KIRA 2Y7MA 5FAAA 5SWQB 5I1HL 3REVB 3HRZB 3HS0B 5CGYD 4IDJL 1E27A 1KCUH 4AC4A 1SOXA 1U8NB 5B3JF 5IP4A 3HN8A 3CN2A 5F1NA 5DJYB 1N18A 3CH1A 4IBSA 1WD8A 3WL9B 1ADQA 4N87A 3PFUA 1JF6A 3D3VA 2DTSA 1AFVH 3IN2A 4LLMB 2Q5BA 5LCVL 2Q3ZA 3DROB 3M8OH 3MJ8A 4ZXBB 3V2AR 4B0MB 2UYLA 1JGUL 4IBYA 3PU7A 4G6ML 4AY0A 1S5HA 5JR1H 2FSEA 3Q48A 4OLZH 3FUEA 4UMGA 1DBML 2BC4A 3FT4A 1S7SA 4GW1B 4OBRA 5FOBB 5GGTH 3U1SL 3LYRA 4TTDD 1Z5HA 2OMYA 4F7KA 3V5DA 2NY3D 3Q44A 2ESVA 4XPTH 3BP4A 2DWYA 3HUJA 4XVJL 2EDRA 2BP8A 3MRPA 4O4YH 1FYTD 2DF3A 1HL5A 1AIFA 1JV5B 2FX7H 2ZUXA 4KRPB 2EIKB 4WFHD 5EU4B 2RFXA 15C8L 1LNUA 1GZQB 3ILEA 1FGNL 3ILQC 3L3HB 4HUMB 1CZ8L 1ZS2A 4Y4HB 2YAHA 4FCAA 4WEBH 5TK4A 4P46A 1YY8B 2EE2A 2WQVA 3VXMB 4ZMAT 5ERWA 1FH5H 3QUMA 4F9PA 5CWSA 1NGYB 2K45A 2E8ZA 4BE5A 2XN9A 2WSDA 1RIUL 1JHKH 3LVEA 3IFOA 3MROA 3PQYE 4Y2OB 3T3ME 2DQIH 1S9YB 1U3JA 1WTGT 2CXKA 1TQUA 2ZPKL 4OBSA 3HLAA 4X7FC 1A7RL 2MFNA 5CLTA 4NO0B 1QFHA 5L2KA 1GVIA 1ADQH 3OG6B 4Z7QF 4TSCL 2M2DA 3PGDA 2Y7SA 2CQVA 3II3A 5DHYB 3QEUB 4D0BB 5JO5A 2IPUK 2YA1A 2BW5A 3MUHL 3U30B 3FOLA 2PWEA 2VUOA 1E5AA 5C0BA 4PJXF 2I9TB 1S7QA 4MDJA 1P4LA 2ZTBA 3LIZL 4AUUA 3L4CA 1H3TA 2Y6TE 3RURA 2ICCA 1B2YA 2D2CC 2VISA 2HMIC 3MTRA 3RVVC 2J6WA 2A99A 1AHMA 2VLKD 5JHMA 1UM6H 4HGWA 5K9KB 4UT6L 4FERA 3ZZ1A 1DUYB 2BJMH 1Q38A 4AIEA 2OS7A 5B4MD 5KVFE 5BRZA 5IMMB 3QYMA 3QUMH 4JFTA 3CD4A 4U1LA 2BIOA 3RZCB 4JO4L 2VDML 4Y4KC 2CCVA 3EJCA 4DGIH 1CLZL 4EPSA 1MVYA 2B3IA 4LLYB 1I1AA 5I0XA 4PMFA 1FSKB 4AEIH 1BGXH 3FO0L 1MIMH 1B2WH 1N19A 4GBXB 4OLWL 4PG9B 4W68A 3SDCB 3H9YA 3GMPB 1UJ3A 4NOFA 3DMMB 3D05A 3QPXH 1YPZA 3SE4A 1NCIA 3KEDA 5C07B 3MUJA 3QDJE 1OP3H 1OSEA 4P4KD 3DHPA 4KI5E 4Q9QL 2X4NB 4YLCA 5C70A 1CGVA 1AOHA 5ESAA 4MMYB 1HFUA 1RK1A 2OXGA 3ARDC 4R7DB 4U1MB 4XTRD 3B5GA 4PRHB 3HZKA 1AHWA 1KCSL 4K7PY 1TYRA 1MHEB 1EVUA 3GD1C 4KRLB 4S10A 2NSMA 2VR8A 2XTJC 4J1UA 5B39A 4PJEE 2WANA 1JERA 2CLRA 2X6BA 3N1QC 1ZVNA 3ARBB 3QWRD 3S34L 1RZKH 2NNFA 3KYKH 3QCTH 4YSQA 2ICWI 1M71B 3WJLC 2XV0A 2NY6B 1IQWL 2QDWA 3WJMA 1LEKA 1C5BL 