4IEFA

Complex of porphyromonas gingivalis rgpb pro- and mature domains
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
197
structure length
192
Chain Sequence
RNPQVRLLSAEQSMSKVQFRMDNLQFTGVQTSKGVAQVPTFTEGVNISEKGTPILPILSRSLAVSETRAMKVEVVSSKFIEKKDVLIAPSKGVISRAENPDQIPYVYGQSYNEDKFFPGEIATLSDPFILRDVRGQVVNFAPLQYNPVTKTLRIYTEIVVAVSETAEAGQNTISTFTGFEDIYKSVFMNYEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Porphyromonas gingivalis Virulence Factor Gingipain RgpB Shows a Unique Zymogenic Mechanism for Cysteine Peptidases.
pubmed doi rcsb
source organism Porphyromonas gingivalis
molecule tags Hydrolase
molecule keywords Gingipain R2 Pro-Domain
total genus 32
structure length 192
sequence length 197
chains with identical sequence C, E, G
ec nomenclature ec 3.4.22.37: Gingipain R.
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08126 Propeptide_C25 Propeptide_C25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3800 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4iefA00
4IEFA
chains in the Genus database with same CATH superfamily
2YPVL 2G2PA 3HKFA 4LLQB 1A4KB 2QR0B 5D96C 5I8KL 2XG5A 1YEJL 5AZUA 5I15H 3A67H 3G6AA 4N2BA 3BUQA 4YSOA 3SPVA 3V6FB 1PX4A 4J6RL 1EZLA 4LLYA 5DC2A 5KYYA 3OPZL 5I19H 1NKOA 3CFBA 4OIIH 5D7IF 1EMTH 1U93A 2EZ0C 2J8OA 3GB7A 3MX0B 4I4WA 4ODTH 1NCOA 5I66A 2IAMA 3AS1A 5I17B 1J1XH 2HWZH 2VTFA 3FMGH 4JG1H 4XMWA 3TT1L 5CM1A 5DT1L 5FCUH 3OB0H 3QDMD 1WS7A 4RAVB 4K0OA 2Q2LA 4P4KA 3FFDA 2AJXL 5KAQF 4HQQL 4G2AA 2QPUA 3AW5A 4NYLA 4W4OA 4I8DA 4ZQKA 4Y8DC 3WMSA 2ENYA 5DQDH 5I6KA 4PJGB 2I85A 2QQNH 3VYOA 3S5YA 1LDPL 1EGJH 2QJDA 5FO7A 1KXTB 4G7YL 4KDTC 1F00I 5DSCA 2DQTH 4M43L 1OAYH 1A3RH 4S1QH 1COBA 3V9FA 4U1LA 4PG2A 4YIQB 2XETA 2WC7A 2ZKHH 2KDGA 4G9FE 3K4AA 2AJVL 4PJ9B 3L1GA 5LWYL 1KCBA 5HHME 3QEGL 4RAVA 4N2FA 5HHPA 1M1XA 2YEVB 1IGFL 3O8XA 2VZSA 3O0LA 5FHBH 1IM9B 4TVUA 3K2IA 1AP2A 5T5NF 3ZHKA 3H9YA 4WWNA 3ARED 2AABH 2E8ZA 2ITDA 4YXHH 4ZYKB 2VR5A 4ZK8A 1T0OA 1P7KB 2W59A 3GLZA 3K6SA 4HEPA 4LLUA 4P5MB 4O58L 3GGWB 4LSSH 5CZKA 5JXED 3RI5F 2DS4A 4PGZA 2YAHA 1MG3C 2Y25A 4B9JA 1KIUB 2R0ZH 4YSAA 3FFCE 1AZNA 1F3JA 1TZIA 2YPLE 3ULVF 2YXFA 3U6XA 4CSSA 3OKDB 4WNSA 4ISVB 3T3PE 5FA3B 4XNQB 3BD4A 2APWA 3AACA 2CDFA 3QUZC 4K7FB 4GKZA 3U2JA 5KS9A 2WNXA 1RZ7H 1QBMH 2O6FA 3TA3D 3C60D 4ZMOA 1JZ8A 1J10A 3CLFL 3MSPA 4O2CA 1AZVA 1M9SA 2GEEA 2JCCE 1T2QH 3T5WA 3CSTA 3VXUB 5SX5K 5BRZB 4DEWA 4HUMB 1LK3L 4ZNEE 4KK8D 1GL4B 2DEYX 5FS5A 2WQUA 5F9WC 2DBJA 3U0TB 4QXGH 3UG5A 1PKQB 4RETB 3K72A 4PGBB 2BIHA 1QTPA 3EZ8A 4LLVA 3TBSA 2JB5H 3EYUH 2O6EA 2R2HA 4FG6D 4IBTA 4F7CA 3PDGA 2Z7UA 3K8MA 4MQXD 4TQEL 5AOIA 2F8VA 2ED7A 2CR3A 4N2AA 5HGDA 2O5NA 3U0WH 4LIQE 4P07A 4FMVA 4GMSL 4QAMB 1OP3K 2Z93B 3MRIB 4R26H 2I9TB 2XG5B 4IRZA 1KPRB 1UD2A 2WTOA 3LDBB 4LSVL 3MJ9L 4JW3A 1N6QH 3GSUA 1OAUH 4MAUL 4GW5A 2X0VA 4FFVD 2A3TA 4K3JH 3MKGA 1KBWA 3VM7A 1O6TA 2ZP9A 4N6RA 4JFEE 4RMSA 1CLZL 4IBZA 1PCXA 2NOYA 2H26A 4G1EA 5IBTL 5KYXA 4BUHA 3CXDL 1FH5H 1DR9A 4H8HA 3BVNA 1U8OA 2F54D 5D1ZI 4U1SB 2X1QA 3NPSC 4B9KC 1AY1H 2OBGA 4FNSA 4JM2B 3VRIA 1S7QA 3WDJA 3A47A 1UHVA 5F0MB 1T5WA 4NX0A 4ZFGH 3VH8G 1GR7A 3PAYA 4FC3E 3A4DA 4X4YA 2VLKA 4E9WA 3JV6B 3L16A 3JYBA 3VB8A 3HNTH 4K5PA 2VZVA 3QNFA 1PYWA 3U9UA 3K46A 1FO0B 2K78A 1SLUA 3KNBB 4IBLT 3GSNA 1E8WA 1JWSB 1X9RA 2A0LD 3OAUH 4KO9A 1VZIA 3IDJB 5H35A 2WQ8A 5JUEH 2W60A 5I19L 4PJXA 3GRWH 2J7LA 1AAJA 1QAWA 3N2JA 4IKKA 4JS7A 4NKDB 5HHVH 4KTEL 4A7GF 3CZNA 2X0UA 4XP9H 1FL6B 4ZMLA 1VFOA 3BP7B 3TCXA 3EBAA 4C8XA 5CR1A 5I8OL 4P5KA 2X09A 2V17L 5FKAA 2XY2A 4P99A 4OGAD 3X2QB 2XT1B 4PJXF 4LASH 2R0KL 1YJDL 1QRKA 3DLQR 4NCC2 5TE4L 3ZQXA 3SEPA 5I5RA 3V4VH 4XP6L 3P4MB 4PH8A 2C9AA 3CVDA 4NIYE 5C6TH 5HHXH 2Y06L 4M1CC 4ONOA 1UCBH 5CIPB 4PJIA 3U2SA 3EYOA 1TZGH 3OQRA 4DVRL 1H3PH 3QUXA 5AEAA 1AIFB 1FVEA 3IEAA 1UEMA 4R7DB 5K59E 4AZ8A 5J1SC 5IHUL 3KGTA 4TXVB 3SPGA 5BS0B 1KY6A 2H1PH 1CB4A 5DHEA 4YHKH 1JZJA 3L4ZA 3ARSA 3L9BA 3FN0H 3L5WA 4WUKL 3RUGE 3ML9A 4OZ4B 3ZKQD 3DSNA 3BUBA 4OGYH 3Q1SH 4XHJD 5IJKA 2GJ6D 2XNAB 4AJYV 4Y4FA 4PJHE 3EFFA 3DJRA 2OTWA 3HAEH 2ADFL 1OGPA 1NGZA 2JIXA 1KJVA 3N0AA 4XPTH 3C6LD 1T7XA 5CEYA 1E5AA 4K94L 3GSRA 4LKCA 4Y4KC 5B21A 4XMKL 1HEHC 3ZW3A 3KL0A 2K7QA 1DQDL 1KYDA 3QRBA 3I3DA 4DO4A 5I8CA 5G5DB 4IRJB 4GS7C 2DQJL 4LRIC 4L2LA 5T3ZL 4CADB 4LU5H 3ROLA 3HFML 3NP4A 5IHZA 1AIFA 4BH7A 4CC1A 1T7VA 2HX9A 4JKPH 4NFDA 2IGFL 1UUSA 2BERA 2FIKA 3QCTH 3MRDA 3NVQA 4XMTA 2Q8BH 2QBWA 3DI3B 1JTTA 1TJIH 1U8LB 2OXHB 3GRGA 1Q0XH 3SCMC 1KYFA 4N9GB 3HHSA 3MFFB 1ZK9A 3HC3L 3MREB 2B16A 3V5KA 5HJ3B 2XWBB 3MBWA 1TVBB 4OJEH 4PV1C 4I85A 3ZYIA 4CN6A 1VCBC 3L9RA 3FQYA 1SOKA 2Z34A 5I1CH 3CVIH 1RQ5A 3D2TA 4NHCH 4PR5A 2EDBA 3WXWL 4I5BB 3ZTEA 4KVCL 4M1GH 3IBOA 4M7LT 1R3IH 1NWPA 4TN9A 3V55A 1H3UA 3SOBH 4GIAA 5FKAB 3OC5A 1T1ZB 4S0HA 3I74A 5EH1A 1MIEH 4XO4A 3PL6D 4RMWA 4DCQA 3D8MA 1YECL 5KVDL 3NH7L 2B5IC 3EH1A 4KZEL 1IO4C 2FGWH 1PSKH 4F9PC 1MWAB 4DZBA 2GY7B 1E27A 4W9FC 5FDYA 4XMPL 4F7KA 1GY1A 1T5WB 2K8MA 1IEBB 2E5EA 3VD1A 3FAWA 1W8NA 2HAZA 2XA8L 4OF7A 1NGPH 2Y5TB 1SN0A 4ALAH 2BOCA 5JA8B 1OGAD 3JV6A 3V0JA 2UWEF 2VISB 2DDQH 3VI3A 3HTLX 4WWKA 