4IEFA

Complex of porphyromonas gingivalis rgpb pro- and mature domains
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
197
structure length
192
Chain Sequence
b'RNPQVRLLSAEQSMSKVQFRMDNLQFTGVQTSKGVAQVPTFTEGVNISEKGTPILPILSRSLAVSETRAMKVEVVSSKFIEKKDVLIAPSKGVISRAENPDQIPYVYGQSYNEDKFFPGEIATLSDPFILRDVRGQVVNFAPLQYNPVTKTLRIYTEIVVAVSETAEAGQNTISTFTGFEDIYKSVFMNYEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gingipain R2 Pro-Domain
publication title Porphyromonas gingivalis Virulence Factor Gingipain RgpB Shows a Unique Zymogenic Mechanism for Cysteine Peptidases.
pubmed doi rcsb
source organism Porphyromonas gingivalis
molecule tags Hydrolase
total genus 32
structure length 192
sequence length 197
chains with identical sequence C, E, G
ec nomenclature ec 3.4.22.37: Gingipain R.
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08126 Propeptide_C25 Propeptide_C25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3800 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4iefA00
4IEFA
chains in the Genus database with same CATH superfamily
4ZYKA 1CYWA 3QQ9C 1FH5H 2DMBA 3PG2A 2DWXA 4DQAA 3K91A 1WHPA 1X5FA 3GBMH 5E08L 5H4ZA 2DYRB 1DVTA 1Z9NA 2Z35B 2GABA 3MSPA 5AL0A 5SV3A 4FI8A 2XQBL 1CI3M 1WRFA 4AUYA 4G42A 2BCMA 2IAMA 4PCKA 2OMNA 4XBGA 3DA0A 4JVPA 3WTWA 4F2MB 2APXA 4H88L 4NT6B 2X6MA 1HXKA 2P5WD 3SKNB 3N0AA 3WFBL 1E27B 4ODXB 2VM9A 2L7JA 3BESR 2E6JA 4HF5H 1XF3B 2CKBL 3O3BB 4MJHA 3GM0A 4POYA 1JPSH 3KW8A 4LSVL 3KPLB 5C2BL 2JB5L 5FO7A 5GZOA 4BGDA 2W0KA 3QEQD 2P5PA 4LLUB 5FWQA 2K6ZA 4JO2H 2VJ8A 4JY6A 3MKKA 2UXTA 3SE9L 3MROB 3WXVL 3D0LB 3ARUA 5B4MC 1BX2A 5LO7A 3P4OA 4W68A 3VXPA 4UB0L 3VRLE 3NZSA 1CD1B 1E8WA 1ROWA 1R3IL 1LEKB 2YD8A 4Z7UF 3V9CA 3IPBA 4NUGL 1KC5L 2CJ3A 1JPST 2IMNA 3QWQB 2NNAB 3N85L 1QBBA 2DIEA 1UZ6F 3LYRA 1O7SA 3FRUA 2WNWA 2BFGA 4EUPH 4D8PA 4Z3FA 3RJQB 3OHMB 1QPPA 5E2WL 2VLRD 1BPLB 1GOHA 3ZJAA 3DURA 4HS3A 4C56E 1CLOH 4QTHA 3L3KB 4RAUA 2VLJB 4M02A 5IMLB 4W9ZA 5FO9A 2NTFB 1WWWX 2O6PA 1XMWA 3L2LA 5HI5D 2JF1A 1LDPL 3ZL2A 3MA9L 4J3BA 3G5ZA 1R5WB 3CDGA 3AS1A 5C08D 3F6LA 3MREA 4RSVA 2JSFA 3DV6B 3QDAA 3KNBA 5ETUA 3G6AA 2BY0A 2YGVA 2AW2A 4OZFB 2DIJA 4JFOA 3O4LA 4NC2B 2BSTB 3PAZA 3V5DA 5JORB 3LRLA 4J39A 4LLYA 1TQVA 1U8KA 3C5JA 3OX8A 4TTGA 2Q7AA 2IJ0C 5M95B 1ODAA 3APNA 4KDVA 1CD8A 1LE5B 3ARQA 5JIMA 1VPOH 3FOMB 3WTXA 5GRXG 4XMZA 4A37A 4FQLL 2X2HA 3D5OF 1ZT1A 3ILDA 2H1XA 4XI5C 4MS8C 3C2AH 2J88H 4OGAC 5KVEH 4KZDL 4TQPA 4MASA 4OIIH 4XNXH 2J4WL 3K6NA 1QSFA 4RGND 3UYOD 1PEWA 3IAGC 2NXZB 4JANB 3WEBA 1X7QA 4WUKH 5J1AA 5IW1A 4OCXH 5ANHA 4EXPX 5EZOL 1TEFA 5EU3B 3K1DA 2YKLL 5CWSB 2FWOA 1NWPA 2J44A 5EBLB 4PLNC 1UM5L 2VMDA 2HUEA 5GS0L 1WFNA 4WI4A 3IKCA 3NFSH 3DTXA 2VC2L 2BZCA 3QK0A 4XP4H 2Q2LA 2FZ3B 1XEDA 1XF4A 4HFUH 3MRIA 3MLPA 3GSNB 1U2HA 4BUHA 1XCTB 4CKQA 3FQNA 1L0QA 4L2LA 4U1HB 1IM3D 1LK3L 2Y24A 1FYTA 1GC1C 4C59B 1KPUB 4RLDA 2OMXB 2MPAL 4A2MA 4XWGL 2GITA 5C09D 4PP1C 3POHA 1TU2A 4W1TA 2FYYA 1OT4A 3ZRCC 3P9LB 4LDOB 3PWVA 1C5DB 4FQ1L 3SHSA 3GS0A 3O2DA 3R7QA 2QKSA 3AG1B 4PRHD 4ZO6A 4HHWA 3VDCA 2LU4A 2JCCF 3C5ZB 2L7UA 4N2HA 4PGBB 3TZVA 4OI8A 3VG9B 2YPKA 2EYTB 3MRGB 3ML8A 3U1QA 3NA4A 4HFWA 4GBXC 4A63A 1BAGA 3N41B 4M1CD 4Q2ZB 3MV7B 5HGHA 2GCYB 4UNTA 1A6UL 1R17A 4X6CB 1CC3A 1NLBL 3GBLA 1MIML 3DI2B 1A3ZA 2FJFA 3TNMB 1UVQA 3U82B 5IEHB 2Y36L 3B9AA 4E9YA 3GHBH 4E2OA 1OQXA 4DOHE 2EDNA 4B95C 1VCBC 3UP1A 2R23A 3TO4B 4JFQB 5AW7B 4F20A 1QVOB 2RACA 5HXMA 1BEXA 1MSPA 5DJ8B 3QCTH 1UB5A 3B56A 1MY5A 5EUKA 3DIDA 1YSOA 3TT1H 4AL8C 3NCJL 3FFCA 4I0KA 1UWGL 3JWDC 1BYNA 1J1PH 2WUBH 2FL5A 3U6RA 3ULUH 1E6OH 2K9UA 3C8KA 1WWAX 4PBDA 5FK9A 5CCJA 4RDBA 4HGKC 2QGDA 3D39B 4FEMA 3GSUA 1N5AA 3CFEA 4QYOB 4AXWA 1EAOA 3L3GA 2ZUQC 3CXDH 2D0FA 6TAAA 1NGZA 4EN3A 1T20B 2V5RA 4BFJA 1A7RL 5BCAA 1PG7H 4KXAA 1A7BA 3CXHK 2X70B 3I84A 5LHDA 1CFTA 3WO4C 3WUWG 1IAKB 5INCB 3D85A 1HI6A 2P7TA 4G5ZL 5AOLA 5L2KE 4YAQB 4MD4B 3HHSB 2B3RA 3HBGA 4U6YB 5KYUB 1NKRA 3WGVB 3QORD 3P2TA 1NC4B 3BDYL 1WAEA 4XO3A 2N59A 3ZE2E 2G2RB 4ZFFA 1R3HA 2M83A 3RNQA 5FPIA 1RZ7L 4X80H 4ONOA 2H0FA 4FTVA 4ZNCD 4LL1A 1TJIH 3U4KA 5DD5H 4JO4L 1JPTH 2AAVA 3UJTL 2OK0H 1Q90A 2BIOA 4PJ9B 4ZSOB 1JWMA 2I69A 5DEJA 1YEHL 2XNAB 4FCAA 3ZHLA 1FORL 4G80A 2ROXA 3B1TA 4NP4H 5E2TH 3HN8A 1E43A 2QTVA 2HTLC 1VLXA 3GSXA 3AG3B 5KS9E 3U9UB 1KTKE 3KPSD 2J12B 1BAWA 2YA2A 5DQDL 2CGYA 4L8SC 4UQEA 1V54B 4K07A 4KJPD 5I1EH 3MV9B 1CS6A 1TQUA 4JKKA 1VEMA 3B5TA 2CLRB 4P3DA 5CP7A 2EDEA 2YPVL 4PJHF 4KH9A 3MYJB 1HCFX 3US0A 5JZ7C 4PJGE 1HXYB 1MCOH 3HZYA 3NK4A 3G04B 4N8UA 1PTZA 1MCFA 2EC9T 2PYED 3OKYA 2OMZA 3QNYB 4I48B 4K7PY 3S8FB 2B14A 2PW2B 3GC3A 2EDDA 4Z7VA 5EIIB 2R69A 1RPQA 2P8LA 1G7QA 4WW2F 4V1DB 1MF2H 4HCFA 5A7BA 2DI7A 5EC2B 3GSWA 1PSKL 3HZMA 3DV4A 4J3OD 4G8GB 4PJBB 3RA7L 5ICYB 5GGVL 4KKRA 3MRHB 2YLHA 4MDJB 1I7RB 4O58L 4KHXH 1BM3H 3ZMNA 1NCTA 4PJ5B 3RWCA 3GTTA 3FO2A 3GF8A 3HZKA 4BFBD 4EVNB 4XE5B 3FNKA 1FDLL 3LD8C 2EKSA 2FH8A 1L5GA 4P5TB 3DETC 2A6DB 2PNDA 2R7EB 4CN4A 4GAYA 4XB3A 4FE9A 4IBTA 4N0UA 4MAZA 4CADB 3ZVVA 2V6HA 1KBVA 1MW0A 3DK0A 4A7SA 1GS8A 4FTDA 4KRPB 4L9LB 5E9DB 3VM5A 5F7HA 4PRPE 2QKIA 4NBZB 2NY0C 1F42A 