5AZEL 4RGOL 4JQIA 4PUBL 3BRFA 1E9PB 4J3OC 5BUGA 2ZOOA 1VFBB 1WSST 3FONA 5DJZA 2AJVL 4EI5B 3VDAA 3B2VL 2FH6A 4KDTA 2IOMA 3WS6A 1XAUA 3MFFB 3QXDB 1QNZH 3OM3B 1NFIA 4OLXH 3OLIA 4NPJA 2CH8A 3FB5A 1GS7A 3RI5K 1FLRL 4DGVH 5AVVB 3BW9B 4LOVA 4YX2H 1VGEL 5GRYA 5I6XC 1U93A 3CX2A 2QPEB 1MFBL 2AANA 2SEBB 3UYRH 1GC1H 2A6DB 3TFBA 2Q8BH 1J10A 1DSFH 1YEIH 2YLHA 3N40F 3VMOA 3WEXB 2QR0B 1JNNH 3TYFA 4E9TA 2Y2TA 5IOPA 4FLOA 3ARGD 5ALBL 5J12C 1F58L 1WFJA 5DO2D 3VMPA 1HXMB 4BZ2L 2XZQL 5EU7C 2A77L 2HFGH 3MBEB 3SE6A 3ECQA 2EEXA 3VWKB 2E75C 1L9TA 3KLSA 3EHBC 1MRFH 3KHOA 4L8SC 1EHAA 5D55A 2H1PH 2ZKMX 4G6KH 3QQXA 4FMKA 2MPAH 4LARL 4R83A 2H0JA 1IGJA 2H3NA 2AK4A 1CPUA 1LWHA 4MTMA 4YUEL 3CHOA 2VRAA 2EUXA 3ROLB 3CHSA 4XOCA 5E6IC 3DVGA 2K9UA 3GT6A 4HDIA 5DYFA 2J5LC 3IKKA 4AI7A 1N5YH 1KIUA 1WEJL 2P47B 2YAPA 3QCVL 2Q3XA 4AQ1A 4JL2A 2HKFL 4ZX5A 1OGAB 3TVMB 3PWLA 1DQML 5JYLA 1KEGH 1DQLL 5IB2B 4JDVB 2HTLD 4LDOB 3WSQH 1IL1B 3ARXA 3GZPA 4UT7L 3MXWL 2DWDA 5DUML 3MODH 3QZLA 3K6SA 2I32A 5CZXD 2CGRH 1QLRA 5J06A 5K59E 4H8WL 3QDJD 3RWDA 3VI3F 1FBIL 5EZIH 1HEZB 1WHOA 1FO0A 3CSFA 1R46A 3SN6N 2I5YL 1I9IL 4M1GH 5E8EB 3UBXI 5JORB 1ORSA 2R4RH 2WWMD 1NBVH 2Z7WA 1KNOB 2QL1A 1XAKA 1FJ1A 2V5YA 4PMEA 1KB5B 5F7HA 4OZHA 1IKOP 3KPRA 2D7QA 4BFJA 4QRQB 2J1KA 1YEKL 5JHDD 2BNQA 3T0DA 1A1MB 3ASWA 4U1HB 3LZQA 5EIIG 5FKAB 4P57A 1Q0YH 4Y4FC 4CBZA 2OW6A 2HFFA 2PR4L 1TCRB 4WSJA 2KLSA 2YC1B 1NCAL 4NC0B 3LXBA 5FA4A 1IKFH 3MAWA 4TNEA 1MJUH 1J8SA 5C9KA 3EGDB 3MOQA 1JYNA 5DEFA 1S7TA 4QHLB 1EAPA 1TVHA 1U0QA 1S78D 4G3YL 2WBJD 4ZUTB 2DYRB 3JUZA 1WITA 4ALAC 4HQQH 1JAEA 2LVEA 4MB3A 4I48B 2K7PA 2A6IB 4Q6KA 3P4NB 3I3BA 4QXTA 3GINA 3JWDC 3CFKB 3B4NA 3W2DH 4XHJC 3GMMB 4FQ2H 3I6LD 1DZ0A 4HIIB 1T3FB 1I85C 2KS0A 3PUUA 2R4SL 1IBYA 1AI1L 4BRVA 5L8LB 2R56H 3UPRA 4HGKC 5A7BA 1FO0H 4UQEA 2DH2A 1AD9B 1J5HA 1BOYA 1NC2B 3LS5L 3B6SB 2BS9A 5J11C 2EICA 2AVFA 1NOLA 5DRZB 4A7UA 3PWNB 3SY0B 1H8LA 2HFEA 1T20B 2D0FA 1IMHC 5CF3A 5HJ3B 5E08L 3O2VL 4JRYE 1XDTT 4XC3H 3T3PB 4LDEB 2HRGA 3VTMA 5JHLA 1OARL 4UM8B 2X10A 