4IEFB

Complex of porphyromonas gingivalis rgpb pro- and mature domains
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
423
structure length
422
Chain Sequence
GRMIVIVPKKYEEDIEDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDKWLGQALCIASAEGGPSADNGESDIQHENIIANLLTQYGYTKIIKCYDPGVTPKNIIDAFNGGISLANYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVAVNGDFLYNVPCFAEALMRAQKDGKPTGTVAIIASTINQSWASPMRGQDEMNEILCEKHPNNIKRTFGGVTMNGMFAMVEKYKKDGEKMLDTWTVFGDPSLLVRTLVPTKMQVTAPANISASAQTFEVACDYNGAIATLSDDGDMVGTAIVKDGKAIIKLNESIADETNLTLTVVGYNKVTVIKDVKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gingipain R2 Pro-Domain
publication title Porphyromonas gingivalis Virulence Factor Gingipain RgpB Shows a Unique Zymogenic Mechanism for Cysteine Peptidases.
pubmed doi rcsb
source organism Porphyromonas gingivalis
molecule tags Hydrolase
total genus 147
structure length 422
sequence length 423
chains with identical sequence D, F, H
ec nomenclature ec 3.4.22.37: Gingipain R.
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01364 Peptidase_C25 Peptidase family C25
B PF03785 Peptidase_C25_C Peptidase family C25, C terminal ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4iefB03
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4iefB02
3.40.50.10390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Gingipain r; domain 1 4iefB01
3QUZA 4MJIB 4WENB 3F12B 3MRCB 4K8RH 2ESVD 5ISZD 1S7XB 5FK9A 2DQJH 5EO0A 1ZT4B 1CCZA 3OKKB 3LZFH 1FGNH 3MRKA 1QSED 1BWWA 3ZKQD 4OLVL 3FRPA 2BSSB 5I17A 4P2YA 1I3GH 3BGFC 1U92A 4RAUA 2DQFB 1ZHLB 1FYTE 1CL7H 1N59A 1QVOA 1R3KB 5I15L 2NR6C 3A6CL 3KAAA 4AWBA 3U4EB 3TO4B 3TBSB 2D03L 4C83B 1A7QL 4PRBA 5I1AA 4EHHA 1G6RA 2BY2A 1F2QA 3QEUB 2J8UA 5C0DA 1TENA 1Z9OA 3FO1B 4OFYA 3DX7A 5DI8B 4YXKH 4PJXF 1LK2B 2EEDA 3CDFA 3PWPE 3GHEH 4AG4H 2CDRA 4F2MA 5L88L 1EV2E 4PJHE 1MCSA 2AGJH 5C0EA 3LMJH 3DUUB 3T1WA 3AAZA 1F4HA 5ENWB 5E70A 3RWEB 2X4QA 5D9SB 3CVHL 3AB0B 5EIQA 3RL2A 4UOJA 4M7KH 4ODTH 4Y1AB 1FNFA 3VXUE 3WIIL 4YR6A 5EORH 4U6XB 1JXQA 3G6AB 1B0GB 4XH2B 2E7LC 3R4DA 3X3GL 1A1MA 5IW6B 3QEQD 4LCYA 2EICA 4YO0B 2A1WH 5GS0H 1DQQB 2FGWH 2VLKE 1J0KA 5FDWA 5BZWB 2ESVA 5F6HI 4JR9L 4GQ9L 4FFVC 1PZ5A 4H20H 1RIUH 4J4PA 4YDKH 1OLZA 1CLCA 4NP4L 5KVFH 1L4IA 2KZWA 2EYRB 4BZYA 1B0WA 4OZIE 1QSEA 3EYOB 1BGXH 4QHMA 2LAAA 1ORSA 3X3FH 3OKMA 4GRLC 2YHGA 3RWJB 4WTWA 3SDCB 4PGDA 4Z76A 5LAXB 5H94B 4IRSC 3SCMA 4UT6H 5K59F 3PDOA 3JV6A 3QI9A 4M7JH 4MA8L 3ZT6A 4YC2B 1OF2B 2VQ1B 4OZHF 4N1EA 4FQPA 5CINL 3WFEL 4AMKL 3VGAB 4ONHA 1R5VA 2XN9B 3V4PH 1K6QL 4Y4HD 5DK2A 1QBAA 4JGMA 2AVGA 5EOTB 1ORQA 5KZCD 4B53A 1N0XH 3ZL4H 4M7LT 1V3MA 3MO1A 2YD8A 5CEZE 1ADQA 3MACH 1NUNB 5C86A 4YGAB 2CNLA 2ADJA 4HDIA 1P2CA 1WCBA 5CIPH 1QRND 3MXWL 4JHWL 3P4OB 2NY3D 2NY5L 4HHAA 1RU9L 4TVSa 1LILA 4NDMB 5FKPA 1W0YT 3GGWA 2WINB 4JFXB 4P23A 3TH4T 2VDLL 1FNAA 3B3IB 2BRRH 3WDJA 1ZHBB 2P5WB 5CSBA 3KJ6L 4PJCF 1YUHB 4QGTA 3SKJH 4PR5A 4JO3H 3ZTJG 5SWZD 3ZDXF 32C2B 2J32A 4MZ2A 2FJHB 5IT2L 5D96C 2BCKB 1EO5A 2XG5A 1X5AA 4JR0A 2B1HL 2ZCLH 4YPGA 1QEWB 4XPBH 1IGJB 3BAEH 1GOFA 3QNZA 1CDHA 4I13B 4GAYA 4XP4H 3T3PE 3QEGL 5CD3B 5JQHC 3ZZ1A 2LU3A 4W68A 4X4MA 4KZEH 3VFGL 1GOHA 2XZAH 5C0BA 1MRFL 2VAJA 5I75B 3GMPA 4ZFZA 1T0NA 3ALWA 5TE6L 3PGFL 4XCFH 5B4MD 3LHPH 4YH6A 3OXSA 5HDQH 1K8DB 3BKML 3BPCB 3QFJA 3HZMB 4YBQD 3DYMA 1I85C 2VXQH 4PRNA 5J9PB 1ED3B 3SE3A 4NQDB 5CZVL 4HEME 4Y7MA 3PWLB 2D4DA 1CGVA 1A1OA 5GGUA 3OKLB 3AREB 4R96A 2VDRH 4UZGA 4M4RA 1NGYA 2F54D 1B6UA 1T2JA 5JXED 3OR6B 4HIHB 4LLDB 2JK5A 4M43H 4MYWB 5F1IB 3Q6FB 4JRXE 1LO4H 4ISVB 1F6AA 2QADD 4U6YB 1T66C 3WL9A 3FJTA 3V0VA 4JO2L 1XIWB 2V7NB 2G75B 3IU3A 4KJPC 3T08A 1S7UA 5TH2B 4FDLA 3I3EA 1C5CL 2R1XA 3HAEB 3QUML 1C16A 2W9DL 2IBGA 4UTBH 2VDPH 4OGYL 3O9WB 4LSTL 2VLJB 3CSGA 3EYVA 4FXLA 5GGVH 3I85A 4OD3H 3BW9A 1FFNA 1XT5A 3AS0A 4JQVC 2A2QT 4PJ8C 4P2QA 3Q3GA 3QHZH 2PW1B 4QUJA 5KANG 2H26A 1D9KC 2FHCA 2A6DB 2BOBB 5JOFA 3E3QE 1MFCH 2IMNA 4KMLB 2H6PA 1CGSL 5I30L 2DQIL 3OKYA 2P8MA 4U1HA 4MAYD 3UTTA 3QIUC 2R2CA 5T3XE 4FQJL 5F9JA 3HZKA 4O2CA 1VKXB 4PJ9C 4ZO8A 1UXSA 1LP9F 4G42B 5DC9B 1OWWA 4PGEA 1MAMH 4LQFL 2YBRB 4KDVA 1F4WH 3ZT7A 1LVEA 4CU8A 2DQCL 3MV9B 4FQIH 3GJRA 1DVFA 1MFNA 1WWBX 3U6RA 4I8DA 4HJGA 3O2WL 4JHAH 5CBEA 4F37K 3K4ZA 1CP3A 4RIRB 1A14H 2F54A 3WN5B 3MRJB 5D1ZD 5TQ0H 5JXEA 3MA7B 4HZLB 5FHBL 3P40A 1QUNA 4XNMA 1FVCA 2ZG2A 5CEYA 4X6DE 3AM8C 3MV11 3EJZD 5FGCB 4K7PX 5CFHA 3D85D 4ZOEA 3QUYB 4NNPH 4JCLA 1FSKC 4FTVE 3FQWB 5L8KB 2NYYC 1ZTXH 1ZT1B 2AP2A 4OKVA 4E41B 2F9BT 3LQZB 4RZCB 3NN8A 2E7BA 4JPIA 5BW7C 4S0TD 3RY6C 4ZSOE 1JNHA 5KSAD 2YMXH 4LPXA 5IWLC 3MLZH 3MLXH 4WFED 5TPWL 4X0KA 1OAXL 5IESL 1WVZA 4RNRB 5D2NE 3O4LA 4IIQC 4QTHA 3BZDA 3MLVL 1N0LA 5DVKA 4MAYA 2A6IB 2X89A 1SEBB 3VXMB 3G08A 4N0FA 4WTZG 4I18B 5E00B 1X5LA 3KPMA 3VFRB 5HVHC 1XGQB 1ZLUK 2VDKL 1ZLVH 3MRRB 1SBBA 3DV4A 1K85A 4XWGH 3CFBB 1UM6H 5I16B 4NJAH 5DJXB 4UQ3A 3DVNA 1E4WH 3VFWB 1ZMYA 4ZVSA 5KVEL 4MLIA 3WJLA 2QQNH 3PHQA 1KIUA 4N90D 1U8NA 2CKNA 3TCXA 1RMFL 1JGVL 4XPHH 2LABA 1S9XB 3D85A 5C6WH 2VDOL 1UH2A 3LS4H 1A7BA 4JPWL 3BKJL 4H25A 3BJ91 1BEYH 3EYSL 4H0IA 3QCUH 1NBVH 4FXGA 2BVQB 2FX8H 