5IR1B 4F7PB 3RVVC 2YD8A 2EIJB 2BSTA 5EB9A 1JVLA 3DBXA 1CL7I 1B4TA 3BQUC 2YN5A 3HN3A 4FKKA 4OSUL 3OVUB 1J8SA 5KSUA 5T33H 2HLEB 4NUQA 1A47A 3SPJA 2DBLH 4APQC 2FO8A 3OXSB 3G5XB 1F11A 4AX3A 3HS0C 4XXDB 2AMUA 3CVHH 2FLRT 4JM0A 2X6BA 1BM3L 4NI6A 1DLFH 1UACL 4PGCB 2A9MH 3Q48A 5FC9A 1RULL 4J3TA 3O9WC 1E7VA 4ZFGL 1SEBB 1JD7A 5JHDA 4A66A 3QJSB 4HUVA 1FG2B 1KWGA 1IC4L 3UBGA 3VXOB 3FC8A 4OUUA 3RL2A 5I6XB 1ZJAA 1BVLA 4D0DA 1L4IA 3BOVA 1N6QL 4ZUVA 4MCYA 4C83A 1Q94B 2PXYB 4P2QD 4YAQB 3V0HA 2XTJC 1T6WA 3W39A 1HDMA 1KPUA 3UXFA 4HH8A 3GXUB 3KL5A 1FVCA 1TZHA 2IXQB 2XWJA 2O1AA 3AWGA 4ONHA 1FNEA 3OMNB 3ABZA 3PQYE 4WI8A 1XR9B 2GCYB 5ACZB 4OJFH 4XHQA 1OAJA 1ZS8A 1MJUL 3EGDA 2F53A 3MNMA 4GW4A 3I9PA 3SDDA 5F3FA 1RH8A 1XF4B 3TT3L 3QUYA 1RHFA 2NSXA 1Q0YH 1U33A 2IH3A 3CDZB 2Q8AH 4HJSA 1UKTA 3WV0A 3ZL2A 4ZOBA 1YUHB 2VC2H 3MXVH 4N2KA 5D7KE 1KLGB 4XNQA 5A1AA 2XWTB 2A74A 1FGVL 1MCQA 2PW2B 4QGTA 5DJXB 3RVTD 2YQ2A 4ZW8A 4FKEA 3SO3C 5EZIH 4D0CB 3UYPB 4KQ4L 2I27N 2UZIH 2JELH 3H9SE 1U8QB 3PWVB 4GLRH 4HGWB 3PV6A 4EEEA 4BKSC 1XXFC 5D93B 4G8GD 3TYFB 5FV2A 4AKQA 3DVNA 4GUPB 2YBGA 2I26N 3NCXA 2DWDA 3T0XA 4AZUA 4E68A 1I9IH 2YLHA 3W38A 4KXCA 4WGWB 5HPMA 3T8XA 3AY4C 1TZIB 3WNNA 1N3NB 3EJRA 1QFHA 2J2ZA 5JOEA 3SE4C 2LTQB 3KBHE 1JUFB 3WLBA 4NKIL 4KXZH 5FHAH 1IKNC 4Z7WF 5M95B 4IYKA 1LMIA 5GRUL 2YS4A 4U1IA 5TQ2L 3Q1SL 4V1DA 1N8ZB 2VR3A 4PRPB 1N68A 2QQQA 3IDIB 1P0SE 2AGJL 4UQDA 4P5SA 4S2SB 3HI5L 4Y5XC 1Q8MA 1R0AH 2XZAH 4FG6C 2D3LA 3G5ZA 3PWLB 3MLYL 4J3OF 5L8JB 2IH1A 4O2EB 1QLEB 2F9BT 2XQYA 1U8CA 2W60B 3Q05A 1EHNA 3DX7A 1QASA 3HPLA 1S5IH 3V5DB 1JFQL 4L0ZA 2IDFA 1NOLA 5HDQH 2BMKA 1QFPA 2C4FU 1M56B 3CZEA 2J43A 3PFUA 4PJCA 3EH4B 3D12B 2EDTA 3M1BB 3RJOA 4F8NA 2P5WE 3VX0A 3UBXG 3HMXH 2VLJA 3O9WA 4N2EA 2Q7YB 1OE2A 2FJHB 5GZNC 4Y5VC 1Q9KA 1SPDA 3UAJD 1WFTA 1HEJC 4P46C 1OT1A 1CK0L 4XMKH 2IADB 5D2LA 5D2NA 4UOW0 4RA0C 4F7TB 1XCXA 2FWLB 1JPST 3FU0A 2WVVB 4PD4K 3MBXL 4U7KA 5GGSY 1AIZA 2KHAA 3BE1H 5ACLA 2VKWA 1P2CB 2YD1A 1ZANL 2KS0A 3WJJC 5F1KC 4U0QB 4PJ9D 2JI2A 3E80A 4AV0A 2OZ4H 2D03H 2FDBP 1H6TA 3DJSA 1ORSB 5GRXG 2ED9A 2J5LC 2ITCA 4E5XB 4W6YB 4IMLA 2D8KA 4G8AC 2HZHA 1ZLUK 3I50L 2COQA 1KB9K 4LLQA 3D7PA 2XN9B 4K07A 5E03A 1YNTB 2A6JB 2YQBA 4FXGC 5DQJB 4I2XB 3ZDXF 3DTUB 2JJSA 3F7KA 4HUVB 1T1XA 3KG5A 4W9KC 1NMAH 3LS4L 5H94A 43C9A 1YPZE 1BBJB 3FUJA 5DFAA 5IG7B 3O6LH 2P28B 5AKTA 3NIGB 3V8OA 5E8NA 1P84J 2O6CA 4WENB 5HHXL 5AAMC 1G0DA 5C6TL 2EECA 1EHXA 3L3OA 4EXKA 2GIMA 4OI7A 2BFGA 1F2XK 1F3DJ 3FRPB 4HWEL 3JT2A 3R7QA 2Z31D 3VI4E 3QISA 3VM5A 5IKCA 1FZMB 4OLXL 4YDLC 3VXSB 3F00A 3DO3A 4RGNB 1RK0B 4UILH 4JRXE 4JDVB 1FZOB 3Q2VA 4QT5A 2DMBA 5F1SA 4R26L 5DU7A 3QG7H 3TL5A 4DSYA 3OB0K 4HZAA 4QOKE 5JIKA 1TJGH 1WGVA 1SOXA 3MXWH 1C7TA 1T3FB 1E90A 3ZLQC 3EZJB 2WP3O 2YUVA 3FO0L 4TQEH 5JTWA 1VFBB 3GYRA 3D30A 4NJAL 4HJJL 4Y2NA 3DNKA 2VLJD 4RGOH 3I6LD 3O9WD 3WYRA 4FXKC 1PCSA 4AIOA 3P77A 1G6RA 1RUKL 1NMBH 4YDJA 1FVEB 1YEHL 1UFUA 5EDSA 1G7HA 1R5IB 3IJSB 1IGJB 3V9EA 4D7PA 1YVLA 2GFBA 3WE6A 2ITDB 4YHML 4JANA 1VRSA 5D1QE 4BCZA 1DVYA 2YD7A 3WEOA 2YSSB 4JLRB 2ZF9A 3U9WA 3WHE0 4KPHL 2R59A 1YEWA 3DXAD 2CSPA 5KZCB 2WLLB 5GGQL 4TTGA 2QDWA 4E36A 1CG9A 2BWQA 4JPWL 5I6LA 3T8XB 5HGHA 2AK1L 4AWJC 1UT1A 3TEZA 1THCA 3MRNB 1WC7A 2VDKB 3NABL 4V33A 5B1CA 4AM0Q 5AB2A 1UADC 2B77A 1FC2D 5D2NC 4GBXC 3DVGB 3WFDL 4TNFA 3LPWA 4NKQB 4R90L 1R9FA 4MQ7A 3SZ6A 1A7QH 3DA0A 3KYNA 4NRZB 3BKYH 4BH7B 3O3BB 5DZAA 3OG4B 2AABL 2ZJSH 4BUGA 4NQDE 4Y2DC 3VXUE 25C8H 3MRHB 2A77L 1LK2A 4QHUB 4UM9A 2DEWX 1DBBL 4Y1SA 5EORH 3TT3H 4BZ1L 1IC1A 5AVUB 5I30L 3B2UC 2K4WA 4U6VH 2XJKA 3MRNA 5HHVL 3RY4A 1G84A 2Q2EB 3RNQA 3N42B 4KK8C 4MX7A 3WELA 5HGHB 4OV5A 1ZVNA 4IJ3C 5J6HA 1RPUA 3ECQA 3EBIA 3PHOB 5DZJA 3HNVH 1HQ4B 4ICXA 4L8BB 4N5UA 3D85B 2FATH 3ZXAC 4R4BB 4XP6H 3R8QA 1EAPB 4BE6A 1ZLVH 3G6JA 2OYPA 3BP5B 2EXYD 1CICB 2L7UA 4LL9A 1FDLH 5D9SB 3U30C 5EC2A 1KGWA 1THAA 3ZOAA 1REIA 3IS1X 1S7SA 4M03A 1RZJC 4XXCA 4Q9CA 3UTTD 2FEEL 3KXFB 5D1QA 2DL2A 4ANWA 2PPDA 5IBLC 2H3NB 2WXOA 3COOA 1CGSH 4L05A 2FL5A 3H53A 4KOCA 2BS71 1R24B 1PFOA 1UYWL 2UZIL 3FB6A 3NEXA 3INUH 1MPAL 1EUUA 1I9JH 2OQJB 1FFOA 4H8WH 1H9DA 2XV0A 4Y19D 4JO2H 2RIKA 3O4OB 1RJZB 4K9EC 4PJAB 5AYUL 4BQ9A 5DZVA 1NCDH 1DANU 2H3XC 3FTSA 1XGRB 3V0VA 4DAGL 3ZTDC 3BDXA 2VABA 3FCSA 5E9DE 5I6NA 4RMVA 1CFTA 4KKLD 4TLSA 3WKNA 1MOEA 3BVWA 1CVRA 3H2PA 4LVNC 2NXYB 4IRSB 2EJ1A 5I15L 4EJ1C 1INDL 3GSXA 4LQ1A 5AUMA 3VD0A 3MLWH 4IJTA 3HN8A 2W92A 3OTTA 2EQDA 3NACH 4U1MB 3TA4D 3TH4T 4X6DF 3V4UH 1XCQA 5E8DL 3CFKB 3TYGL 3WKML 4CAGA 5EUKA 2WKOF 1QG3A 4I3SH 1H0DB 4R0LB 1H3TA 4JN1H 2GHWB 1KDIA 4FNLH 1BD2B 1KYAA 3UTSB 2WBJC 1E50A 3RB5A 3TWYA 3V4UL 5C9KA 4KRMB 3KPNB 4PWJA 3WBDA 4QGYA 1JGUH 3O0RH 2LQRA 4JM2D 5K39B 1OK8A 1G7LA 2X9YA 5PAZA 4YMPA 1TQCC 2Q3AA 3OXRB 2WM0A 1MHEA 1P5UC 5C0BD 2VLLB 1F4HA 3MOAL 2XZCL 4Y2DA 4AVKA 5JDSB 4ODTL 2WLLA 5JW5A 4ODXA 4XXCC 4KNSA 3KR3H 3QUYC 4HJGB 3EIFA 4FXGB 3ZHNA 1DYZA 1KPRA 4PJEE 4PUBL 3WE6B 2J6EH 5ADPL 1FPTH 3MRDB 3L9EA 5B7MA 1N9PA 4EI6B 1ZSHA 4XVSH 3VGGA 3LV3B 1MCEA 2Y4SA 5HDLA 1XEDA 5MEQA 4DGUA 3EOBB 4JJOA 3C2AH 2VLJE 3SYCA 1W72A 5T33L 4GSXA 4X4XA 1TNMA 2K6WA 4UTAL 2X70B 