4L8CA 4FYRA 2XICA 1UYWL 2V2XA 4R26L 2AQQA 3B2UD 3TZVB 5I18L 4RMQA 1QR1A 4WU5A 4P5TB 1UH3A 2FL5B 5DJAB 3I74A 3MRBA 1KENH 2VW7A 3VE0B 4JQXA 1FFNB 3VFNA 3GWJA 1KCRH 5BVJA 2ZZUT 4Q6YA 4C55A 3N41F 4K8RL 4F7MB 3WO4C 3NACL 2IEPA 1KB3A 4H1LG 5JW4R 1Q72H 3R06A 2C4FU 2VDNL 3TJEL 3D18A 4L3AA 5FW8A 4HCGA 4A37A 2WXGA 5HGBA 2YBRA 4E9WA 1QSVA 2GC4C 3DX7A 1SXAA 5IB4A 1ZTMA 5AW4B 1Y18A 3V4VL 4B9IA 1PZUB 2NZ1A 4YSDA 2R69L 2OJZH 5KYYA 1MRCH 4KK5C 1DVZA 1YUHB 2Y1AA 5EFIA 2Q3AA 2IWFA 2FE0A 5FGBA 1D9KD 2DQGH 4YHZH 3U6XA 3EJQA 3MRRB 4IIZA 3MUGA 3QQDB 3HZ3A 4LRNL 2GITB 3POCA 5LWYL 2MTAA 4ZS7H 3D0LA 2KPWA 4F15C 1OF2B 4FXGC 3VG9C 2O30A 3I50H 3EDJA 2R1YB 5IK3B 4TNVK 4HX1B 1IILE 4HUUB 3E8UH 3IPEA 3BAEL 4LNRB 4B27A 2VN5A 1F02I 3HMWL 2BVPB 2NR6D 4Y7MA 5F7UA 1IX2A 2QSCH 1CLCA 5JHLH 1IAKB 4UV7H 1J18A 1Q9WA 2WINA 3DUUB 4OQ1A 1UM5H 4XXWC 1UADC 3MJ6A 5D70H 1N26A 4JY4A 4PWHA 5HTSA 2BIPA 2W80C 4M61B 1IEHA 3F7KA 5KUKA 4HPOH 1I9RH 2NY2C 5GISH 4RGNE 2AKRB 2HG5B 5C0EA 1ETB1 4PB9H 3BPLB 4HAFA 3IDUA 1X5HA 2OSYA 4XNYH 4OZFB 5GGSY 1BM7A 4CMMB 1H15A 2FEEI 3PHAA 1VAHA 2CKBB 2JSFA 2ZSWB 2ICEB 3A4FA 3O4LB 3QIWB 3MR9B 4CU8A 2YD9A 5CLXA 4BQ9A 3AADB 4P2RB 4NUMA 2UZIL 1DSYA 4A6YH 2XKNB 3BT2L 5AZUA 2OK0H 3GBEA 3OR6B 5FXCH 3WFBL 4UZSA 1MFUA 1PEZA 3EFFB 1M57B 4P3DA 3UYPB 1M3IA 4QXVA 3CN3A 3KPNA 3AROA 1I3RB 1P4UA 4JGUA 3TCTA 4LQFL 5DS8A 1RFDH 1B0RB 4PEEA 1UM4L 3S3JA 4UCFA 3WUWB 2X53A 1MRDH 4W9CC 4OY9A 1RULH 4OCSH 4U3XA 1KTJA 3KPQA 2EAEA 2Y9RT 3AREB 3GMQA 3IETB 5D7HA 4L1TA 2VLJE 2A83B 4KTDL 2VLLA 1MLCB 4KKPA 4FG2A 3QYCA 1V8HA 1JBJA 2NOYA 1TF4A 4UINL 5IB3B 4JRYD 3WFHB 3GXTA 3HG1B 1QFWH 5FM5M 3WV0A 5I1GL 3GYRA 1H5BB 3CHQA 2J8OA 5SX4I 3S37L 1T83A 4XPHH 3GTTA 2IQ9H 3WY2A 2CJ3A 1E2WA 1Y0LB 5IFHH 1JPFA 3DX0A 1SVZA 4F2FA 4L0ZA 4XMZA 3CFUA 1W9XA 3F00A 3PXJA 4JFXB 4DFHA 3O41A 4YGVB 5DD1H 3EYUH 1BREA 1KJMA 3WXWH 3ZDXB 1F4HA 4ZTEA 4CW1B 2GQHA 5T1DL 4A55A 5DQJB 1FH2A 4HCIA 3G5VA 4F2MA 4LHUA 2JIXD 3EKCA 1D5BB 1G6RH 4YZFE 4X8CA 2BP0A 5FYKH 1MCRA 1R0AH 1Z3RA 5AOIA 4PJBB 3ZKMC 3KCPB 