1ZEAH 1W8OA 4U1KB 4APQB 4HUVB 1PW3A 2A73B 1F90H 2MHAA 2XG4A 3TT3H 5DK0A 5DD0L 3N50A 1IAIM 5KSAA 3SE9H 2A6KA 5MEQA 1WIOA 1TITA 3P4NA 3TJHC 1W0WA 1KENH 4KPHL 4EI5C 2IH1A 1FORL 3GJSA 3HCVA 4YHLL 1E6OL 2ZSVA 3U36B 4PJDE 2G9HB 4HGWB 3CH1B 5C08E 4QHKJ 3W9EA 4EUPG 1PQZA 5I74C 4L9LB 2DQEH 2F53E 1HIML 4YHML 1Q38A 3VH8G 1CD1A 3BOVA 4J23A 5I1KH 3IDIA 1EEYA 4DJMA 1A7RH 3MJ9A 1MLCA 3BP7A 1B0RA 2NR6D 2AJSL 4UDUA 2APBA 3NMEA 4PJFA 2EO9A 2R0ZH 1XF1A 2BNRE 2CDGB 1I4FA 4WRLA 4GG6B 1WTLA 1CLZL 1EO8L 3G04A 2Y0BA 2HLFC 4KKAC 1ITBB 4YNYB 5T1MB 3GKWH 1JWUA 3T0EE 4TULL 3WIHH 2OM5A 3U4BL 1OP3K 2EH8L 2DIBA 3VXRD 4WI3A 3UC0L 4DWHA 3GBML 2ITCA 4HF5H 2H2PC 2XWBA 3JTTB 3K46A 3QHTC 1A9EB 2ICEB 3QJFB 4ODSL 4YE4H 4J1UA 4JQXA 3P4MB 1JNJA 1JHLH 4ZQKB 1YMHA 4U2ZA 4XPFL 3RZCD 3NFSL 2CKBB 1JV5B 4LP5A 4CMHC 4LCWD 1GGIH 3H9SE 4Q6IB 4YHYC 1FZKA 1OAZH 3DMMB 1YEKL 3HKFA 1S3KL 2YD9A 5C0CD 2HAZA 4P5TD 4JY6B 2F5BL 3MV7A 3VG0L 3O41B 4OF7A 5SWSE 2MKWA 4K94H 4JFZL 5IB5A 3BE1H 1XH3B 2OL3H 2Y07H 4OAWA 3S97C 3JWOC 1CFQB 4GRLD 4RFEA 4PUBL 5DRZB 3L3OA 3EDRA 1U2HA 4IRSD 3ULUF 4X98A 1WFNA 2FH8A 3JUZA 5AYQA 3OX8A 4LGRB 4R8WL 3QUXB 3MJ8B 1KULA 5B21A 3ZHDA 1VA9A 4H26B 3P0VL 4HJ0C 1RHKA 1NEZG 1BFTA 3LIZH 3VWJC 5DHVA 4GBXB 3IKKA 3MRPA 1EJ6A 5EOQH 3ARDB 5D6CA 4OCRH 1JMXA 3CFJA 3LKNB 1KLUA 3DROA 3WFCL 1MCHA 2OTPA 2Z8RA 3PGCB 4KKLC 3LQMA 4X5LA 5DXWA 5IQ7H 4ZYKA 3NIFE 2FR4B 3H9HA 1BD2E 5GSRA 1QFUH 5IBCA 2GJZA 4EJ1C 4DFHA 1KPUA 4WTZA 2JJUA 5MHSD 3WHXA 1GGCH 4X7SL 2P46B 4YHOL 5GJTH 4LEXH 4DGVH 4HT1H 3RZCA 4GAFB 1WFUA 4ZOAA 1ZS8B 1VFBB 1NDMB 4JRWA 3BPOC 2GAZA 4LCWA 4NFCA 4I2XA 3GI9H 3KYNA 1B88A 3LQAL 1GL4B 5C0JB 3JUYA 3VFVA 2Y36H 4HK3N 3V4VH 1J88A 1YJDH 4P5TA 1JGLH 1G0DA 4LCCC 5BVPH 2BHUA 2DLFL 4ETYA 1G7IB 4YWGH 1RE1A 1G7HB 3BSZH 3CVHA 1NCDL 3BEVB 1YEDB 2ZUSA 5D5MA 5EDXA 1INDH 4U1MB 2B0SH 4CJ0A 1I9JH 4LVOB 3MREA 1JF1A 4ONOA 2F19L 3BRGC 3NFNA 3QXDA 1FYTB 1BFSA 1IQWL 5IK3A 2J8UE 5KVGH 4KV5E 5EZJB 4WU5A 1JNNL 1RZGA 1JUFB 4C54A 3GMNA 2NXZB 4HBQA 4X5WA 5C0AD 2R4RH 1QZ1A 4HJJH 4M5YL 4OLZH 2RAMA 2PO6B 3PWPB 5F8RC 1WC7A 3WNOA 4X6FB 3UMTA 4F7MB 3V6OC 3RJDA 4HUKB 4NRZB 4YXLH 3OB0K 3CFDB 1AFVH 3UJJH 1MLBA 1EUTA 3N0PB 3SPVA 4ZTOL 3DX8A 2BSTB 4IRZL 2YEZA 2YUVA 3B8SA 4PPTA 2V2XA 1YYLL 5I76B 3U9PH 3LPWA 3R1GL 3VXUB 2BOCB 3IXTB 5BOPA 4Q0XL 1IEHA 3JVGC 5J56B 1T66D 5E08H 1T21A 4G6KH 1KN2L 3SKNA 3VH8A 3VRJB 2DWEA 4KJPD 3QWOB 5AG9A 4MJ4A 4X5XB 1RK1A 2W9LA 1ZHNB 3VI4E 4GW1B 4XCCL 4AH2A 4ELKB 2ESVE 4LLYB 5ISZE 3EDKA 3SKOB 1XEDA 5I1EH 3T65B 1X4ZA 3N85H 3OXRB 4NPYB 2GK0B 5JPNA 1QSEE 4P5KA 4KY1H 4X6EA 1DBMH 4G80B 3P9MB 4DAGL 4XC1L 4M93C 4PJ8D 1XF2A 2PTTA 1R3IL 4QHKI 4JFED 4OZIB 2E5EA 3FB7B 2EECA 3EYQC 2X70B 1RSFA 2ATKB 1GGTA 1YNTB 4PGZA 4R0LA 3QQ3B 1TLKA 3BRFA 4RGMC 1I1FA 1SBSH 3GO1L 1XF4A 1CXEA 3QIUD 2OQJB 4CW1A 5E8EA 2VE6B 4M1CC 43CAA 2W07A 3B5GA 2COQA 4PJ9D 1JPGA 5I1IL 1INEL 3KPPA 4BZ2L 4G6JL 2QQKH 2AJ3A 3BFOA 2Z31B 1CFTA 3WEXB 4PB0L 3BP5A 1RI8A 2IFFL 3QDJA 3WXWH 3SDAC 5EBWB 3UDWC 5HHMB 2UZIL 2MMXA 2YSSA 3EGSA 4U0QB 4PJAB 4R4BB 1Q9WB 4R4NC 5JUEL 4UV7L 4NUJA 1PAUA 4KVCH 4DN4L 4DK6A 1MCLA 2NZ9D 1QG3A 4QRPB 5C2BH 1BOYA 4FFYL 1BQHA 2C26A 3QEQE 3VMPA 1QO3B 3KR3H 1QBLH 3QNYB 5DD6A 1HH6A 3WUWG 3CH8A 4ODUA 4HK3J 3QDGA 2CKBH 1P4LA 1R24A 2NY2C 4GAJL 1TZIA 4UT7L 2HBYA 5SX4I 5F3BA 5E2TH 1I7ZA 1K4DA 4GG6F 4TSCH 2RFXB 1Z5LA 3CUPA 3VWKB 1NEZA 1A6AB 1T7ZA 2QKIB 2H65A 1UB5B 5F88A 1BLNA 1ZGLB 1F4YH 5I19L 3LVEA 4U1IB 3B2VL 3GI8H 1IE5A 3MV01 2LVEA 3MRNA 2D2OA 2VC2L 3H6JA 1KCVH 4FQLL 1PY9A 1UKSA 3FHAA 4CL7A 1MFDH 3BZEB 3QUMA 5DZNA 5IC4A 3QIUA 5IB2B 1CT8A 2AV1A 4QTYA 2WANA 1WV7T 2CNOA 1A3LH 3O3BA 2VMFA 4ZPTA 4NWUH 1YQVH 3QQ9C 3VGFA 3QFJE 2ICWJ 1L9MA 1RULL 4F9PC 4PJBA 4PJ7B 5BXFA 5IFAH 2AJZB 4WW2B 4QULA 2W38A 3HZYA 1B2WL 4GSDH 5D7IB 1SYSB 1XCQA 4RWHA 5H37G 3DO7A 2AK1H 2NW2B 1OP9A 3O6KL 1UM5H 4HS6B 3BISA 1QRNE 2JB5H 1FJ1B 3UJTL 4NO0D 5FXCH 4R2GC 1F9EA 1CXIA 1J7VR 1SY6H 1RZKC 1CFSA 5TGBB 2JJTC 4LNRA 4K2UH 1KTLB 1EXUB 3AM8A 4B5EA 3PGDA 4JFFD 4POYA 1KB5H 3FB6A 4JPKH 4U1NB 3MLSL 4NCC2 1D5ZB 1CR9H 3CDGB 5SWZE 1YC8A 3ARWA 1NC4D 2DIJA 4M61B 2B4CL 1NCTA 4BA8A 5IBUB 4MD4A 4CVUA 3ECBB 1SYVB 3ARGA 4ZAKA 1CE6B 5EZLA 2R2BB 5EUOB 3RI5K 2OJZH 3GBNH 3VGDA 2CXKA 2W9EL 3C2AL 3TJHD 1NCAL 2HJLA 2Q20A 3C87A 3NABL 4XHQA 4CAGA 4IMKC 1CD0A 5E1HB 3D9AL 1RUAH 4N0RA 5DQJA 1IM9B 2DS4A 4PP1C 5E8NA 4X4YB 4BYHA 3L95A 4G8IA 4KZDH 5KN5A 5KVMC 5DMGD 5T1LD 3QCVL 1RZ8A 4RISH 4GKNA 3NACH 2A38A 4TOYH 1X44A 3CCHB 5C0RH 4D2NA 4HWEL 4ONFH 1T6WA 3VXSD 5F97E 4E9LA 5C8JB 1FVEB 2RQ8A 2X1XR 2QSCH 4KXZH 2F54E 3ZSSA 4DKAA 1IM3B 4TNWK 1GAFH 4N6GA 4TVPD 2MCPH 4I5BA 3MLYL 3HI1B 1RIVL 4NO0A 3U9UA 1UCBH 2HLFD 1NSNH 2Q7YA 4KKAD 4X6DB 1AXTH 2AQ3A 4XVJH 1JHKH 4Q9CA 5EA0H 3OJMB 4JFFA 4M48H 3W0WD 4FTVB 1MHPH 5HHXL 4G8FB 3HE6A 3SEPA 4K3GA 1NC4A 5D7JB 5B39G 1UA6H 5IP4A 1F58L 2HBQA 3RL1B 4HXAH 1MH5B 2Z93A 1NMEA 4ZSOB 4E5XB 1AXSB 1KLFA 3QHFL 5HI4C 2V17H 4KROC 3WO3B 2DQUH 3STLB 4CUCA 3EDJA 1FGVH 1YMMD 3EOBB 5DRNA 5AEAA 1CD9B 3U1SL 3VXOA 1AQDA 1NDGA 1D6VH 5D2NB 2ZSWB 4ZUUA 5B38A 2NN3C 2Q6WA 2J2ZA 1KCSL 4QRTB 4PY7B 3VXTB 5F7UA 3ROLB 3RNKB 4D0BA 3WXVL 4CNIB 3FQUB 5EU3B 5HI3C 5T1LA 2R1WB 