4IEFB

Complex of porphyromonas gingivalis rgpb pro- and mature domains
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
423
structure length
422
Chain Sequence
GRMIVIVPKKYEEDIEDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDKWLGQALCIASAEGGPSADNGESDIQHENIIANLLTQYGYTKIIKCYDPGVTPKNIIDAFNGGISLANYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVAVNGDFLYNVPCFAEALMRAQKDGKPTGTVAIIASTINQSWASPMRGQDEMNEILCEKHPNNIKRTFGGVTMNGMFAMVEKYKKDGEKMLDTWTVFGDPSLLVRTLVPTKMQVTAPANISASAQTFEVACDYNGAIATLSDDGDMVGTAIVKDGKAIIKLNESIADETNLTLTVVGYNKVTVIKDVKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Porphyromonas gingivalis Virulence Factor Gingipain RgpB Shows a Unique Zymogenic Mechanism for Cysteine Peptidases.
pubmed doi rcsb
source organism Porphyromonas gingivalis
molecule tags Hydrolase
molecule keywords Gingipain R2 Pro-Domain
total genus 147
structure length 422
sequence length 423
chains with identical sequence D, F, H
ec nomenclature ec 3.4.22.37: Gingipain R.
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01364 Peptidase_C25 Peptidase family C25
B PF03785 Peptidase_C25_C Peptidase family C25, C terminal ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4iefB03
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4iefB02
3.40.50.10390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Gingipain r; domain 1 4iefB01
5JMRA 1T1WB 3FJTA 4EDXA 1IAIH 1I4FA 4OIIL 2PYEB 3MV11 5E8PB 2R2BB 2YEZB 2E9IA 4GAGL 3TCXA 4LCWD 3QJFA 1X7QA 1RZIA 2OI9C 4RFNC 1J0KA 2ZCLL 4XVUD 5C6WH 3WSQH 3MRHA 5CD3B 3NN8A 4WUUB 5DDHB 1P7KB 3LHPH 1YC8A 5C0GA 4D8PA 3CFIC 4X6BB 3FL7A 1I1AB 4S2SA 3K4ZA 4X7EC 4Q9QH 2AKRA 4ZDHA 3QXVA 3SEPA 1A7OH 4UIKL 5DURB 2R2EA 4JZOB 4NM4H 2DMKA 1U8LB 3BXNB 4FABH 5E03A 4ZUUA 2E7LA 2FSEB 3MV9E 5DGQA 2QEJA 1X5XA 3F58L 4OM0H 3LKPA 4K8RL 4U33A 2VH5L 3ZYIA 2VDOL 5B22A 3MLYL 1CZ8H 4C55A 4XVTH 5K59F 3PWPA 5DT1L 3DSNA 4H5SB 2BY1A 3WFEL 1EGJA 4TUOB 5FA3B 1S3KH 5HYJB 4LAJH 3MV8D 1ZHKB 5BJTA 4MD0A 3DO7A 4XTRD 