5L0QB 32C2A 2QPUA 1G0YR 2IMNA 3FO1A 5TFSH 4AIZA 1V55B 1Q9LB 5I30L 5E5LA 4GAGH 3WY3A 3EG9B 3QNYB 4DOHB 1HQRA 2Y5TA 4ZSOE 2P5WE 1U2HA 3I9GH 3MRCA 3CIQA 4DN3H 3RVXC 2XQYA 4ZTPH 3ELAT 3QORA 1FA4A 1YYCA 2FJGA 1B3JA 1HZHL 3MOBH 5CD5D 5HY9A 2DRUA 4Z3EA 4WI4A 4KJYB 4MA7H 3SPVA 4DUVA 4JFVA 2XHNA 1L9RA 3MRFB 4DP1X 1G1OA 2A9AA 2GI0A 4IOIB 4IRJA 3X12B 1VGKA 4RGND 1AGCA 4X0KA 1S9WB 5DD0L 3ULSA 1PF3A 2W9EL 4JZJB 1V10A 3DRTA 2AJUL 4HP5A 3DYOA 4X80H 4LCCC 2BHZA 5DJ8B 2BS71 1PLCA 1IGIL 5HYFA 3O3EA 1UC6A 2J8UB 1UB5A 3DURB 3FFDB 3GJEB 2GUOA 4RNRA 5E1HB 1BLIA 2EEAA 4D9QE 4J3OG 1VLXA 3OSKA 2Z92A 3MV7A 4KXBA 1R9FA 3F8UB 4FQIH 2E7MA 2N4IA 5K33A 4DP8X 2X4PB 3RFZA 3ZTEA 2Q86A 1E90A 4GKNA 4H88L 1HH9A 5ILTL 1MQ8A 5CIPB 4YHYB 1FI8C 3RUGF 1ZJBA 2IGFL 3QE5A 1Q9OB 2YK1H 4Q7DA 4P3CH 3HNVH 1E3ZA 2VLJD 4IW4C 4M1DH 3B8YA 3SKOA 4B9GA 1E27B 3HOGA 4I9XA 3NRQA 4TM9A 2V5RA 2YD6A 4P5KA 2Z35B 4G9FE 4GPVA 2MQCA 1PQZA 3CH1B 3ETBJ 2J4WH 1NGWA 2Y7NA 2W0PA 3WKML 3D3VB 4MAYD 5B38A 3Q2CA 1BWMA 4HS6A 5F7NC 4NCDA 2VWEC 3FH5A 3GSVB 4CUCA 2UYLB 5LBSH 5IBLD 1S5HB 4E68A 2FSEB 4KNTA 3APCA 1M3JA 3NIGF 3FT4B 2BC4B 3C60A 1S7SB 2WN2A 1E9OA 4KHTH 5CHNB 4AH2A 4CAGA 4IRSA 2KBGA 5C6PB 4RSYA 4P2OD 3LRKA 2IDSA 3ESOA 2X0UA 2CJUH 3OLGA 4JHUA 2H32H 1DVFA 1FAIH 2ESVB 3P3SA 4NQVA 4NZTL 3BP4B 1ASQA 5AKRA 2EE0A 3MRPB 5BOPA 3QG7H 4OCXH 1AIFB 1QKZH 2BRRH 4GI6A 2JI2A 3ESPA 3F7YA 1LNUB 3JT0A 1G7QA 1MCOH 2H3KA 3S36H 2AI0L 2ITFA 4AYEC 2CDEA 1HHJA 2X89A 4P46B 2QQKH 4R7LA 4WI8A 4XCYA 1FRGL 3CXHK 2V5TA 3VD0A 4OI9A 5ERWB 4ZFOA 5D7SH 1FN4A 5CWSB 2XN9B 3IFOB 4MQXC 2YHGA 4I5BB 5IVXE 2B2XH 3HVDA 2FJHA 3KM1A 2EP6A 4F8TA 1CBVH 1S3RA 2DQFA 3NJFA 4QAMB 4YR6A 4DAGH 1ZHNA 3HHMA 1NGPH 3MNZA 3I3DA 3PGDB 4F8LA 5C7XH 5KVEL 1MWAL 3HS9A 3TT1L 1VJSA 5C0RL 1NMCB 2W9LA 1S7VA 2F5AL 4RGMB 3H4HA 5GGRB 4K55A 4QT5A 3TTYA 1L7IL 5I71C 1J5OL 1BZ7B 1QI3A 4PS4L 1SEQL 5D4IA 1YDPB 3UBHA 4LP5A 4MDJB 1P4LB 1RZKC 4Z7OE 5I6KA 4PJFB 4N85A 3ZKNC 2VISB 1LMIA 5ELIA 2NZIA 3QJOA 1QP1A 4D9QD 5ENWA 3IRCA 4FQJL 4Y9CA 4FJ6A 3E2HC 5IVOA 