5KAQF 3DX8B 1S3KL 3EJPA 1EZLA 2NY1C 1O6TA 7FABH 1DQMH 5FYJE 2PR4L 4NQXB 3SIKA 1AQHA 3P2DA 4PJIA 4WJKB 5BVPL 4OV5A 3RWDB 4P23A 2EACA 3LN5B 1J0JA 3PQYD 3IXAA 1P69B 2RA1A 2BNQA 1FH5L 2FJGB 3TL5A 4RESB 4Y5YA 5GRVK 3G6DH 1HEZB 2X44D 4OQ1A 5J5EA 2E9JA 2O1AA 2WBXA 5F8RC 2WQRA 4QRRE 3FU6A 4N8VG 3RVWD 4X9BA 1A7OH 4JPQA 4XAWL 1OP5H 1AR1D 3AQYA 4X5LA 4L3EB 2WXLA 2C9XA 1A6PA 4ZOEA 3O3AA 4BZ1A 3OAZH 5D1XB 1Q1PA 3OKMB 1A3RL 4X5XA 4JMNA 2F1EA 1MAMH 4KO7A 1N8ZA 3KH3A 5I8OH 2VC2B 4DEPC 3M1BB 4NO3B 2QBWA 4Y1AD 5EZJB 3HZVA 3CQPA 4WI9A 1CTOA 5C0JA 4G6AC 1EMTH 3RFZB 1G1KA 4WU7B 1A4AA 1I1RA 3MJ9H 1AHMA 4PS4H 2PLTA 5G5DB 25C8L 1SDDA 3D34A 3QNFA 5SWZA 2BW4A 1G0XA 3TNNB 4H26B 1XIWA 1P0SE 2I25N 4JFUA 4R0LA 3ARFB 1ACXA 5T3ZH 3FS9A 4MA7H 2OW6A 4C8XA 4I77L 1PPIA 3NJKA 2R15A 5L6YL 4I13B 5L2JA 5ADPH 3P40A 1RZFH 3POCA 4S0SD 5LCVA 3N6YA 1D6VL 2O6CA 3Q6GH 4NUMA 3HS0C 2VXVH 4KJWD 4DW2H 3EJSA 5I2IB 1SOSA 1N0LA 2Q7YB 1WUZA 4S1DC 5EU5A 3HC3H 5DD0L 5IVOA 4PJDF 2CDFA 1DE4B 4JLRA 3LDBB 5JHLH 5LLIC 1COBA 1OLZA 5FM5M 3QAZB 4FA6A 2KLTA 4NZUH 1GOGA 3MACL 3TASA 3VFSA 1W80A 5CSZA 4RCAA 2W91A 3MJ6A 4ES8A 5F7UA 2NY4B 1QR4A 4GRMB 4R7NA 4B0MM 5HDBF 3CLFL 4O51B 3HPLA 4ZAKA 4R7DB 2RTTA 1IC7H 3MBED 3U4AA 1ZS8A 2FDBP 1F86A 1WEJL 5IB3A 4FULA 4EZKA 1OF2B 4LL4A 2G9KA 1ADWA 1KXTB 3QE5A 4ETQA 3KDPB 3RAJH 2AV1B 2I26N 4KZEL 4HCIA 3FTGA 3ZKMD 4AY0A 2ATPA 1J1OL 1QHQA 3VFOB 1A14L 3DUUB 2J71A 4U1KA 3SDAB 2ZKHL 4ELME 2PP8A 3UERA 4U1IB 4LSUL 4JRYD 3MUY1 1KN2H 4X5PA 1EHLL 1BVKB 1NDMB 1TDQA 1TMQA 3L1OL 4NUJB 4OZHB 43C9B 5LCVH 4XNXL 4A1RA 4HU8A 3EO9L 4ZQTA 4D9LL 2EDLA 1X5AA 3IGAB 3VU2A 3BPOB 2C1PA 1AO7A 4ANWA 1E2WA 3I9GH 3FH8A 4I85A 2ITCA 2RALA 2YUVA 4BKLB 1PY9A 1DBKH 2WHVA 4XN4A 5BRZB 5F1IA 3SBWA 3LQMA 3WIHH 3WOVA 4YEFA 5L4MA 2G3XA 3P02A 4WSGA 4XNYL 1CE6A 3WXWL 3HUJA 2XFXB 1ZHBB 1KIUB 1AGCB 2CDGA 4GP8B 5FFGA 4H8VA 4NO5A 5E1QA 2XUWA 1MCEA 3UAAA 2ZJSH 4DCQB 3LMJH 5ID0B 3EYSH 3VA2C 4YHYB 1AMYA 3O41A 2YUWA 3OJDA 2BDNL 3ARBD 3O3DB 1XR9B 4NHUA 3NESA 5GSVB 1O9ZA 4B50A 3II3A 5I66B 5F0MB 4HS6A 3RX5A 4UV4L 3TGXA 5C0BA 5DA0B 2OMVB 4EBQL 3TJHD 4E9QA 3ATEA 1E9QA 5HYSG 1WCQA 2HKFL 2OR8A 4JAMB 1QSEE 3E6HB 4FDWA 4NBYB 1BECA 4QRAA 1FUNA 2OMWA 2GT9A 5E8PB 2QPFA 5DLML 2EILB 1HH9B 5IUSA 4E0RB 1W8OA 4ZX6A 3DIFB 3L9YA 4I5BB 5C0AD 2QQKL 4ABUA 4ZG1A 5EU6D 1AKJA 3SGEI 3S37L 2JCCB 1PBYA 4Z0BH 3MN8A 4R7VA 2BNRD 4WDIB 1KTJA 1V7ML 1D7DA 4OZGF 4C4UA 5E4AA 3W3BA 3II1A 5HDRA 4PI0A 4EE2A 3EYVA 5LXVA 5MEPB 3LV3B 3QNXB 4LU5L 4D0BA 4OD1H 4WU5A 4Z78A 3C08H 2ITEA 1F4AA 4KX9A 3L3OA 4ERSH 1OGAD 3VCLA 1G9NC 4NWTL 4KRLB 2A6KA 5EBMB 1UXMA 2BH0A 4JCMA 1Z3RA 3F64A 2R8SL 4QXUL 3L9RB 1NFDA 3L4YA 1J8HD 3MODL 1RJZA 1ZTMA 1CF1A 4W9HC 2WB7A 5MENA 2AQTA 2WSPA 1FO0H 1L9MA 3QC6X 4HCRL 1CE1H 5EUOA 3QDJB 1M9SA 1E6OL 3GPSA 3QUXB 4QF1A 3NG5A 2J6WA 3VMOA 4W70A 2V7NB 2WVVB 5FKAA 2IPTH 2OX5A 3IJYB 2UWEB 3CFIC 1CURA 1JF1A 4Y7MA 3ZK0A 2WQWA 2AF2A 4ZDHB 3ZGHA 5GRYA 2X1XR 3QR1A 4ONGH 2YS4A 2VZ3A 1F2QA 4JO1H 2VSMB 7PCYA 1XF1A 2AV7B 2CDEA 2XWBB 4FMVA 4OLXL 2IXQB 5AVTB 5E8EA 1GA2A 4WI8A 1LYQA 2VAJA 5D2LA 1OV8A 3AROA 1YUHB 3FCSB 4HIJA 4XMTA 3K71B 4BA0A 4RRPG 2A2QT 4G7QB 5DVLA 5IM7A 3OKDA 1JGIA 3HLAB 2Q10A 3TJEH 1WT5A 2WANA 2OULB 2OS7A 4FHJA 1FHNA 2FSDA 1Y6KR 4MD0A 2ZAHA 3NCMA 1MFDL 1S9WA 3QDME 1RZJH 3VFTA 3U7YL 2RCSH 3NACH 4J5VA 3C6LB 4EPSA 1TFPA 4G6FD 1CICA 5FYLL 1JZIA 4NRXA 2C9SA 3DMMC 2ICWJ 4HKJB 1M53A 1OAUL 3AAZA 3PABA 4WSJA 3TCLA 1WYJA 3NSJA 3KEHA 3UPRB 4V11A 4OU3A 5T1JA 5A2BA 2HG5B 3PAUA 1AOZA 4JPWL 4XPFH 1EHAA 4OCSL 3V6FA 3CH1A 4I18A 1YCSA 3WNMA 2XXMB 1N7ML 3VWKD 1LQBC 1KIQA 4FI7A 5DLLA 4QHUA 3CXHJ 2BIMA 3KBFA 3LEXB 4X8JB 2WWMD 5CU5A 3C5ZC 2BVUA 2ICWI 4WKXA 3VG9C 4DZBB 3N1QC 3Q1SL 4PJ7E 4UV7H 1N4XL 4RZCA 3NSFA 5EC1A 4JN1L 1KTDB 5GGRB 4MXWH 3FT4B 4FFWC 4UINL 5EO1B 5I0XA 4YFEA 1YNTF 2A4CA 4NRYA 3KL0A 3RZCA 1YY8B 4CGTA 1QP1A 5JOFA 4HEME 1BVLA 1UZ8B 5IB5B 5IQLA 1A9BA 3L3IA 3NH7H 2O30A 3QZNA 3OKOA 4NBXB 4YBLB 3QUYD 1NFIA 2H0JA 4E41B 1TEGA 5CUSL 3NYKA 1OT1A 5JNYB 5DCCA 1E0OB 4LQFH 1CFMA 1BZ7A 2CUAA 3V5KB 3LKRB 1CQKA 4NQED 1FZOB 2PO6D 4H8UA 2K6YA 4QXGH 5I17B 4FQHA 1BBJA 2KLSA 1KGCD 3FU7A 2G60H 3LZPA 2OP4L 4H5SB 4IBUA 2YPLD 4HK0A 1CBJA 2R2EB 3I9AA 2X9XA 4YSEA 3I74A 3ML9A 4QHKJ 3MBWB 5DO2D 1BFVH 1NGWB 4RQQB 2LQRA 4LSQH 1CFSA 4IK6A 1SXNA 5FUOL 1PLGL 1TETH 2VLKA 4F5CA 5AOIA 3H9ZA 3UTTD 2GUOB 1FFPB 3U36B 2FYVA 3IN2A 3MLSL 3MV11 5AVSB 4FQXB 4LMQI 1BJ1J 4FOMA 4XP1H 2J1WA 4M9OA 2VSDA 4GSDH 3UAJC 3SE3A 1GCYA 4LHUD 1J88A 1Z3GL 5I28A 4QHKI 3EFFB 1RUAL 3MXWL 1GAFL 5H35B 5JDSB 4ZW7A 3KPQB 4RMUA 4JGMA 1H8NA 4R6UA 5FIEA 4R5XA 1XGTA 2W95A 5HHXH 1P5VB 4OD2A 5ALCH 2C3HA 4IHOB 1GR7A 3O8XD 1M1XA 3RWJB 1HE7A 4MNGB 5DR5H 1HQ4B 5GRVL 1Q0EA 1MQKH 1EFXA 2B4CL 4U1JA 3V4UH 5D1ZB 2JJSC 4PJCE 2AXGB 4NI3A 1DJIA 3R1GL 3H9YA 3PWNB 1AZNA 4FLOA 3RNKA 4ISVB 3BQUB 4C54A 2O61A 2F53B 2WCSA 4C47A 1J48A 4XH2A 1NKGA 4P9HL 1KBGH 3CDZB 1NCDH 2MQCA 3IDXL 3MLXL 4PQXA 4GG8B 3T1FA 4AJWA 3FUHA 4PGCB 4POZC 1Q0XL 2XBTA 1PLBA 2E6PA 3VXUE 4YDIL 3MXVL 4YSUA 2J1KA 4K9EL 1FA4A 4G43B 4NERA 4ZMWA 4IRJD 4QHLA 4XB7A 2F68X 4NQQA 5DJXB 4KITB 1KGIA 2AVGA 3T3ME 3VXOB 1O7DE 3ULVE 