2C4XA 3DTXA 3QXDB 1IGJA 1CD9B 3ORJA 2VDOH 5IBCA 3STZA 3O2WH 3NACL 4LCUA 3Q3GB 4NQVA 1JWMB 1R5WB 4LSDA 2CKBB 3IDJA 3KYMB 4QUIA 1CL7H 1F00I 1HIMH 1TZGL 4JFHE 3QDJE 1F58H 4FXGA 4WTWA 4KROC 1KJMA 5CHNB 5D1XB 1T6WA 3QIBA 3TESA 1H3UA 3CZFB 3EFDL 2ICEA 4HUXA 4QF1B 4P3CH 2CLRB 1NCBH 2IBBA 1UKQA 4H88L 1KT2A 3OAYH 2GQHA 4B7LA 4FXLA 3UJTH 4JCMA 1HIML 2JJSC 4LSTH 2RIKA 1NGXA 1S9XB 3I6KA 1OF2B 2UYLB 3BSZL 4RRPA 1XGTB 4HGWB 4OD2A 2BNUB 4HWBA 3H3KA 3T0VA 4PJCE 3OB0K 4WI6A 1NANI 3ARGC 3VGAC 3EYVA 4FQXA 1Q1JL 1KBGH 1G0XA 1NGYA 1NMCC 3FO2B 3BO8A 4PGEA 3EYQC 1NFDE 1RVFH 4EIZC 2MHAA 5T1KD 3X14A 3GHEL 1I1YB 5KAQF 5T33H 5D7IB 1QLFB 5DRNA 1FO0A 4X80H 4XI5D 5IHUL 4GMSH 4XVSL 3BESR 5EBMB 1Z0NA 2R1YA 3DI2B 4L3EB 3MV9D 1FNEB 5FO9B 3OAUH 1KFAH 1ZT7A 1ORQB 3TCLA 4EOWL 5B39G 5I17B 1FC2D 5FA4B 4BFGA 3L3HB 5KSAD 1J1XH 4YHKL 1G9NH 3PJSB 2ZJSL 1YN6B 4I48A 4LVNB 1I9IH 5KBNC 1JZ7A 2WUCL 4M5ZH 4EJFA 3SKNB 5MEQB 3V3KA 2AABL 1IQDB 1G7HB 5CUSL 5ERWA 3WFHA 1XF2A 3BE1H 3VWKD 1IGML 1J8HA 4XH2A 1RD6A 5T1KB 4F8TA 3FT2A 1FFOB 3ZDZE 1L0QA 5E9DA 1RJYB 1G9NL 3OKNB 3S3PA 5T5FH 4U6XB 2VL4A 2FH8A 4Y16C 5IB3A 4S2SB 2CUMA 3P0VH 2AJVL 1P53A 1A5FH 1CLOL 3QIBC 2MPAL 4X99A 3RGVB 3PV7A 5DVNA 4HIHA 5KVFL 1FYTA 3MUY1 2LQRA 3D18B 3OXRB 5C6TH 3RZWA 4X6CA 3DEHA 5MP6L 3RL1A 1N5YH 2VXSL 4Z7WF 4JRYD 5DJCB 3CUPB 5JZ7C 1M72A 3CK0H 1HSAB 4N0CC 1JTOA 5DQJB 2VIRA 2NYYD 5TDPB 1YDPA 3IXAB 1KGCE 3KYKH 4ETQB 2Q3AA 4S1RL 1U92A 5FK9A 3X13B 2EEAA 2LE9A 3GJQA 3LMJH 3EYSH 5TDNA 4JM2B 1XGUB 3U0PB 3AUVA 1AO7E 5HDQH 4DVRL 5LXGH 5C0EB 2B39A 1Q9WB 2Z0BA 1BZQK 3LB6D 1GH7A 3F7RA 4G8FA 5JUEL 4AM0A 4FQJL 3HC3L 5E2VL 1KTKE 2YBRA 5EZOL 4BH8B 1XCQB 5JXEA 1LEKA 2WZPD 2EDTA 4YPGA 5C0BD 3K80A 2A9NH 3K4AA 5EZJA 1F2XK 2WP3T 4PJAF 4DVRH 5HDQL 4AJ0A 5LXGL 3SIPA 3RDTB 4G9FD 1A7NL 3PCXA 3RKPA 2I5YH 4JFHD 4Y4KC 4Z95L 4PTUA 5ESAB 4IS6B 2QLVB 3QO1B 1XF5B 3MLXH 1NBVL 3E6FB 4C58B 3UAJD 1MFBH 1S7SB 5GRUH 4N5ED 4NOFA 2AJZA 1AGEA 1NCCH 5FYJD 4Y2DD 5DEGA 5J9PA 4AEIH 4U2ZA 1AHWB 1CL7I 3O6FD 1EAPA 2YR3A 5D1ZD 3VFMB 1QRNA 