1Z3GL 2ZNXA 4XP5L 1KBWA 2VZ3A 1J1XH 1KLUA 1OWWA 1ZVSA 1WS7A 2OLDA 1KXQE 1KB9J 3G04A 2YMTA 3CDGA 5FUZH 3BDXA 5IIEA 3ZIYA 1EEYA 4QXWA 5DT1H 5EOCL 4J8QA 4JHAH 5D7LE 3K7UA 1NL0H 5D5ME 4U1LB 3SE4C 2I24N 4HKJA 1KTDA 3LX9A 1W15A 1RIHH 4Z0BH 4U2ZA 3TO4C 2UVEA 5F0PB 1KPRB 2VZTA 5KTEH 1TTBA 3L3OA 1T6WA 4G9FD 1GC1C 1I1AB 2ED8A 1WWWX 1NSNL 3RDTC 1QEXA 3TT3H 1UJ3B 3UC0L 3ZHNA 4FQQB 3O9WD 3V0HA 1AHWC 1WA1X 2DQJL 3FQUB 4E5XA 2BFGA 1KJ2A 1TVDA 3H4FA 2R2BA 2CUMA 2DD8H 4MMXC 5DJ0A 1I75A 3FB8A 2CSPA 2ZAHA 5B3JE 1UWYA 5GJSH 2M26A 5GS3A 5FM5O 4JO2L 4WGVB 4LT7A 3KLLA 3ULVD 5L9DH 4AXWA 5F1IA 4AGNA 1RK1B 3N0PB 3V0WL 1NGZB 1U91A 3H3PH 4U7KA 5C97A 5EN2A 1N2RA 4ZFQA 4H8VA 5HYSB 2C3XA 3MCLH 2EKSA 3CGTA 1J0ZA 5BRPA 4J1UB 3RA7L 3EOTH 1ZCRA 2CLRB 4Y2DD 3GNML 2R0WH 4BIKA 3QJTB 3COOA 1F4WL 3BIAX 2P44B 1T03H 3VSQA 1NGXB 4YDVA 1K4CA 3S5ZA 2BY3A 1MXGA 4AMKL 4EI6A 1BMGA 1U8JA 3BD5A 4GSQA 1KIPB 3QNFA 1J88A 1QQDA 2X3AA 4XRCB 4Y19A 3ELQA 1MELA 1JZ5A 1UHVA 2XFXB 1NFIB 2KDGA 3S3CB 1HC1A 3IXTB 2CE6A 3DX2A 4DKDC 4BXVA 1OM3L 1KIQB 1TZGL 2VGLM 5AB1A 1ACYL 1VPOH 1IM3D 2AABL 3GIVA 2DQDL 3TASA 4PJCF 5AYTA 4YC2B 2XSKA 2AV1B 3VD9A 1NEZG 3CC1A 3D9AH 3MTXA 4ALAL 5JPNC 2OXHB 1S7WA 5D1ZD 3EYFA 5IOPB 5D8JH 2UWEA 2W8CA 5IZ7A 4HJGA 4WLCA 5I8KH 3QJFA 3UG5A 1VZIA 4XCFL 3APFA 2QPSA 1J8HE 8FABA 5B1KA 4N2GA 5HDBB 4YDKH 4C4BA 2ZE0A 5BCAA 3BSZL 2EDJA 1YNKL 5HHVH 4LOFA 2MOQA 4YXLH 2V6HA 5GSRB 2Q8AL 2EYRA 1IGJB 2FT7A 3ARRA 4OCNC 4P23A 2YIHA 1JYWA 4KKRA 5TQ2L 5A2AA 4X6DB 1RSYA 3DVGB 5SWSE 4APQD 2Y72A 5I8OH 1OCWL 4GLRI 5D7LD 1YLBB 2XWTA 2G0LA 2YPLE 3OF6A 1WO2A 1FPTH 1KIUB 5FYLD 4ODSH 3EJRA 5F6IB 4AUJA 4AQ1B 2RAMA 2K9FB 3BAYA 3ULUF 3PWLB 2MPVA 1HJCA 1W91A 2YPKB 4CSSA 3H0TA 1WISA 1KUMA 1A3LL 3BVWA 3VH8G 4YHIA 3NK4A 5EU6E 1PYWA 1ULVA 1BEYH 1QLRB 3DK2A 4NWTH 3SDYL 3VXRA 2N0MA 3RWDB 2NNXA 1OSYA 1PW3A 2YQ3A 4CGTA 2B3RA 1MI5B 1FNSL 1ZLUK 4HIJA 2Z6FA 5J9PA 2ADFL 1PX8A 5E5RB 1FJ1B 1G7MA 1CE1L 3FRUB 3KH3A 3GBNH 2FT8A 3KPRB 4FLSA 4IIQA 1NMAL 1UCBL 3GUTA 2V7NA 2ENSA 3GB7A 5EF1A 1XSKA 1MH5A 