4TTDC 1RK1B 4HISA 1EV2E 2ZWSA 4UOJA 3C75A 4Y4KD 4CNIB 4Q97A 5L4FA 3US1A 4S1SL 2CWRA 2AXJA 1HL4A 4QRUB 1AKPA 3T6ZA 3QEUB 1DBBL 1NTDA 4MZ3A 5K9KA 1WC7A 4PR5A 4M3HA 3BAKA 1ZVYA 3CTTA 3EYOA 3A6OA 3K2KA 3OD3A 5F7YC 4BRJA 2YJQA 1U8CA 1YN7B 3FMGH 3D12B 1U58A 1QBAA 1MDTA 3DDFA 3QFDA 4G1MA 3ZHFA 1HINL 2VE6A 9PCYA 2ENYA 2WMPA 3MLRL 4NKMA 2XWDA 3AXIA 1KTBA 1NCJA 2JIXB 3T3PB 4G6JH 2Y72A 5G4NA 5I5IA 3RTQB 5FHAH 4L9LC 5CMAA 5AW3B 2XQYK 3VXRE 4Z7WE 2ZUVA 4M29A 4XPHH 4HD9A 3TFBA 2WXMA 3JVFC 3REWA 2HVJB 2ZP9A 3BKCH 1HX0A 4HQQL 5B1CA 1OP3K 3X12A 4Q9QH 1C12B 2CA3A 1ACZA 3T8XB 1P1ZB 3C09B 3WNNA 2FWLB 2QSVA 3QQ4B 1NBQA 4ODWA 5T3XH 2P80A 4DP9X 4AYGA 4UBDC 3HMWL 2WLJA 1GZPB 5BZXA 2E9WA 4QNPF 5F93C 2Q76A 4MD5A 3CZJA 2Z8RA 4UU9A 4DO4A 2Z1PA 4Z76B 4RNRA 4MJJA 3B9KB 3RFRA 5HPOA 2YEZB 1MPAH 1RD6A 2BY1A 5DJAB 1ZLSH 5DRZA 3GMLB 3WE1A 3PHOB 2DOCA 3QO0A 3VACA 3BUYA 1DTUA 5D1XC 2X4PB 2AS5M 5KEZA 5HD8D 5DMKB 3QXWA 1YMME 5IREA 2X6VA 1DN0B 1T1WA 3P3UA 1E4JA 1OVZA 1TKWA 4IU2B 2Z0BA 5EBGA 1JPGB 4LFHG 2YSSB 1U3HB 3BE1H 4K8RL 2VWEC 4F33A 4PLOB 2V7HB 3QJVB 4S1RL 3WJMA 1G43A 1IJ9A 1OPOA 3VYNA 2ORBL 1WP6A 3PE9A 1TLKA 3HC0A 5B7MA 4KZCA 4NKIL 1YRKA 3T2QA 4AKQA 1W8EA 1DQTA 2K9FB 3S3JA 2BCKA 1WF5A 5IJCC 2B2XH 3FOLB 1QSFD 3J2PA 2KC0A 3LPGA 1QBLL 3VXQB 1G7JB 1GGCH 4ORZC 1OAZH 4GEJA 5AZEH 2WCPA 5JDJA 1NLDL 4FA8A 1EZUA 5I6KA 2JKXA 2EE3A 4FEIA 3T0EB 3KGRA 2YOAA 1MFEL 1HWHB 2AERT 4OCYH 3RU8H 5C3LD 1YEGL 3GMMB 1E5CA 3QG7H 3IGUA 5ACMA 2B7DT 5D5MF 3HG1A 5IK3B 1H6FA 3DBXA 3ULUD 4FXLA 2Z8SA 3PWPB 3RY6A 1FQ9C 4GBXA 4ORGA 4MCYB 1FYTD 5KVDE 3O3EB 2NY4C 3V0WL 2OTWA 1FL5A 3MC0A 3BVXA 4LCIH 1I3RA 1UXLA 3LRHA 2J6EH 2YBRB 5HHNA 3DO7B 4PHZA 3LH8A 3TH3T 3FO0H 4DTGH 1JDAA 4F8TA 1XEUA 2XYCA 3NSXA 3D09A 3JYBA 4DVRH 3O9WB 1JGEA 1NGYB 4XOBA 1G7LA 2HZHA 3A5VA 1IGFH 3NIFB 3ESNA 2AJZA 3SDAC 1HHIA 4EKJA 2YFOA 3AS0A 3F58L 2NX5B 2E27H 3KBHE 2H7WA 4ONGL 5GQBA 4IGBB 1PZ5A 1WG3A 3PJLA 2W0LA 3JV4B 4YHLL 4AIZB 4F8QA 3BEWB 3TS8A 1WFOA 1YEEH 3CSGA 4NCDA 1FNSH 1ZT7A 2IEPA 4GXVH 4L8DB 5SWSE 5DEGB 3BPOC 4JHAL 5KS9A 2H32A 4F15B 4OLVH 5KSVB 1MWAH 3UCRA 5TDOA 1PW3A 1A7PL 2VKXA 1AD9A 5GJSH 3GPEA 1A6AB 1SY6A 4WY7L 3WNPA 4KY1L 4B9FA 3FSVA 4X7EC 4DP1X 5DVPA 3DNKA 3ARSA 2YO3A 3IRPX 1EERB 1ZTXL 2R0WH 1L9RA 1MJ8H 2BP0B 5LBSA 2BOCB 2YRLA 1A0QH 4R26L 1VADB 2Y7QA 4LPWA 1Z9LA 3V55A 1U42A 4RGMB 3PIQB 4CC0A 3CLEL 5DSCA 5KBKA 2VLME 5KVFH 3WTYA 4P07A 4U3SA 1BVNT 4HOWA 4D0CA 1OE3A 5DD1L 3PXJA 3FQUB 3TBBA 3U0TB 5IB4A 1IC5H 4LSRH 1HSAA 1FZJA 3VWJB 3WE6B 5DU7A 2A0LC 1TXKA 4B53A 4L8SA 2GJZB 3CVDA 5EZIH 5DDHA 4YC2B 2DM7A 2VR8A 1WAPA 3N42B 5JXEC 3MI6A 3QIBC 2DLIA 4FTVD 4TVPE 1YEFH 5L7XH 1WBZA 1BP3B 2FX7H 1IEAB 1ESOA 2TSAA 4KPHH 5J4MA 1S7UA 3KXFB 2GTZB 2IV8A 1LD9A 1OCZB 2BSEA 5DZLA 5DJ2A 2CHWA 3FUEA 4MXWL 5H2BA 3BEVB 1D9KB 2XN1A 1AQDA 1TPXC 2DQFB 3K2MC 2D4FA 4MVBD 4QIRA 2ZXAA 5GIRA 4K7PL 1KXQA 1MFAL 1EGJL 3D3VE 4JG1H 4GO8A 1WZKA 3FSAA 2EIKB 4AVJA 1YNTB 4PJAA 3BKYH 4HIIA 2EYRB 3HS9A 2EC9U 3KYNB 2EXYD 5HVWA 2VDLB 5CGMA 1G7IA 1EEYB 2YD4A 2G9HA 2IG2H 1U21A 5D8JL 1E4WL 4OKVB 3AB0B 4EXKA 1HZKA 3M46A 4KY2A 4W9GC 1QI3A 5LBSH 2ZXDA 5J6GA 4BHUI 3VMPA 1I1AB 3T0AA 8FABB 1YJDC 2WUCH 2RJMA 3UZQA 4S10A 4AMXA 3QUXC 5DURD 3WIIH 2MMXA 3LIZA 3O4OB 5C0RL 1HOCA 2P28B 3V6OE 1LMKA 1DSWA 5E1AA 1H8LA 2W60A 3L16A 1E40A 4KJQD 1PF3A 2NTSP 4QRRA 2EZ0C 3GMRB 3WS3B 3WLBB 2NUPA 2JKSA 2F74A 1UD8A 4D9QD 1RK7A 1I7ZA 1DR9A 2ENSA 3MRJB 5D7IF 4N90D 4M6ML 4WI0A 4DETA 4LSPH 5D6DA 1X5XA 2UZIH 4JFYB 1M2VA 1WISA 2O5YL 4XP1L 1UFUA 5IHUL 1A22B 1C5BH 2ZXEB 2IGFH 4OH2A 4RFOL 5HJDA 5KG9A 5LWYH 4YHIB 3WKQA 1A21A 4R96A 1GYAA 2VQUA 3W2DL 5CCKL 4M62L 1URIA 1ADQL 2GK0A 4AYEC 5ICXB 1SEQL 2KDGA 1N64L 2ICEB 1T2QH 1G7MA 3D25B 3B6SA 1CD0A 5T1DH 3TTSA 5LXGL 1KB5H 1WFTA 2WGXA 4AZ8B 3ATBA 5SX5K 4Y5XA 5FOJA 2D31A 3MOAH 5T3ZD 3C6LC 4Z7OB 5F6IB 4TVUA 3QI9C 4KRMB 4GMTL 2QQNL 2JH2A 2NYKA 4P9ML 4UTAL 4WK2B 3S5YA 3B7RL 4KHTH 4M6OL 1RZKH 1FZKB 4J4PD 2VIRA 4BH7A 4CVXB 1Z5HA 3WFDL 5JLZA 5FYJH 1NIEA 4FHBD 2PKDA 3WKMH 2PCPB 2ZOWA 3A67L 2OQJB 1HK6A 5I73B 1CO1A 4H8WL 1HKLL 1A6VL 4NZFA 4OSUL 2BNQD 4OLWL 3MJWA 3LIZH 1F2XK 4GW4B 5SX5H 4H20L 1AD0B 2WCGA 3CVIH 4RFNC 2I07A 2WLZA 3NEEA 3QIUC 3V4VA 3ZKND 2Q7NA 3M1CA 3FQYA 2WBJB 3T6WA 1RZPA 3OTTA 4OD3H 2BOBB 1JN6A 3DYOA 3H6JA 2Y1VA 3DX9B 3N0PB 4E9VA 2FO4A 2P47B 4Q0XH 2CGZA 5ISZA 4KKLD 4HBQA 5E6IB 4WEEA 3NCWA 4LDEB 1I3GL 1W0WA 4HDIB 5AWNH 2PWFA 4G9DB 2IALB 1BYOA 3RUGF 1HYRC 3BZFA 3GMPA 3RPKA 3U9PL 4JMXA 1GVIA 4PIBA 3U1SL 1QFPA 2VDQL 1ZSDA 5LGJA 4QT5B 4WK0B 2CGRH 4JPVL 3PS6A 1A4KB 3ASNB 4HMDA 4YBLC 5D1QE 2F54A 2F8XC 1PKQE 4OLEA 1CXFA 1GW6A 3QEQB 3WEXB 4O4YL 1QTYT 3LH9A 3UTZA 4CMMA 2N01B 6CGTA 2BFVL 1YYML 1X6LA 5C0FA 5IHZB 3LPWA 4AV5A 1ZXKA 3ZE0B 4PW9A 3TBWA 3CZNA 3GRWL 4JZOA 2IWKA 3SDXB 2FAUA 2ZKYA 4HPOH 1UTDA 1IVTA 3INUH 3QQNA 2EJ1A 2WAQA 4LESA 4IU3A 2HMIC 4JDEA 2IPUG 4A2FA 2VLRB 1EUUA 3T2NL 5EDSA 1VSCA 4Q89A 1KV3A 4FQXC 2ARJQ 3V4VH 1GTFA 4XTRD 2GJ6E 3QJHA 1KG0B 4MAUL 4B60A 1I8AA 1KIRB 32C2B 4YXKH 4TSAH 4K3DH 3FH5A 5DZOA 4TF4A 4TQEH 5C08B 3IS1X 4LPTA 1RJYB 2QSCL 2Z35A 1AI1H 3K6OA 2HYMA 3P0VL 4ZPTA 5FCSH 3CU1A 3UBXA 3T4AA 4FMFA 