2YN3A 3S9DB 4U3SA 4QXGL 4XN2A 4HWEH 3RU8L 1FC1A 4XI5D 5MERA 4I77L 1KEMH 4LOFA 5F7BA 5HVWA 1MXGA 2P8PB 1HH9A 4XN5A 5GS0C 1OTTC 5CD5D 5I2IB 5LXGL 5CHNB 4NAJA 3CFCH 4BBWA 2QPEB 4FYSA 2BW5A 5CN1A 5DHVB 1A14H 4XPTL 3I2CH 1MI5A 5IB3A 3DO7B 4LCWD 2O4EA 2CMRL 2RACA 1H19A 3SQRA 2ZOWA 1F6AB 1G1YA 2R1XB 2BSEA 4IKLA 1I8LA 3FN0L 4DO5A 1OTUC 4MXVE 3IMRA 5CD5C 3BCFA 1YMMB 4PRPA 5CILL 4HPYL 1AGCA 3EAKA 5A3ID 2ZXGA 5M7QA 4XB7A 5KVGL 1TSRA 4P5TC 5FUCC 4FA6A 6PCYA 4HKBA 4J28A 2XVBA 4KKPA 3TH3T 4LKXB 5LVEA 1PZBA 1EZSA 4HD5A 5HBBA 4WK0B 1ZLWH 3RG1C 4F58L 2D7QA 4FZEL 1AGDB 3C9NA 3RBSA 4F2MA 1CMOA 5D7SL 3KWVA 2WXJA 3CMGA 4HXAH 3PWVA 1SBSL 2OMZB 2B4CL 2BNQB 4XN7A 4CKQA 2GAZB 4K3GA 5JZ7D 2C7UB 1USQA 1CLOH 4PY8J 5AW6B 3PQYB 5LGJB 2LTQC 3BDBA 2ADYA 1B2WH 3F2LA 5FF6B 1R3HB 32C2A 3PJLA 1RUQL 2BNRE 3KWXA 5J13B 3V0WL 3D0AA 3OGOE 3DX3A 4CVXA 2J6WA 3ARVA 1EXUA 1XR9A 2GCYA 5ACZA 3S4SB 2K45A 4J3OD 5JLZB 1W8EA 3K6DA 3SYQA 4OZFB 3D4YA 4MJHA 4EKXA 5F1IB 4NYLB 5EA0H 2YD5A 5CFHA 5KJ4A 3L6FA 4P3CH 1BQUA 2NY1D 3HE7B 2YRLA 3MNZB 3UTZB 1WCBA 1U8OB 1ASQA 3T2QA 4YFLF 2JQZA 4J8QA 5D1ZC 3FRUA 4EUPB 3JUZA 5IT2H 2YO3A 1S7RB 4POZC 1S7UB 4KKCC 5AALA 1VPOL 3TJHC 3HE7D 2EIMB 1WH0A 3KD4A 4HZLB 5MEOB 1T4KA 2VDLB 4MCNA 4XOCA 3JWDH 2A4CA 1RVFH 4JY4A 3BVNB 4DTGH 4PVBA 3US0A 4L3EB 2RGSA 4Z3EA 2ZCLL 4E9SA 2GBVA 3UDWA 5BOPA 2CHDA 1TYJA 1U9KA 2DQIL 5I1LB 2ZSVB 2JLLA 3IT8D 4ICWA 3GMNB 5IVXF 1DHKA 3U2IA 1PL3A 4NOFA 3WN5A 1NEZG 5CZXD 3VNYA 2PN5A 3MXVL 4PJ5B 2X1WL 2QQLH 2YJQA 3MNZA 5AB0A 1NPJA 5T3XH 3VXMD 3T1WA 4PCKA 4EUPG 1TIUA 1J5HA 3IFOB 4AGPA 4IMLB 4P2RB 3GBEA 4KQ0A 1KZYA 5GRVK 3CDFA 1ZT7A 3DTXA 2O72A 4LHJB 3ARFD 5DZNA 5JPNB 2VN4A 3MR9B 1WD9A 2W5PA 2EICA 3OAUL 4ENZA 4WKXA 3U36A 5ICZB 1IKNA 2YRBA 3MA7A 1BJ1H 3U1SL 3I50H 4F27A 3KH3A 1FBIH 3APFA 3PWPE 4QXUL 4MBRA 5F72S 2FJUB 1X4YA 1X5AA 2RFXB 5E9NA 1SHSA 3QPXH 3VD5A 3VXUA 5A40E 3M1BA 3QUXD 1EBPA 3P11H 5TH2A 4Z3GA 3I9GL 3HJEA 3DUUB 4FI8A 4WI2A 3DGDA 3HC4H 35C8H 4I1PA 3QR1A 3QDMB 3GXTA 1TVBA 4AIEA 1QO3A 4ORGA 4M7LL 1BBDH 3CIQA 5FB8B 1OSPL 2XPZA 1UQSB 3HS0B 3QPKA 3ZTJG 2FSEB 2OMXA 2V33A 1ND0A 5T3ZE 3Q2WA 5J3HC 3MBEC 1P4BL 4PB9L 5J3HD 5F7EH 1M1XB 4RCAA 4ELMA 3T0EA 4PJ9A 3MCLL 4K7PH 4HBCH 2XKNB 2DWSA 1O6SA 1O7VA 2UV3A 1XV8A 1R0AL 4NO2B 1G0YR 1I8AA 5DK2B 1JYXA 2WUCL 2YK1L 2XKUA 4Q9RH 4KMTH 4KX9A 1TTCA 3MGOB 4P3DB 3RX9A 2NY2C 1R3JB 4L5FE 1JMZA 1VFAB 1J9RA 1XIWD 4XTRD 4UBDD 4ZUUA 5L4JA 4MJ2A 5EO9A 4JFDB 5L7XL 1Z0MA 3VNZA 5DZLA 4LSRL 4F37K 5C0EB 3BT2H 4WTWA 2GTZA 1ORQA 3RUGA 4J23A 3QNYB 3LXCA 2Z31A 3Q8BA 4Y4KB 2C3VA 3KYMB 2G5BB 4UDTA 3MODH 2IH3B 2QPFA 4BK4A 5IHHA 1UB5A 2Q3XA 5AG9A 4MWFB 5K9OA 2KMWA 1ET5A 3T0BA 3ZE0B 1A1MB 1ZDQA 1A1OB 3PWJA 5MEPB 1NUNB 4O9HH 3F05A 1EEZB 2XY1A 4JG5A 15C8L 3Q5YA 2ZAHA 2E59A 4OM0L 2VLRB 3FKUS 4XBGA 1TVHB 5DJ2A 3GEFA 3CZFB 5FK9B 1X5JA 2KT6A 2Y0SA 4FJZA 1W16A 3NCCB 4NC0B 1M9WA 4NKDA 1SRDA 4ZUVB 5HHOE 4R8WL 2UWEB 3NJNA 1FLTX 1PU0A 2C9QA 2FAUA 4AGLA 4ENED 4TM9A 3KEDA 2WGXA 1ZIAA 4LLMA 1PBYA 4ACPA 3FCUB 2H32A 3CU7A 5BNXD 2FZ3A 3SDDD 3O3DB 3WJMA 2IDTA 2CA3A 5J1AB 4PPTA 3ZE1E 4PRIE 3VXME 1J11A 3Q2NA 2XA8H 4RGNE 3HIZA 5E9AA 4K23L 5B4MD 5GQBA 2WTPA 1BM7A 3OZ9L 3VFGH 3TNMA 1ZXQA 3TURA 3BWZA 3P1VA 3GIZL 5DVPA 1LWJA 1S3KH 5IBUB 3F04A 4OSUH 1URLA 2O93L 4AW4A 1JRHI 5I18H 1N5AA 5IJCC 3V4VB 3C6SA 3FPYA 5CGTA 3B5GA 1V3JA 1GGCL 3PGCA 1C16A 4GRMB 5J12C 1NAKL 2PWGA 5CLZA 2PO6C 3WY2A 4U31A 2JI1A 3GPEA 1HXKA 5EA0L 4GRLA 1DLFL 3NSYA 2QQLL 2G30A 4HC1H 2QTVA 3IM1A 1E28B 1CS6A 4CDHA 1YLBB 1XGPB 1FV1A 3LV3A 5T1KD 3H2WA 1AO7D 2VC2B 4PJBB 2E9BA 1D5XB 2FX7L 3C08L 3QDJE 4HEMA 3VCLA 1NSNH 3N1PC 4KAQH 3GINA 2Y6SC 4YBQD 5IBUG 1MPAH 3BN9C 5BOJA 1S7WA 3PWJB 2ZCLH 4AVJA 1JGVH 1DJIA 1L7TH 2MPAH 2OCCB 2WCSA 4A6YA 3QHTC 4NRYA 5I6XC 3NCFB 1F4XH 3TTSA 3RE0A 5K39A 4IBWA 1AGEA 1WZAA 4P5TD 5DHYB 5I0ZA 1VKXA 3ZHFA 1A3ZA 3SY6A 2YUWA 4WFEE 4X5XA 1A9EB 1WWCA 3EJYC 3LZQA 2JWYA 5ICZA 3K7UA 3FDWA 5F0JB 1HZLA 3V6OE 2B1OA 1NFIB 2VSCA 1S9YB 4G8EA 2P7TA 1QSEE 1MQKH 1HS6A 3Q8FA 3UC0L 2YD4A 4UZSA 5ANMB 2WKGA 1CR9L 5C08E 4FG4A 1EH9A 4Q8BA 3UERA 6FABL 4I0PB 3IPBA 2AJUH 1CGWA 4ODVL 1LXMA 4WCYL 3X1FA 1HL9A 4IEFA 2JSFA 2OSLA 1TYRA 2VITB 3QO1A 1CDGA 4PJ8C 4UWQB 5ESAB 5GGVL 3CFEB 2HRPH 4P5MA 4R90H 4MS6A 1KC5L 3K0WA 2ARWA 3HUJE 2JKRM 4P23B 2G9HA 4MFHA 3ZZLA 2ZJSL 4FTVB 1GGIL 2CO7A 4J8RA 3S5LA 3MRQB 3ULUE 1OWWA 1QPPA 1SY6A 2NY5C 3VVWA 2ITFA 1UXMA 1YPZA 4IDJL 4IRJC 1G6RH 1FVDA 3QIWC 5BRZE 4D2NA 4G82A 4M7ZC 1R5IA 3IJSA 5F89A 4WEEA 3X3GL 4XE0A 1GSMA 3P0VH 4Z7IA 1TU2A 2WNKA 3Q6FA 3BQVA 3R8BB 1J8HB 1OO2A 4OFKA 1QNIA 1TG8A 2B2XL 1BYNA 4WW2F 2HVJA 1IFRA 1B4JH 2ZYHA 4M5TA 4OZIF 4R3SB 2K3TA 4XOBA 4FG2A 3TIEA 3NBNA 1E2VA 5FYKU 5F6IC 3NZHH 1OSZB 4F7CB 4GAJH 4EN3A 3QULB 1OM3L 2XBDA 3MROB 2H0EA 3MOAH 5I75B 2Y7LA 2GT9B 5KVGE 4JUSA 1CFQB 4I18A 2EE6A 3RPIB 2CMRH 3F7YB 5ILTH 4R5XA 4WFGD 4A2FA 1Y0LB 3HZ3A 1MHPL 1R34A 3BD5A 5LO7A 4JO5A 1CD0A 3LDBC 2IAMB 5B3JF 3MGTA 5EZPA 4YFLI 5C0BB 4HCRA 2RQEA 4JZJB 1RJLB 3TEWA 3GSWB 4PJCE 1G7QA 4PG2C 3ZR5A 3ERXA 3WKMH 1BBJA 3DUSA 3RU8H 2NTFA 3MNDA 3UPAA 1BOGB 1U58A 5GGRB 5JW4Q 3EJYD 4HFUL 2AXFA 2F7RA 2BM3A 1KULA 1I9EA 3PY9A 