1JHLL 4P57B 3D06A 3Q5YA 5JOEA 2R8SL 2HFFB 3KYMA 2Z9TA 3MLUL 3CXFA 3N1PC 4PBXA 5FA4B 1EWHA 3KM2A 3TBYA 2QV2A 5F9JA 2HRHA 5DEFB 4GMTL 1S7TB 2ZG1A 5AAWC 4Z7VA 5F88A 3BE1H 1B88A 5E2UL 1FL5A 5BUAA 4BD4A 3WTYA 4F7CB 2VE6A 4V1DE 2VC2L 3U6RA 5E2WH 5ICUA 4JHWL 4ODTL 1RIVL 2WB1A 3FULA 2OZ4A 5LNEA 3TURA 4PRIA 1H3UA 4MCNA 4OZIF 1UD2A 3OLDA 1JZ6A 3GK8L 1N67A 3WFCL 4URTB 3KW7A 4Y0GA 3ERXA 4ZX6A 2CMRH 1CFVL 2WV3A 3UPRB 5D71H 4JO5A 4ZUWB 3V0GA 1A6PA 3OX8A 4PLJC 2YAOA 1YA5A 2QADB 2ISDA 4HC1A 4G7VH 1EHNA 4BGLA 1L6XA 5J13C 2MWCA 3DX6A 3GMNA 1F45A 1FFPA 2DWEA 2H0PA 1IE4A 3O4OB 2DW5A 4JQXC 1H3GA 4L4VE 4QIRA 2J43A 5KSAD 2BK8A 4WAFA 4R97B 3LNEA 2PWFA 4ES9A 1I8IA 1RERA 3EJPA 4PJIA 3JTTA 1UOVA 3NH7H 5ICXA 3X13B 3WHE1 4WU5B 3ESUF 3KLKA 3PGFH 5SWSD 2IANE 2E76C 3VFNB 3WTSA 5BVJB 2G2RA 4RSVA 3AC0A 3RWEB 1NFDF 3HHSB 4EUPA 4QKTA 2V3FA 2X4UA 3R06B 3RHWK 4FXKB 4A04A 1WUNT 1KB9K 3LN4A 3CZNA 4OR1A 5B7FA 1KCVL 2VRKA 2D73A 2OZ4H 5LKNA 1TJIH 3DX7B 1U8PA 3MREA 3SBPA 4F7TA 1AR1D 1C7TA 1NCWL 2N59A 3JV4A 5EU6D 4N9GB 4GKSB 3QO0A 2HT3C 4KJWC 5AW3B 4EN3C 2VR4A 1JPEA 1EXGA 1TYEB 2W0LA 4JRLA 4UTAA 4JM4H 4M8QA 3MUGB 1HH6B 1ZJAA 3MRNA 2F8IA 1IU1A 3LNGA 2BY1A 2W91A 3D0LB 3TPUB 4WFGD 4EIGB 3SCMA 4EKJA 2QQNL 4KKBD 5T3ZE 3NA4A 4U6YA 4HSCX 3FHQA 4G9DA 3VI3E 4KJQC 1IJNA 1XH3B 4ZAKA 1L0YA 1Q9WB 2HWZH 3U36B 4JY4B 4RFNC 4KVNL 2J1YA 4XB7A 3B43A 3NCYS 1K4DB 4GRLD 1QPKA 4GT7A 5AB0A 1AFVL 1G5GA 1ES0B 3ZKSD 4MB1A 3M8OL 5JXAH 3A47A 3GKWL 1XGYH 5D7IA 4I77H 3BGMA 3T0EE 3N42B 4OLZL 2CLZA 2ADGB 7PCYA 4FQXA 3QUKA 5E0FA 1PD1A 1NEPA 5GGTL 3UZQA 5DQDL 4R2GD 1NAMH 2FJUB 5HI4D 1OK8A 4N0CD 3BKCH 3BZEA 1DJYA 4XPTL 3NT0A 4WI7A 2FX8L 4BSVA 4XB3A 4O4YL 4P3DB 5AW6B 2FX7L 3ABMB 1I8KB 3CSTA 1PLGH 5DS8B 1UOKA 4UTAH 1CK0L 5I28A 2F0CA 4RWYH 4AV0A 4ZODA 3L3JB 3TBTA 3T6WA 4WEBL 5DSCA 4GRWF 1IC7H 3KPQB 1K5WA 3GMQB 2ENYA 3N04A 4V33A 2K70A 5TQ0L 1T7YA 2L0DA 5DR5H 3IYLW 4UDTB 4TTDC 3LD8B 1JHKL 2X4SB 2DQIL 3BH8A 2BSED 3FSAA 2OSLB 2WO2B 4L4VD 2CHZA 2V9UA 5DVNA 3AW5A 5K5YA 4WDIA 2EDNA 5EC1A 4DERA 3X3FL 