5D9SB 1VKXB 3CE1A 3HB3B 3LB6C 3NA9H 2P5EE 1MDAA 2Q2EB 1R75A 4AH2A 4F2MA 4KRNA 1CBVL 1UD5A 1VGKA 5D1ZC 2R0ZL 1XGPB 2JV6A 3GSVB 4Q52A 2BINA 3OWRA 5CLYA 2AQ1A 1CDYA 4BWWA 4Y1SA 4AVKA 4HOXA 4UZSA 2CO6B 1X5MA 4JK0D 4BQ9A 4RBPK 3EYFB 4U6VL 5GISL 4BKSC 1T5XA 4J2XA 4HU2A 1LO3H 4JQIA 2F7RA 4RGNB 3SPVB 2WQUA 2Y06L 1LK2A 1AO7D 4IKJA 3GJFK 5E99L 4AJ0A 5LQBH 4Z0XA 4NS0A 5C1MB 4Z3EA 5JW4R 1ANUA 1I9JH 3B2PA 3MROA 4Y7OC 4AUUA 2X3CA 4LOFA 3DVNB 2GC7C 4FGMA 1WZ1L 1QUNB 3P1VA 1JZHA 3I50H 4KI5F 4J7RA 1TZ8A 2NY5L 1YEDB 3L4XA 5EIQA 2DKSA 3CHXA 3KAAA 1DVZA 3RKDD 1IGML 2VDNB 1I1YB 1YEJH 3FN0L 2ROYA 5D5MB 5CLXA 5I76B 1GY2A 1IM3B 1A5FH 3GXPA 5I16B 1NMAL 1U8OA 5AW2B 4MBOA 4FQ2H 5DVOA 5C09B 4PCYA 3FFDA 4PRBB 4CJ1A 3FT3A 3KYKL 3L3KA 4LCIL 2VLJA 2ZCHH 1AIFA 5EPMA 5LB1A 3T4YB 2Y3NA 1FN4B 4HA1A 3RTQC 4AM0B 1UEMA 4DTGL 5F7KC 5HHMD 2ENJA 1LHZA 1KN4L 4JPIA 4MX7A 2VZUA 2JJVA 3C09C 2ZAIA 4GKSB 4JO3H 4HUVB 3DXAB 4L29A 5B7FA 4AENB 5JORA 3QHFL 4ZFZB 3BZDA 4JQIH 1LO2H 3PNWB 4FXGB 4X99B 5G55A 3EAKA 3EGXA 1ZA3A 3DGCR 4UIMB 2V9RA 3B9KC 4G8FB 4RMVA 5KJRH 3FOMA 1FPTL 1NC2D 3F7PC 1AZZC 1T7YA 3Q8BA 4GXVL 4KVCL 4F37K 2QFRA 3IM1A 1XL6A 4HV8A 4JZJB 5DK0B 1J18A 3WAKA 1V3LA 2HJLA 2B1OA 2YGOA 4KAQH 3TBYA 2OYKA 5H94A 5MEND 1HESA 4P2QD 5C0CE 2EDQA 1IM9B 2ALAA 5F88B 3JVGC 4G9FD 4JANA 2RD0A 5E70A 3BKMH 1G6RH 2V5SA 2VMJA 1BBDH 2X4OB 1M3JA 2CNYA 5J1SC 3PDOB 2DQJL 4BXVA 1F90H 1U3HC 4N2KA 1CTMA 1JMXA 1CZ8L 3MJ8A 4NN6B 3SEPA 2WNXA 4I2XE 2R0KH 4B96A 4OLZH 1MVUA 3QS2A 2ZOKB 1T89A 3HMXH 3L95B 4KWUA 4PJFE 3ZO0A 3RRQA 1EZVY 2FZ3A 4NO0A 5IFJA 4AIXA 3UGXA 1FG9C 4OUUB 1HCVA 2IWFA 7PAZA 3DMMA 3GSNA 3BCFA 3SKMB 3VXSE 4P3WA 2QZQA 2XKNB 1MI5D 3HHMA 5EH1A 5B1KA 3QORB 4FF9A 3Q6FA 4QYAA 3FQ1A 4M4RB 3VI3B 2EDWA 1KPUA 1T4KB 2OMXA 2X2UA 4YX2L 3ZTJH 1CIDA 2OMUA 4CN1A 4YXHH 1Q9KA 4K55A 3DI3B 5FO8B 4D3CL 2FX7L 3T0EC 5I1KH 4DZ8B 1SM3L 3N04A 4KV5E 5DZJA 1UKSA 1DQDH 3GMQB 3OB0K 1MELA 4HAFA 1DVFD 4N8VB 4XMKH 1FRGL 4QCIA 3IFOB 3QJQB 3FC8A 3LS4L 4PGBA 1EQWA 3ZHKA 1NCAL 2QVFB 2VDQB 4OVVA 4JL1A 1A3QA 4I3RL 1E9PA 3MV7A 5FB8B 4UT6A 1F4XH 5CN1A 1H9VA 4UQDA 3CHQA 3O45A 4X6CA 1U91B 4N0YH 3KZ8A 4OM1L 1YVLA 3SYAA 4MQTB 3FH7A 3N9GL 4YSQA 2UY6B 5KBDA 5D2NB 5E0QA 2J43A 4NENA 4ZUWB 1NPNA 5FFOA 1TITA 4JFQA 5T1LA 4OCWL 3SOBL 3O9WC 2ENQA 4M5YH 1ET7A 2PYEB 5DJ8A 4ZMXA 1JVOA 1YY9C 5KW9L 3MA7A 5CJOH 1T7VA 1IGCH 5J13B 4HJSA 2DM2A 4TRPL 1IQWL 2CO4A 3EJYD 5E8OA 4JFWA 4E9WA 3LEVL 4F1ZA 3L08A 3B8YA 15C8L 3K5SA 4JFVA 5I6XB 2VL5B 1A6WL 2ZKXA 3VI4E 3VYPA 5MERB 4QYOA 5IMKA 1XDTT 4UI2A 4GUCA 5DMGD 2DIAA 2X7LB 1EHNA 3Q2CA 4F15C 2AJ3B 3QGVA 4HC1A 3TT3L 4J8QA 2X70A 5FA4B 1UASA 3BXNB 3VXME 3VGFA 2HVBA 2KPWA 3QW9A 5INCA 1QLFB 4N85A 2DI8A 2K7PA 5KYUA 4YAQA 4U6HA 5EA0L 1SLWA 4M1DL 5HI4C 2XPZA 4AQ1B 4EJ1C 6FABL 1IKFH 1KJMA 4HCGA 3ELQA 4HOZA 1JNNL 3GMOB 3UAJA 1Q9WB 1WIUA 2OSLA 4UTBH 2BSSA 5D7LA 4EOWL 1E30A 1SJVA 5HDWA 2XHNA 2CALA 5CZKA 1CDBA 1FNFA 1J5OL 5KSBA 3JBG7 1MFNA 4RGMC 2LU3A 1K5WA 4NHCL 5E4IA 5FYKE 3TONA 5AB1A 2JB6B 1OAYL 3O11B 3ARVA 4L37B 3WTVA 4NB7A 2JXMA 1WSST 5KN5A 2WXGA 1C16B 1KWKA 2GQHA 4KO5A 2C7UB 3W81A 3VWJC 3U9UA 3PFQA 4JG0L 4IKKA 5SX4H 3UADA 1AZUA 4MLSA 3KGTA 1YQ2A 3BGMB 1FFQA 1U2YA 1KY6A 3C9NB 3QFJA 4YNYB 4Z3HA 4YE4L 5DGQA 4N6RB 4YC2C 2MCAA 1LNUB 2CLRA 2WPGA 3SOTA 3UC0L 1NFKA 2XFGB 1F56A 1S9XB 5HJ3B 1AR1B 4A67A 1RVFL 3FYIB 3FONA 3G04A 3CLWA 5HSFA 1LXMA 1WWBX 1D9KC 4BFRA 2NUTB 4ZK8A 4JEGB 3LRMA 1ODUA 4Y1AB 4Y5VA 2A74C 2XN2A 1BD2E 1S5IH 4GO9A 4NYLB 2IF7A 2PW2A 1QFUL 2XYBA 3RUGB 1NBYB 1FV1B 1EFXD 4U6XB 3GIZH 2RFXB 3RWIA 3A6BL 3BDBA 5IBLD 1GZQB 4FNQA 5EC2A 5BNXD 4LLVA 3MRBB 3R0NA 3F12B 2BO0A 4G8GA 1A64A 1LP9B 1U6AL 2Z7UA 3MRHA 5T3XD 2KZWA 3RJDA 3KWWA 1I7RA 5EOCH 1I1AC 1LEIB 4M7JH 4C56D 1UACL 2R29A 1BQLL 4HSQA 4H8QA 2VXSH 3CSPA 4TUUA 3H9SB 1GPOH 3O4OC 4O02L 4EVNA 3RVXD 1SHMA 1NCCL 1VFAB 2PP7A 1GGBL 5DXWA 4YDKH 5HYSB 4JM2D 3Q9PA 3V0JA 2A6DA 4U1SB 3S6CA 3INUL 4IMLA 4G70B 3ZL4H 2WBKA 2YN5A 2A1WL 2ZUXA 2OAAA 1G0YR 2Q8BL 2H4EA 5AZ2L 3BO8B 3ULVH 4L9LA 2Y5TA 4KK5C 4AYFB 4R90L 5C9JB 3KJ4C 3ARED 1IL1B 2F15A 5J6HA 4P2AA 4N22A 1OGTA 2XG5B 2KKQA 4LSTL 1F4WL 3HIZA 5EZIL 2QL1A 1KGXA 3T65A 1IEBA 1YO4A 3VFUA 4YXKL 4APXA 4NX0A 1S7VB 1PNDA 3RWDA 4IIZA 4ZTOH 4X8GA 3LN5A 1G9ML 4DPBX 2EH8H 1M7IB 3LKOB 4XNBA 1OTTD 1O75A 1UWEL 4HUNB 4ETYA 2IPUK 4W6YB 1VDGA 1T04B 3FHEA 5FAAA 5IJBC 3MMEB 5HI3D 1E7VA 3HG2A 3M1OA 5F6IC 4R3SB 4JZNB 5F71A 1AFVH 3MV8E 4FHKA 3LZLA 4TPRL 4L3EA 5LN8A 1RCYA 4OJFL 4ZW6A 4F37F 4ONHB 3DSFH 1TZHB 5C07E 3VAEA 4BFOA 2CRMA 4AYMC 2DD8L 1CGSH 3G08B 1A6TA 5L4JA 1OLLA 3G7TA 3T5WA 2YD6A 1DO6A 2H41A 5I73C 1N0XH 4JRYB 5IMOB 1RFDH 3GD1C 4PJEE 1DSFL 3QEHA 3OPZL 2Y7OA 3IE4A 1X7TA 4WU7A 5TFSH 4KXBA 1KELL 3P11H 1Q1JH 1MLBB 1E4KC 2CJUH 3TNNA 4LCCB 2ITDB 3SGKC 2B20A 1OAXL 4EQ3A 1G9HA 1VESA 5CO1A 4FLQA 4PP2B 2FD6L 3S36H 3VDBA 1E2VA 4JVUA 2BP5M 3IFNL 3KVPA 4OQTL 2K3TA 3TA3D 4BFNA 2IO5A 4XX1G 2OBGA 3JWNC 3X11B 2R1XA 2BIIA 3FT2A 5GGQH 5A3ID 1O7VA 2VLLA 3QUZD 4L3FA 1K85A 2I60H 1NEZB 4Z8FL 1P1VA 1YEJL 2EDHA 3NJJA 3IYLW 4I0CC 1YPZE 3ARBB 4LF3B 3QPQD 4RAVA 1ETZB 2KZ1B 3BHBA 1JV2A 2ZXCA 4G1EB 4S1QL 3SJVE 3MNWB 4QKTA 1QR1B 