2X7LA 3QWQB 1JXQA 4Q0XH 1FVEB 5KTEH 2VDLH 4JPKL 2WWKO 1EZVX 3EYVB 1GGBH 1JF1A 4OGZA 3IJYA 2A2QT 4UT7L 3BP4B 4V2CB 3TIDB 5EU6A 3OQ3B 1WITA 2R69H 2DWEB 5F7EH 5E00B 4JQVA 1U93A 1DQLH 4GKSB 1RUQL 2F15A 4KU1A 3K7EA 3RAJL 2YD6A 5HY9B 1JI1A 3DSFH 4JZNA 3O8XD 4R9HA 5IB4A 3B5GA 4KHTL 4LNRB 2C3XA 3HAEB 3UC0L 2VDRL 2HN7B 5DHXB 3MACL 3P73B 1PVHA 3Q5TA 1U42A 4NN5C 3RFZC 4JVWA 1ERNA 4H25B 4LIQL 3DVFA 1FNLA 1XGRB 1M71A 1K3ZA 2F8XC 4AIZB 4ALAH 4Z78B 4PJEA 4PUBL 5FYKH 4QO1A 4XCCH 2W0FA 2AJSL 2GSIB 3GMMA 1HNFA 4RIRB 2FATL 3CX5K 4DWHA 2JJTC 4L8DA 3VRJA 2VR5A 1BVKA 4YDJA 5DMYA 4U1KB 3BH8B 5T3XL 4ZUSA 1IAII 2AJXL 5EZIL 2I9TB 5BRZA 1KUMA 4O2EB 4JPIA 5IAGA 2H32B 3AB0C 3V5KB 5ACZB 4MNGB 1C5CL 3CLFL 1QVOA 2V5SA 32C2B 5F7HA 4S1QH 3DVGA 1UZ6F 1BOGA 2ZCKL 1MI5B 4G6ML 4Y2DC 4W4OC 2JCCB 3JZ7A 1JZ8A 4M6OL 1KEGL 1A6UH 4JKKA 5DJDB 4U1JB 5I66B 5CP3A 1FORH 3RPKA 1VACB 2CIKA 5HXMA 2YD8A 5JO5B 5IG7A 5T3XE 2H8PB 4L3ED 1P4BL 4LPUA 1J1XL 3MFFB 4I9WD 3QIUD 1M05B 3VXRE 2BCKA 3NCMA 1FE8H 4MA8H 1QEWA 1EDQA 2Y06H 3P9WB 5DZLA 3PUCA 1T80A 3GKWL 2AABH 5EO0B 4DCQA 2NPLX 1NAMB 3CFCL 1KCSL 3QIWB 4Y7MA 5ITFB 3RZCC 3AREA 3BHBB 1MJJB 3LY6A 1SJXA 4L3CB 3H0EA 5TF1H 1HHGA 4LSZA 1QG3A 1BD2A 4ZFFA 1MHEA 1DBKH 2ZSVB 3D1MC 1A6WH 1CDGA 1NJ9A 2BDNH 5DYOA 5ESVB 1NSNL 4TSCL 2XQBL 5DD1L 1JYXA 4QUEA 3ZE2F 1FVEA 4R4FL 3IBFA 3RWEB 3FB5A 4PRZA 3FQWB 4WIQA 1RUPH 2XZQL 3WIFB 1ND0A 4PRHB 5GGUB 1MEXL 2K9UA 1MFEH 2X1QA 3PQYE 5D2LB 2VDNL 4RMSA 3T3MF 4OZ4A 1UZ6E 3LVEA 4FXOA 4JKPH 1U8KA 1YNTA 2ERJB 4HZAA 4RX4A 1KSRA 5IANA 2GSGA 5DFWH 1PG7W 3BX7C 3GNML 2WWMD 3EO9L 2EDDA 4HK0B 4PR5A 5DUPL 5JW4Q 5L8JB 3HUJB 3ZZ1A 4U1SA 3OXSB 5I9QC 2ADIA 1NW9B 4D0DA 3LN5A 3AB0B 5E2JA 5AZ2L 1DLHB 1EXUA 3HZKA 5TFSL 1FZJA 3QQ9D 5D9SA 4RGOL 5FYJU 1I3GL 1PY9A 4AK1A 2DQFA 3D0VB 2VDQH 4YPJA 1G7LB 5E94B 5HYEA 2AK4E 2YHGA 4LFHG 3ALPA 3ARQA 3NA9L 3MLRL 1OP5H 2IGFH 4Z18A 3AMLA 1IJ9A 4FQPA 1JRHH 2X4OB 2F53D 4RWYL 3C60D 3NPSB 4MA1B 5MI0B 1FFNB 1XF4A 4C59B 1CBVL 4PJ8A 2NW2B 5IEKA 4ZD3L 4HG4K 4KY1L 1FNHA 5BVPL 2AS5M 