5AYUH 4NGHH 1CGYA 4IS6B 2JELH 3K74B 2DQDH 3DO3A 2MTPA 3M1BB 5JNYA 2VOTA 2F5AL 1Q9OB 2J3SA 3VXSA 4LHQB 2WDPA 3DIFA 5JW4N 3D2UB 1LE9A 1FH5L 1XR9A 2N7BA 1C12B 4ODVH 4RMTA 4JY5H 4KJYB 2C3XA 3MRHB 4HKJB 4FNLH 5AG8A 3W39B 4AIZB 3B9AA 4HH9A 3WV0A 4RWYH 4OZIF 5HGGS 3FQNA 3LN5B 4K23H 4LCUB 4LPCA 15C8H 1AO7B 1I7RB 4EHDA 1GIGH 1NC2A 2NY4D 4PGCB 5DJDB 4KKLD 3W0WA 1VERA 5LQBH 1RD6A 3H2WA 1FGNL 1FBIL 1JPFA 4BQ8A 5DUMH 1N5YH 2R56H 1SMOA 5F9WC 1INQB 3RTQA 1HHKA 2VJXA 5AZ2L 1DEEB 3HNVH 2AJVH 1CU4L 1D6EA 4WFEE 1R5WB 3MUZ1 4MDJB 1E4XI 5E95B 3D18A 3G5YA 2R4SL 1YMMA 2IF7A 2HJKA 4LF3B 1KPVA 1QA9A 2J88H 4FQ2H 4DCQB 2VIRA 4K8RC 2AAVA 4L3CB 1PFCA 2AV7B 1J05A 3RIAK 5F1KC 1Q9LA 3C5ZD 1FNGB 4PJAF 1KFAH 4UUJB 1LWRA 4JO4L 5C08B 3C6SB 3FQRB 2DKSA 1QFHA 3W5MA 4JKWA 4P9ML 1FL3B 2ICWI 2VLLB 4QRRD 1P84K 3T8XA 2KQNA 2BMKA 4RGND 3QAZB 4PJFE 3BD4A 5KSBA 4ODTL 2I9LB 3P77A 4RFNB 4KMQA 1I8IA 1HI6B 3GMOA 3PE9A 4KVNH 4N90E 2AW2A 4WO4C 1J1OH 1U2CA 5ID0B 3C8KA 1HOCA 4A6YB 1TTUA 3EO1A 4X80H 4BH8A 1DL7H 4KQ3H 2UYLB 2A1WL 4M7LH 3T0EB 1HHIB 1GGYA 5GS0L 2FGWL 4JM4H 3KLAB 3CDCA 4OCSH 1RIUL 1E6JL 4WV1C 5KVFL 4F15C 4WI5A 1KC5L 2ZUVA 5INCB 4Y16A 3CMOH 3EZ8A 3B43A 4CVXB 1S9YB 4KQ4L 1MHHA 1NKRA 4JJHA 3DI3B 4W81A 3NVQA 4D9LH 4M7JL 1WICA 1J0HA 2X4NB 2HA1A 4PJ7F 4WW2F 5GS0C 5E0QA 3V8OA 4Y19A 3MV7E 5LXGH 1ZA3A 1NBZB 2D7TH 3F7VB 3FO2B 4FP8H 3OPZH 5EBGA 5ICXB 3C5ZA 2E8YA 4QXUL 2GJJA 5DMKB 5FCUL 2XRAL 2Q8AL 5DUBB 5C6TL 1YEGH 5HYJB 3MACL 5CZXD 4EN3A 1MVUA 3K81A 4XMKL 4NQXA 4QRRA 1HH9B 4JDTL 3GSNH 4LVHB 5SX4H 4DEPB 3KLHC 5GGVY 4JZJB 4PP2B 1TQBB 3VFOA 4M1CD 2I26N 4MSWA 2XXCB 4NQVB 5CGYC 5FYJH 2BRRL 4F7PA 5HJ3B 2CUIA 5DLMH 1CDJA 4MZ3A 4JO3L 3K2UL 5GS1C 4BQ9A 3V6OA 3PL6B 2HJFB 3SDAD 1R0AH 2ICWB 3CNKA 3FONA 3L9RB 1AKJB 4YUEH 1BD2B 4F7TA 4P48A 4D9QD 4HUNB 4R4ND 4Y4FC 2HFEA 1AGCB 3NCBB 4AL8H 4XAWL 4OCWL 3HMXL 3FAWA 4KZEL 4LCWE 4I2XE 2GI7A 4I0PB 4JQYA 2CK0H 3I2CH 4TN9A 3QUZB 3U7WH 5C0CE 3TPKA 4XCFL 3DI2B 4WVRA 5FK9B 5EO0B 4HGMA 5DO2C 5E5MA 4I3GA 1TXKA 5HDQL 3MRKB 2OP4L 5D5ME 4PLOB 4ZVQA 2VXQL 5I17B 1WAAA 2FATL 4JRYD 1U92B 3TESA 4RAUB 3KLDA 4X6DF 5CILH 5D7KD 2VDRL 1N59B 1QVOB 3ZHKA 3T0VA 5I1AB 4PRBB 4M6AA 3VG9C 1G6RB 5TE4H 2J8UB 5C0DB 1MJUL 3QDMA 5FV2A 1CIUA 4D8PA 3DX7B 4C56D 4LBEA 3P0YL 3TVMA 1D5XA 1JF5A 5I0DA 4F2MB 1S7QA 4PYGA 5C0EB 1OSZA 3AAZB 2Q8BL 2VDPL 2X4RA 4LSQH 4XMPH 2X4QB 4OD3L 3SDAA 2HT3C 4N8PA 3RL2B 4NOLA 3QHZL 3ARYA 4KH2A 4OCYH 3BGMA 4YR6B 5IGXL 5MHSE 1KN4H 2XKSA 3DEJA 4R2GD 5T5FH 4K9EH 2R2HA 1I1AC 4Z0BH 1A1MB 4CVZB 5C7XL 2CH8A 4MA1C 2M1KA 4ZS7H 5GQBA 4HFWA 4LCYB 2DTSA 1KEML 5FYLD 2ITDA 3ZKMC 3RVTC 2ATPA 4GO6B 1M7IA 5FDWB 5DR5H 5IOPA 1PZ5B 1B6DA 2QL9A 1F4WL 3CU1A 1JNLL 4ZO6A 2XZTA 2K1MA 1QSEB 4JQZA 4JHAL 1ORSB 3FQTA 3OKMB 2CGRL 2GEEA 3BZ4A 4PGDB 4Z76B 3VGHA 2D7QA 5ALBH 3SCMB 4UV4L 3BI9X 3PDOB 3JV6B 3QI9B 1QFPA 1A14L 1VACA 1JGDA 5C0AE 3TO4C 1R5VB 2DM3A 4J7RA 1LDPH 4NNPL 4C56A 1I51A 1ORQB 1FP5A 1KBGH 1ZTXL 1JYNA 3MO1B 1JN6A 3IS1X 1Z3GL 2AJUH 5HHVL 2VZUA 2Y5EA 2ADJB 4A6YH 4LLUA 5DZOA 4HDIB 1P2CB 1WCBB 1LO2H 3WIFA 1FRGH 5EN2A 3GSRA 1BREA 1NUGA 4G7YH 3OWEA 4GW5A 1BZ7A 4PJDF 3SDXA 4HHAB 3AB0C 3N1PC 4MQTB 2V9TA 5FKPB 3GGWB 2M26A 4P23B 2AEPH 3FQXA 3LCYA 4PR5B 3L3KA 2QLFA 3V0WH 2EDQA 2I07A 3QPXH 1N26A 3PWJA 4GAGH 3RDTA 3DURA 2WBJA 3H1PA 4YPGB 5IASA 3T3ME 5J1TC 2R29H 4JFEE 3QNZB 3T09A 4M5ZH 4P5MA 5HI4D 4JFQA 5EWIH 5I0ZA 5DUPH 3IFLL 1UM6L 2V7HA 4QEGA 1NANI 1LO3H 4L8DA 3SDCC 5F1NA 3DVFA 5C0BB 3UPCA 2QQNL 1N64H 3GMPB 4Z7WA 1MFEH 4ZFZB 1T0NB 1MCBA 4HX1A 4UDTA 1XGRA 4XPHL 4YC2C 1M7XA 3OXSB 4KTDL 2VR5A 1UCTA 5HI3D 3QFJB 3VGAC 1BEYL 4PRNB 2GY5A 4FXOA 1NBVL 3GSUB 1A1OB 5GGUB 5KTEH 1I9EA 4R96B 1A6VL 1ZE3C 5JW4R 4UOW0 1NGYB 4OUOA 3QQNA 5HYSG 1LK3L 3ARVA 1CF8L 4MNHA 1ZGLP 2RB8A 2FZ3A 4AY0A 3EDEA 3GJFB 3MNWA 2JK5B 4N8VG 5GISH 3QBTB 1F6AB 1CLYH 3WL9B 3DUHA 4RGOL 3V0VB 1GFWA 4PG2A 5KAQG 1KENL 3EOYG 3IU3B 1S7UB 3G6JA 4XP9H 1P84J 4MNGE 1DFBL 4WJ5A 2R1XB 4KJQC 4QYOA 4UOW1 1C16B 1CDYA 1N8ZA 3QG7H 4KJWC 1IRAY 3MLUH 2C3VA 5K9OA 2ED7A 4GMTL 5ITBH 5J8OA 3EYVB 3BW9B 1FFNB 1WBXA 5FKAA 2M8XA 3KPRA 4CMMA 4K3JH 2E3VA 4P2QB 5I1KL 5E2UL 2H26B 5JOFB 1HQ4A 4K7FA 5TFSL 2RGSA 1MCOH 3O81A 1G0XA 2H6PB 4PLKC 2EDNA 1KJ3H 3BIBX 3DBXA 5FUCC 2D7MA 2YZ8A 3AU1A 2P8MB 4U1HB 3UTTB 4UINL 3UROR 3BDYH 4K8RD 2YS4A 5L8LB 4LKCA 3HZKB 2WQ8A 4O2CB 3S35L 4EIZC 4HKXA 1UXSB 3MGOA 2KPNA 3BKYL 1G6RH 1H8SA 5I75C 4BFIA 4HWNA 2XWTA 1OP3H 1IL1A 2Z0BA 4I0CC 1DVFB 3U6RB 4PRDA 4HJGB 4KTEH 4C4KO 1ZLSH 4RRPG 4YE4L 3SGKC 3C2SA 4J3WA 5FGBA 1MFAL 4MHHI 2OR8A 1JHLL 4PTTA 3ARPA 3AREC 4MD5A 1Q72H 3BXNA 2EEAA 3RWFA 2AABL 3TFKD 4XNMB 1FVCB 5CEYB 1KNOA 2QADB 4NC0B 4WO4D 1GGIL 3H42L 4S1QH 4JFFE 2ZKHL 5I8OL 3TF7C 4ZVPA 5C9JA 2WP3O 2XY1A 3BGAA 4MS8C 1XIWC 2Q86A 4OKVB 4X7TA 4K94L 5CAYB 2P4AB 4OT1H 5DJCA 3IXAA 2J8UF 2OL3L 4JHZA 4KV5F 5ITFA 2Y07L 3NN8B 4PRHA 4JPIB 1MHCA 1JNHB 3O9WC 5EU6A 5AZEH 2OK0L 1FG9C 3MUHL 4LVNB 2VLRA 4L4VD 4FXKA 4X0KB 4LLWA 1JGEA 1NGXA 2GSGA 2OTWA 3RVWC 3O4LB 4QTHB 4HW6A 1Q0XL 2MFNA 5EC2A 5GS0D 4DVBA 5JOEA 4MAYB 3H7LA 3KXFD 1CDBA 3P2TA 3ZTNH 4S2SA 3F7PC 1C7TA 1W72H 3G08B 4N0FB 3Q5OA 1KCLA 3KPMB 5FCSH 2A0LC 3BPNB 3VXSE 3IBCA 5IQ7L 1FQ9C 4GXUM 