2P9RA 4AITA 1CXEA 1SJHA 3LPFA 4H1LH 3SZ6A 1DO5A 2VDPH 3UBFA 2ARJA 5KOMC 4W9FC 2WIMA 4HJUA 4PCTA 3RL2A 2Z0UA 3GSRA 1QHPA 4R8WH 3SDCB 2LV4A 1RIVH 5K9OA 2YMXL 2OLDA 4UOW1 3EOBB 3UG4A 4OFKA 5EU6B 1TZIB 1NCHA 4K5LA 4MNQA 5LNDA 4Z7NE 3BUTA 2BNRB 3OKLA 1X4YA 1MUJA 3BGAA 4JFEE 5I1LB 1K4DB 1UA7A 1HE8A 1MHHB 2AV1A 2JKLA 4RISH 4IKIA 3BVNB 3GZKA 2QFPA 3DUUA 3PGCB 3VFOA 2UZYB 5JOEA 2JFCA 1OGAB 4CSZA 2AJYL 1MFCL 1P7QD 3HCVA 4JFFB 4E5XB 1JHLH 3CFQA 1KFAL 5KVDH 2PPFA 3DGGB 5HI5C 1FAIH 4WFHE 2PXYD 2EE6A 1J8HB 1ZVHA 1FFRA 1NDMA 3UTSA 4AK2A 1K2DB 2BM3A 3ZDXB 1QFWL 4KAQL 3D06A 2L0DA 2ADIB 3OXSB 3V7AG 2VDOH 3IGAA 3E1ZA 2XXGA 4F7KA 4P2RE 3QYMA 3IJEB 5C6WH 5JW3L 3HB3C 4FABL 3MRCA 1R5IB 5C7ZA 5CAYB 4CC4A 4BKLA 5JHDE 5BRZA 3SD5A 1OTUD 3H56A 1PNCA 3ECBB 3L81A 5CKGA 1DLFH 1BLNA 3MLWL 4IMKA 3BWUF 4PTTB 3WD5H 3F7VB 3OKKB 4LRNH 3MLUL 1CLYH 4JM4L 3OVUB 2HKAA 1AGCA 3RP1A 4BUGA 4OB5H 1EXUB 3OF6A 4YLBA 5IQMA 5DHMC 5K9JH 3B8SA 2GSIB 2YXWA 1WAAA 3I6KB 4ONFH 4RGNC 3W5NA 2D7TH 2UZPA 1MJ7H 3P2BA 3E3QE 4JDVB 3CDCA 5GSVA 1C08A 1I85C 4JB9L 3VG0H 5I66A 1INEH 3GZQA 3VFWB 3D69A 3K4AA 2YRZA 3GB7B 4Q8BA 3X1NA 4JAMA 1L9NA 1DQDL 2FNWA 1S7QA 3E6HA 4OLUH 1RAMA 3BRGC 4DN4L 2DH3A 3UJJL 5E8PA 3CGTA 4ZI8A 4XC3H 1HH9A 3QIBA 5BVJA 1QFWI 3DIFA 4I5BA 4G6FB 5CBAB 1UWYA 2W88A 4L3AA 4ZUUA 2EP6A 5JQ6H 4HKXB 2N0MA 1FGNL 1OB1A 2JQMA 3QUML 1BZEA 5JA9A 1VFBA 2ODHA 1SYSA 2OV0A 1D5IL 2DQDL 1LVEA 1Y6MR 2R2BA 3P77A 3LV3A 3QNXA 2OYLA 3AY4C 5TDNB 2C9RA 3GKZA 2OMTA 2EAEA 5KJ4A 3NK3A 3JXAA 3VWKB 3Q43A 5DJCA 3VXNB 2X6AA 1F41A 2ED8A 3S96B 2JLPA 5TH2A 2E7CA 3SO5A 1YQVH 3QWRA 4LP5A 3K8MA 4PB9H 2P26A 1NCUA 3LH2H 1BFSA 1L7IL 4W9DC 1RUPL 1RZIA 3SDYH 1I8MB 1OK8A 2WXJA 4M1CC 3MVSA 4Z5RB 4WV1B 4JJ5A 5ITFA 3X14B 1XH0A 3QUXA 2Z3FA 4M7LH 4GAGH 1DJZA 2BVPB 2UUDH 4FXGC 3SB3A 2Z6FA 1F8TH 2WVVA 1INDH 4M8QB 1IUZA 5CP3A 3RWFB 3VGEA 3ZRFC 3IJYA 1QQDB 5D96B 1JYNA 2JLLA 2DH2A 4ZDHA 1X3DA 4WI7A 4PRPD 5ILTH 4LB8A 4NZJA 1A6ZB 2F5AH 2VDMB 3NP4A 3U7WH 3QUYB 3QAQA 4Y9FA 2Y22A 3GO1H 4KK9D 2AV7A 1I8KA 4JZJC 4XP5H 4YGVB 2UVEA 5FYJD 2IXQA 1SLUA 3CFKB 4EI6B 2B3IA 3T0WA 5JPNB 4X7DC 2PO6B 3O2DL 2MOGA 2R4RL 4AYBA 3K71A 3KPTA 4NFDA 5CINL 3WEAA 1ZIAA 4F7CA 2YPLB 5CZVL 4ZMPA 4Z7VF 5KSAD 3X17A 5DMJB 4LRIC 1ZDSA 4QRRD 3QQXA 4NN6C 1JZ5A 2EO7A 4Y19A 4D9RD 4DP5X 2Z4TA 2OMBA 2EE2A 2BK8A 3S36X 1N2RB 5E8DH 3C6LA 3ARWA 3KLLA 2WYZA 1FFTB 1WIPA 1XZ0B 4KK8D 4X6DB 3QI9A 4GIAA 4Y2OA 3TO2B 4FL4B 2DN7A 2VZSA 4MKMA 4TNFA 4HKJA 5E00B 1OE1A 3WKYA 3LKQB 3V52H 5FOBB 3IMWA 4P5KA 3ZT7A 3QORC 3IETB 3MNMA 3O2VH 4G8IB 4LHUB 2GK2A 5A43C 1LO4L 1FVCB 3WMPA 1IC1A 1NGPH 2ID5A 2H0EA 1ZJAA 1H19A 2ZXBA 3TPKA 5GXBB 4XNZB 4WQOA 4X8JA 1ZEAL 3X3GL 3QIUA 1ZANL 2VDKH 3NJXA 3VJ6B 2IQAB 3O8XB 4DZBA 4GQ9L 4WRLA 2KERA 1E6JH 3D7PA 1QACA 3PGFL 4KJPC 4G6ML 1XCXA 2XRAH 3IXTA 3S3CB 4JRXE 4NKOB 4XC1L 3DOSB 2V2XB 1XGYL 2Z93B 1PZDA 5DWPA 1W72A 4BUQA 1YY8A 4ZYKB 3ENEA 3DARA 5FYJU 3EBIA 1UZ8A 2QDVA 2WY3B 1OM3H 5D2NC 5JPMA 4HXAL 4YHMH 1QASA 3C6EA 4M7JL 2OZ4A 4B3VA 1PFCA 4G42B 1GPOL 2IAMB 5D72H 2VR7A 5MHSE 5JNYA 2WQSA 3BP6A 5J13C 5IUCA 4M6AA 3V5KA 3LHPL 3LKRA 3UMNA 1NGQH 4DO5A 1F4YH 2DBJA 4IRJB 3ZZSA 3ZL4L 3O6KH 4WNQB 1N19A 4YDLB 4DQOL 4UT7L 4I1NB 4IS6A 4H5SA 1MZZA 4HS8L 4YHZH 5EWIL 5I6XC 3KJ6H 4J3OC 4Y4KB 2QQLH 5DEFA 1ZGLM 3EH5B 4CGUB 2EDRA 2LABA 3CVHA 5J57B 5K59F 3MBWA 5EOCJ 5AEAA 1DCLA 1ZIBA 3NJIA 4RETB 4WWKD 5FO7B 4X7SL 2C5DC 1YECL 3DX1A 1U8PB 2EDBA 5IV2B 1FFPA 3U36A 3LVTA 2E7LC 1EHKB 2X5PA 4AQ1C 2Y23A 1VIWA 4RMBA 3P4OB 2DEYX 4CBZA 3J8F7 1II4E 4YDZA 2DBLH 1DQJA 4LSSH 3GJEA 3SKJH 2CRIA 3EFFA 4OGXH 1DQLH 1X5IA 4JX0A 4QUOA 5GGTH 2WYHA 3IJ9A 1I4FA 1LO0H 3FRUB 2H47C 3ABKB 1W72H 2R69L 3T2OA 4D8PB 3PL6A 4JFZH 2EDYA 1JXDA 2L7EA 5BV7C 4P5MB 2CKNA 1HYSD 3DURB 4WEUD 2DL2A 4QTHB 3RZWA 3QJTB 5CGYD 4HUXB 5AB0A 5C9KA 4YHKL 1HQ4A 4RAUB 2VR5A 1KMGA 4BV1A 2AK1L 2YZ8A 3GQFA 3BVWA 4PJXE 5FO9B 5D1ZA 1JUFB 5JUEL 1RL1A 4F9PA 3I3BA 3UCQA 4ZFOL 1CXIA 2WWNA 3GK8H 3RVWC 4JHBA 3G5ZB 3MTXA 1PZBA 3CDGB 1AR1C 5I1HH 4A2GA 5TPWL 4ISVA 3KVQA 4UIKH 3MREB 4BKTC 3KLAA 5LJYH 3LNGA 4AE0A 4CBPA 2K7QA 3KNBB 4MQ7A 3LHAA 3J7HA 2WJ7A 1TMCB 2R56H 4FKEA 4WCYL 3GXUB 1G94A 3WFEL 4JFOB 3V5DB 4LLYB 1U8KB 2QQQA 4KQ3H 3C5JB 1JFQH 3OX8B 3E2HB 4G43A 5E2UL 1U93A 3SSGA 2YAHA 2I60L 1BZQK 3FKUS 3UJIH 4FZ8H 4HULB 1QTSA 4I9XA 5DJXA 4J8RB 5E1IA 1RK1A 3RGBA 4CNIA 4YDJA 1IAIM 1CGYA 1ZT1B 4GAJH 2DKMA 2OCFD 4QRUA 3QEUA 2MQ3A 1T6VN 3MRMA 5JYMA 3MV9E 2DS4A 2VMFA 4X4ME 1KPVA 1D2PA 3FCUB 1QSFB 2APTA 1I7UA 2W9EH 4L48A 1TCRA 3IT8D 4QGTA 4JO8A 1YN7A 4L3CA 5J1AB 4O5LH 1CFQA 1ZLDA 5IW1B 2JQZA 1RIVL 3O6MH 1I31A 2GFBA 2DQCL 3LXCA 4XCNB 4X9HA 2TRYA 4KJWC 2I7OA 4H25B 4JCLA 2FWOB 2CIIA 5DJYA 4BK8A 3HUJF 4BZ1L 3MBXH 5KVGE 5IT2H 1KF9B 2XV3A 2CO7A 1I8IA 3CDFA 1IEHA 3RTQA 4Q7DA 3DTXB 3ZX1A 4GPVA 1XF4B 4TNGA 3MRIB 4OY9A 5B39A 3DK2A 2NY6D 4BSWA 3UG5A 3JYCA 3FQNB 1P1ZA 4TN9A 4V1DE 3U0WH 3CHRA 1FYTB 2VT0A 4XGZA 2LU7A 2AGJH 3M17A 5I0VA 3NIDE 2VB5A 2JTDA 2GITB 2J57A 1HHJA 4PJBE 1TU2B 1WBXA 4PBWD 2FYYB 3BIKA 3MBEC 4NN5B 3PWVB 3B2VH 1DUZB 4PJ5E 4QXWA 5B21A 4Z76A 1NANH 3OSVA 4XMXA 1IU1A 4PW4A 1LWRA 5CEZE 1DANT 3L3HA 4OGYL 2FB4H 1SVCP 