1WZMA 1MAJA 1S9WB 5GGUB 1AGCB 2A38A 5AVRB 5IQ9B 1YSOA 4FLOA 4K23H 43CAB 4FAAB 2VR9A 1FZKB 1WTGT 3VD4A 4QLWA 2LT9A 3NH7H 4JBSA 5FGBC 1N6UA 3UIYA 3NIGF 3LD8C 4AUJA 5A2CA 3GD1C 1UXWA 2OMYB 3P4NB 1S9KC 3L3HB 4L9DA 1S7TA 2DM4A 3QG6B 3QVAA 4ODSL 5DD1H 3U4AA 1JNNL 1E3XA 2W80C 1UB5B 3X14B 4KRPD 1QNZL 4EQ2A 3HAEA 4M6MH 1E3ZA 2ZUUA 3WTTA 3BPLB 3P77B 2X70A 3H9HB 2JJWA 5DJ6B 4XMZA 3I75A 2P5PA 3C75A 1W72B 3JWOL 5F2FA 5HI4D 2KQNA 3WS3B 2P5WB 4ZMWA 3S8WA 3Q7JA 4XP1L 4D94A 5EO1A 4UQ9A 2BVUA 4H0LC 2FX7H 4ZMVA 2NY6D 3FCTA 5DI8A 1CTOA 3RFRA 5CSZB 2YPKB 1IX2A 4HLZH 3MLTB 2R29A 3C60A 5GISL 1VEOA 3W2DL 5JPNA 3BPNB 3VE0A 3KPLA 1ONQB 4G43A 2A4EA 3F7VB 3FB8A 5DURD 5AKRA 4ABQA 4JMNA 2VR4A 3NN8A 3EO1A 4PWEA 5FA3A 5GS1C 4F2MB 3O11B 4DQOL 4IBQA 3QDAA 2W81C 5D96B 2ADJA 4JGNA 1S3KL 2Z1KA 1A6WH 3TBTA 5FHBL 3HR5A 5FO9B 5JNYA 1NAMA 3AREA 4PG9A 2IPUK 2NNFA 3N5AA 3N9GL 4KJYB 3WEAA 1T22B 3G6AB 3NJHA 1JGDB 3N85L 2WUBH 2R2CA 2BP8A 3GSNH 1L5GA 1UWGL 5G5DA 3HG1D 2DF3A 3ARZA 3NIDB 3KPLB 2N1TE 3N9GH 1TO4A 3HCVA 4ADIA 4BSVB 4RMRA 5B38A 1SDDA 4PHXA 5E5LA 4P05A 2X4OA 5GGQH 4ALAC 4UQBA 4ODBD 3FTWA 3AQZA 4FABH 3EJTA 1I3RA 1E6OL 5EEXA 4RQQA 2I25N 4N9OB 2PKDA 2O61B 3RAJH 2XFGB 1HHKA 3AWFA 3ZQ9A 3UZVA 3VXMA 4X4XB 1G0XA 2G60H 1FP5A 3AC0A 1XO8A 3J07A 4G5ZL 2XXGA 2KQMA 4PY8I 4S10A 2D0HA 2ZUXA 5EPMB 2C1OB 3M86A 4JPSA 5KZCD 3VGDA 3AT0A 3WKQA 3S4SA 4K5MA 4YLCA 1KZQA 4IK6A 3N3EA 1DBKL 2RA1A 5JR1H 2PYFA 4DVBB 1PZ3A 4NGHL 1AOZA 2CNZA 3MV7B 3O6KL 5I82A 1PX8A 2ZCHL 5J0BA 1MQKL 1PIFA 4M8VA 1H8NA 3QRFM 4ZD3L 4H0HB 4H5SA 2EDMA 1X4ZA 5FYLE 2YXMA 1AG6A 1MCDA 1R3KA 2C34A 4CU7A 1DJZA 1UM5H 4X6CA 1I31A 1KN4L 2YPVA 5JOPD 4UUJB 1QFWM 4B3VA 4RLDA 3VW3H 3PJSA 1T2JA 1CFBA 2MMXA 3TN0C 3IDXL 2HRLA 1V7NL 5J7CC 2H0JA 1IJNA 2XN0A 1QD0A 2GK0A 3FT4B 3O3UN 3NCWA 1D5BA 4J39A 4N1CA 2HFFB 4BH8B 4FI7A 1XCQB 3I02B 5IBTH 1KWKA 1VERA 3GJFA 2OJ1A 3FOMA 4EI5A 5KBNC 3AAZA 1ADQH 2FJFA 4J1UA 4PJHF 2JF1A 4X7CC 3SO5A 4HW6A 4JFQA 2WIIA 4LARH 1TNNA 4JQIH 5F7EL 3US9A 4PJDE 4QRTA 5CJOL 2AZUA 2CJUL 2NPLX 2VLKD 1R33A 4ZXBA 5DJDB 2WZPA 2Z8VC 3S35L 5DMGD 4NO3B 1VFAA 4AE1A 2J72A 4EE2A 3B9KC 5CSGA 4YHNB 3SD5A 3LQZB 4JFHE 2HJKB 3L4UA 1MCSA 2HUHA 4LSUL 2CJUH 5CF3A 1FNAA 3DX8B 4YDKL 3GBML 3L8QA 4HK3J 4NJ9H 3NDYE 3LZLA 2Q87A 2WXRA 4AVIA 2VERA 3OGCA 3OF6A 2HN7B 3W0WE 1NH6A 4LEXL 2YRZA 2WWKT 3M8OH 3ZKND 1JNHA 3L1EA 3V5KB 5CUSH 3HG1E 1DJGA 3GF8A 2HLAA 4TF4A 3GKZA 1FFNB 1KN2L 3DX4A 3OWEA 3S3JA 3P4OA 5B3JE 4Z5RA 1U8NB 5C1MB 4E0RB 1OV8A 2X7LA 1IFHH 5D6CA 1QBML 4LCWA 3EO0B 1N67A 3DX8A 4HPOL 3QIUD 5IB5A 4Z18A 2HJKA 2VQUA 3EDDA 4G6AD 3LCYA 3O3EB 5JHDE 3FUDA 5IMOB 4L8DA 2ZXBA 4RBPK 1D9KD 4KBPA 4IK7A 4X4ZA 4R7NA 4U2ZA 2FRGP 2ZXWB 1DN2A 4NCC1 4AGMA 4TLUA 3QXAB 4YHOL 4QXTB 3GK8H 3ML8A 15C8H 2HPOA 3CQPA 3N43B 4PGDB 5GS3A 4AXWB 3QYMA 1MEXH 2X1OA 4PSRA 2JB6B 3C6LA 3V52H 5HXMA 2N7BA 4MAUH 4AITA 2C4FT 4KV5E 5ABZA 3ARBD 1QFWL 2J3SA 1GJIA 5E1GA 2WY3B 1U8NA 2GKIA 4Y5YC 4PRDB 4AW7A 1U95B 5F88A 1IAIL 2CZNA 4AGQA 1PZ2A 3MCKA 3STZA 3MNWB 4X4ME 1BF8A 5B1JC 3EHBD 2IQAB 2X2UA 4Y5YB 4CKVX 4WKZB 4NXKA 3DVFA 5GSRA 1MFEH 3K6FA 2ATAA 1ED3B 3EYQD 5IB4A 2Y1YA 1KNOA 4YDVA 2ARJQ 4M6OL 1AP2B 2QFPA 4KDVA 1A14L 3GUTB 5DJ2B 5K9JH 4A2EA 2G5RA 2OQJA 3JWNG 4PLNC 1WBXB 1S46A 4NWUL 1TJHH 2ENQA 2Z7ZA 4XPBL 3ZPDA 4UMGA 1JHLL 3FQWB 5D1XD 5DC4B 5CU9A 5D4IA 1MHEB 2NUTB 2BIMA 4OLUH 1IGCH 2PCYA 1OGAB 3F58L 1KACB 1RZKH 2NY0B 2WLIA 3WNKA 1D7BA 4PJBA 4IRZL 1CFMA 1HWWA 1NGQH 3U7YH 1ZV9A 4OFYA 2H2SD 2OCFD 4NM4H 1AD9A 5GSVA 3MREA 2VDLH 3BP5A 3G7TA 3PP4L 1JWSA 1G1CA 2Z92B 2HKHL 4JVUA 5KYWA 1MHCA 4PRHE 3DRQB 4NO5A 1A4JA 4LGSB 2BRQA 3ESVF 4RGND 4HHGA 4XMVA 1KB5B 3V4PB 4Z3IA 3WIHH 1A6WL 2XTJE 5C0CE 2YOCA 1MJUH 2LGNA 5DK3A 2AK4E 1IZKA 2VZOA 1U2YA 4HDIB 5SV4A 5KEZA 3RWHB 1F6LL 2X4QA 3ECVA 4ZMYA 2BNRA 2XV6B 4L3CB 1SFHA 4UM9B 2PPAA 3MX0A 1ZE3C 5CEYB 1OGAA 1AY1L 4RFNB 1A7NH 4FFZH 1QX1A 4HIJA 3WKYA 3X1GA 1OP4A 2X1PA 4OZHB 5I18L 2FQGA 3GBNL 1PZ5A 4XGZA 3GFUA 4XNAA 1PD0A 3O2DA 1USZA 1AR1B 1XTMA 3OJ2C 1M53A 3RWDB 3D2UD 2XQBH 2OA9A 3EHBC 4RZKA 5GS2D 4H20L 3V5HA 5D2LE 1AR1C 1NDGA 1QTSA 3QDJB 5ICXA 1HL5A 3VRJB 4S1DD 3GS4A 3X17A 4KK9D 3CCHA 1ZEAL 1UATA 2PXYC 3MNWA 1FH2A 1QABA 2BY0A 3FU8A 4RRPG 4G43B 2Y23A 1QUNB 1FBIL 4XPFL 1ZPUA 4DAGH 4UTBA 1I7ZB 3NJMA 3O8XC 2VDMH 3MV9B 1R46A 5IIEB 2XWTA 3TO2B 1CYWA 1P4IH 4I88A 3BIKB 2NR6C 2HRHA 1NICA 3O6FA 2ZOTA 4MD5B 2OYLA 1NCGA 4OFYD 1MCJA 2EUXA 3GBMH 4JRFA 2YA1A 2PPFA 5FGSA 1N6VA 5CFAA 1N18A 2GY5A 3LNGA 1ZA6A 2V2TA 4HUWA 5HHMD 1E9PA 3B9KB 2IDQA 4DOHE 1ZVSB 4CVUA 2O5XH 4APQD 4K8RD 2CO3A 2WZ0A 2XQ0A 4F80A 1NCCL 1NCNA 2JQMA 1ITBB 2NLJB 3FZUC 5CNHA 3OKDA 5CGBA 1IM9D 1OP5K 2L04A 1JGUL 3O0RL 3BKML 4J27A 4PG9B 4D8PB 5DMIL 5AD0B 2MSPA 4OZIB 2R0LL 2VXTL 5AW5B 2NZ1A 4WGVB 1S7XA 4XRCA 3GIVB 2HMIC 1SYSA 1ZLWK 2OJZL 1KIRB 2OMTA 3QG6A 5DA0B 3HBGA 4F9LA 2WAHA 3QA3B 4HALA 5LJYH 3N43F 4O58H 3FO1A 4LCIL 2AEPH 4MAYB 1R3IL 4B9FA 1BGXL 4H0GA 2ZOKA 2CRIA 5KOMC 2K8QA 3AMKA 2P43B 2AXFB 1M05A 4S1SH 5KS9E 2CAKA 2J55A 3R1GH 4HK0A 5HTSA 4PB0L 4R4FH 3GKWL 3HE6A 4GW1A 1V55B 1FLRL 4I89A 4RESB 4Q0XH 1UM5L 1G7HB 1ETB1 4X9BA 5FOBB 4LEEA 1KTLB 2ZXEB 4PSPA 5IHBA 