3DV4B 5GHWH 3O6FC 4WTXA 3RVVD 4UQ3B 3DVNB 4L3ED 3KLHD 4TVPE 4OFKA 4P46D 5GJTL 2EDWA 1HHHA 3PHQB 4L1HA 1U8NB 2GITA 3HRZA 5CGYD 1PSKH 5TDOA 2CIIA 3D85B 3GI9L 3AMKA 2DD8L 4H25B 3W0WE 1YJDL 3OAZH 2CMRH 4FXGB 2JJWA 1JTTA 4Q9RL 1GSMA 2LU7A 2MHAB 3QA3A 5B3NA 4KI1A 1KIQA 2BVEA 2B0SL 5DK0B 4Y4FD 3ZSTA 5KSAB 2A6KB 4HIIA 5MEQB 2R69H 5K9KA 3P4NB 1YMME 1W0WB 5KVGL 3FCTA 2R0KL 4HLZH 1QX3A 2DF3A 1FNLA 1HCVA 3NZHL 2XTJB 4DW2L 2IH1B 1YJDC 3HCVB 1RFDH 4XC3L 3AY4C 4HJJL 1MF2H 5HYSA 5J06A 3WHE0 2ZSVB 3KXFA 5T3ZL 4D3CL 5DO2D 3MRDA 2ZCKL 4N8VA 3W9EB 3FO9A 1PQZB 1AIFA 5F7HA 3IDYB 4N7JA 1CD1B 3RRQA 1SJVA 1QRKA 3IDIB 4I3SH 3TIDA 1EEYB 4I18C 3UJJL 1MLCB 3BP7B 4EBQH 1NBQA 5KSBE 1B0RB 4PJGA 1Z9SA 3UYPA 4UDUB 3V7AG 1NBYA 4PJFB 2CK2A 3ILPA 5DJAA 1SVZA 4L3EA 1I4FB 4FZ8L 4V2CB 3WFBH 4P46A 1UQSA 4OI9A 3A6BH 1TETH 3W2DH 1G7QA 1NQBA 2RHEA 3PIQA 1JWUB 3EFDL 3GJFH 3CFCH 4W6WB 5DJ0A 2ITCB 2XWBB 5I1EL 3EIFA 5KG9A 4GH7B 2O5XL 3N85L 2OR9H 1UT9A 1DCLA 1BVKA 4Y4KA 4J1UB 2HT3D 1FFRA 4JN1H 2WBKA 2EIBA 1FIGH 4I9WD 1YMHB 4WUUA 4Y4FA 1QYGH 1RPQA 1IZKA 2BVYA 3TWCL 4APQC 3CZJA 1AC6A 1K9TA 3SIRA 1FZKB 3LEVL 4RRPA 5EU7E 3KJQA 3PXHA 1KEGL 2NZIA 3CPLA 3RVTD 4P9HH 3MV7B 1TCMA 3FB8A 5F7EL 1YEHH 4BQBA 3D6MA 3MV8A 2EC9T 5IB5B 3U2SA 4OAWB 3MQIA 1U93A 3INUH 3O0RH 1JYWA 4W4NA 2R0WL 5IG7A 4LCIL 4LIQH 4G9FA 3WXWL 4RFEB 4QRRE 3HMXA 3QFDA 4L9LC 5IC6A 1NEUA 4LQ1A 2N4IA 4RGNE 5J12B 2QR0A 4X98B 1U3HC 1BAFH 4QTIH 3OX8B 1MIMH 4DKFH 4XNUH 3CFKA 3WJJC 4W70A 2X4TA 1CQKA 3S35X 3TO4D 1U3YA 5DHVB 5IB1A 3OAYK 1BVLA 3MRPB 1NANH 5JHLH 4P0DA 3MUJA 2B2XH 5D6CB 3CFJB 3V6OE 1KLUB 3DROB 3GFUA 4G43A 2BDNL 5E2TL 1YN6A 4FHBD 4XNZB 4ZYKB 4TSCL 1URLA 3H9HB 3ZO0A 1C5BH 5GSRB 1RUMH 3UYRL 2GJZB 1OAYH 1FYHB 1KPUB 3WHXB 3K0WA 3GI8L 1OPGL 4QUAA 3TBTA 3RZCB 1M72A 4Y1AD 1U91B 4YFLF 1VB9A 1CD8A 1WF5A 2GAZB 4F7CA 1AP2A 2X41A 3KYNB 1LHZA 4KKBC 1MSPA 3KPTA 3VFVB 3CSBA 5C0NC 1HDMB 4OM0H 4P5TB 4Q6IC 3RQ3A 3PWUA 1FN4A 3DMMC 3BUYA 3ITNA 2VYRE 3CVHB 3QRGH 1E4KC 5TF0A 5D5MB 3QB7C 5IFAL 5ILTH 4QNPE 4YX2H 1LMKA 2XA8L 1GZQA 3ARBA 4M9PA 4C59B 1MNUL 3MREB 1JF1B 5E2WH 4XTRC 1U8PA 1Y0LA 3NFNB 3QXVA 3QXDB 2AK1L 2BVPA 2OX5A 5IK3B 1UM5L 4WU5B 3SDCD 4G7VH 1RZGB 3DXAA 3NTCH 5HVGB 5IJKA 3GMNB 4P49A 4X5WB 2BJML 5HTSA 4K2UL 5DEGA 1KB5L 3QUXC 2XZQH 1WC7B 3K80A 1LO0H 4P2CG 4XPTL 1MQKL 5K9QI 4MGXA 3IT8D 4GBXC 1I8KA 1MLBB 1VFOA 3SPVB 3Q2CA 3DX8B 1L0XA 2YEZB 4XGZA 5DA0B 2V2XB 5B8CA 3HC0A 4D9QE 3IDGA 2V2WA 3GBNL 3MRIA 5BMFL 1WBYA 1OY3B 1T21B 3SKNB 3VH8B 2DWEB 4TPRH 1KELH 3QEHA 3WNKA 1RK1B 1RUAL 4KJQD 1UXWA 4AH2B 3GIZL 5GGQH 5E2VH 4KJWD 4KZDL 1OTSC 3QIBC 5JPNB 4P5KB 5DQDH 5C0RL 4JRYE 4ONFL 4NQED 1XF2B 2PTTB 1J0ZA 1F6LL 4H5SA 1D5MA 5L9DL 5D7KE 3KYKH 3WKNA 4XP6H 4TRPH 1F11A 4NKOA 3LKRA 2VXUH 4R0LB 4PLKD 2CR6A 1I1FB 3EYOA 1XF4B 2E9IA 2EH7H 4M9RA 2P43B 4CW1B 4LVOC 4MX7A 1UACL 3ZYZA 3P9WB 4MD0A 5E8EB 43CAB 4NWTH 4C56E 2ZZUT 4NZDA 1JPGB 1RJCA 3DHJA 3KPPB 4AEHH 5EA0L 2AJ3B 1CFTB 4M48L 1UWEH 5DYOA 4XBPA 3BP5B 1MHPL 1TJHH 5L2KA 2QBWA 2PO6C 4PJ5A 3QDJB 2PTVA 5CJQH 1DZBA 2J5LB 2YSSB 3EGSB 5ALCH 4LFHG 4CKVX 4OFVA 4EDWH 4NUJB 5CJ8A 4QXTA 1FGVL 3O8XD 4TNWF 5F6IB 3O3DA 1BQHB 1QFWL 3SGJC 1D6VL 2P7TA 5DD6B 1HH6B 5IV2A 1QSZA 1RUQL 5FYLE 4ODUB 1KMCA 4KK5C 3QDGB 1P4LB 1R24B 3BH8B 2X1QA 4PJFF 4CRPA 1TZIB 5F3BB 1I7ZB 1K4DB 1ZHBA 5F96H 1Z5LB 1TQCC 3CUPB 2EE3A 1S7SA 3BH9A 1F3DJ 2JELL 2DQDL 3BO8A 5F88B 3O9WD 1BLNB 2FX7L 2H48A 1IQDA 32C2A 3FT4A 4NQEA 2VLJD 2XFXA 4AIXA 2FJHA 4HPYH 4YQXH 4XPGH 2B1AH 2HFGH 2VXTH 1T7WA 3MRNB 1SC4A 4DUWA 2F8XC 3RVWD 1PEZA 1CBVL 4Z7WE 2DKOA 4DUVA 3QUMB 2VXSH 5F7FA 3QIUB 1CT8B 5IM7A 2AV1B 4FNLL 2CJUL 1OD7A 3O3BB 4ZPTB 4QRSA 3MBXL 2NY6B 2HBZA 4HKZA 2KBGA 5HYEA 3NCYS 15C8L 4PJBB 3TV3L 5BXFB 4X7EC 1GIGL 2A0LD 2HKFH 5FYKU 3PCXA 3QPQC 5DHVH 2Z31C 1XCQB 3O6FD 4HH8A 3MV9D 5HPMA 3DO7B 3SGKA 3D0VA 3QWRD 4OLVH 1X5FA 3HNVL 3B9VA 2AJVL 4KU1A 4FEAA 2FDBP 8FABA 3PP4L 3G6JE 4LNRB 1HHGA 3A6CH 3PGDB 3O8XA 4FQ2L 5HGHA 3FB6B 4MXVE 4X9GA 1DBKL 4Y5YA 3LOWA 2V7NA 3FZUC 4K7PH 4ZVRA 1J87A 4MD4B 1EA9C 4FFWC 2EYSA 4WWKA 3ARGB 3DHMA 4E41D 4ZAKB 5EZLB 3MX0A 4KMTL 4AEFA 3VWKC 1ZV5A 2YOCA 2HJLB 3CVHH 1T5XA 1OGAA 2PW1A 3BVNA 3H3BC 5DQJB 1NGQL 1DANU 5IUSA 5E8NB 4LFHD 4KVNL 1NJ9A 3IJHA 3L95B 4G8IB 3S6CA 1EPFA 2PF6A 4F8TA 4HCRH 3S4SA 5KN5B 5ACMA 1RZ8B 3HNSH 4GKNB 2OL3A 1RAMA 1P53A 4M7LL 2X1PA 4WI8A 3RIAF 3VXMD 2AK4A 2YN5A 4G42A 4OCSL 2WSKA 4N7MA 4NP4H 2XZDA 3O6FA 4WW2C 5F1OB 3WE6A 3U79A 2D31B 4I5BB 2NW3A 2X5PA 1CTNA 4NO0B 3V6FA 3U9UB 1A5FH 2Q7YB 5D5MF 3T4YB 4ODXA 3NFPA 4MA8H 3BWAA 4LNVA 4JEGB 2BP3A 4JFFB 1C08A 1YEJH 2WZPD 5D1XA 4OI7A 5E8DL 3WFEH 2AXGB 3OPZL 4OGXH 4TUKL 2C3WA 4M7ZB 3HE6B 1F1JA 2DBJA 1NC4B 1K6QH 3PQYB 3ARSA 3MA9L 1YEGL 5J11B 3OKDA 4JCMA 3KWWB 2Z93B 5JA9A 1OLLA 4BUHA 4ZS6C 4APQD 3GSNL 1EGJL 5DRNB 3FO0H 2QSQA 3VXOB 1AQDB 1NDGB 3WS6A 3EO0A 2H4YA 4ZUUB 5E5UB 5B38B 2Q6WB 5J1AA 2Z9TA 3ZKND 2LAGB 4QXGL 2NY5H 1RHHA 3AY4A 3GIVA 3W9DA 4OZGA 4D0BB 4RMVA 3HS0A 1N6QH 2OMNA 2VDLH 4C58B 3T2OA 1RURL 2VDML 3KJ6H 3T4AA 1AD9A 5I74B 4AM0A 2H4WA 1MAKA 2Y9RT 1QFWM 2HLAA 5JNYB 5M7QA 4I18A 4OCMC 1KB9K 2B1HH 3DIFB 3QO0A 1PGRB 4KAQH 1U3HD 1FG2A 4FN0A 1LE9B 2ARJQ 3P30L 2Q76A 4AL8L 