3ZKMC 1MOEA 2I24N 1B2WL 3TZVB 2YPKB 1RZQA 4CW1A 2X4PA 1L6ZA 1MCBA 3GSQB 3UACA 4HFWB 1CVRA 1SVZA 3SGJA 1BJMA 3LZFH 1GGUA 5E9DE 4XO9A 5LG1A 4JDTL 5IFHH 2EIZA 4LRNL 4IU2A 4I3GA 2ZUYA 3V0DA 1BVOA 4S2SB 1G7PA 4D8OA 3GLZA 4H2AA 4BJLA 2FJFB 1UVQB 1QKZH 3O6LH 1H3PH 2MHAA 2A9ML 4U7SA 1HWGB 1XFPA 2R23B 2CBMA 3NAAH 3PREA 1RPKA 3G6JA 1KSRA 3KYAA 1QYGH 1F02I 4IHBA 1INEL 3U46A 3UBXG 3LKPA 3FJTA 1N8OE 5EUKB 1F3JB 2CIKB 1CFBA 1X44A 3F8UB 5EUOF 4DIXA 2NMSA 1NCOA 3FOLA 1NAKL 1BWMA 2IGLA 4FFYH 3DROA 4Y89A 3VXQA 3RWEA 4LPVA 1UCTA 4PEEA 1Q0YL 2WTPA 4YDNA 1EJOL 2RGSA 5D1XE 3GSUB 1N5AB 5IB1A 3CFEB 3S5LA 4AXWB 3T0EA 3L3GB 4HWUA 4R4FH 3ARBC 1NGZB 4LHJB 4V33A 3WIFA 4EN3B 5MP6L 4KXCA 5CJQL 3S4SA 3PCYA 3GMMA 1N68A 3IJHA 4NO0D 1KACB 1CFTB 2DDQL 2HUHA 4WHYH 4F2FA 3B83A 1HI6B 4N3TA 2EIJB 2VWEE 3TJHC 3PWPA 3QWOA 3VI4A 4ZFFB 3O3EA 4GIOA 1R3HB 2CK0H 4HKZB 1WS8A 4I87A 2FECL 4FTVB 5T33H 1YQVL 4JGNA 3MOBH 5JOPE 1F3DH 4TVPL 1VA9A 4DN3L 4XP6H 2F9BT 5F9DC 3RIFK 1JWMB 1RIHL 1WQVT 1ZLUK 3RX9A 5T1MB 3VB8A 3VXMA 1PVHA 3R06A 4O00A 3JT2A 4ZO7A 3KWVA 4G80B 2F1BA 5LGHH 2NYYD 2MKWA 1OZUA 2CHDA 2XTSA 4Z7UE 3CZFB 4LASL 1F8TL 4UT9H 1RLWA 3OHXA 3VW3L 4OLYH 2PCYA 2NY3D 1UZ6E 3MAWA 2CH8A 3HJ0A 2W9DH 4Z7IA 1NJ9A 3KGUA 1QLEL 4MTMA 1IGIL 4P3DB 5GRZA 2W1NA 3DC0A 5FXCH 2XX0A 5BUGA 3TC9A 4UWQB 4XP9L 3N43B 1IFHH 4GQZA 1MRCL 1ZLUH 4ELDA 3HZYB 4L8DA 1RK0A 2WTRA 2XVKA 1XB3A 2FBJH 1FAKT 2VZVA 3EOAB 2Q20A 4GMSL 1NBVH 2WO4A 5T1LD 2IWGA 5HHOA 2B1HL 3WAJA 5F89A 2OMZB 2I5YL 4NM8H 2IV9A 3KPOA 4Y2NA 1K8DA 1ZHKA 1NMBL 4Z7VB 4Z3TA 4NC0B 1QO3A 2ZWYA 3IDMA 2P8LB 1G7QB 2FECI 2LW3A 3F04A 3F83A 4O2EA 3RVVD 3I9PA 2CM5A 3GSWB 3N40P 3HZMB 3DV4B 4WTWA 1VADA 4YHPA 4JKPL 5I1IH 3PIQA 2XVBA 3BD4A 4I0PD 3FHAA 4JY5H 1TVHB 1KB3A 3RWCB 3FO2B 4K94C 4JPKH 3FQUA 3HZKB 2FJHA 2AABL 5E1HB 4OZHE 3EH3B 3WE6A 5D93B 2EKSB 2YRPA 1XH3A 1L5GB 3CUPA 3BIAX 2EVJA 3LN4A 3H85A 1KFGA 2GJZA 1SVBA 4GAYB 3ROOA 4Z95L 4N2IA 1CDHA 1I9IH 4HLJA 1GMIA 3EJRA 1UGNA 5D7LD 1FE8H 1N6UA 4U7KA 4KKCD 4BCYA 1HZHH 2VDKL 4U3HA 2FUTA 4KJYA 1IEAA 1Y0LA 2AAAA 1TTFA 4HXBH 5FYKH 2GBUA 3K74B 2VDRL 2P8PA 5DS8B 4YSTA 1ZLWK 5A7EA 1D9KA 2ETWA 1ZSHA 2V9QA 4PJIB 4PWJA 5K9QG 4OV5B 4W9JC 4K7FB 5FEBA 2A74A 3DHMA 3IU4H 4NDMB 1AGBB 1L7TL 3VWKC 2BNQB 1C5CH 3IJ8A 3ULVD 4Y5YB 3LNEA 1IGYB 2EEAA 3KYNA 4DKTA 5IOPB 3BAWA 3CK0H 5F7EL 2IANA 5DFTA 4L5FH 2WWMC 4YZWA 1U8HA 1EEYA 3PP3K 3BAIA 1OXYA 2APVA 2X88A 3QCUL 3MOQA 2EKJA 4LEOB 1SXCA 1CU4H 3EGSA 1NUDA 3O3AB 5IQ7L 4ODTH 2D03H 2F58L 3KEDA 1I1AA 3T8VA 1BEYL 4X5XB 2MEJB 4FS0A 4WV1C 4YQXL 1D2OA 1N8ZB 2OM5A 2EEBA 3LNHA 4X6FA 3MR9A 3SYPA 4R4BB 2O5XL 3IDNA 5TF1L 4AC2A 2JCCE 1NIFA 5D96C 4L4VA 4HUMB 4MYWB 4JHWL 3GMRA 3WS3A 3WLBA 1ZHNA 2UXVA 4ADIA 3VXRD 2XZCH 1OWWA 1AXIB 4NKDA 2G5UA 3QUYC 4HSAC 1SDDB 4NNXB 3E1F1 5SWZB 3PXHA 2V5MA 4BZ2H 5ACZB 1UKQA 1KYUA 1XIWB 1XV8A 4R0LB 3CFTA 4L1BA 4ABQA 4F80A 4X50A 4A38A 2PO6C 5I5JA 4ALAL 1A3LH 4KKAD 4YHIA 3FTWA 4QHNA 5L2JB 2FGWL 1MG2C 2JJTC 4MCNA 3W57A 1GGIL 3OV6A 4KX8A 3ECQA 4WTXA 4PV9A 4KKQA 1T6WA 5ICXA 1P2CA 3FUJA 1H8OA 5DO2C 2F8OA 5DZAA 1QRKA 2KT6A 35C8L 2YAQA 1MW2A 4FFTA 4XPGL 1TYRA 2FRGP 1QNIA 4UM9A 3QDJE 4AZ8A 4EDWH 2FO1A 5F8QC 4YSAA 3FZUD 4JLRB 5HGGS 4WVRA 1KCWA 1DVXA 4TSBL 4FL4C 1YMMD 3ERXA 2UWEE 4P59L 1AZBA 3QHZL 1A1MA 4FI6A 1LM8V 1PEZA 1QMUA 5DI8A 1JL8A 3VFSB 2Q6WA 1WDAA 5D4HA 3UYRH 3U1PA 1ZS2A 2PCPA 5CSZB 3ZW3A 2WOYA 4XCYA 4NP9A 2VNCA 2HMID 1UT1A 4R7NB 4BCZA 1Z9SB 3N55A 4ZAKB 3HPLB 3PFUA 1U8NA 2DWEA 3OQ3B 2V8LA 2BVYA 3DRQA 2CBTA 1KCRH 2WM0A 1IT9H 5IB3B 3FDWA 4XNZC 2C9UA 2HT3D 1E4KA 2YLKA 3F65A 4ETQB 1S7TA 1HDMB 3SGKA 2FEEL 3A0OA 3FTGB 3O8XC 4RWYH 5AYTA 2ATPB 1TQBB 3JWOL 4YSSA 2BOBA 1S78D 1NOAA 3DX9A 2P5WA 4U1KB 4MB5A 4PJFF 4PG2A 5PCYA 4MLIA 4AGQA 2VMCA 2DICA 5EEXA 3D2UA 3ZYOA 3CFNA 3Q13A 3DTDA 4GQPH 5T1KA 3VFGL 4FFZH 2R59A 2ZYIA 2O5NA 2RQEA 1RPUA 4F8NA 1TOXA 4JE4B 5ALBL 2FT7A 3LNFA 4X0NA 2RAMA 2J8HA 4YBHA 4XAKD 5DT1L 3E9UA 1VFMA 3OAYH 4XWOD 2C1PB 1AO7B 3KM1A 3WEXA 4G7YL 1GCFA 4BA8A 1NA8A 4JPSA 4O5LL 5F1NA 5AAMC 1E5ZA 3O6ML 4N6QA 1CFVL 3QXDA 2H5UA 4PJHE 4KV5F 2X4SA 4XMPH 5F1IB 4IRJC 3MBXL 1F6AB 12E8L 3BSHA 2MTAA 5EIIG 3HUJB 2IOMA 1UM4L 5DWUL 4Y4KC 2AJSH 1HIMH 4NO5B 1RJCA 1H3VA 3H8NA 1E65A 4FZEL 1HEHC 2YIHA 3O41B 3OJDB 5D7JD 1B2YA 2FEEI 2XLLA 1QLEB 3RIFF 4LLDA 4ZJ9A 2EH7H 5LG6A 2X4TA 5E7BA 1JRHH 3MJ7A 2OFQA 1DLHA 1JCVA 3QQ3A 1VENA 5ANMB 1JHTB 3WEOA 4PIRF 4X0KA 4Z7AA 3F7RA 1FFNA 4KDWA 1E9QB 4QRQA 4E41E 4P2CG 3TV8A 5HHMB 3LZRA 2OMWB 5FF6A 2GT9B 3EH2A 4CDHA 1ITBB 4JM0A 1JD9A 4IRZA 4QHPA 5SWSD 1LMIA 1QABA 1GIGL 4J27A 4MNQD 3P4NA 2E3VA 3IDYB 2IADA 1RULH 1PS3A 3CSYA 4HX1B 5D9SA 5TE4L 4WI6A 3RE0A 1E4XL 3EYVB 2G4EA 2X9ZA 1AQKL 1A4CA 4D0BB 1TTUA 4WU5B 3DVFA 2XOTA 3GI9H 3WJLA 4Z78B 2WLLA 2ZX5A 1PD6A 3MNDA 4NZ8A 4A6YH 3L3OB 1FNGA 4ZMLA 4X5WA 1A47A 1NC2B 1AGEB 1S4IA 4X9YA 2A6KB 1CI5A 3NAAL 4FQJL 1E67A 3FU8A 4N26A 1XGUB 2R0LH 1DJGA 2AMGA 1JTOA 1MREL 1NFDB 2AQPA 4XXCC 3UTSD 1RJZB 4PTUA 5I19H 1UGKA 2LT9A 2HRGA 4G8AC 5F72S 5MENB 4KVPA 1NCBH 1DQVA 4DKFH 5D71L 4TL4A 4MJ6A 3CU7A 3OC5A 3C87A 2BXZA 2BERA 3LQAH 4LP8A 4MB4A 1I85A 1Q94A 3Q48A 4G9FB 4QF1B 2VZOA 3GT6A 4G71B 