3QNYB 4MQ7A 3HC4L 4U1LB 3SDAA 3S35H 5TPWL 5F7DA 1HH9B 5EC1A 4NOLA 4FQXB 4OF5A 4XNMA 1RZFL 1MCWM 3RRQA 3BAEL 3DSFL 2QSVA 2DMCA 3MUJA 4POZD 5C07B 3WSQL 4V1DB 4HC1H 3S88H 1HSBB 4ZSOE 2A73A 2YC1A 4PS1A 1AQKL 2EYRB 2WQRA 5IB1A 1TENA 1IQDA 1D5IL 3U4BH 4XRCB 2GT9A 2R1XA 1ACYH 2FECI 3L9RA 4XTRC 1CS6A 4N90E 5JPMB 3U30B 3KG5A 3T1FA 3OKMB 3I6GA 1FSKC 3T65B 5BV7L 5KSBE 1W0YT 4EHFA 2ZUQB 1NC2A 5GISH 5KSVB 3IU3B 1NBYB 3VFGH 3D6GA 4L4TA 4NN7B 2X89A 4TUJA 4G9DA 4X9IA 4UNTA 1G7HA 1B88A 5ERWB 5DQJA 1KB5L 1MJ8L 4JY5H 3DV4A 4E41E 2JJUA 4KVCH 1QBLL 1D6EB 5DRWA 5EOTB 3MLWL 4HPYH 5D7KD 5I0DA 3VA2C 2AEWA 2NX5E 1JZ5A 1X5YA 4KJPC 1CGWA 3JWOL 2YSSA 4ZO9A 4L8BB 4WNQA 4P46A 4P9HL 4PJHA 4TNWF 3UTSE 4N8VG 5BO1H 4QOKA 1P9MC 2DQCH 4HZLA 2UVFA 5DLMH 4PRPB 1J1OH 1YEDA 4P3CL 1A1MB 5C09E 1NCBL 4BH8A 1HSAA 4PJ8C 1E28A 5IBPA 3CU1A 3FN9A 4GBXB 1RIHH 4XP6L 3LEYL 1CGVA 1I7UB 2X42A 5IT2L 4LPCA 4ZUVA 4KAQL 2UY6A 1KG0A 1EVTC 1T66C 2RFXB 3GDBA 3NZHL 4TOYL 4P23C 5I1LA 4C4KT 1DSFL 4IS6A 5KOVC 4KVNL 4JM2A 3KYOB 3O2VL 1G7QB 3CFCH 4NC1E 4M61B 5CJBA 4KK8D 4D3XA 1VADB 5BRZE 2W07A 1I9RL 2VQ1A 1WIPA 1KTLB 4LLAA 3ZDZF 4PG2A 1MCOL 1KEMH 1LMKA 1XZ0B 1K88A 4Y4FD 3PQYB 4U7MA 5D2LE 5BQ7B 4G6KH 1I3RA 3MRGB 4FS0A 3VXRD 4TSBH 4AG4H 1IEAA 1D5XA 5DSCB 1N64H 3WUWG 1A7OL 1CR9L 3HAEH 4MNHB 5DGRA 3QO0A 1U3HD 1CU4L 3LQMA 5C0CE 2OR8A 1LGVA 4OM1H 4M48H 1Y18B 4XAWH 2NQCA 2E3VA 1RWOA 2O93L 4OCXH 3QG6A 1TPXC 2KQMA 1HCVA 3VFWB 5KN5B 3QH3A 4OV5B 1VFOA 3QQNA 2YPKB 2D0HA 3NIDE 1J86A 1LDPH 3TJEH 5E8EB 5LGHL 3CPLB 2R2BA 4YHZL 4HGKC 3VD7A 2R0KL 4YX2H 2QSQA 1MCBA 3PGFH 4RGMB 4CW1B 2WQ8A 1IEBA 5GS0L 5DD5L 5F93C 4OZGE 3EYFB 3DUUB 3EOYG 3G04A 4HS3B 1LP9A 4J3SA 2Q76A 2VZ3A 1Q9LA 3GBNH 3IDMB 4FNLL 3RX5A 5I8OL 3LEXB 2JIXB 1H5BA 3FOLA 3TYFB 3HA0A 1UEMA 4XBEL 4LMQI 2XZZA 4X8JB 4XH2B 3WHXA 2DD8L 4ZNEA 5DJAB 5LU9A 1I3GH 4O2FA 4OLXL 3RVXC 5C9KA 1RUML 3V6BR 1U3HB 3E4CA 4J1UB 4PRID 5DMJB 2LABA 3UJTL 3TFKC 4DN4H 4OCSH 3NFNA 3FQUA 4ZXBD 1QD0A 3EO1B 3KJ6L 4WI7A 3VXRB 4BK4A 1PZUB 3KPOB 4LPYA 5DJXA 1K2DA 1RK0B 