3NA9H 2EE2A 3TNMA 3QEGH 4L8SC 2YD7A 2CK0L 4HH9B 1HSBA 3VFGH 3S34L 5D2LA 3FQNB 1MRFH 2D0FA 5CCKH 2WIMA 4NC1C 1NC2B 3W0WB 3PGFH 3T77A 5K59E 1CTOA 1JPFB 4GOSA 1IAIH 3AS3A 3UO8B 3RTQB 2KKQA 1HHKB 1F8TH 2FLRT 5CZVH 5TDPA 3C6LA 1OM3H 2VZOA 5D7JC 3SGDH 1D6EB 4EHNA 3BX7C 4L4VE 2H3NA 3D18B 3G5YB 1MJ7L 2ZUUA 4QOKA 3BEWA 1YMMB 3DRQA 2HJKB 1KPVB 1QA9B 1BIIA 2VIRB 3PP3K 3VXQA 3IGAA 4KKBD 1J05B 3KXFE 2DICA 4X83A 1Q9LB 5M95B 4JO2H 4PTUB 4KUZH 5D2NC 1NLBL 4RX4D 2IAND 1J10A 4ERSH 3NPZB 4AYFA 2I60H 1C5CH 1WZLA 3QUMH 2W9DH 2OCFD 2APXA 4PJGE 4NNYA 3T8XB 4BM7A 4LSTH 2BMKB 1UEYA 4XTRD 5KSBB 4UILH 1A1NA 4L3EE 2IADA 3GSXA 3P77B 4OCYL 1U3HA 3DETD 4UBDD 1EAPA 3LRGA 3GMOB 4Z0BL 5C3TA 1L0QA 3C8KB 1HOCB 3QUXD 3EO1B 3T3MF 5I30H 4BH8B 2ZG3A 4FQJH 4HK0A 4P4RA 4GBXD 2BVUA 3KPNA 2UZXB 2YUZA 3SQOH 2NY4B 4M8VA 4QUGA 4LQFH 2FH6A 2GUOB 3I9GH 1BM3L 2DQCH 1YEEH 1CVSC 1FL6A 2XOTA 4Y16B 4Z5RA 1MJJA 3O2WH 3OTTA 4K9EC 5ALBL 1MHHB 3QJFA 3UBXG 2CO6B 1SJHA 4ZO9A 4JE4B 3R7NA 2V2TA 4LAJH 4Y19B 4CN1A 4JM2A 1ZA3B 4HWUA 5EG6C 4BH7A 1LDPL 1OTSD 4HPOH 5DD3H 3QIBD 3C5ZB 3VD7A 3F58L 1TZGH 2IANA 1KBGL 1D3CA 1CDCA 2W0LA 1LEGA 2X05A 4ZD3L 1KJ2L 4QXWA 1KCKA 1F42A 4EN3B 4ONGL 1MVUB 1I75A 3U7YH 4NQXB 4QRRB 3H7BA 1NFDA 4RGNB 2JE8A 2KH2B 4G7YL 4ODWA 3T0DA 1AGDA 3VFOB 4MSWB 5GZNC 2CLRA 3LH2L 4PGJA 5TPWH 1T7VA 4RFNC 1OAXH 5IESH 4F7PB 2W91A 3L6FA 1R6VA 1A02N 2RR3A 3QIWA 4UTAL 2G5BA 2VLMD 3QPXL 5CJ5A 1ZXQA 4GAGL 2PO6D 5EUKA 3PWPD 4Q58C 3FONB 3T0EC 3NOIA 1K3ZA 1BFVL 1OTUC 3M17A 4F7TB 4KKCC 3ULVH 4I9WE 2W60B 4MVBC 2HFEB 1IGTA 1WZKA 1XGYH 5EWIL 1GYAA 2FR4A 2O61A 4F58L 1SY6A 4NBZB 1FZMA 3N1FC 1EVUA 1LO3L 4XB8A 4YPJA 4PV8A 3UPAA 5ICZA 4ELMA 3VXUD 1I9RL 1KB5A 3F62A 3I02A 2DMBA 3HNTL 4KK5D 4BQCA 5FFLA 4FG6C 1BF2A 5E5MB 2GTWA 2LU4A 3CVIL 3NZ8A 5FM4A 3WNMA 3QIBA 4MA7L 3ZYJA 2NXYB 3HHRB 5IAEA 4KTYA 2R2EA 4V1DA 3EYSH 4M93B 5KTEL 3MXVL 7CGTA 4ZNEA 1ZA6A 4NSKA 5E9DA 4PRYA 1IC4H 3BEVA 1II4E 1YEDA 4NFBA 1MJ8H 2XPGA 5GISL 3L7FA 3QDMB 1I3RA 2Z35A 3SQBA 5J6GA 4D8PB 4LVHC 2MQCA 5EO9A 4DCPA 4DEPC 1FL5B 3GHBH 2IBZY 4JZJC 1TQBC 4LBEB 3TVMB 2FO1A 1D5XB 4HMEA 3HZVA 5J89A 1S7QB 1FORH 4FQCL 3B5HA 5J7CC 2I5YH 2YD6A 4JANA 3MOAH 1E6OH 5JIPA 1OSZB 2X4RB 3QPQD 5INDA 2NTSP 3C5SA 3SDAB 1KPRA 3FN0H 4UB0H 2LTQC 4F7MA 1HIMH 3PL6C 4YHMH 3BGMB 1P9MC 3OKEA 5HHMD 3ARTA 4F33A 1JZ5A 1IAKA 3UJIL 3MLPA 1MCOL 3B5TA 2R2HB 1KJ3L 4J6RL 2AJSH 1KT2A 2BY0A 4G3YH 4ODBD 4GW4A 3BIJA 4HFWB 5IAGA 1TNMA 3V7AE 2ITDB 1GC1L 3TZVA 3IKCA 4F80A 1T1ZA 2ATPB 4HIXL 3CU7A 1M7IB 4QRPD 1CLZH 1HSAA 4I0PC 3FZUD 5IOPB 3QUZC 1VFMA 3WDHA 3EBAA 4TULH 3VFNA 3U4BH 4KK9C 4FFWD 2HFTA 4KHTL 1TCRA 4KTEL 3UC0H 3FQTB 3GBMH 2AS5M 1DN2A 3DV6A 3BZ4B 1KUMA 1KJVA 4XBEH 5C9KA 4IYRA 1KACB 3VWKD 3SE4A 1CE1L 4YHZH 3LKQA 4G80A 5F7WC 5BZDA 1VACB 1JGDB 1Q72L 4PS1A 5EOCH 1G7LA 2FIKA 4XPFH 3V4UL 3V4OA 2HTLC 3NFSH 4XNXH 3QQ3A 1F00I 4U1LA 4C56B 2K3TA 3KS0J 3NCJH 4P2RD 3GMMA 1YEKH 1YY9D 3IJSA 1TJGH 5C09B 4MA3A 3UBXA 1JN6B 3IS0X 4YEFA 3DSFL 4OGAC 3VG0H 1EDQA 1RWVA 3U83A 4LLUB 3OB8A 3S5LA 3WIFB 4NRYA 5AZEL 5M94B 5EN2B 3GSRB 3D25A 4GW5B 1G9ML 1BZ7B 4PUBH 3SDXB 4D3ZA 5SWQA 5FUOL 1FDLL 3ULSA 2WV3A 4NT6A 3M07A 4YBHA 3FQXB 4R4BA 1XGPA 2YRLA 1KB9J 3L3KB 2AEQH 2I07B 2JCCA 5KSBF 1IARB 1W72L 3PWJB 3RDTB 1NAMH 3DURB 3KYOA 3TIEA 2WBJB 4OD2A 3WKML 2CIKB 2ZUYA 3RVUC 4NQEE 4GXUN 1I3UA 4J4PC 4P5MB 1PZUB 4JFQB 5ESVA 4ZS6D 3ME0A 2V7HB 4X99A 3ESVF 4H1LH 5J4MA 4L8DB 3TBWA 5FUCE 1K4CA 1CI5A 1RUKH 4HUXA 5F1NB 4DZ8A 3MLRH 4N9GA 3SCMC 4Z7WB 1I9IL 4HIJA 4DN3L 5AUMA 3QI9C 4YHOH 2DI9A 1KCRH 4HX1B 4UDTB 1J1PL 1XGRB 5BV7L 1WZMA 1F3DH 1A6UL 4Y2DA 3LQAH 4P2RA 4GMSH 4EJFA 4YDIL 2CMRL 3PNWA 4J3UA 3I50L 3IBFA 2OZ4H 4RDQF 2DLFH 1EHNA 4GT7A 4UU9A 3H3PH 4S10A 4XMLL 1EMTH 4MNHB 3V7MA 1NCDH 2FZ3B 1OP5H 3MNWB 1U8HA 3ZKXC 4PLJD 2R69L 4JFDD 3UX9B 1SYSA 1A2YA 2FBJL 3LKPA 4LGPB 5FYJD 2F19H 4J3XA 3QP3A 3G6JB 1JJUA 3QH3A 4UAOB 1IQWH 1FNHA 2ID5A 3IETA 4WJ5B 3AMLA 4QYOB 1T1YA 5JORA 4QGYA 1N8ZB 1MF2L 4HULB 4P23C 1WFTA 2C3VB 4M5YH 2DWDA 5K9OB 5DHXB 1WBXB 4Z7NE 5FKAB 3KPRB 4KRPD 4CMMB 5C3LD 1FIEA 4DTGL 1T20A 1JZ2A 5GZOC 5KSVA 2NLJA 2VLJE 1G9NL 3IFNL 4EBQL 1FCCA 1HQ4B 4K7FB 5D7JD 2DYPA 4OQTH 5GGTL 4F57H 3DBXB 1FFOA 3AU1B 2G60H 1YYLH 2W92A 2H5IA 4H0GA 5IB4A 3A6BL 2E8ZA 4PRZA 4NKIH 4Q0XH 4LKCB 1PKQA 1TETL 4MQXC 4HKXB 2QQLL 3GMLA 3MGOB 1W8NA 3I6KA 1KN2H 1RWPA 1S7VA 1QSFD 3HUJA 4BFIB 4LLMA 3ULUL 2XWTB 3QNXA 1IL1B 2ZPKL 4N9OB 4HS8L 4PRDB 1DBAL 2LV4A 5F9OL 1L0YA 1BZQK 2JJSA 3B9KA 2E9BA 3IB4A 3GSNA 3MV9E 4JN1L 1EGJA 3SE3C 2C4FT 1FIGL 4DAGH 4PTTB 4XC1H 1F4XL 4MD5B 1R3IH 3BXNB 1IGFL 2HWZH 3RWFB 1A3RL 3AVEA 1KNOB 3WDIA 4ESKA 5AWNL 4JFDA 2ARWA 4KK8D 1WAAF 2C2OA 4LARH 4L8SA 2QL7A 4K3HA 3SBWA 4QNPF 5C9JB 1H8OA 4P9HL 4WI6A 2BY1A 2Q86B 1YEHL 4JZOA 3CSYA 4X7TB 5DJCB 1YY8A 3IXAB 4BZ2H 4G6JH 5ITFB 4PRHB 1AO7D 1WWWX 3O0RL 5C1MB 4OLUL 2BSRA 1MHCB 4E41E 1RUPL 4LIQL 4PB0H 5EU6B 3CDYA 2N7AA 2VLRB 1QKZH 2IFFH 1S5IH 4QCIA 4FXKB 1AHWA 4LLWB 2UZIH 5GJSH 1JGEB 1NGXB 2GSGB 2OTWB 1BAFL 4QTIL 3O3AA 1JWSA 5EC2B 1T6VN 4DVBB 4OZGE 3D3VA 3STLA 4S2SB 4DN4H 5F7DA 3QULA 4MJ5A 3I6LD 4FFYH 3OAYH 4KUCF 2NX5D 2B2XL 3RBGA 2RIKA 1QSFA 2XIDA 2DOCA 1YECH 3PF2A 4IHOA 1QP1A 