3DDGA 5BV7H 3MLVL 1QI4A 2E56A 5C08E 5CUSH 1GGUA 3AM8A 3QXVA 4M5TA 1JPFB 2EIEA 4G43B 4E41E 3VFMA 1CD1A 2IAND 4PJGF 3IAGC 2WCSA 3X14B 4X9YA 3LS4H 3EYVA 4MCMA 3JZ7A 4CMHB 1VFOA 1Z9PA 3OAYK 4JMNA 5F7BA 1D2OA 1C16A 1W80A 3C09B 1XX9C 1KJMB 2ARWA 3PDGA 3IWUA 4J8RA 1F41A 3ZQ9A 5HHMB 4KHXH 3C2SA 3S2CA 4F2MB 2BERA 1AGEA 1HAUA 1AC6A 1QPXA 2W81C 4LHUB 3S48A 3HE6B 4TUOB 1YMMA 1KY6A 2BP0B 2DLEA 3GGWA 3IGFA 2XPYA 4F5CE 4OF5A 5FKPB 5L8KB 1AGFA 1UM6L 4DUXA 3C08H 3KR3H 3K6NA 5C0DA 4WF7A 3FO1B 4M6MH 2DDQL 4Q6IA 3BH9A 3C12A 1A6AA 4HJTA 2Y5TB 2CAKA 3QZNA 3B7RL 4N2MA 5E6RB 5MENB 5T3ZD 4G8FA 3OWRA 4H8PA 2HN7B 3MRCB 3N40P 3LTVA 4UAHA 3HE7D 2E6PA 3QORB 4Z95H 1P5VA 5B39G 3SDDA 5GRVK 1NDMA 2FJGB 3HR5B 3L16A 2O72A 2PW2B 2Q1EA 3NQIA 4FI7A 4QTIL 4R7XA 5TH2A 1IM9A 3SPVB 1KYOJ 3OD3A 1BGXL 1MIML 5J6GA 1B2WL 4YHKH 4IRJB 4S0TD 3EYSH 1VGKB 1AGCB 3QPXL 4LL1A 4X0KB 1WGVA 3IXAA 4PJDA 3ULSB 4NHUA 3L1FA 1KMGA 2VXSH 2XQBH 1L9SA 4KKQA 1CDGA 4OB5H 2VDNB 1WV7T 2OMXB 2FJSA 2FIRT 5EORH 5HVHB 1LD9B 2C9XA 2X9WA 5CLZA 4ILDA 2ZCZA 1RPUA 4HISA 1UB5B 2LVCA 2EDXA 1N64H 4NLAA 5FDWA 5EN3A 4CSTA 3S4SA 4PJ8A 2VJXA 4XNZC 1IARB 2IOOA 4RIRA 3T6XA 2VM9A 3RFZB 4N86A 2Q86B 4HXAH 3WFEH 4GKNB 1HH9B 2B0SH 1RZKL 5CBEA 2WNXA 4YXHH 4P4KC 1DYZA 4M7KH 4FL4B 4OJEH 4Z9KB 3SKOB 3R7QA 1A9BA 4P5KB 4EN2A 4XTRC 1EA9C 1S6NA 3C60C 3EFOA 1E65A 4IRSC 1RJZA 1XR9A 1GOHA 1ZA6A 1OO2A 1QNZL 2VDRH 1PG7L 3VXSE 1TPXC 1DVFC 2IQAA 1MCJA 1R75A 2BXZA 4HUVA 2O61A 3O6FD 5C08D 3O0RL 1TOXA 3FS9A 1KSRA 4DGVL 3IJ9A 1CFSA 2IG2H 4LVHC 4YX2L 1FZOA 5J0BA 4EIBA 4QI3A 1E9OB 4AH2B 4RLDA 4QOKA 4X7SH 5E6SB 1GIGL 2VLRB 4EZJA 3UYRL 1HL9A 4NQVB 1DSFL 4PJ9B 3ZE1F 1JNNL 2DJMA 2PPFA 1I31A 3OJDA 3AS0A 5I73C 2GFBA 2OSXA 4ODXA 5CSGA 5AVSB 1E40A 4C56E 1JD7A 1U30A 2HFGL 3OJVC 1QBAA 2KZ1B 1I7RA 1NANI 3BWSA 2DMHA 4JPIA 4A2HA 4Y1SA 4KMQA 3RWGB 1MRFL 3FCGA 5H94A 4ATWA 1HHJB 4ZMYA 3IGLA 1X4YA 2MPAL 3F7LA 3U9PH 4XCYB 4ZPTA 3BQUA 5HHNB 2GW5A 1YEDB 3PIQA 3UTTB 1FN4B 1IAIH 5FF6A 1Y1DA 5C0NC 3NCJH 2FJHB 1N5YL 1JNLH 1ZVHA 4JUTA 4PS8A 5DO2C 