2RB8A 4GBXC 5CCKL 4K9EL 5KVGH 2J1KA 3MCLH 4OF3A 3HI1A 1GGIL 2YD7A 3UAJC 4GS7B 1HKLH 2DF3A 1N0XL 4R26H 3R6GA 1T1XB 1JK8A 3IJHB 4I9WE 2QQQA 1KACB 3ULUC 5GSVA 3WFCL 3DRTA 1MCCA 2QKIA 3IDUA 2V6HA 1R3IL 4QHNB 4R4BA 2GJ6E 3RP1A 1AKJB 4PV8A 4KQ4L 1SM3L 4ACPA 1JUFA 4AENA 5K9JH 5IC6A 2YPLA 3FHQA 4LCCB 1AIFB 3SGKC 5HHPB 2GEEA 4LGRB 4XT1C 1O7VA 1NCCL 3JV4A 4MB4A 4C83A 3VG0L 4OFKA 1N59B 2ESVA 1TVBB 4PJ5E 1KB9K 5A2LH 3VFSB 2D7TL 4NQCE 4Z5RB 1EHLH 5HHOD 4RGND 1HHIA 1ZMYA 2ZUXA 3CFBB 2VERN 4R7NB 2E7HA 3OAZK 5MEOB 1UC6A 3O6LL 4KRPB 5KSAC 2GITA 5B4MD 3VI4E 2BRRL 5I1HL 1UWGH 2EC9T 4GRLB 4M6AA 4R4NC 3NIFE 1IBCA 3GRWH 1Q9OB 1AP2B 1OVZA 1H5BC 2HH0L 3MMEB 3VWKC 5D2NB 4L29B 3DMMB 3UCRA 4I18C 4HLZH 4JRXD 3H9SA 2AJUL 1FO0B 3BMWA 5IC4A 1INDH 4QRRD 4GH7B 3QXAA 4QY8B 5D96B 2DQTL 2D4FA 4ESKA 4N9GB 1L7TL 3N1PC 3FB7B 4Z7OE 2A6JB 5FHAH 3O2WL 1EX0A 3D2UB 4MAYB 2FIKB 1FZOB 2I26N 3KJNA 2DYPB 3O6FB 5I1AA 3P2TA 1QKZH 4WDIA 3O2DA 4ZS7H 5KVMC 4J12A 1OL0A 3GSNA 4ONFL 4ZTOL 1H15B 1DFBH 2JK5B 5F1SA 3D39D 1FZJB 5D9SB 2BNQB 5IMOB 4HFWB 4J3OC 4YBQC 4CJ1A 4LASL 4AIZA 1EEYB 2YPVL 2AEIT 3MXVH 5HHMD 5CUSH 2D0GA 3MLVL 4AEEA 5J13B 3FRPA 1IT9H 1O5DT 1UJ3B 3I6LD 4ERSL 5IWLA 1E6OL 2XYCA 1AC0A 5T5FL 4M1GH 2ZCKH 3MLSL 3DUSA 1JNJA 4LCIL 1OGTB 3SDYH 2NTFA 4YAQA 3MUHL 4ZO6A 2OTWB 4Z0BL 1XF1A 1MUJA 3TT3H 4IHOB 2FX7H 3SDAB 3VCLA 1UM4L 5FAAA 2UZYB 3W11D 1S7QA 1RK0A 2HT2D 3N06B 4KK9C 3HN3A 2OL3A 1FORL 1CICB 1FP5A 1RZJC 1EGJL 1K4CB 4Q9BA 4HMEA 4HUUB 4OCYL 2CLZA 4LGSB 4UT7H 1QBAA 1F90L 2DM4A 3RWJA 5IQ7H 3MBXH 4OT1L 4P57B 3X11B 5D7KE 3KYNA 2A83A 4P59L 5IEKB 2YXMA 5CSZB 1EK3A 4NNXA 4XMLH 5FFLA 2R1XB 3J8F7 1UG9A 1BFVL 4ELMA 4QOKE 4HUVA 3SGEH 1X6NA 3OZ9H 3WIHH 3P77A 3P0YL 1XFPA 4UT6H 5C08B 4FNLH 1WVZA 4CDGC 2NLJB 1FG2A 4EBQH 2Y72A 3VWKB 1GFWA 3QNWA 4XNMB 4GG6E 5ELIA 1PYWA 4YK4B 3BKCL 2GTWB 1YEJL 4RMWA 1XR8B 1A7NH 4MJ4A 3M17B 2OTPA 2CDFA 1T20A 3MUGA 4L3CA 3O3EB 1DTUA 1B0GA 1CT8B 1XAUA 1OP5K 3RJDA 4P2QE 4PUBH 2P43B 4HIIA 4P9HC 5FYKL 4BQCA 3P4MB 4EBQL 4HD9A 2GJ6D 1BD2B 4ZFFB 