2FEEL 4GAJH 4UT7H 5C08D 1TDQA 1ROWA 1C5BL 4YBQC 4GKSA 1DVFC 3DUSA 1K5NA 2X44D 4JHBA 2EEBA 4G8EA 4J3SA 2VAAA 2FNBA 4CADA 1HHHB 2WWKT 4NHCL 2OSLA 5GZND 3UO1H 3B2VH 3HRZB 5TDOB 4K3DL 5JXEC 2CIIB 2VC2H 1TPXB 4FQLH 1KIPA 2QADC 3QT2A 4OM0L 1AGFA 3CJJA 5B3JF 2XKNA 5TF1L 1VENA 3IJYA 3HR6A 2ZCHL 2Y72A 4R3SA 1LE5A 2R8SL 3OKOA 5SV4A 3LN5A 1OTUD 1RULH 2N1KA 4KKCD 4YX2L 3QA3B 4M4PA 1KIQB 1LO5A 3MSPA 4MVBD 4YAQB 2IBZX 1KCUL 4HIIB 4J12A 5K9JL 5K9KB 3ALPA 4XNYL 5D7SL 3FCTB 1TVHA 5JOPD 1NAKH 5IQ9A 4LVNC 2X42A 3NTCL 3RZWA 3K4DA 4HC1H 4Y5XA 3UJTH 3CZFA 5HYSB 3R5JA 4WFFD 3V95A 5BVJA 2VH5L 4XCNA 1YEIH 2DLTA 4FG6D 2VXVH 2AEIT 3MRDB 4AJ0A 4N8VB 1IJ9A 1HXMA 4OF5A 1JVKA 3FO9B 3G5VA 4MAYC 5A2KH 1AIFB 2NNAA 1LO0L 2V9QA 2NX5A 3SDXF 3UTOA 5KSUA 4G5ZH 1IAOA 1ZWIA 3F6LA 4GQPH 3TIDB 2EIZA 3H0TA 5CWSA 4PJGB 5DTFA 3EFFA 4YDLC 1K86A 3GRWH 1NBYB 5HYJD 3BPNC 2FJGA 3ILPB 1UH4A 2N56A 4L3EB 3KYAA 3KPOA 1UZ8A 4P46B 4NCC1 1P7QA 4X4XA 5JTWA 1G7QB 2XYGA 4TPRL 1NCAH 1EEUA 3PIQB 1PG7W 1IKFL 3WJLC 1V3KA 4XXDA 3D9AH 5E2VL 2E9JA 3GSVA 5DJ0B 1KJ2A 3BIKA 3UCRA 5KG9B 1CFNA 2BFVL 4Y4KB 3QCVH 1BVKB 3DRTA 5GSVA 1EEZA 4Z7WF 3TEUA 3NIGE 1HHIA 3PL6D 3NAAL 1VEMA 1T7XA 4HWEH 5HSFA 5IVZA 4UT9H 43C9A 4XP6L 4TRPL 4WUUB 4Y4FB 1QLRA 3MRLA 5IBRA 2VXUL 1AKJD 2DQTL 1BD2D 2DJ4A 3MOQA 1U9KA 5MP6L 4Z7OF 3M8OL 5JPMA 5KSAC 1QQDA 4S0SD 4WFGD 3MLYH 1YDPA 3CPLB 3Q0HA 3VD4A 2NY0B 3FB8B 3GUTA 4I0PD 1M4KA 3GJQA 3FFCD 3MV8B 3QUZD 3S96A 4AEHL 2XTJC 3EAKA 2IANE 2MSPA 3MUGA 3U2SB 3TA3C 1U93B 3TJEL 1XAUA 2MNUA 5D71H 5IG7B 4G9FB 5F93C 3G6JF 5HHXH 4EDXA 5CJQL 3QFDB 1NFDE 3N1GC 2QR0B 4K7PY 2LQRA 4JFOB 5DK3A 4MJ2A 1F58H 3I75A 2FYYB 3CFKB 3VG9B 3MMEA 4PS4H 2X4TB 4JFYA 1UVQA 3QHFH 2EKJA 2HTLD 1XZ0A 4BK5A 4Z7UA 5IB1B 2J6EH 2X4PA 1BVLB 5J0BA 2VN4A 3U1SH 4W6XB 4OFYD 3TPUA 1KCSH 1IGIL 3DPBA 4HLZG 4BJLA 1UWXK 4G43B 4OGAD 1YN6B 3V6ZA 3AS1A 5HDBE 3EO9H 1LP9A 4P2OA 1A0QH 3ZDYF 1OOAA 4X6CA 1OW0A 2HFFA 1CLOL 4YQXL 1R3LA 1KLGA 2F5AH 4JQXC 2B1AL 3TBTB 1NCNA 1XF5A 2VXTL 5L0QB 4ELME 1C1EL 1DDHA 4HZAA 4DZBA 4WI9A 4F7CB 3ARXA 4MA1B 5F70A 1FH5H 2B7DT 4IEFB 5D1QC 3OQ3B 5T5NG 3RGVA 3PWUB 1FN4B 3BUYB 1S78C 3WBDA 3FFCA 4OB5H 4NO3A 3RVUD 4V1DE 2HKFL 5E4EB 2OYPA 3IF1A 3W11C 1GZQB 3ARBB 3HC4L 4J4PD 3CLEL 2HN7A 3DEHA 5IHLB 4XVTH 3T2QA 2EDTA 4H8WH 3D0LA 1U8PB 1FBIH 1Y0LB 2BVPB 2VR9A 5AZ2H 3DXAB 1V5JA 4Q9QH 3T04D 3SCMD 3HE7A 1S7WA 5J12C 3QI9D 1CU4H 4TQEL 4NIKB 5DEGB 1HZHL 3KPSA 5I9TA 2R4SH 4QO1A 1QLFA 3MNVA 2AXJA 2QLJA 3HG1A 1KGCD 2VLME 2NCMA 5DT1H 2APVA 2CJYA 1I8KB 4K7PL 3WUZA 5D6DA 2HVJA 1MRDL 4XGZB 3UTQB 1C8PA 4JO4H 4X7DC 5B8CB 1R3HA 3HC0B 2CRZA 4FGUA 5D72L 3IDGB 2V2WB 4P9MH 4XNZC 3MRIB 3RY4A 1WBYB 1G7MA 3QXAA 3RUGA 2HT2C 3QEHB 3E6HB 4GUPB 4MB4A 3KHQA 3HTLX 3CFEA 1NCCL 1CXFA 1UXWB 3G5ZA 3R8BB 1J9CT 3RZCC 3MNZA 4Z8FL 4P23D 5CSZA 4HCRL 2HVKA 3HNSL 4CVZA 1JZ7A 1S8DA 1A3QA 3MCLH 4P5TC 3RPKA 4XPAL 4H5SB 3STZA 1D5MB 5GZOD 1QBBA 3JSSA 5LGHL 3CAFA 5J1SC 1DUZA 1MCFA 3GB7A 5IVNA 1F11B 4NKOB 1E6JH 2VZ3A 3LKRB 3PUCA 1FAIL 3NPSB 4AK1A 1YC7A 5JA8B 2OXHA 5J6HA 1KC5H 4W4OA 2H1PL 1RWOA 4MX7B 3K1DA 4S11A 5BS0D 1Z0NA 4MD0B 5IVOA 4XI5C 4MQXD 4KQ4H 2YWZA 3C5JA 1A5FL 2BC4B 1W72A 1PYOA 5DFVC 5C0BD 3MRMA 3HPLA 4M6NL 3O6ML 1YEJL 5DYOB 3TYGL 4XBPB 1BMQA 5L2KB 4OGXL 4PJ5B 1NCUA 3DARA 5LGJA 3QFJD 25C8H 5ESQB 3MLTA 1F3JA 5E99L 3MBEC 4QXUH 1UJTA 5FCUH 2XRAH 5C6TH 4LSDA 2Q8AH 1UB6A 1UM4L 5HHME 4L5FL 4QXTB 4XMKH 2MPAH 3DYOA 3FO0L 4JDTH 3KS0H 4EQ2A 4PJAE 5KAQF 3O3DB 2DQHL 1A4KA 2P7TB 2JB6A 2R39A 5IV2B 1R5IA 1KTRL 2JCCE 1KTDA 4PJGF 4QRPE 4XXCA 1SHLA 2XNAA 1N6QL 1NW9B 3EDQA 3TM6A 4IOSD 2EXWC 1OSPH 1FO0L 4IDLA 2V5RA 1S7SB 3BH9B 3BO8B 1X4YA 3K2UH 1IQDB 3FT4B 4NQEB 1TVBA 2XFXB 4YHPA 3PDGA 1SJEA 1E4JA 4KAQL 4P2QD 2C2MA 3BYTA 3ZE1E 5MERA 4AEEA 1IGCH 1PG7H 3NA9L 4QU0A 3U0WH 2NY5C 5IM7B 4R0LC 4XAWH 5FM5O 2FL5A 1YPZB 4OCWH 3HMXH 5F7LB 5BS0A 1BOGA 4QRSB 5DHYA 3UTTD 4HKZB 4P2RE 2YPKA 4XNQA 5CCKL 4JDZA 5FAAA 2E27L 4MCZA 1DQJA 4MHHG 5JZ7C 1IAIL 5EBMA 4PJ7E 1P7HL 1VGKA 5HPMB 5GGTA 2OP4H 3D0VB 1DVFD 1F8TL 4TTDC 2C4FU 2FATH 3RY5A 2DB8A 3GSUA 4HFUL 1T5WA 5D7IE 1V7ML 1OM3L 5FIEA 3D69A 1IC5H 2J5LC 5DFTA 8FABB 3EOTL 1FV1B 5F7MC 1H3XA 1HHGB 2BNQA 3O8XB 5HGHB 4FQ1H 3GJFA 1LEKA 2DQGH 3PP3H 3GBLA 1MJUH 1AR2A 4Y5YB 5F6IC 4LU5L 1M71A 4X9HA 4KUZL 4ERSL 2NQCA 2I60L 4OZFA 3PV6A 3O6LL 3P0YH 3EYFA 2EYSB 4FRWA 4WWKB 4JO1L 1UJ3A 2QL1A 3AGVA 2Q8BH 1A4JA 2GJ6A 4YZFE 4JJ8A 4UILL 1SEQH 3UZEA 3IDNA 1T5XB 1MWAL 5EUOE 1ZLWH 1OGAB 5DD5H 5H35A 3BVNB 3I84A 4XCYA 5IGXH 5F9AC 2X40A 1NJ9B 3IJHB 3O4LD 3HUJE 3S4SB 3U30B 3KGRA 4WU7A 5C7XH 2OL3B 2F15A 2X89D 1DQDL 1KEMH 4D3YA 2AK4B 2NY6C 3SQOL 1G1YA 2XA3A 4CN6A 12E8L 1WK0A 3I9GL 4KGJA 4IJ3B 1JNLH 5CGTA 4F9LA 3LV3A 3O6FB 3ES6A 2ZNXA 4RBPK 5CHNA 3WE6B 1YEEL 3RHWK 3MRGA 2CGRH 2NW3B 1J5OH 5LUAA 4JFDE 2WW8A 1NUDA 5FYJE 3V6FB 1MIEH 4UV4H 3TN0C 1MCDA 1HEZA 5I8EA 4ODXB 3NFPB 3BWAB 3NH7H 1YNLL 3K3QA 4OSUL 4F3FA 1C08B 3S7GA 2Z4QB 4YHIA 5D1XB 5T3XL 4NC1E 4Y8DC 4FS0A 4HPOL 5DD3L 4F7EA 2NZ9C 3D39A 1ZVSA 3S36H 4WCYH 3S70A 3ZE2F 3T1FA 1TZGL 1MCPH 4GKZA 1JPTL 3OKDB 4QU5A 4U7KA 5AAMA 3U7YL 4O00A 1Z3GH 4LP4A 2YR3A 5HHVH 2RJMA 3ARGC 5FO9A 4ZAKC 1MHEB 1K2DA 4PLNC 3EO0B 3L7EA 