4P2OB 3CHQA 4N5EC 3KPQA 2FBJL 1BVKA 1N64H 3GKWH 5DS2A 2BS8A 3QCTL 4R7XA 4HCIA 4LPVA 3WUWA 1F6FB 5E6UB 2Y3AA 2FQDA 3ME0B 3PAVA 3KBFA 4L4TB 2FBJH 4QY8B 4HMCA 4OGYL 2DH3A 3KBEA 2RMNA 5IVZB 1AXIB 2D3JA 2YD3A 1Y0LA 3S5LG 3B2UD 2XWDA 3B9DA 3L3DB 4K94H 4X7FC 3EJPA 3GBLA 1BREA 5FYJU 2EEFA 3OZKA 1BWWA 4KFMA 1ZT7B 5BS0E 3T3PF 2BVQB 3OMIB 2Y07H 5E2WL 3I6KA 5GJSH 1J8HD 3NGBB 2X4NA 3DROB 3WNPA 5DRZA 3SKOB 3HS9A 4YGVA 3QXDA 4NUGL 1DQTA 4WLCA 1UJTA 2GSGB 4OCWH 3KLHD 1UB6A 5EWIH 3ZKMD 1D9KB 1IRAY 4YEEA 4WEUD 1WUNT 4KZDL 1FYTB 1X6NA 1SVZA 1NJ9B 2WUBL 1CD1B 3DTDA 4UT6L 3S5LB 4N2MA 2VDNH 3P9LA 5L2KE 1UZGA 4G7VL 4AQ1B 1UD4A 5D71L 4WO4D 4G71B 4MGXA 5DS1A 3SE8L 1IBFA 4LBAA 1B0IA 4GI9A 4BZ1A 1WSST 3CFMA 2A9DA 1YN7B 4GAGH 5GGTA 1ESOA 2PP8A 3VXTA 4XO8A 5CU5A 1LWRA 3HNTL 5HHOA 4A2HA 3BP6A 5ECJE 2Z4QA 1NCHA 4IKNA 4ZMTA 5ECGA 4YSTA 3LNIA 1QWUA 2OAAA 1WBYB 5L4MA 1BIIB 1NQBA 2AFNA 1F4YH 3NCMA 1NIDA 4MJ6B 4EN3C 1TQCB 4O51A 3N04A 5G4MA 4XCNB 3WFHB 5IT2L 1WAAF 2BP8B 2DQFB 3T2OA 1LEIA 4PRIA 1GHFL 4UAHA 4HLZG 1JYWA 1YUKB 3MRLB 2BJMH 4XH2B 4ETQB 3L1OL 5FECB 3BPLC 2EH7H 3LZNA 5MEND 1A8ZA 3ARWA 4U3XA 2X4OB 3FUHA 5K1JA 4R0LC 4ZD3H 4WHTB 1VKXB 1IB5A 1S7WB 1N19A 4OU3A 4RGOL 2HVKA 2AANA 5EU7E 3NN8B 5D72L 1N4XH 1T89C 4LK4A 4DKFH 4ELKA 1A21A 1MZZA 1QSED 2QGCA 1UH3A 4H26A 4N2HA 4KO7A 4IGBC 3RPKA 2EE2A 2UZPA 3V0DA 4RZCB 3HRPA 4Z5RB 6CGTA 3BKCH 3CXDH 3TO4B 2NXYC 2IQAA 4IRSC 5EO0B 1BVLB 4XWGL 2XVLA 1LEGA 4D0DB 2X89D 1RULH 1I8MA 1MVYA 4X5QA 2ARJA 3TJPA 2WQVA 4XZ4A 2J88L 3TBTB 5GXBB 1PZDA 3U0WL 2IF7A 2YBRA 3RZCD 5C2UB 4PJHA 1BQHA 5AYTA 3U7WL 2XWZA 3NIDE 3P73B 1GKEA 2WN3A 4WV1A 1IKOP 5FUOH 4PGDA 4F1ZA 4XCNA 3UH8A 3WFHA 1LEIB 1K4DB 3D85D 4MB4A 2EUZA 3ABKB 5F88B 1NUDA 3QS2A 4PMFA 1OOWA 1UFGA 4PJ9C 2F6AA 5AOZA 3P9MA 1A0QH 2AK4A 2VDLL 3PP4H 4UV7H 3V6ZB 3QZPA 4N25A 3WIFA 4HGMA 4RDQF 3ZK0A 2VDPB 1YUHA 3DI2B 1G7JA 1AQKL 1QFWI 3OKLB 4O2FB 1BPLB 4PRNB 3GT6A 1G7IA 5EZJB 5I0DA 3EH3B 1G87A 2WQWA 1YN7A 2HJLB 3O3DA 1FZOA 3AROA 2E4FA 4N28A 2JK5A 4K5NA 2I7SA 4F57L 5E7FA 4TSBL 2KI6A 2FO1A 4LSTH 1G9MC 4L9LB 3TEUA 2D03L 2AQ1A 4NC1C 3LKRA 3NAAH 5CGYD 2FJFB 1YRKA 4FG0A 4JR9H 4LLWB 5HYQB 2OMVA 3QJOA 5H37G 1RMFL 1U8KB 1A7NL 3W39B 3PXHA 5CIPA 4M02A 1G9MH 1PEWA 2EIEA 4PB9H 2YJLA 1E28A 3MRPA 2Y7SA 5E2UH 2NYZA 5FFLA 1E5BA 3IKKA 4UTAH 1ZKAA 4F2FA 3N1MC 4LP5A 5KVFE 1E0OB 2VLLA 4Y2DB 2ZUQC 3T6WA 5C08D 1NIAA 5L4IA 4BFOA 3L4WA 4PJEF 1A3LH 1E4XH 3EFDH 2VERN 2AQRA 5KYUB 4X6CB 4KHXH 1GOHA 3DURA 2V2WA 1E42A 2HVKB 2X4RA 3QIBD 3FW6A 3Q43A 3KHOA 4N2GA 4KXDA 3OGCB 1INEL 1ZA3B 3KVPA 2BOLA 5BV7L 1BQKA 4FQ2L 3MOQA 1IE4A 3SE6A 1JFHA 1OTSC 2WIIB 1MCPH 2YGOA 5DFVC 4LO9A 1FORH 1IAKA 3N50A 1MEXL 5EZLB 2DTMH 4M43H 3GSWA 3QXTA 4ZXBB 4UV4L 1UASA 3LNDA 1WRFA 1A6TA 5I5MA 5LBSH 4MZRA 4QHLB 3ZYOA 1AI1L 4FNTA 5F7DB 1BIIA 3H56A 4ABVA 1T4WA 4M6NL 5F9DC 3ASNB 2Q9OA 1MAMH 3STLB 1I4FA 4JPWH 1I3UA 4G59C 1XR8A 2R1WB 2WP3T 5EV7A 3DURB 3UABA 2PO6A 1YMME 4GB9A 1N10A 3I9AA 4IJ3B 2ZKXA 1GTNA 5DD0L 3D1MC 3VFSB 4KNTA 3EW3B 2OMXB 1EEZA 3R18A 2WBWB 1NFAA 3ARDB 1HXYA 4FF9A 1GJUA 3FNKA 3S3DB 2XXCB 3T0DA 2YZ8A 5I5IA 3QEUA 1RZJL 3B9AA 3VU2A 3OHXB 3RLSA 4PJEA 3WY3A 4GSRA 3BRFA 1ZGLM 3OR6B 1YHPA 3MBXH 3JV4A 2J2ZB 3EO9L 1KJ2H 3B34A 1WE5A 2EC9T 1UEYA 5HYIA 4YSEA 3JWOC 1NCIA 3WFBH 5FIEA 1NFDF 4JRYD 4JFDA 3U82B 1LE9A 1PKQA 2V3DA 3HI6L 4AT6B 1IFGA 3QIBA 5T5NG 3WTXA 4O5LL 2LU7A 2W65A 1ZVSA 1MY7A 1IC7H 1KCVH 4TQIA 3VWJB 2VMDA 4XO3A 3C60B 1L0QA 3N1QC 2AK4B 2X2HA 3UZVB 3ZTJH 4DIXA 3X13A 4DQAA 1AC0A 1NBZA 1U2CA 5IUCA 3JWNE 1Z5HA 1ITCA 4BKLA 2BDNH 1XH0A 4L37A 4N2CA 4NRYB 1ASPA 4XWOD 1KJVB 3O6FB 3RTQD 3WUWB 2NY1B 3LKSA 3II2A 4GG8A 5DC9B 4XX1G 4YDMA 5AVZB 3SBPA 2AVFA 1NFIA 5JNYB 1BSIA 2KLTA 2L7EA 1F1AA 2K9UA 1A9EA 4UQAA 4CSZA 5SWSD 4Z78B 2XCMC 5FYJH 1XAKA 4A2LA 3HE6B 1SOQA 4ELMF 1GA2A 2R83A 3RIAF 1Z0NA 4JY4B 2FBRA 1FG2A 4YZFE 5LHDA 1P6WA 4CUCA 4QYAA 2GG1A 5C0AE 2OMNA 1Y18B 2BP0B 2J1KA 4N8CL 3FU7B 5EOCJ 3L5XH 1G9NH 5IW1B 4P23C 3IMBA 3ZDZB 1CFSB 3QZBA 3W2DH 3ZUNC 5H4ZA 1GZQB 1NL0L 3KVQA 4ZW7A 3HZMA 4PWKA 3UZEC 4F3FA 2OMTB 4YUEH 1GYUA 3FSWA 3ZGHA 4BA8A 4YN3A 5FYJE 3VFVA 3VJ6B 4JM2F 3R19A 1OT4A 5SX4I 3UC0H 2EDRA 5CLYA 2VZUA 1U0QA 4OZIA 5FO7B 3UADA 6FABH 3ZIYA 3ZJAA 2OJZH 4NP4L 3OKEB 4PJ7A 5J11C 4TRPH 1CGXA 2AQPA 3UCRA 1KMGA 1G7MA 4PJBF 1X5KA 3PS6A 5H2BB 4JDZA 4PTTA 3WS3A 1S7TB 4AY0A 2WWMD 1U8IA 3QIWB 1E27B 1YMMD 4HWNA 1YEIL 4TMPA 5DJ6A 3VXTB 1PX3A 1XX9C 2L7JA 1LYQA 3D52A 2EILB 3CK0H 4L23A 3DV4A 4ZO7A 2SODB 3SDYL 3D87B 1YPZF 3GEWB 2EEBA 4I18B 1EIBA 2EXTA 3KGRA 5IKCB 1DVFA 2NY3C 4JUTA 3RKPA 4AQ1A 1JXJA 1NMCC 2F74B 3BAJA 1BP3B 4ZMPA 3BGFB 3CFUA 4LOVA 2V7NA 2Q8AL 5I73C 4IBYA 3QQDB 3NMEA 3MLWL 1N0XL 2H45A 3ZDWA 3ZDXB 1MCWM 1MQ8A 4WI6A 4WK2B 1JGLH 4XPGL 1YYLH 1M71A 4KHTH 1PDKA 2GI7A 1IT9H 3OHMB 1VSCA 5CCKH 1FRGH 3DOIA 4AMKH 4QRFA 3MRBB 1V8HA 4OAWB 1WCBB 2DLTA 4PVNA 3H3BC 1TQVA 5F89B 2BIIA 2VAAA 5DRZB 1CDBA 1NC4B 1Z9SA 2YARA 4P23D 1Z9NA 1RUAL 4KRPB 4LDEB 35C8L 3TN0A 3KPSA 3X1EA 3W11C 1U6AH 4I3SL 1U8HA 5C7XL 3NESA 4R6UA 3SE9H 5AW0B 5DMIH 2OYMA 4GKSB 2ZKHL 4R2GD 3MFGB 3TVMA 3ROLB 4B9PA 4CDGC 4PREB 5IB3B 5IHZB 3S88H 2D4FA 3BZEA 4F2ME 