3VTAA 1RK0A 1GYAA 2DQFB 4HUWA 4YR6B 1OCRB 1A66A 3N1GC 3HRPA 5EO9A 1ZHNB 3GXDA 3BD4A 3KXFE 3P77A 4QHKI 1KEGL 4NNPH 4UOQA 3MNZB 3C5ZA 1MFMA 1MHCA 4JKNA 1N6VA 3B34A 4KDVA 4LGPB 4Y9EA 5F7EH 1II4E 4X5WA 5GHWH 3MODL 3ULVH 1S7VB 2CGRL 1J1OL 4CADA 1BMZA 4MQSB 5A6IA 3LZLA 3L5WB 1MJ7H 3UTSE 2XPGB 2BS8A 5EZIL 3DSFH 2QGCA 3C6LA 5H8DA 1NCOA 4M1GL 1AQHA 1UXWA 2B5IC 2R4RL 4UOW1 3T71A 2WYHA 3JV5A 1ZGLP 1CFNA 2G2PA 1ZT7A 4GH7B 5CEZD 1K8DA 4UQ3A 4I7ZC 3Q8FA 1DVYA 2VZVA 3L3OC 3QFJE 1KLUB 1Q0YL 1ZVSB 2MSPA 3LKOB 4JFQA 4H40A 3N85H 4JPSA 3ZTCC 3G04B 5B1CA 4JNXA 4KKAD 5CZXC 2WOYA 3ABZA 5IIEB 1E8WA 1EEYB 2NY5H 6PAZA 3WN5B 3FB6B 1AZNA 2B4CH 3LZOA 1MJUL 3DXAE 2G75A 3Q6FA 4ZFFA 4XMUA 3KS0J 4HKJB 4ABVA 4EIZC 1SYVA 2WWMC 3KVPA 3KWXA 2WWNA 2Y7QA 3BKYL 4NBYB 3PHOA 3NJLA 1P6FA 3QSKB 4HQQL 3FYIB 3WE6B 3AXLA 5T1KD 5F7YC 1RZ8A 3RUGE 2V9TA 3RB5A 2J71A 4Y16D 3I02A 4C4KT 3RNKA 4E5XB 1KJ2B 3FRPA 1A8JH 1JFQL 1KPUA 2R2BB 5JXED 3WD5H 1A14H 4FQ2L 3FB8B 2XWBA 2CO4A 2XWJA 3HMXA 4LEOA 2R56L 1L9QA 2IAMA 5F1IB 4BFOA 1MOEA 2JKLA 2PCFB 1FO0L 2WKOF 4DEWA 1VKXB 2NXYD 1U91B 2O1AA 1S78C 1TSRA 2WBJC 1PDKA 1N2RB 2IBZX 2Y2WA 1ZE3H 2QKSA 3BLKA 5E9DA 4Z5RA 4FAAB 1ZHKA 2BNRE 5C3TA 3N43B 4C56D 4PW4A 3UGEA 2LU4A 1EGJA 3NIGE 4WTQA 3PL6D 3FL7A 3B8SA 5H4YA 2RHEA 1XGUB 3Q8CA 2XQYK 3QULA 5DC4B 5I1DA 5FYLH 1EVTC 1XIWD 2KH2B 3K1KC 1MHPH 3CZSA 4NT6B 1KTLA 4YDVB 1K4CB 5FK9A 4N1CA 1NDGA 1U8JB 3TNNB 1DJIA 2UY6A 1KCRL 1QQDB 2HJLA 3RIKA 4Y19B 5LUMA 4HEME 4LVNB 2GY5A 1Q72L 3A4EA 1JTPA 1HCFX 1F56A 4KTEH 1RAMA 4UZGA 2R9HD 1MFAL 4N2DA 5CCGE 1KYUA 1P6AB 5HHOE 4MRCA 1CICA 1V27A 3U7WL 7CGTA 3RVWC 3Q9PA 4ZZKA 2OJZL 3BPNC 3B2UC 3Q3GA 1U8KB 5KW9L 2IH3B 3M07A 5C0AD 1MW3A 3ESVF 3LKPB 1S7WB 3UTSD 3EYFB 4YHZL 4HYTB 2WLYA 3P0YL 4JAMB 3P11L 1KYOK 1AE6H 2ED6A 1X3DA 3QJFB 1AS6A 4X99A 2CJSA 4TQPA 2WIIB 4FMFA 4BKLA 5JA9A 4GJTB 1G9MH 4FNTA 3VQMA 4NQSA 1QVOA 2EYRB 4JANA 1HWHB 2NZ9C 3QFJD 4P23B 2ZCKL 5G2NA 1UM5L 5D70L 1A6WH 3TCLA 5I71B 1KGUA 1C12A 2QHRH 5AFAA 1D9KC 1I9RL 2XG4B 2XWTB 5GISL 1CWVA 2OTUA 3DXAD