4G8IA 2VDNH 5SX4H 1BQHB 4LK4A 4NN7C 2GJ6B 2BY3A 1XH3B 4YC2B 2H54A 1S7RA 2FYYA 1T5XA 3DJ9A 1QYGH 5EOCJ 2DWEA 4YHIB 1LNUB 3F8UB 5CP3H 5HHOE 5KTEL 1NC2B 4PJ5A 5IVNA 3WNKA 1Z3GL 2Z8WC 1MHPL 5C0IB 5CP7B 2EKJA 2F19L 5J12B 4Z6AT 2JJTA 4NWTH 5DJ2A 5F1IB 3S4SB 5F6IB 5GS0D 5SWZB 1L9NA 2BMKA 1ZHBA 4PRIE 2HFEB 1GIGL 5DMGD 1C5DB 1K6QL 3WFBH 2VISA 3WXVH 3O0RH 3O41A 1OAXL 1NUFA 2EDKA 2C3HA 3FN0H 4Z7NF 3WMSA 3MRFA 1A6ZA 4X7DC 1F11B 4X7SL 4XAKD 2IANE 4JR1A 1KENL 4XPBL 3BZ4B 3OG6B 4XP4H 5BMFH 2E8YA 2CSPA 3ZKMC 1Y6NR 2GJJA 1FGVL 43CAA 5DVMA 4M6MH 2OXHA 3WBDA 4LHUA 4HHAA 2H32H 3MCKA 2YD9A 4HFUL 4KY1H 4GAJL 1W0WB 4HKJB 4U05A 1MLCB 4J4PA 1KLGA 3O3DA 3VRLF 5F9DC 4H26B 3ZT6A 5DA0B 1D5BB 5CJ8A 2RCSH 2QQNH 1ZHNA 3LQAL 1CG9B 5IF0A 5C09D 3AREC 2IH3B 1IAIL 5D70H 3QJHA 3IB4A 4JFOA 1T1ZA 3B6SA 5IVXB 3HC0A 3GZKA 3EOAB 4OJFH 4LCYA 3ITNA 2X41A 1CP3A 2V9TA 3ZYZA 3MC0A 3W81A 4JFED 2NZIA 2EDNA 4KKAD 4NGHL 1YEKL 3HAEG 3VXNA 5GISL 3U9UA 2HLAA 3KYNB 5EU3B 4MWFB 1IZKA 4ELMB 1HH6B 2G5BA 3MBEC 4MAYD 4X4YA 2ZOLA 2B1HL 3MJ9L 3OKDB 4YHPA 4L4VD 2H4WA 2XOTA 2BFVH 2MMXA 4HDIB 5JPNB 1Q0YH 4XCCL 3HPJB 4GSDH 5L88H 3DI3B 1EBAA 1KMCA 3GBLA 4IJ3B 4MDIB 5F3HB 5J12C 4U1GB 4RAVA 1FNSL 3JWDC 3OL2A 4UOJA 3TN0C 2PYED 1T20B 4M1GL 4QRTB 1DQQB 3ARDD 1LWRA 4Q9CA 4OLVH 2H5IA 3NA9H 4JY4B 1NCWL 4I3RH 2C2ZA 3MRIB 3QEUA 3EYUH 2QADB 5TE6H 4CU6A 4QNPE 3FO0L 1VPOH 3DO7B 1EFXD 3RGHA 4DW2L 1LE5B 1F8TL 3FO1B 4RRPG 2EXWD 3RGVA 2P5WE 2XTLA 1OT2A 3ARZA 4PJ7E 2GYSA 2FHCA 4MNQE 4TVPD 1VEOA 4LVEA 5IBLD 4WFFD 1NCWH 5HD8D 3W2DL 1J5OL 5IASA 2RJMA 4R8WH 4DGVL 4U6YA 4YBLB 5LGKA 3OKOA 1BD2E 4D9RE 3CDCA 3U36A 3HFMH 1FE8L 1KG0B 4NO0D 5TQ0H 4WO4C 4BKLB 4IMKA 1DUYA 1AGBA 3CVHL 1OTSC 1D9KA 2ESVB 4QYOA 4AIXA 1YPZB 1CFSA 1JIBA 1NMCB 4LCUB 3TWCL 5C1MB 2WW8A 4XPHL 4JHAL 2HAZA 2JCCF 4NQDD 2YRLA 4M8QA 3SKMA 3H9YA 1BBJA 3ARDA 5SWZE 4F7CB 4KMTH 3CVHH 4JO3H 1RFDH 3IDGA 5KZCD 3CFDB 3SDCA 3H9SB 3VFGL 1N3NB 1MJUL 3GSQB 3QXUA 1YQVH 3BIAX 3V0WL 3DGGB 1NSNH 3FQNB 4X0KA 4Y1AA 1S7UB 3U7YL 1I1AC 5F8RC 3E6FA 4JQIH 