4CMHB 4JQXA 3TF7C 4Q6KA 4Q2ZB 4N1EA 3CFEA 2XG4A 1W80A 4PJDB 3TBYB 1L9RA 1MCCA 5A2BA 1KPVA 3PPSA 2VSDA 3TX4A 4JX0A 1A6UL 3HVDA 3L9YA 1K4DA 5AOLA 1HINH 5SWZE 3VRLE 5A2KH 2ETWA 3CG8A 4B9IA 2XU9A 3HRZB 3P4LA 4GYBA 2EIDA 4F7EB 4P2OA 2RB8A 2GSIB 1MIML 1TCRB 4WUUE 5D6CB 4E42A 2JH2A 1X3DA 4KUZH 1I3GH 1WFUA 2MCMA 3VXUD 1PVHA 5AB9A 4HISA 1RURL 3DX7B 1NFKA 5DYOA 4XVSL 5E9DB 2PF6A 2A9NH 2RHEA 1IBHA 3VSTA 4LL1A 4RZCA 3H0TB 4BFBD 1F1GA 1O7DC 2IGLA 5DK2A 3K2UH 1NIEA 3OXRA 4Y9EA 1ICTA 2OMWB 3UTOA 2X4SB 1FNSL 3GM0A 4RNRB 1KGIA 4YNYB 4JFDE 4WSJA 3UTPD 3QA3A 4NM4L 5CJBA 4ANUA 3CBKB 3DMMA 1V27A 3QJRB 2Z65C 2EVFA 1MIEL 1T21B 1F58L 4U1NB 5KN5B 1GSKA 5JIQA 4GAGL 3B7YA 3CFIC 3W56A 3OR7B 2WCGA 1NKRA 3O2VL 3U9PL 5EU5B 4UDUB 4XMXA 3IJ8A 1NDMB 2PLTA 4GBXA 4M7KL 4Y5YA 1MZYA 3KM2A 2EH7L 1VZGA 4Y4HA 2ZIDA 3FT0A 3PIQB 3MCKB 3GSQB 4KI5C 4U3SB 4LCCC 2D0FA 4PRDA 4AEIL 3V8CA 5ICUA 2YK1H 5DWPA 4R2GC 1ACXA 3V0EA 1VFMA 2X38A 5L0QC 1J5IA 1CWVA 2EYSB 1EHAA 3B2PA 4G9DA 3VXNB 4HEME 1KJ3H 5D7LE 2Y7QB 3F12A 3IJYB 1WICA 2CO4A 4BZ2L 3AABA 4HUKB 3TONA 5BMFL 4HIPA 3THML 5SX4H 1RUPH 4HIIB 4J5VA 1DBAL 3MLUH 4X5XB 4YSPA 4M4PA 2JNZA 3G08B 3KCPB 5JW5B 1DO6A 4X99A 5KUKA 4N3UA 1U3HB 1RHHB 2VABB 4EPSA 2B3RA 2ROYA 4FXLA 1YN6B 4UOZA 2HX7A 2XWJB 3FCBA 4P2OD 3PGDA 3D51A 1IBGH 4Y1AD 5I66B 4G83A 5GPRA 1LE9B 3E6FB 3ZE0F 3KW7A 3KXFD 4HKZA 2AJVH 1RZKL 3B6SA 3ARGC 4IBSA 4KO6A 5DWUH 1QEWA 1V3MA 1WAPA 2R0WL 4OCSH 1H8OA 4OF5A 4R97B 5I1AB 3LN5B 1NBQA 4RRPM 3LRMA 4P48A 3AADB 4YWGH 3EUUA 1L9PA 4F58H 3SHSA 4X6DE 3DOHA 3PGCB 1JNHB 5FYJD 4DVBA 4Y19E 3B2DC 1NAKH 3V6BR 3RQ3A 4FQLL 2WLNA 4U7MA 3LPFA 3FSVA 1HX0A 3AM8C 1X7TA 4QD2E 1A02N 4X6BB 4ZNEA 4FJYA 5HI5D 4LSDA 5F8QC 3G6DL 4GP4B 5JW4M 1OXYA 3F84A 5AAMA 3KLDA 5DLMH 4MA3A 3G5YB 1JK8B 4QHUA 3FTGB 1IIKA 1OWRM 4XB3A 3X12A 4ATWA 4AK2A 4Z0XA 1MXDA 1ZGLP 3L48A 1EWHA 3MO1B 4N8CH 5FF6A 2XBZA 5KS9F 1U2HA 3IGUA 4LOEA 4OZ4A 3UJJH 5T1JA 5ABAA 2XWCA 3O8XD 2VDMB 4OFDA 2R39A 4MMZB 5AL0A 1RSYA 2FX8H 1KJMB 1YY8A 1HYRC 2KZBA 4P5TA 2AITA 4BGDA 3MLZL 4CVWA 3OHXC 4HUUB 4WSKA 1JV5B 1NCJA 2CDFB 2PPEA 2YC1A 5CJQH 1JZ7A 1MW1A 2Y69B 4PRHA 4HULB 4TYUA 4YHLH 4WW2C 4IOIA 3I84A 4BHUI 5HJBA 4NQDA 3TOPA 4CL7A 5D9SA 4G42B 5ESQA 1BMZA 4FN0A 4LSQH 3WS6C 4R4BA 3UOAB 1PQZB 3M07A 2XKNA 3Q6GL 1TKWA 4C58B 4B9GA 3ILQD 2JCWA 4URTB 4W9HC 4F9LC 2GFBB 3HE6D 5BVPL 4PJ6A 5DQDL 4L1TA 3IXAB 5I8EB 4K3DH 4EDWH 2OMWA 3A22A 3AQDA 4LQFL 2BC4B 2F8XC 1P5UB 5EU6E 3B1UA 3FK3A 1W0VA 4GO6B 1UM4H 5D8JH 1J5OL 2BCKA 3PFQA 1FN4A 1NCWL 4QTHB 2NLJA 1M2VA 2XQBL 3OAYK 3AM8A 3RB7A 2JI3A 4EDXB 4WFHD 2J5WA 3BGMA 8FABA 2X6MA 3DIFB 4NM8H 3ULVH 3SKJL 3QO0B 3F65A 1XF2B 1OANA 3AT9A 1XMWA 2GC7C 5C08A 4NZDA 2OL3B 2QQKH 5JO5B 4ZG1A 4RFOH 2IAMD 3FHQA 2GQHA 1GGYA 3OKOA 4OGZA 4PJGA 2JK5B 5IUSA 3BVUA 3LH8A 1EAOA 3SJVB 1J7VR 1D7CA 3RGBA 4ZSOB 1UWEL 4QRBA 4R8WH 1G7JB 2QGDA 1DTUA 5JHLH 2OXGA 1CTNA 4W1TA 1S7VB 3BAWA 2UZXB 2WINB 4OZHE 4G6KL 2DQJH 1AZUA 1I85C 4O00A 5T3ZH 5KBKA 43C9B 2YSSA 4KROC 2IFFH 2R4RH 4BWTA 5AVXB 1JYNA 4XODA 3SGJC 5IWLA 2IDCA 1CZ8H 3QORA 4BFIB 4F15B 2HJFA 3SOTA 2NUPB 4F1SA 1I1FB 4J4PD 5IEKB 1ND0B 1YC8A 3KXFE 1Z5LA 1LK3H 1YCSA 3LNHA 4N6QA 4UV4H 4YO0B 3VXPB 4M7JL 1J9SA 4ODXB 1AHWB 3O41B 4WU7A 5E1IA 4CMMB 4Y7OC 4ZPTB 3ZE2B 1IBBA 2WLMA 3OAZK 3VD9A 3WFEH 2XDHA 1EFQA 2YMXL 4YVNA 1AHWC 1OCOB 1ORSA 1T04A 3GI8H 2CLVA 1NLBL 2BSSB 1T2QL 1CFNA 3MODL 4QTIH 4DP2X 4F5CA 4TNVF 5D70L 3GZKA 4ES8A 1UWXK 1H5BC 1EZVX 4Z6AT 4YBHA 4QRTB 3CHPA 4M00A 4Q9RL 2ZCZA 2PR9A 1S9XB 1UJ3B 2VM9A 3WD5L 4LSSL 3K81A 5CP3H 2AJXH 4QMEA 2FLBT 3QIUC 4PMEA 2R0ZL 3IFOA 3K74B 3VRLF 1ES0B 1ID2A 4DP9X 3HG1B 5EC1B 3AG1B 4FDWA 3G6JF 2HFEA 3PHQB 1KXHA 2J71A 1P7HL 4WI4A 2P45B 4PS4H 3LKQB 1DN0A 1FFQA 4W4NA 5GRJH 1MVUB 1NFDB 1Q9WB 3LZPA 2XHNA 5ICXB 4X6FA 5T3XD 4BD4A 1RLBA 5C0IA 1CFVL 1FE8L 1E2WA 1NDMA 1QVOA 2LW3A 4GBXB 3ROOB 4N0YL 4B96A 2H26B 4G1EB 5LWYH 2Q1EA 2X12A 2J88H 1ZIBA 2DIBA 4MXWL 1T7YA 3DGCR 3SGJA 1LDPH 4BINA 4ZI8A 1UT2A 1CGUA 1UOKA 2HFTA 1E5ZA 3UAEA 4DEUA 4EI0A 1XCTB 3LJ3A 4WSGA 3BRDA 4QXVA 2IWKA 3G04B 3EG9A 4RGMB 1DVFC 4PIRF 4HUXA 3TYFA 1IC4H 4QJ5B 1XMEB 2BNUB 2W8CA 2P8LA 3T0AA 1CE6A 3TWCH 1IV8A 2BJML 2VCOA 3W0WD 4ODHL 3LD8B 4V11A 4UB0H 4V1DE 4Z7NB 1AE6L 1EXUB 3LEYL 5C0RH 3MBEA 4Z77B 1QRNB 4HV8B 4OKDA 4A7VA 5ANMA 1PG7L 5LBGA 4ZUTA 1JXKA 2CIIB 4KTDH 3PHAA 5CD3B 3QUYB 4YSDA 3BEVB 1JZIA 2JJSC 2VJXA 5D6DC 2BO0A 5A2IH 4W9LC 4R9HA 2F54A 2A73A 2OULB 3IETA 2OPCA 3C08H 2AP2A 2YPLD 3SPHA 4L4VD 2LU5A 2AAAA 1WG3A 5IZ7A 1VAHA 3HEIB 1HILA 4QCIA 3KYKH 3S36L 4MD4A 1HE7A 1SJHA 3BLBA 3D05A 2R69A 3UP1A 4DFHA 1RVFL 3U83A 5D7IA 3O3AA 1XH1A 4I3RH 4OKVA 3MTXA 3LKNA 1X4XA 1CUOA 3MRPB 3WY1A 2DEXX 4Q52A 4UNTA 4EZJA 1ULVA 2F7QA 3NZHL 3ZE1F 1TU2B 3VDBA 1NCAL 3TLRA 4XNDA 3QORB 2VDRH 5TDNB 1PZSA 2VE6B 3F5WA 2P4AB 3H2QA 4GAAA 4E9RA 2BLFA 4G9FD 2AK4D 4MMXC 1GMIA 1EXHA 6TAAA 4MAYC 2YAOA 4FXKB 4WUUA 1W6WA 3UTPE 5GHWH 3TGXA 2B7DT 3VE0B 1PDKB 1T7ZA 3RTLA 4W70A 1XSJA 3W81A 2VR8A 3ESOA 3LRHA 4JE0A 3VDAA 4YHLL 4ZUWA 1HHHA 2RBLA 4HU2A 4PRNA 4LCCB 5C92A 3MC0A 3IDXH 4F7PA 1ZWIA 1AR1D 1QZ1A 1HH9B 2VZTA 5EDXA 1JPTL 4H1LA 1OCWL 3GWJA 1Y1DA 3BN3B 3GMQB 5E7BA 4M7ZB 