1PDKA 4KX7A 5FKAB 4Z3JA 4WNJA 1BA9A 2VUYA 2Q9OA 3E2HC 1N10A 3GRBA 3DVNA 1JF1B 3WNIA 3F5WB 1QUNA 1SEBA 3ELAT 1V3MA 1JZ7A 3UPCA 2XPGA 3M7FB 2NSXA 5DYFA 2QSTA 4MQXD 1AXSA 2HRLA 2VQTA 4MNGE 4AG4H 3OF6D 4AV4A 4XVJH 3EIFA 5E8EB 2EYSA 5D2LB 1OHQA 1E4XI 4OZIA 1H6TA 2P3YA 3U48A 1U8JB 4X6EA 3D3VD 5DJZB 1RERA 5IM7B 4NGHH 5C09A 2CK0L 3LEYH 3QUGA 1KLGB 1U4EA 3THMH 2EVHA 4KUZH 5T33L 2V5YA 3MZTA 2F53E 4HIHB 5AKVA 4MD0B 4P46D 4NQTA 4IBYA 3MGAA 3FAWA 1KJ2A 3UROR 3VQ2C 3VFTB 2GBVA 4PRHA 2PPEA 1OB0A 1JZ6A 1Q9OB 1W91A 5AG9A 5AAWA 4MXVF 1NAMA 1QPXA 3TBTA 4NRXB 1H3XA 2GIMA 2BRQA 3ULUC 3RPBA 2HLEB 1M2OA 3BH8B 3A6CL 3AAZB 3PABB 3TCLB 3CWGA 4HUVA 2IDTA 4LARL 4AENA 1T0PB 1DBAH 3UDWA 5C6PB 3V6FB 1XGQA 3PNWA 4X99A 3CH1B 4BELD 1PG7W 3CHOA 4UIMA 3G9VA 1EXGA 2XN9A 2O4EA 3H4HA 3ZZLA 2O93L 4QHUB 3AXLA 5GRJL 1JGVH 3SPHA 1GC1L 1QRNE 1MJUL 2Q86A 1R24B 2WLYA 2VJ0A 3B43A 3QWRD 2NNRA 5EOQH 3MLZL 3V95A 3D18A 2XWXA 4JZJA 2Z31A 4Y9GA 5HDBE 1ULVA 1UYWH 5GHWH 2EDTA 5EC1B 3FQRB 4NEHB 1P6AB 5EFIB 2EVGA 5E8NA 3MCKA 4QXTB 2C9PA 1EBAA 4NRYB 1RUKL 1MCNA 5D55A 2KBGA 4F7PA 3PDOA 2HRPH 4LRIA 2FLMA 2CNZA 5IFAH 1BVLB 3NABH 3UO1H 1A9BB 2BVOB 1T0NA 4H44C 1EUTA 4J3SA 3OKOB 3B1UA 1NFIB 4P2OD 3N3EA 3QRGH 4ICWA 1RP9A 3D30A 3ARGD 3MFGB 3L7EA 4ANKA 4JRXA 3Q44A 1BZ7B 4M61A 1RIUH 2YD9A 4AOFA 4C4BA 4QEGA 5FM4A 4CMHB 1BCIA 3L5XH 4FNTA 3QORA 4WFGE 5DHYA 3ETBF 3UPAA 4FQHB 4M4RA 1BBJB 1T4KA 3FU7B 4TSCH 2OCJA 3H4FA 1TO4A 4HK0B 5AYUH 1OARL 2WGNB 1HZHL 4I1RA 3GSOA 4AL8L 4Y4FA 2GBAA 1AXTH 2AJXL 3M6DA 4M1GL 4Y19D 2K45A 1F4HA 2OL3A 3JWDL 5J3HD 4OZFH 1CFSB 4UZGA 2VLKB 3HI5H 1HN1A 1F58L 1VGEL 4PJEF 3IFOA 1P7BA 3L5WA 4MAYD 5FYLE 2VXQA 1ZGLA 4GYBA 3KPSA 1UURA 3N1GC 5ESAB 3RL1A 2ZCKL 1YC7A 5EULV 1PFOA 3FQXA 4DGIL 5FW6A 1AS8A 1GXEA 1EDYA 1QA9A 3APMA 4I4WB 5FGBA 4W9KC 1SY6L 3G5WA 3VD0A 3CZEA 5D1QD 2GC4C 5EU7C 3V4PH 1U95A 4KMQA 3U30B 4QJ5B 3EYUH 4ZUWA 4GXFA 1XGTB 4IJTA 5IWLC 4OD2B 2H2SD 5DVMA 4MVBC 5GJTH 1AAJA 1M1XB 2FWUA 4KQ4H 2Z91B 2FEDD 4LMQE 1EFXB 4U1JB 1CYGA 3HAEA 2EXYC 4OZGE 4KO6A 1WA1X 1SRDA 4EZLA 5HYJE 1K8IA 1MHPL 2LAGB 3EFDH 3RNKB 4ODVH 5JXAL 2KUTA 3FQWA 4JR9H 1EO7A 1DQIA 2O61B 5F3FA 4XH2B 3T1FB 2XTJE 4TUKH 2AJ3A 4NXKA 4MZ2A 2LVCA 2EADA 3N44F 3BT2L 2GJ6D 1QLFA 3HFMH 5HY9A 5L0QC 4KJQC 4H4NA 4Z7NF 1X7SA 2E7LA 4AQ1A 1CR9H 3QZLA 4FNSA 3G5VA 4GLRH 2VXTH 2ZG1A 1O6SB 3LRKA 4HJ0D 2H26A 2ZF9A 3GMOA 4YH6A 3W9EA 1Q9WA 3LRSA 4EDWL 2Y9RT 2HPOA 4X83A 1KUMA 3NIFE 4AGPA 2D3VA 1A1NA 3EHBD 4ZMYA 3AREB 1JXJA 4OM0H 2GAZA 1AG0A 1WC7B 4PR5B 2NX5E 4EF3A 2JB6A 3EYOB 5C92A 2ZSWA 4I9WE 1C16A 1U8CB 4LVHB 2WVTA 3PY9A 3QFDB 4G1MB 4LK4A 5D93C 3HE6A 1G6VK 3PQYA 2VE6B 4HLZH 4GUQA 2WMPB 4GB9A 4AUJA 1SDAB 3FB7A 4M7KL 5D7HA 3C9NA 5ICUA 1Z9MA 4NKMB 2NY2D 2QPUA 1LNUA 4X8XA 1OSPH 1DBML 4X4MA 4GAAA 3Q2NA 3PV6A 4U7MA 5HJ3A 2IOOA 4J4PC 3X12B 2WVUA 3BLPX 3FUMA 3P4LA 4TNWK 4WTQA 2EQDA 1IFRA 2ADFL 1O9WA 3QO1A 3FAXA 3PL6D 2EDMA 2DQ6A 3QQ9D 3S8GB 4ODWB 1N18A 2BX5A 3V0GA 4AWJC 5ABAA 1BZOA 3ZZQA 1ERNA 1BZDA 5CCGE 1S8DA 1UD4A 4PD4K 2AK4E 5IVXA 5IJKC 4NYLA 1R0AH 3AW5A 2Q76B 4HT1H 4LZKA 4MD5B 1UC6A 3H3BC 1V3KA 2GJPA 4N86A 4UU9B 1FV1A 2AEPH 4NAJA 3HI6L 3E80A 4U6XA 2RFXA 4RNRB 4AC4A 1GZQA 2NOYA 3PP4L 2V3FA 3KHQA 3ZKNC 2CCWA 3BUYB 4AK1A 3F12A 2OI9C 3RVTD 1LP9A 4JGJA 2FK9A 3T0VA 5E08H 1RUML 4N9GA 4XMPL 1ORSA 2DMKA 4KKLC 3Q2VA 4MWFA 3N2JA 1CD9B 2KYIA 2XQBH 1K6QL 1TKWB 2QLVB 4B41A 2F8VA 4YFDB 4H88H 3KXFE 1UJTA 2JELL 1NUNB 4PJ8A 4F33B 1BQ5A 3WFBH 3WJMB 4B27A 4OF5A 1CQYA 3RY5A 1L0YA 2CJSA 3BO8A 5KYWB 2WTOA 3HC0B 3CSFA 1WD8A 5HP5A 1FCGA 2CKBH 4BK5A 2QDWA 5C9JA 3SE8L 4R0LC 2K1MA 1KCUL 4LSVH 43CAA 2XG5A 1U3ZA 3EFOB 5C2BH 5CKAA 4HGWA 2JB5H 3TWYA 1XL4A 4HG4K 4RX4D 1FVEB 3VD2A 5DQ9B 2FEJA 5BQ7A 3WKNA 4D2NA 5HPMB 3SE9H 2J20A 3WXVH 1M7IA 4FNUA 4KROD 3MBEA 4A2EA 4LCUA 5I30L 1MWAB 5F0PB 4DO6A 4UB0H 2N3JA 3X1FA 2CPCA 5KVGH 1R3IH 1T04A 2MKLC 3QVAA 4G7RB 4MA1B 1Y1UA 1KC5H 2A9NL 2EE9A 3QA3B 4ZTPL 4KTGA 2ZYHA 1PCXA 3N85H 3PLYA 2WLMA 4JZNA 1B88A 4R3SA 4BFFA 1KCKA 5C0CD 1O9VA 3I2CH 3DBXB 1TZHA 4M8UA 3NSDA 2BOLA 4JFTA 4GBXB 2HXAA 5E2WH 4JBSA 1DANU 1JF6A 2OTWB 4JRYA 5J7CC 5IGXL 1MCWW 1I3RB 1P84J 3E7JA 5K1JA 2Z92A 5HHNB 2WZ0A 1MLBA 3OXRB 1MEXL 3AQZA 3AZUA 1LDPH 1PIFA 1PYWA 5K39A 1NIAA 3MA9H 3VXSD 1DHKA 1JGEB 5DHVA 4UDUA 1TQBC 4PP2A 3OGCA 4N24A 3ZE2B 1FCCA 1MAKA 2AJZB 5H37A 2F5BL 1HHIB 1CXKA 1FG2A 1W9XA 2B0SL 2WIIB 2G2NA 2Z1KA 3H7BB 3OAUL 1H3WM 4LVOB 4MS8D 3I9IA 4Z7OE 1F13A 3DOIA 1NH6A 3GEWB 1M4KA 1PZ5B 2I27N 3C8DA 3ZLQC 5D6CB 2BNUA 5JA8B 1NEZA 3ESOA 2Z4QB 5FA3B 1CK0L 1PX4A 3IVKA 3W11D 5LBVA 1ND0B 1ZT7B 2FUQA 4U1MB 2ICES 2ZUQB 4LF3A 4YR6B 3ARBA 3E38A 1ETZA 2AJVL 5KS9B 2H32B 3SCMD 4FQLH 2B1AL 1T2XA 3CX5K 1XGZA 4QGYA 4NIKB 3K8KA 1NM9A 4HD5A 4AMKL 3J27A 4KZDH 2ITFA 5AUMB 4MJ5B 1MN4A 2J4WH 4QTIH 3QXVA 4X98A 2XETA 4BIKA 5DUML 2FQDA 2P52A 1G87A 1E3FA 4E9TA 1MRDL 1MCQA 4PJGB 5EZOH 4XNUH 1O6VA 2Y7QB 2YKLH 2AQNA 4R4ND 4JL2A 5C0AA 3RKDC 3ULSA 5EU6A 2GPZA 3EOTL 4QRPE 1UM5H 1TQSA 2QMKA 3W0WA 5DSCB 5GS0H 4NC1C 4U3SB 3CZSA 2J55A 5ECGA 1OP4A 2VC2H 4D0CB 4G11A 1MHHA 1UT9A 5FUZL 4ODSL 5I71B 3CVBA 1HSAB 4X7CC 4OBRA 3UABA 4EIUA 2HJFB 4F91B 1TZGL 3JSSA 2UZYA 