5KSBA 4BSVB 3MLYH 4CGTA 4ZVOA 2BSRA 2G75B 3PGFL 2EIZB 3MV7B 1CGSH 4MAYA 4R2GC 4O58L 3GBNL 1RFDL 1F4HA 4ZFZA 2DM7A 2YMXL 4MA7L 1FNEA 2ZUUA 2Q8AL 4CAGA 2YUWA 5BZDA 2WUCH 4DFHA 2ITDA 3V55A 3IKCB 1B2WH 1T4KA 3AC0A 1YECH 3SDDD 1VEMA 3BE1L 3ILPA 3HE7C 4PJ7A 4G43A 4H1LA 1EMTH 4QY8A 2WBKA 5EIIB 1GAFH 3DBXA 3K74B 1S9YB 2W0PA 5I1JL 4YHNA 4GMTH 4FGUA 1G7PB 3RGVC 1A6AA 1X4XA 4XBGA 3CSYA 3LOWA 1OAUH 5INDA 3T77B 3V52L 1B2WL 4QU8A 1FFOA 2CNNA 3CX2A 4ZFOA 4PJXE 1S7WB 1IQWL 5FOJA 1QRNE 2GK0B 5T5NF 5IVXE 2O61A 1QFWM 4ZUWA 1LD9A 3L3HA 3R1GL 3BT2H 3CX5J 1DDHA 4QRSA 3FQUB 3MREB 5TE4L 4EJ1C 1UCTA 4N9OB 4U1MB 5EUKA 4IMKC 3CDGB 4HEME 1ZHKA 3W11C 5BJTB 4XGZA 3IYLW 2AK4A 3CDFA 5KW9L 5D93C 1BEYL 1WTGT 1HEZA 2P8PB 3T08A 5LGJB 4GLRH 35C8H 3QNXA 4G6FB 5A16A 2R0ZH 1UXWA 3V4PH 4PGCA 4DVBB 1CLCA 3BH8A 3U0WH 3AXLA 1X5KA 2NX5D 3KPQA 1ZSDB 4OQ1A 4L9LC 4N8CH 1S9KC 3OPZL 3O9WC 3PWUB 3WFZA 1KCUH 4NO0A 3T1WA 5I1EH 1F02I 2NY6B 1FYTB 3QRGL 1H8OA 3C2SA 2CLRA 1VGKB 2Q86A 1JGEB 4HF5H 4N6NA 1ITBB 4LQFL 5I2IB 5CBEB 2GCYA 4MAYC 3F5WA 4JG1H 1JGDB 2IC2A 3J7HA 5JW4M 1KCUL 1GL4B 5DJYB 3I6KB 1I51A 2CKBA 4ENED 5D71L 2AEPL 5D72H 3VD5A 5J89A 1CQYA 4WWKB 4LGPB 2AJUH 1KJMB 3HR6A 5C0AA 3WO4B 4G6AC 1MCOH 4TQEH 3BO8B 4H8WC 2GI7A 2BVUA 5IEHA 5D7SL 4EI5D 3BP7B 4N68A 1HHKA 1HOCB 3SE9L 2CR6A 3OG4B 3E8UH 2HJLB 5JQ6H 3S96A 4LAQH 1PX4A 3FO0H 1FG9C 4LLYB 2OYPA 4TQEL 4XVJH 1I1YA 3MRPA 4Y88A 5FO7A 1FVDA 4DCOA 2X10A 5I73B 5DLML 1QOKA 4Z8FH 5ANMB 2XTJD 4RAUA 4KJWC 2OR7A 3LSOA 4MJ5B 4MJIA 3IDIA 4AY0A 1HINH 2V9QA 2BOCA 2WDPA 4N1EA 3DURA 4N0FB 5H8DA 5C0CB 5M94B 5I74B 4WU7B 4KGJA 3UYRH 3MYZA 2NY5H 1YNTB 2PXYA 3NCEB 4AL8H 2QL7A 5IESH 2VC2L 5T3XH 3ARGA 5JLZB 3EOTL 4OZFB 3K1DA 1FC1A 4LFHD 4JG0L 3D9AL 4JHWL 3VXMD 4ODHL 4P2RE 4DK6A 4F9LA 4YDIH 3H9HA 1KPRA 3UPRA 2Z9TA 2ADIB 4PJDB 3C5SB 2DI8A 4B5EA 1RZ7L 4YK4C 4NPYB 5C0BE 2NY5L 3P4OA 4HJ0C 1CG9A 2F53B 4I2XE 1JGVH 4Q2ZB 5KVEL 5T3ZL 5MERA 4TULH 5KANI 4S1SH 4UINL 4DGIH 4WI5A 4CBPA 4KTDH 3F7YA 3ARFA 4LPTA 4Y19B 3ZHKA 4YHYB 5J7CC 4WI9A 4G7YH 4WJ5B 