4L3CA 3W0WA 1HL8A 3NFSL 4QRAA 5DO8A 3LEVL 3OAYH 5IQLA 3RWHA 1XBDA 2MQCA 1UOLA 5DRXB 3P0VL 1DDHB 1LO5A 4DEPC 3MACH 1I9RH 4HJUA 2ZUSA 4K3HA 3SBRA 2NYKA 1JZFA 1A7OH 2YAFA 5IB1B 1MDAA 3HZVA 4HIQA 3BAYA 2IMMA 2K6YA 3QUZA 3UBFA 1Q0XL 2X4TB 3AY4A 1PY9A 1KB9J 2DQMA 4HJGA 3TS8A 4DZBB 1UJ3A 3GXFA 2F1EA 3JTSA 2NZ9D 2YFNA 1IAMA 2Y36H 4G70B 2R2BA 3K6IA 5ALBL 2MEJB 3AGVA 4GG6B 4U4BA 1A7OL 2VLRD 5TD4A 5DFVD 3JUYA 4BCXA 5AZ2H 4NN6C 1MF2H 3ZKMC 4G8GB 2X3AA 3IFLH 2FEDC 3BXNB 4I0PC 3B43A 1JAEA 5CEZD 4QYOA 3TBWB 4ZXBD 3OWRA 4HQQH 1T83A 1TTUA 1HN1A 3BVXA 2E9JA 2QHRH 1BOYA 4R5VA 5KSUB 4LSTL 2ADFH 1QSVA 2XYCA 3MV8D 1U36A 4PP1C 5EBGA 1P6AB 2IV9A 4RH4A 4BIKA 5GZND 1JPFA 2V7HB 5GRUH 1GGTA 4TKWA 4YDKH 1SXBA 3JTBA 1ED3A 3A6BL 5K1NA 5ELIA 1M42A 4UT9L 4ZOCA 4FI6A 3HLAB 1T5KA 4KK6D 3WN5C 1JZEA 1U30A 2Z35A 3TZVC 4HIHB 4KGJA 3MYJA 4GINA 3IFNL 3DPBB 5CN3A 3W3BA 4B0MB 1JOIA 5EO9B 4B27A 4BWWA 5CEXB 1OAQL 1UCBL 5IF0B 4PJGE 2HFFA 2X10A 4KKRA 4G7QB 4BH8A 3RWGA 4AOFA 1QA9B 1F2QA 3EFFB 3RNQB 4FRWA 5FUZH 4JFEB 3EKCA 3K2UL 2X4PA 4AQOA 4ZUWB 4N5ED 5CZVL 3ARBB 2KERA 4H2AA 1OSYA 4L4VE 3CMOL 5C07A 3LQAC 4ZFZB 2WXQA 4JHAL 3IDGA 4KRLB 3ARBC 3ARFB 1EJOL 3B5HA 1O9ZA 3EH5B 1IL1A 1A4JB 1QLFB 4PGEB 4C4UA 1T22A 3LKOB 3GTVA 1RZKC 1S7SB 4AT6A 2CBOA 3EO0A 3D25A 1Z5YD 2SEBB 3NUKA 4KUZL 4TSAH 1NIFA 5DRWA 2E7MA 2IALA 3MN8A 5DXWA 5I71B 5ITBL 2DLFH 4KDTA 3IJ7A 3SKUD 2HLFC 1JGVL 3LQMA 4ZX5A 4NZRH 1ZANH 4HVBA 4JGUA 4CN4A 3QQ4B 1MRCH 5ETUB 5IB2A 4ACTA 4WI3A 3BEWB 1SNRA 1B88A 3MNVB 5E1HB 3RTQC 5I1JL 5DK0B 1L9QA 5ITBH 3GIZH 4NQVB 4NZTH 2K70A 1CICA 3CHXA 4LCWE 4F9PA 2NXYD 4IRSD 1BG9A 4H1LG 4NZRL 4Y9CA 4YHPB 4G6ML 3IDGB 1LO2H 3QCVH 3H85A 4RGNC 1GH7A 3QK0A 1UT9A 5C07B 4NENA 5BQ7B 3KDMA 2ICES 3K2KA 3W5NA 1XGZA 5I24A 2FEDD 4G6MH 4PRHB 2GSMB 4JRYB 2CM5A 2F53B 4GMSH 4PBDA 4Q9QL 2DBLL 4Y4KA 3GO1H 3QUML 1PKOA 3D3VD 1DLHB 3RRQA 4NRZA 4YEFA 4GOSA 4LSVH 3MRHA 3GRBA 4P49A 1LD9B 5EIVA 5I16A 2NXZC 4GUCA 2E47A 1WBYA 2NRDA 2W88A 4QHKI 1RZFL 5F7DA 1BV8A 5CJXC 4U05A 1X7QB 3OAZH 4J2QA 3RTQB 3K1DA 3NJFA 1RZ7L 1IEAA 4DKEL 2QKIA 3PE9A 1TMCB 3TWCL 1N0XH 1MW2A 4PYHA 3O2DL 3C2SA 3QJZA 3HB3D 3HRZC 4NFCA 2NQDA 4JJ5B 3EYQC 5HVHB 3G5YA 3BLKA 3INUL 3VMOA 2FGWL 1BFVH 1MJ7H 5HHMB 3GSVB 1A64A 4OD2A 4ZAKD 2A6DA 3T08A 2VLRE 1NDTA 3QXWA 2C26A 4ELMB 4QYOB 2X4RB 3QDJD 3APDA 2J1YA 4AJVA 5CMAB 4ZAKB 2FYYB 5B1AB 1LO0L 1FDLL 2AEIT 2ED6A 4HSCX 5I1GL 1INDH 1S7RA 1EHLL 1KTKE 2IEPA 1U8JA 2NXZB 5DRWB 3BUPA 1MDTA 3IVKB 5E8EA 4JO4H 1U8PB 3MLVH 4Y16D 4HHAB 1K85A 4CJ1A 4DZ8A 2XVKA 4AV4A 5I1KH 2QFRA 2DWTA 3IDUA 3EYSH 4JPVH 3EBHA 1I8KB 1QBAA 3V10A 5CKAA 1NSNL 4KAQL 5BOZG 5EEZA 3PHQA 3P40A 5DVMA 1QSEB 2VXSH 2XG4B 4OJFL 5E5MB 3D4ZA 1BQHG 2DLIA 5BZWB 1PZUB 3HNSL 4LOUC 5DJCA 4GS7B 3L17A 4YHZH 4YX2L 3VA6A 3FRPA 4OCYH 3EHBB 4K71B 1IZJA 5GGTL 5EF1A 2CR0A 1NCWH 2LFEA 1FZKA 1BIHA 3DPBA 4CC4A 3CVHB 1LP9B 1NBYA 5I74C 3VXPA 4CMMA 4YBQC 4N6RB 4OBRA 1Z9SB 3P3TA 3HUJB 3UJIH 1X7SA 3SKJH 5CINL 4DZ8B 2YXWA 2VAAB 5PCYA 3T1FB 4GG6E 5D7KD 1I53A 2APTA 3QR2A 1JGDA 3NFPB 2H5UA 2YD9A 5D6DA 1QR1A 1FVDB 3OAWA 4MDJA 1CL7H 3KPRE 2HWZL 3FMGL 5DMGC 1QBBA 1IM9A 2ZD0A 4CILA 2DTSA 3IU4H 1YEJH 3IDIA 2BVPA 4M7LH 1NC2B 3SD2A 1OGTB 4FQIL 1TJMA 4FMKA 4FTDA 2MNJB 2VXTH 1GGIH 4LVHB 1BVOA 3E0GA 3FTUA 5HJ3A 5ADOH 1RJYB 4M4RA 5HDOA 4XMPH 1A25A 1NBZB 4HP5A 3UTQA 4ZFFA 4NQEA 2FJGA 4W9ZA 2OTWB 3GHPA 5ILTL 3B4NA 2HMID 3S3PA 1HCYA 4JHUA 1XF2A 4RFEB 3MXWL 3QULA 3ILPB 1JG9A 1MREL 4LLDB 2BMKB 3KM1A 2CO6A 4ELDA 3BGMB 4J3BA 3WNJA 3UYPA 1NTDA 1ADQL 2VXVL 3S2CA 2BZDA 4GI6A 5GGSA 4QRSB 5I71C 2FECL 3FZUD 3NZ8B 1E9PB 1OL0A 1MRCL 1PJ9A 4PLOB 4DGYL 1B4JL 1JTOA 1PTZA 3OR6A 3Q3GA 2WLYA 5DLLA 4FQCL 2NY6C 3OD3A 4HCGA 4HJ0D 1E43A 5FW6A 3OKNA 1TETH 1QWNA 32C2B 2NUTA 1DUZA 1E4WH 1U92B 5C0NC 2Y2YA 3ULAB 2R4SL 2Y3NA 3GB7B 4TL4A 5BV7B 3T04D 3VTTA 1EJOH 1V3LA 3KWTA 4B9ZA 1I7UA 4GBXD 4AKOA 5E0QA 2Z3FA 1MAKA 4JHWL 1O6VA 3HMXL 4NQVA 5IVXA 1ZHLA 4X80L 1X5ZA 1EUTA 5CZVH 5LAXB 1XCWA 4DK3A 1YY9D 4YDZA 4X8JA 1ZXKA 1VF5C 3GMOB 3T1FA 4N2NA 1PF3A 1MVFA 1BFOA 2EO7A 4JGMA 1T0NA 4P4KD 5F7FA 4S1DC 3BZFA 4FFTA 4OJYA 1A7PL 2AHIA 3IS0X 3ULUH 2B4CH 1MRFH 4O4YH 4FFZL 2R23B 3S7GA 1G7QB 3QEHB 5E5RB 4D9RD 1G9HA 4MD4B 4Q58C 1XIWC 3CDZA 2EO9A 2GK2A 5CBEA 2VC2L 4HGKC 5GS0L 4WGKA 4AYFB 3IJEA 3MLXL 5FA4B 1KUMA 3LHPH 1JS4A 2A74B 4F24A 4N90E 2X4QB 3FT9A 5A43C 4XMLH 3ARYA 4L8SC 4XCFL 1L7IL 4UU9A 1H8SA 2YA2A 2FZ3B 1DUYA 5DEGB 3U9UB 1P1VA 2YPLB 1Q1PA 1RIHH 1ZS8B 4MCYB 4L4TA 3CFCL 2BNQD 1UZ6E 4PJ7B 4CN1A 2IAMC 3RDTA 5JYMA 4UTBL 2X9ZA 1UWGH 4X5RA 3KHQA 1JBJA 3LN5A 5I1AA 4TNVK 4IIQA 3H54A 1NCAH 2YSTA 2LR4A 3T3PB 1FNGB 4PP2A 3VXQB 1OAXL 5C0ND 4Q9BA 3BYYA 2R8SH 4RBPH 3CZLA 3ZTNL 3HG4A 3H55A 4XN1A 3E3QE 4F93B 1YEEL 4H8VA 3VXOA 1BEXA 3L4TA 5L2KD 2CU9A 2O5ZL 3FQWA 4N0FA 4FLSA 4PRID 1NWOA 2CGZA 4P2AA 4PS3A 4LCUB 3MRRA 4E9QA 4PGBA 4WNQA 3MA9L 1MCHA 3O4OC 3P0YL 3G3LA 3U0TA 1S9WA 2XICA 4Z1PA 1P7QA 2JELL 4XVUD 1AGFA 4HS8L 2DQCH 1SLVA 3OLDA 1BZ7B 2N3JA 2F19L 3U7WH 1DSFH 1J0JA 1U3HD 5JO5A 3IRCA 5AD0A 3O4LD 4U1HA 2EO1A 4PWFA 1UWEH 5J1AA 3WJMB 5J57B 3W9EA 4XWGH 1K8DA 2ESVD 3QPQD 4G3YH 2X05A 5EU5A 2WQAA 1WHOA 1J48A 2EEAA 