3D3VE 5J1AB 3VDBA 3WLBA 2Q87A 1RHHB 5IKCA 3W9DB 3GIVB 4OZGB 3HS0B 4WEBL 2XTJD 1QSFE 1YYMH 4LLQA 1OT1A 3TA3D 1EFQA 4LHUG 3VA6A 4ZMAT 3T4AB 5ELIA 1AD9B 3RWGA 4AM0B 4MMXC 2BSED 2HLAB 3MROA 5FO7A 2XQBL 1V05A 4D9RD 2WWMD 4EOWL 3QO0B 1RJZA 3CLFL 4U7SA 3ULVL 3PDDA 1FG2B 2Q76B 3IDXL 1XGYL 3FAXA 2EDOA 3OR7A 5E8OA 3TNMB 3IAPA 1HE7A 3IFLH 1WFOA 4LGSB 3U46A 3KJ4B 1HSBB 5D2LB 1RWKA 1JBJA 4HQ0A 2IG2H 4R26L 5T33L 4A2MA 4N5DA 4JG1L 4NM4L 1T89A 3Q5TA 3VGBA 3T77B 2CLVA 4QU9A 4NOJA 2R23B 4KTDH 1YZZA 1JK8A 4J3OC 1AO7E 2DDQL 3NCCB 2CJXA 4M7ZC 3HE6C 5TDPB 3VFSA 3C6LB 2P45B 1A6VH 1IC4L 5J11C 1U3JA 2H3NB 4D0CA 3ZYIA 4QOKB 5JMRA 3BEWB 1LK3H 3DRQB 1MJ8L 1CF8H 1S9VA 1BIIB 3VXQB 3IGAB 4GRWB 2HMIC 1S5HA 5CUSL 4HV8A 1BVZA 5D1QD 3GHBL 4RGOH 5DVMA 1S7RB 3I6LE 2XV6B 1S78D 3TBVA 2NX5E 1DFBH 5FYKL 3VFPA 1G0YR 3MV7D 2I5YL 3RWIA 3MOAL 3TA3A 3LRSA 4JKLA 1BJ1J 3W11D 1AI1H 2A77L 5DMGC 4NNYB 3HLAA 4GMTH 2XI9A 3FN0L 4UB0L 3EUUA 5CP3H 5IANA 1A1NB 2IADB 3GSXB 3SDDD 4C55A 1U3HB 4P3WA 1EAPB 3L1OL 5E2UH 1H3VA 3FN3A 5TFSH 3S9DB 2EDDA 4G3YL 1WT5A 3I6GA 2BY3A 4DQOL 4UINH 4DVRL 3NIDF 4LK4A 1N6VA 4HK0B 4PIRF 4P4RB 2ICCA 3KPNB 3S35H 3BKYH 3IAQA 3V55A 1RJYA 5DDHA 2YXMA 1LD9A 2L7JA 1MEXH 1FL6B 1NCWL 4X9IA 4Z5RB 1MJJB 1T83A 3K7EA 4XBEL 4LHUD 3KG5A 5ADPL 4YHZL 3RTQC 2P5ED 3QNWA 5JOPE 1SJHB 2DM4A 2HT2D 1H3PL 1MFAH 4WW1A 1U8MA 3OSKA 3LN4A 2V2TB 5EOCL 3RWHA 2QLBA 4OLEA 4JM2B 4JJ5A 1TMCB 4BH7B 2AABH 2Q3ZA 1NMBL 3VW3H 3V52H 4XNXL 4WFFE 3MLWL 3MYJA 2GSIA 5D1QA 1T7YA 3H42H 2K7PA 3NCJL 1LDSA 2ZKHH 5I8OH 1TJGL 2IANB 1LEGB 3PHSA 3DX6A 4A2LA 4ZUTA 4KXZI 1EUUA 3UP1A 1DBBL 4G6MH 3GK8H 3H7BB 3VGEA 1NFDB 1CGTA 4ZO7A 4Z95L 5HYJE 5IABA 4ODWB 3SDDA 1BQHG 4WFHD 2OK0H 1AGBA 1AGDB 2WK2A 4NZRL 4RQQA 4EIGB 4XI5D 4Z7UE 3OJVC 5BO1L 2CLRB 2NY1B 2C1OA 4NO2A 4Z7NF 5DFVD 3IVKA 3L6FB 5K9QG 1T3FA 4LSPH 1Q0XH 3MGAA 2CDEA 3QIWB 4LOUC 2G5BB 2AEQL 4EI6A 5L6YH 5EUKB 2Y7QA 1NAML 3GSWA 1T4KA 4CBPA 3VE0A 3PWVA 3MBED 3M17B 1UKTA 2X4SA 2NY4C 4NQSA 1IGTB 3FOLA 4B7LA 2O61B 3B2UD 4GJTB 1FZMB 4LHUA 1QFWI 2VSCA 4PV8B 5ICZB 4Y16C 5MENA 1RUKL 4ELMB 2P5EA 1KB5B 3MLRL 5IBTL 3I02B 4WFGE 5DGQA 1JE6A 3MRFA 1KCRL 4NRXA 3B8YA 2IQ9L 4DOHB 1P4IL 3FFCE 3NA4A 4RMUA 2GTWB 5ANMA 3NZ8B 1U91A 4WY7L 1RY7B 2P42B 4JPVH 2EXWD 5JDJA 3QIBB 5EU7C 3UBXI 4GMSL 3OAZK 5JLZA 2DD8H 2R2EB 1I1YA 2G2RA 4V1DB 3BQUA 1HDMA 2OZ4L 5FV1L 3C5ZC 3H3PL 5SV3A 2V6HA 5CJXA 1ZA6B 1EMTL 4NSKB 5E9DB 4YLQT 4Q9RH 3WNPA 4GS7B 4UQ2B 5L8JB 4EN3C 1V3LA 2XPGB 3L7FB 1I3RB 2Z35B 4RSVA 4G9DA 5J6GB 2WIIA 5EO9B 4RGNC 4HCRA 4KDTA 4POZC 2YKLL 1CDIA 2X1WL 4R6UA 2R0KH 3LQAC 3HG1E 4CDGC 3HZVB 3BN3B 3NZHH 1PX4A 4DW2H 4JANB 4XC3H 4Z7VA 4PJHA 5INDB 4X9FA 5T3ZH 3C5SB 4D3CH 5JZ7D 3ZT5A 2ZCKH 1KPRB 4RFOH 3OD5A 2APFA 4TTDD 3S8WA 4BUGA 3QDJD 3MBEA 1QACA 4OZGF 3OKEB 3RUGE 4F33B 5F44A 1IAKB 3DTXA 5HYQA 4OQTL 35C8H 4F57L 1L9NA 4I1RA 1T2XA 2G60L 1KT2B 1WEJL 4LLVB 4AENA 1ZANH 4GW4B 4FZ8H 1JF6A 4NKIL 5DC0A 3C60D 3TZVB 3IKCB 3N1MC 1DLFH 1T1ZB 4NBLA 3BPLB 1HSAB 5LU8A 5ETUA 1XF3A 5IROA 2VLKA 3GJFK 3VFNB 3EFDH 3QDGD 4GRWH 1TCRB 1TQCB 5LGKA 3GM8A 3DV6B 3SE8H 4XZUA 5D7LA 1KJVB 2O5XH 1N2RA 2KL6A 1IMHC 2NXYC 5D93B 5DRWA 4NN7C 3LKQB 1MY5A 2VZTA 4N8CL 5BZDB 4G6AC 2XYPA 2O26U 3HR5A 2HWZL 5CZXC 3MRQA 4XBGA 1G7LB 2FIKB 2APWA 3TWCH 2CUHA 4KC3B 4LARL 4U1LB 5CSGA 3H0EA 3EDFA 5KJRL 3FTGA 3GMMB 3LEVH 1FO0A 3IJSB 4MA3B 1KGCE 1KEGH 3UBXB 2UUDH 2NY6D 5F7EH 4ZFGH 3TVMC 3PG2A 5DWUH 2IBBA 3S5LB 4GRWF 5HGBA 4FZEH 2FJFA 4U2YA 1EJOL 3K8LA 4NRYB 4M1GH 1QKZL 2R0WH 3D25B 4LCIH 1RZ7H 1S5IL 5B38G 5SWQB 3AC0A 3KJNA 5GJSL 3OKNA 3ULSB 4JFHD 4ZXBD 3TN0D 4NT6B 1UENA 3TO2A 1XGPB 3NCEB 2JCCB 3C60A 1ZSDA 4Z78B 1JCKA 4EHLA 3ARQA 5C92A 1N7MH 3KYOB 3TIEB 4HUUA 4OD2B 1YECL 3N1QC 3KPLA 2GK2A 1D5BA 5E8PA 5A1AA 1IBCA 1QBMH 1ADQL 2Q1EA 3BH8A 1DN0B 3F5WA 2BDNH 2KZ1B 2L7UA 2D3VA 5ESVB 4X99B 1JWMA 3ARGD 4ZAKD 1Q94A 2EC8A 2C2ZA 5E5RB 3TBWB 1K4CB 3UYRH 4HUXB 4DZ8B 2VDQL 4OLYH 4N9GB 5BS0E 1RHJA 4HIJB 5AUMB 4X4ME 3UO1L 5B22A 2CQVA 1OPGH 3V4LA 1A7NL 5C0BE 1JGUH 1W0VA 3NIGF 3CXDH 4Y2DB 4P2RB 5C70A 1SM3L 3PNWB 3RBSA 4ZTPH 3GSQA 2ARJA 4UU9B 3WSQH 3QRFM 3MGTA 1H5BA 1T80A 3V3KA 2R15A 3RP1A 1MWAA 3WNNA 1C5DB 3BDXA 1U8HB 2IQAA 1LQSR 2XA8H 4TSAH 1SC3A 1Y6NR 4JRXA 4OCNC 1A2YB 1MNUH 3LKPB 2PUQT 1NAKL 3QH3B 3QG6A 3NCMA 3TN0A 4ZXBA 2X4OA 3IETB 4HC1L 1PX3A 3C9NA 1T1YB 1F6FB 5JORB 4ALAL 1XMWA 2FX9L 1YEIL 2BJMH 3VFMA 2VXVL 1NFDF 2DWDB 4LRIA 5GIRA 2CSPA 4X8JA 3OF6D 3ULVD 2AJXL 3N06B 4G5ZL 1T20B 5DD1H 4XPTH 5TQ2L 5I2IA 3RDTC 2GJ6E 1MQKH 2NLJB 3HE6D 5KSVB 2XQYG 2WBJC 2DYPB 2DI7A 3PQYD 2IGFH 3KLSA 3GRWL 4P2QE 5HYIA 1BQLH 4NZJA 1FFOB 5FA4B 1FVDA 2VL4A 5IB4B 4ZFFA 3K1KC 2HMID 1PKQB 5BMFH 1A7OH 3GMLB 3O11A 3I6KB 5HDBF 6CGTA 2CD0A 3UTTE 2YD4A 3BZFA 4R4FL 1S7VB 3HUJB 1Q1JL 4LLMB 4AWAA 1RIHL 3RWCA 4LIQE 3QNXB 4JKPH 1LEIA 2VDNL 3GIZH 2CNNA 4ELMF 2B4CC 4L8CA 3B9KB 3CC5A 2WNGA 2ZOLB 3GSNB 1K8IA 4TSBL 1L7IL 5H8DA 1NCBH 4UT9L 3JV4A 4RDQG 3G6DL 5L9DH 3EKCA 4JFDB 4XCEA 4XB7A 3PWNB 4L8SB 2D31A 4Z7QE 5LU9A 5JQ6L 1UACH 4H1LG 4PG2C 3K2MC 1DTUA 4JZOB 3CSYB 4UAOC 3MODH 5CS7A 4N0CC 3T4YA 1YY8B 1FLRH 2DAVA 3OF6A 5BQ7A 4NJ9H 2BSRB 1NC2D 3EYUH 5D71L 1N3NA 5FHAL 4KRPB 2AXGA 4Z77A 1JZ4A 1EH9A 