1Y18B 1OT2A 1OGAA 2VN3A 1J0ZA 1LK3H 2ZYSA 1JFHA 3OLEA 5FUCC 3QEQE 2MPAH 3Q1EA 4XWGH 3WCYA 1DEDA 4XPBL 3FF8A 3VGDA 5A2FA 2F1AA 1JWUA 3LN9A 2ADGA 1K2DA 1T7WA 4FQ1H 1A4JA 2MWCA 5B39G 2WYTA 1S7UB 3VFMA 5EZLB 3OXSA 3VXMD 4B9JA 2CK2A 3ESUF 1LD9B 3ZDZB 2X12A 5DJ2B 3NZHH 3L4TA 5H2BB 3AS3A 4YL9A 3ZQ9A 1NGXA 1R5IA 1S6NA 5D70L 3KWUA 1RZJC 3D4ZA 3G3LA 1KB5B 4LP4A 3L3OC 3U6XA 3WS6C 1R1CA 4LIQL 3UBXI 4PJAB 4N1CA 2ATKA 4HIIB 4X6CF 5MI0B 3ZYJA 3SQOL 2VLRE 4JHUA 3NCYS 3F7VA 5C6TL 1WLHA 1A6UH 4G6KL 1RZGA 5FYKD 5ID1B 2G9HB 1NLBH 3UAFA 2BVQB 2BRRL 2Y36H 3CBJB 4LOUD 5J6GB 4QNPE 1RIUL 2HKHL 4L4TA 4OCMC 1G9NL 1OCRB 4GOSA 4LCWE 3UZQB 3F00A 3QDGE 1GS7A 5F9OL 1LDSA 5C08E 5T5NG 5E5MA 2V2TB 3OR7A 5KSAB 3NCJH 5E1AB 3K8LA 3MRLA 2W60B 1UWGH 4QRRB 2BP3A 5EO9A 1BAFL 4GEIA 2NUPB 3S3SA 2F74B 2PR9A 1I7ZB 3VXTA 1E2ZA 4BQBA 4F7EB 4GG6A 3HI5L 1RUQL 3VGAB 4WI0B 5CBAA 1M2VB 4DKDC 4XE0A 4PMEA 4YL4A 1MZYA 1SPDA 4L1DA 4AQOA 1A7RH 1E8YA 3MRNB 4X4XA 4TNWF 4QDGA 5TDNA 1WT5C 1ZE3H 1MJJA 2JMRA 2GK0B 4G5ZH 4NOFA 5LKNA 2FIRT 3KPPA 3BDYH 1G7MB 2NYZA 3B6SB 4PGEB 3S5LG 5IROD 3S96A 1DVFC 2WZPA 4AIEA 2WXHA 4Y5XB 1RZ7H 1XF5A 1K72A 1A2YA 5E94B 4JO4H 1DEEA 3H3PH 3UJTH 4ELKA 4XCCL 3RIAK 1F6LL 2VIRB 1YEHH 4URKA 4HWBA 4BH7B 1FORH 9CGTA 5JLZB 1Q9LB 4WHDA 1AJ7L 2BC4B 4WV1A 4LLMA 3X14A 2YXFA 1GYVA 3AADB 2BLFA 2BWIA 2GSGA 3I3EA 5FYKU 3O2WL 3KCWA 5CFAA 1WGVA 2CR0A 3GSNL 1QQDA 4GXUN 4J6RL 5D5ME 1IJNA 3GZOA 3DX3A 2IAND 1EAPA 3QUYA 3JTSA 4D7BA 3WGUB 4DH2A 2I07B 3V4VB 2YPVH 3V9FA 3VFRA 2X89D 3SZKC 3O6FD 3HFML 4PRAA 1BF5A 2GTWA 1JN6B 3CFUA 4NQDA 5IIEA 1CR9L 2FO4B 4NQEA 3UMTA 3EJYC 1CGTA 4GW5B 1GS6X 2AITA 2YKKA 1JGLL 2WINA 2JJTA 1XT5A 4N2FA 1YAIA 2ALWA 4ZUSB 3PWUA 4L4VD 5DMGC 1SJXA 1M3IA 5FLUA 4HKBA 4WWKB 3DXAE 4UT6L 2F54B 3GS7A 1N2RA 1PSKH 3WY2A 3UTTA 2OW7A 4X6DA 5C07D 3VRJB 3DRTA 3RA7H 3TO2A 5GGVH 3GLAA 1KGJA 4HUUA 3UTZB 1M9WA 3ZN6A 4CMMB 2DQEL 3LKQA 5FOBA 4AEIL 4O58H 4CMHC 4QHMA 3AGVA 1J0YA 4OAWA 4LAQL 3IETA 4OCRH 2NY0D 1IBBA 3L1GA 3KL3A 3WDHA 2NCMA 4LHUA 4MB1A 3TBWB 1VEOA 4LPXA 4APQD 4JZOB 3TYFB 1FDLH 4KUCF 4ZD3H 3TFKD 1B0GA 2EUVA 3V6ZA 3LIUA 5IBTL 1EO5A 1IO4C 5GS2H 5K9QI 1HILA 3JQOB 4IU3B 4UM9D 4ZOAA 3QJUB 1FLRL 4E9XA 1LEGA 4GKOA 3FB5A 2FT8A 3O8XA 4HWEL 1S3KH 3TV3L 4BFEA 1R0AL 4GLRI 2MRYA 4FYSA 1UA6L 2AEPL 5CD5D 3GGWB 3QJHB 1B6UA 2PR4H 4WEBL 3DOSA 2V2XA 4HC1L 4LKXA 3IE9A 5BVPH 2WV3A 5F7LB 4DEUA 4EUPA 3R7RA 1IVLA 2R1WA 4WW2A 4PRIA 3U30C 1VAHA 3VI3E 3ZZ1A 3BKJL 4ZPTB 3BDXA 3SJVD 4E68A 1TQTA 3UBXB 3T4AB 2B59B 5CILL 3EG9B 4XAWH 4LOVA 1WWCA 5AAMA 1DQKA 2J5WA 1JCKA 5EBWB 4AH2B 4YHNB 2VW4A 2YSTA 1A3RH 2P49B 5I8EB 4IRJA 1XCWA 1VGKB 1P7HL 4WNQA 5IBLC 5EIVA 2D7QA 1G9EA 1Y07A 4Z3IA 3D2UD 3RB7A 5T1KD 2W0FB 4Y88A 4Y4KA 3I02A 4TUOA 4JFDE 5GRUL 3DECA 1T5XB 25C8H 1LK2B 1CYXA 5E4OA 5IV2A 1U8PA 4AE1A 3ALPA 4Z0XB 3RVXC 3MTRA 5FX3A 5AOZA 1DYZA 5IBUB 4JM2C 3L3JB 1AZVA 4JE0A 5D2NE 4KKZA 4I77H 2DLFH 4M3KB 4WFHD 5KVGL 5L6YH 2DJUA 1DL7L 4P2YA 3WTTA 1ZK5A 2EUWA 4NJ9L 2PYEE 2HG0A 4YZFF 1D6VH 1WFIA 5A16A 3AREC 3D2TA 3DJRA 4KVNL 3FU3A 1KTRL 4P2RD 2NY6B 3I2CL 2KI6A 3BN3B 4U1GB 4GP5B 5CJ8A 2W65A 2YD3A 2YXMA 1G6RB 5DD0H 4P5MA 1U8OB 1SMAA 1EEQA 3O0RL 4LVHC 4Y0GA 3FFDB 2ZIDA 5D7IE 3FT3B 4FMKA 5I8CA 4HUXA 1OTTC 2R4SL 1AIFB 1MIEL 5EPMB 3MACH 3MFFA 4DK6A 1JUFA 2E86A 5C3IA 2R29L 2D7PA 5AVYB 3JZYA 2BSCA 4FQQA 2R2HA 4DKEL 5HI3C 4TMPA 3QJFA 5CEZL 3CLFH 3KPMA 4XXCA 4JPIB 1CLCA 2XC8A 1OANA 4MX7B 4CVZA 4QJ4B 2I9TA 1WEJH 4YK4B 4HEPA 5KYXA 3QSKB 2EXWD 4L29B 4KZEH 3NBNA 2YN3A 1V3JA 4ZUVB 1J1OH 5J9PA 3EGXB 2H2PD 4H8HA 1ZA3B 4JNXA 1A14H 3ASOB 1V7NH 2Y25A 2ZKHH 4I8DA 4DUXA 4J8RA 4YXLL 4NQCE 4JG5A 2HT4D 1W0YT 4OZHF 4LSUH 3M45A 4R5VA 1DDHA 5AQ0A 4NQSA 1EHLH 4HV8B 4N87A 4RMWA 3L1OH 4PGZA 2HJLB 3TBYB 3EO9H 4QTIL 2XN0A 5H94B 2DWYA 4D9LH 3SGEH 1RSYA 1QSZA 3TA3C 5JIHA 3UYPA 3SY0A 4ZXBD 4PJDA 4CJ0A 2MNJB 3JWNG 4K3EL 4UDTA 5FHBL 5A3IC 2NXYD 3BH4A 3QUZC 4XCNA 4XNUL 4H25A 4AJYV 4N5UA 4IK7A 4K3GA 3MJ8B 4XBEL 4XNYH 2OYPA 5KYNA 3WXWH 1AANA 1OD7A 3QPQC 1MVUB 1J9SA 3K72A 3WU1A 2FVNA 4QTFA 2ZUUA 4NO0B 3UP6A 5IFJB 5KZCD 1WAAF 4K3JL 3U4EB 1Z9PA 3RUGE 1ETA1 2P8MA 3DMMB 1IIIA 1N59B 2BDNH 5ITBL 3Q6FB 4Q4EA 1UA3A 2Y07L 1T83C 3RIAF 3OG4B 2CLVA 2OMUB 4UV4H 3OLIA 1Q9KB 3IEAA 3NDZE 3Q06A 1A7NL 4WUUE 3EBGA 3GBEA 4B5ZA 4EBQH 3IFLL 1DUZA 1IX2A 3SY6A 2HKFH 1K9TA 4MA1C 1G1YA 3ESVF 3H9SE 5I0YA 1L9TA 3CX5J 4ZW5A 1P4IL 3NZHL 1UENA 4ODUB 5DLMH 2ICWA 1QWNA 3P30L 4QCIB 3V8OA 5L88H 3KLHD 2QQKH 1MH5A 3KBPA 1KULA 2EE0A 1NDTA 3HR6A 3S37H 3DDGA 4FKKA 2NY3B 1KENL 3RY6C 3GSQA 1V7MH 3IPEA 4AQAB 4HH9B 4QI3A 1E9PB 5DGRA 3FUNA 2V9TA 4Q9RL 3LQZA 2XTLA 1ILSA 1J1XL 3O45B 2XBDA 4LU5H 1OD9A 2PXYC 4N2GA 4PWGA 4NUQA 4PVNA 2RH0A 4S2SA 5E6RB 4KKNA 3TIDB 3H9HA 1H5BC 1KIPA 2JI2A 1JSYA 5CIPH 2XN9D 4LBAA 2AQQA 4NWTH 1IRAY 4B9ZA 5I15H 5FV1L 4MJ4A 2XWTA 4JG9A 4NENB 4WJ5A 2XICA 5T1LB 2R8SH 4QXUH 3MODH 1F3JA 1Q72L 3MA7B 2CIKA 2Z31D 3HG0A 5BOZG 1ZAGA 1OTUC 1EJFA 1LWHA 1IV8A 5F7BA 3AU0A 4LVOC 4N3UA 4F57L 4HCRH 5E8OB 3ZGIA 4IRSA 4RVBA 3KLQA 4OJDH 4FQCL 2OSWA 1R33A 2UWEF 3W38A 2J8UA 4YBQD 3BJ91 2NXZD 2F19H 4XPTL 2Q3AA 1JVKA 3U4BL 4IBVA 4NZTL 5IMKB 4I0PB 2WXQA 3U0PA