2XXMB 4YBLC 5EU6B 1T20B 5T5FL 3UL4A 1K8IA 3ZYJA 4AENA 1XZWA 4NO2A 4PJ5E 3PQYA 3I6GA 5EO0A 4G3YL 3EYVA 2GPZA 1LLAA 1P7KA 4HFWA 3K6SB 4DK6A 1JCVA 3VWKC 1J5OH 1PEZA 3Q8CA 3IMTA 5I8EA 4JRYE 4FLHA 1CG9B 2GVYA 3QWOB 3L2NA 1W72H 4KK6C 5DK0A 1FAIH 1N0LA 5DJ8A 3BUTA 4NENB 5IB2B 3RDTD 5KN5A 3CUPA 1MFBL 3D08A 3U7AA 3CC5A 1FGVH 1CDCA 2D7NA 2DQUL 4Q6IC 1A1MA 4OV6F 2IANE 5KJRL 4R7DA 2FNBA 3L9RB 2DLEA 2N0MA 4KQ3L 4B9YA 2V8MA 3LXBA 3MBWB 4AMWA 4LNVA 1OAZH 4K8RC 4PGEA 3LX9A 4K8RL 4NLAA 4PN6A 3BX7C 1EAPA 2C1OA 1WVZA 4PW9A 2WSDA 4UILL 4WW2B 5DYOB 5IEHA 3ULVL 1DZ0A 2VL5B 1LTXA 2YGPA 2RR3A 1MNUH 4PRBB 5H4YA 4AQ1C 5KAQG 5L2JA 4M56A 3E2HC 3WD5H 1WQVT 5B39A 1F56A 2CO6B 1P53A 4UZGA 2UZXA 1HHGA 4KKNA 3RI5K 4NAMA 1ML0A 5E0FA 5I6PA 4IKIA 1OCZB 2XRAL 4OLZH 1N26A 5KSVA 4YHNA 1CD9B 4K3DL 4EDWL 4XNYL 3CFDB 5AZEL 5BV7C 1CGSL 2A6IB 4X5WA 3IAQA 3GLEA 2Q6WB 1FJ1A 3QORD 3MYJB 2X53A 4X6DB 4I4WB 2CIIA 4DN4H 5C6PB 1UZ6F 2CCWA 3QPQC 4AZ8B 4MA1B 3BQUA 3AB0B 3ZN6A 4U1HB 1CD1A 5E8PA 2CPCA 1E3FA 2DYPB 3VFMA 5B1JA 2K3HA 2EEXA 4J3VA 4R2GB 5L0QB 3SDAC 5IK3A 3IXTA 1M71B 3N41B 1V7ML 1OW0C 1SOSA 4E9TA 1A4KA 2QR0A 3UBXA 2AJZA 4U1SA 1IVLA 2Q8BL 4Z7QB 2EXSA 3NT0A 1MUJA 1J8RA 4GI8A 1D6VH 5I6MA 3LHPL 4LCYA 1YN6A 3HC3H 4Y4HC 1OAYL 1I1YA 5AOKA 4PJ7F 4GP8B 1HWGB 3KPNA 4X7DC 3FBKA 4X99B 4ZDHB 3SQBA 1CXHA 4KKBC 3RKDC 1C8PA 4G42A 5K59F 3T6XA 2ZSWB 3FYEB 1CXEA 1QEXA 2N0KA 4J12A 3NTCH 3NCEB 3NCJH 4Z7UE 5LCVA 1AD0B 3G5VB 1RLWA 4NO0D 3I3EA 3LRSA 4OZFA 4QRRE 2C1PB 4N2LA 2F54E 5TK4A 5CUSL 3LNEA 4BFEA 3O6MH 2V9UA 5DS8B 4MQSB 1KJMA 1YY8B 4GQ9H 4Z8FL 4L5FH 1JXFA 5F6IB 5FCUL 4YHMH 2Y5QA 1GGBH 1FHNA 3MV01 5I9QC 5INCA 2FO4A 4H40A 1XF3B 1MLBA 2DM7A 2MOGA 3L3HA 4E9YA 1EAQA 4L48A 5D7JC 2FJSA 3QC6X 4Q97A 4N8VA 4N8PA 3NGBC 5F7WC 5K1VA 1GVIA 3KLSA 2EH8H 3BSZA 4JFDD 2E9WA 3ZKXB 5HPOA 3ZMRA 2AQQA 1YMHA 2Z64C 4GRWE 1ZJBA 4G5AA 2CLZA 3D3VA 1SXSA 1I8IB 1B0GB 5AVWB 2H3NA 1IVTA 4KX7A 3BIBX 2ZTBA 2ZXQA 3DV6A 5D1QB 2J8UE 4RNRA 5T3XE 2D2CC 5K9QG 3QJFB 4OZFG 4G9FA 4OD1H 2CIKA 1PG7H 1BOGA 1U58B 1JUFA 1OARL 5KVFH 4KFZC 1CLVA 5D7LB 2Q7AA 2K1MA 2J20A 3H4FA 1N3NA 5IFHH 4P4KC 2W38A 1I1FA 3A0OA 4XVTH 1N7ML 4DKDC 2M8XA 3WUWG 1IEAB 1ID5I 1KV7A 2BSDA 4LVHC 3MLPA 1JHTB 4F8OA 5F9AC 1QO3B 4LBEA 4WAFA 5FYKH 3CHSA 2ZICA 1DUYB 4QRPE 1MSPA 3B7TA 3DC0A 1SJMA 4MJ4A 4IIZA 3F7VA 4WTXA 1FFPA 1G9NC 4HS6A 5F44A 4XCYB 4YZWA 3VI4B 2DV6A 3MUY1 1KTBA 3L3DA 3QHZL 5CIPH 3SCMD 2IMNA 2Y22A 4OCWL 2VDOB 4KVNH 5AFAA 1PAZA 3PF2A 4WWKD 4Z7UA 3VSVA 5TQ0L 4JRYA 2XWEA 3RX7A 1DUZB 1YEFL 5HHQB 4H8WC 1I1RA 2AV1A 4NS0A 3ZTCC 4TQ8A 4R3SA 3Q3GB 1VJSA 2AXGB 4O02H 4QRQA 5BRZA 4JO3H 2UY6B 5TE4H 5KSAA 4MKTA 5F7YC 3KPSB 1A7RL 1AC6A 3SBQA 3OZ9H 2UWEE 4AIZB 2DJUA 1WP6A 2ZF8A 3FT2A 2WWMC 1QQDB 2WW8A 8FABB 4JFED 1WZLA 3PG2A 3OLEA 2ZONA 3PREA 3NA4A 1TLKA 1LM8V 2AJSH 3SO3B 1X5MA 2VMCA 3PAZA 5LAXA 3WLWC 5IFJA 1RK7A 4ODWA 5ADOL 2CALA 1ZHLB 2DMHA 2EKSA 1GYVA 3RILA 1RUAH 1GGCH 4ZFFB 3JXAA 5I1DB 3SE3A 4P2RD 3T6QC 1OLZA 4APQB 3LEXA 1KLFA 2QV4A 2NW2A 3BRGC 3MV8E 1FORL 1LO3H 2VOTA 3BISA 4S2SA 4Z7WB 3EFDL 3RVWC 2VN6A 2FQEA 4GSUA 2E6JA 5LGHL 4I7ZC 4BK8A 3O81A 3OXSA 1QVOB 1TKWB 2IFGA 5DMYA 1U93B 1ZV2A 1JZHA 3OKNB 1CVSC 3K8KA 4M1CD 4U49A 1FIEA 1D6EB 2R27A 2DH2A 1NCDL 1DVFD 1NCUA 1T4KB 2IOIA 4UTCA 4JFZH 5LN8A 1ZLUH 2BVYA 3TJEH 4DT2A 5FFGA 5CHNA 4GUPA 3VI3B 1ACYL 3B3IA 1FAIL 4TULL 2VYRE 3HBQA 1NOAA 1U8QA 3UJIL 4C47A 4WEBL 1IEBA 1XDTT 3STLA 5F1IA 4GH7B 3T77A 2GTWA 2Z92A 1I1AC 3SYOA 4NQEB 1UXLA 1DO5A 1HT6A 3EDJA 3MJGX 4BYHA 1H6FA 4ODUA 2A0LC 3IYLW 3MGAA 5D1ZD 2OMBA 5IW6A 4PRPE 2F68X 1ZHKA 1T04B 2V7HA 2B9BA 3GZQA 3U36B 2O5YL 3D50A 1GOGA 4GEIA 1J86A 5ADPH 1X6LA 1IKFH 5T1LB 4ABWA 1E40A 1U41A 3J7HA 4HBCL 4NKOB 5B7FA 1O9VA 4YPGB 3UMTA 2QVKA 2XZCH 3PWUB 1KPUB 2IQ9L 4OF3A 5D1XA 5F9OL 4OR1A 3ZYZA 1J1OH 4YDIL 2BSRA 1NMCB 1HSAA 3HC4L 4C83B 5HGGS 1RURH 4G8FB 5DJ0A 3U1PA 4Y9FA 3EH2A 1X5XA 4P57B 4DP5X 4EOWH 4J3XA 2D3VA 4CVZA 4DOHB 4HG4J 3LHAA 4HPOH 5JIMA 1I1CA 4N8VG 3N6YA 1F0LA 4AL8H 1EZVY 1LGVA 2CIKB 3PWNB 1ZHNA 2FLMA 5E2JA 3QAZC 4Z7OF 2B1HH 1HQ4A 4EBQH 2P5ED 3MMEB 2QQNL 4UNVA 5SX5H 3TBCA 1OPGL 3L5JA 1GKOA 3HW7A 1W91A 3PXLA 3DXAA 3QAZB 4HCRL 1DFBH 4GO8A 1M57B 4KO5A 5BXFB 1KCRL 4NZUH 4P23A 4OJCA 4CMHC 3HG2A 1QUPA 5HGBB 3GIVA 1QMUA 1J1PL 5HYSB 4XTRC 1JE6A 4OCRL 3X13B 1SXAA 4LGRB 4XMLL 4Z76A 2NY2D 3UTZA 3H7LA 4Y4FB 1T66C 1P4BH 3QEHA 3WTVA 2ORBL 1XQ4A 1F3DH 2UZYB 3O3BA 4IOSA 3CC1A 2CBMA 2IANB 5LLIC 2OTUB 4LCWB 3ULVD 3ESMA 3BZFB 2UXVA 3C87A 4KJPD 4UT7L 1IQWH 2BH0A 2ATKA 5LNDA 1OALA 4XVTL 3TZVA 5HJGA 4HUWB 4NZFA 4O5LH 1NUGA 1ZLSL 2C5DC 5JIHA 1KJ2L 4L0PB 2EIKB 1OTTD 4POZD 3ULUD 2DQIH 5HDRA 3HZMB 4QTHA 5BQ7A 1GAFL 4NPYB 1N8ZA 3CPUA 4PFEA 3T6ZA 1CXKA 4L8BA 3FU7A 1PD1A 2HRGA 4QEGA 1MWAH 3FUFA 2XTJB 5C0CB 3CFJA 3QJVB 2BNQA 3OMAB 4MWFA 3W57A 1HILB 1WS8A 2WTRB 1VADA 1T1YB 4RISH 1CBVH 3F7PC 1O9WA 4V2BA 3DMMD 4BZYA 4NQCE 3M7FB 3FFCB 4U33A 5SWSB 3UBXB 4TSAL 4AENB 3BFQG 4QJ3B 1SUJA 1AO7A 3BUYB 4LPTA 1DJSA 5FYKL 4EVNA 4LRIA 2ZQKA 5GGRA 3WMQA 2F18A 2A77H 3UAJA 4X83A 1M7DA 2VWEC 3DBSA 4AJ0A 4JM2C 2OZ4A 3IMVA 4CADA 5A2JH 1VESA 4DN3H 2OYKA 1FNFA 4FHKA 3HJ0A 5E4AA 1D5BB 1HTYA