4U6VL 2FEDC 1WQVT 2ORBL 3G5XA 4QCIB 5BRZD 1AHWB 3RTQD 3PQYA 4QU8A 3A67H 5FOBA 3RGHA 2BVTA 3O3AB 1JWSB 3KWWA 4PS4L 1IEBA 3D3VB 3ARZA 3FFDA 1DSFL 5F7DB 2F74A 5I1GL 2J6EL 3O4LE 3QULB 4MJ5B 5HDOA 4RMRA 1QFWH 3S8EA 1QSFB 3LDBC 4H88H 4FQXC 4IHOB 1RUQH 3L5XH 1BBDL 3R0MA 4X4ZA 3TP4A 2LE9A 1NL0L 5LCVH 1UWXH 4HXBH 1E27A 1MAJA 3EO9L 1A0QL 1ERNA 4GKSB 5CP7A 3DUSB 4U4BA 1K5NB 1GHFH 4G8EB 2FX7H 2VAAB 4O9HL 4CADB 5FGBC 4HKBA 3GJEA 2OSLB 1U6AH 2NTFA 5GS3A 3O4OB 5ID1A 1A6TA 1FLTX 5A2JH 2D7NA 3V79C 1KIPB 1CBVH 1NLDL 2W0KA 4LOUD 3L5IA 5DA4A 3QJHA 4MB5A 1XGUA 5JIIA 1AGFB 2XKNB 2CJUH 3IJYB 2DKUA 1AE6H 4OB5L 3MBXH 4R3SB 1LE5B 3OKOB 3P73A 3TV3H 1EBPA 1LO5B 5IFHH 4P99A 3V6BR 1T0PB 4QRQA 2VWEC 4XVTL 4H8WL 1S7TA 2WLZA 4YHKH 5DVLA 1TVHB 2C2KA 4YDJA 4Y16D 5BRZA 5IQ9B 3D6HA 4Q9QL 3DVIA 5KVDH 4HWZA 4Y5XB 3BIAX 4M03A 3CZFB 5BVJB 3PP4H 3JWNC 4XCNB 3HFMH 3D87B 1JRHL 4OM1H 2XTJE 1HXMB 7FABH 4Y19D 1KSRA 3G5VB 2NNAB 2SEBA 2J30A 1CK0L 1O5DT 1WBZA 2NX5B 4I48A 3VXPA 3R8QA 2B5IB 2BHZA 1DBKH 2MCG1 2K7QA 5DT1L 5KSUB 2F53A 1IAOB 1ZWIB 3BP6A 1CWVA 2EIZB 4O02L 4PTUA 2EE6A 1U3ZA 3H0TB 5CWSB 4D9RE 5DTFB 3EFFB 2P2CA 4P4KA 2VZ1A 1DUYA 4JVPA 2Z8WC 4DFIA 2FJGB 1BWMA 5DVOA 4EN3D 2JCCF 4JB8A 1F2XK 3KPOB 1UZ8B 3BESR 2BNRA 1IBGL 4KMTH 5I18L 1P7QB 1YNKL 4X4XB 2YK1L 3RPIA 1HN1A 1D7FA 1RZFH 4POZD 4PGBB 5I71B 4XXDB 5I9BA 1BJ1H 1GVIA 1NGQH 3TFKC 1CDGA 3GSVB 1Z6JT 2K7ZA 5A2IH 1KJ2B 1XFPA 1DP0A 2MQ0A 2PR4L 3BIKB 3HMWH 4LPYA 1TPXC 1CFNB 1MRCL 3ZE1F 3DRTB 3MFFA 5GSVB 1S9WA 3R6LA 1EEZB 2VN7A 3MCLL 2V5SA 3CFIC 4QF1A 5IEHA 2PYED 5IVZB 1MFBH 43C9B 1QLRB 3MRLB 3QWQB 4NBNA 1FFPA 2GUOA 3UYOD 4CU7A 3H9SA 5JPMB 1QQDB 1OD9A 4LRNL 1YDPB 3JWDH 4OTXL 3GUTB 1BF8A 5F7YC 5IF0A 1NAMA 2FECL 4BKLA 3S96B 3RU8L 1RWNA 1FZJA 3B6SA 3MUGB 4DK3A 4XT1C 3S3PA 4JN2A 4JAMA 5D7IF 4DKEH 4NOFA 2VITA 5E8DH 5IR1A 4U6HA 4P3DA 1KTKE 4EDXB 4TUKH 25C8L 1PYWA 2NXYD 2ZJSH 5SX5K 2R1YA 4H1LA 1WWCA 3MA9H 2ZWLT 4G6AD 3I75B 3DECA 4JB9L 3L3JA 3DNKA 3MMEB 4JFYB 1UVQB 2MPAL 1XZ0B 5H0IA 3RVVC 2DLEA 2FWOB 4Z7UB 5IHZA 1EGJH 2X4PB 2FHBA 1P4BL 4HUMB 5GXBB 3QDMD 4P46C 3TPUB 1FNSL 5EU5A 4YZFF 1F97A 4QXGH 2OZ4A 1HCFX 1QNZH 3LEXA 3TVMD 4ENEC 3V6ZB 1OSPL 5EUOF 1HKFA 5IMOA 1LP9B 4P2OB 1RURH 4X6CB 4Y2OA 2VDMH 2LTQB 2HFFB 4JQIL 4TTGA 4Y4KC 5JW4M 2PYEA 1R3LB 1WCQA 3HUJF 5HPOA 5C07D 1KLGB 1XF5B 3TH3T 2P5EE 2Q3AA 1DDHB 3JTSA 1IGCL 1PG7L 4KUCD 1J8HD 3UTSD 4DZBB 4NN5B 2GTZA 3U0WL 2W60A 2DIAA 4AW9A 3P30H 2VUOA 3NR2A 4JGUA 5ANME 3RGVB 3IU4L 4I0KA 5C2UB 2VQTA 3FFCB 3S34H 3SY0A 4NO3B 4JJ7A 2NY0C 5HGAA 2EIDA 3HB3C 2I25N 4N5EC 3IF1B 2D7PA 3F7QA 2E6PA 3VCLA 4ACPA 3THML 3S37H 2HN7B 4ETQA 4RAVA 4ZDHA 4OQTA 3D0LB 1S9KC 3WFHA 1M1SA 4WFHE 2H32A 5F71A 1ITCA 1IC5L 3HE7B 1S7WB 2XYHA 5DRXA 3KPSB 2IEPA 1MJ7H 2Y5TA 4FQ1L 1QLFB 3MNVB 2DQGL 4IRJD 5I9QC 4Z7VE 3HG1B 4QY8A 2A9ML 3SDYH 1TJIL 1FL5A 4S1SH 2HVJB 2VZSA 5C09D 1NLBH 4WHTA 4BK4A 1A6ZA 2EXYC 1CQYA 1R3HB 3W82A 1JP5A 3O3EA 1G7MB 2VB5A 2ZNWA 3QXAB 3RUGB 1SEQL 5DJ8A 5C07A 1LNUA 1MCQA 3CXHK 5DD5L 4KGLA 3CFEB 4DKDC 3G5ZB 3UTSA 1J8HA 3MNZB 5L0QC 5AD0A 5CSZB 2A6JA 2HVKB 5ISZA 2GCYA 1HNGA 2AQ1A 5FOJA 5C6PB 1BX2A 4PB9L 1S8DB 5DEZA 3QCTH 4LPUA 4U0RB 5D7LE 3STZB 3RDTD 5E7BA 1DUZB 5HD8C 3GB7B 1UC6A 2WBJD 1K88A 1EHLL 4QTXA 5E4EC 1CICB 3F8UB 5J6HB 4UI2A 1JPST 4RBPH 3ARBC 1BM3H 2H2SC 2VERN 1J5OL 2BNUA 1MIEL 3C5JB 1U8JA 4R97B 1W72B 5DJZA 4O4YL 3NH7L 3MRMB 3HPLB 4WGWB 5IJKC 1WSST 4OV5B 5IIEA 4PFEA 4IRJA 5CZKA 2X4UA 4RMSA 5GRJH 3S36L 2WMPA 5LGJB 3H11A 4J3TA 1TNNA 4WCYL 4YDVA 3TCLA 3MLTB 1Y18A 1F3JB 1MCPL 1EEQA 2G5RA 5C09A 3F58H 1H15A 4XHJC 3FKUS 3QDJE 4ZD3H 1UB6B 1KJ2H 2YA0A 2AKRA 4ONGH 1IFHL 4I77L 3ZKXB 4U31A 5B8CC 4K55A 5BV7B 4WUKH 2CRYA 2OS7A 1A4KB 3RHWF 2JB6B 4YBLB 1H3GA 1R5IB 3QEQA 4TYUA 1HILA 1KTDB 4F37F 4NO5A 1U8LA 2HH0H 3SO3C 2XNAB 3MZTA 4UIKL 3LH2H 4N0CD 1YYML 2ERJB 1GPOH 4LASL 3S98A 1NPUA 4ZPVA 2A74A 3QDGE 4X8XA 5IJVA 4UTAH 3CK0L 2GT9A 1TVBB 1X5YA 3W81A 5IAJA 4YHPB 1U8KA 2FEDD 1IGML 4MLSA 1SJEB 3KPRD 5GRVL 1BFVH 2CIKA 5MERB 1WISA 2M2DA 4HC1A 2W0PA 5DGRA 3ABZA 1HINH 3NPSC 2FL5B 5BS0B 1CVRA 2C3HA 2EDKA 4F58H 1BOGB 2H5JA 2GQHA 1NMSA 3OG6B 5DHYB 4ZVOA 4NZTL 4Z0XA 2YPKB 1I9RH 3OHXA 2IPTH 4D0DA 4XNQB 4Y4HA 2IG2L 2NY7L 4JDZB 4FQXD 5DF0A 3EHBC 1T2QH 4PJEA 1X6NA 2FEEI 3MC0A 4MCZB 5DURB 8CGTA 4M00A 3HNTH 1DQJB 4YIQA 4AEIH 2KUTA 3KHOA 5CGMA 1OCWL 3LS5H 1YA5A 3CVIH 4PJBE 5EBMB 1VGKB 2BVOA 3GRWA 4DCJA 4MA7H 1FNEA 4ZFOL 1AQKL 1T5WB 2WM0A 1CGXA 4TNVK 3D69B 4X9BA 3MXVH 1QRNA 2HT4C 4JFHE 4KI5F 2BNQB 2WLYA 1MCKA 2BXZA 2HRLA 3X11A 1LEKB 4CU6A 1RHFA 1MI5D 2AI0L 2D7OA 1M71B 1IZJA 5SWZA 3O2VH 4AQ1B 2J4WH 4OZFB 3PV6B 3L3HA 3BD3A 3EYFB 5CBAA 4FQCH 4MQ7A 4QT5A 1UJ3B 1AI1L 4Z7UF 1FPTH 3E6FA 1A4JB 4M1DH 2GJ6B 1F02I 4PRHD 5DS8A 4TUOA 2R0LH 4QUEA 5K20A 3IDNB 4OKDA 5EU6D 5CD5C 2QEJA 1PG7X 2VLRD 4M3KB 5H35B 4XCYB 1JI1A 1A6WL 3KVQA 5EC1A 3BYYA 3UJIH 4NHUA 4AT6A 5DEFA 4X6CF 4N6OA 4WU7B 4J6RH 3MCKA 3OZ9H 1NKOA 2PCPA 5F1SA 3IDUA 4FMKA 1GC1H 4FQXA 4HIXH 4URTB 5D70H 3TGXA 4HAGA 3LD8B 4N5UA 1FCGA 3LV3B 3ES6B 2DM7A 5CHNB 1MEXL 1T1WA 3MRGB 4KHTH 5D4QA 3IRZA 1T04A 4U3HA 1HXYA 1I8MA 2J6EA 1ODAA 1HEZB 2W65A 5I8EB 1CE1H 1HHJA 3JV0A 2H9GA 3EJYC 4K71B 3ELAT