3QAZB 3WJLC 1X5FA 1GC1L 5IBUB 3VGHA 4M1CD 1RAMA 3F12A 1XF4B 3G9VA 2EDHA 5GS0H 1L7TH 1ZHNB 4WGVB 3FZUC 1QFUL 4NKMA 3PABA 3C09B 2D31B 1WCBB 1KXVC 3N9GL 4W70A 5IFAL 3PD1A 1IBGH 5C08A 5HGDB 2R15A 2X4SB 5F7DB 1IM9D 1FLRH 4PJCA 5GRJL 5J11C 5E08H 4YUEL 2UWEE 2SEBB 5CINH 1PKQB 1F1JA 5JORA 2V9RA 3MBEB 1RV6X 3GRWA 4LLUB 2HWZL 2F74A 2B20A 1HXYA 3RTQA 3ZKND 3ULUF 2YPVH 5E5UB 3R1GH 1DUZB 3L3IA 2IPTH 5HSFA 3ZLQC 2O26U 2XN9A 2BCKB 5E8OB 4X7TB 4L8SA 2GJ6A 4EHDA 1T5XB 4YE4H 1C12B 1NLBL 1Q94A 1G84A 3GIZH 1S9WB 4K8RD 3W5NA 3EYOB 3WIFA 1M7XA 1ZT4B 4PY7A 5DEGB 1CXLA 3WHE1 5DRZB 4MJIE 1WTLA 5JXEC 5BOPA 3OPZH 4OGAD 5K33A 1G7JB 4JHBA 4CVZA 5IVOA 4S0TD 1RHFA 2EDLA 3VRLE 1TJGL 3QRGH 4LHJB 2DKSA 5FOBA 1SEQH 4TUKL 1JPGB 4OT1H 2BY0A 3LSOB 2YK1L 5GJSL 4DCJA 1KELL 3T3PF 1N6QL 2GJZA 5ISZD 3QEQB 4HH9B 3HZKB 4FQ1L 4OCWH 5GGSA 3EHBD 1I1FA 3IXTA 4CVXA 5ENWA 3MJ7A 1Q8MA 2VZTA 1CLOH 1TVDA 5KVDL 2HVKB 2NY0D 3QXTA 1CDBA 3MV7D 1KJVB 1CTOA 2HG5A 5BXFB 5L0QB 4Z7NE 1Q9KA 3V5HA 2HFTA 4GT7A 4HAFA 1CFVH 4HKJA 4TNVF 4X4XB 3VMOA 4OZHE 4OAWB 2IFFH 4U1KA 4PJIE 1I1AD 3AU1B 3L3GA 5DJCA 3KR3H 4WU5A 4Z77B 3B9KB 2EE6A 5GS2H 3TYGL 2NY2D 5E70A 1WT5C 5ID0B 3UTZA 4UILL 5J11B 1HWGB 5I9QB 1JMZA 4D3CL 1JHTA 4M7JL 4MNGA 5ECJE 3WIIH 2EE9A 5DUMH 1M6OA 1I85C 3QI9C 1FV1A 3LN4A 1VACA 2CIKB 1HYSD 2R39A 1QBBA 4K8RC 4TN9A 3X3FH 1RWWA 1UH2A 1TCRB 3O11B 4KK5C 4NHCL 2ADGB 4EXKA 1SJEA 4PRNB 4GRLC 4LASH 4H1LH 2X4SA 3L7FA 2E6QA 5GRUL 4OLVL 2H26A 2A77H 1UWXK 5DZOA 2PR4H 3E1F1 5A40E 5C0DA 2MOVA 4QU5A 4XP1L 3HPLA 2MKLC 1MSPA 1D9KD 3WKMH 4PJGE 4QU9A 1P5VA 4QXGL 4HK3J 4TVPH 3GMOA 4NBNA 3QIWA 5I75B 2VXVH 4NDMB 4O02L 2VAAA 4W4OA 5DJ8A 1J7VR 5F9AC 1ZLWH 3MRCB 4OTXL 2H2PC 1JWSA 5GGVH 1R5VA 2EO1A 1T03H 2Y4SA 1HNGA 5EA0H 3HFML 3LKSB 4A6YB 4KMQA 2XZAL 3KPSB 5GGQH 4XPAH 2OSLB 2GAZA 1BLNB 3L3JB 2W65A 4EUPH 3BQUB 4JFQB 1VFBB 4Z7VF 4XP5H 4N6GA 2EYTB 1H3TA 1V7NL 1VGKA 2Q86B 3FT3B 4EVNA 1OGAD 1MLBA 3QCUL 3MGOB 4JFYB 4XCNB 1D5MB 2OXGA 1D6VL 4MQXC 3O4OC 1A7RH 4HQRA 3GIVB 1JL8A 5ICYB 1MFDL 5DJZA 3ARED 3AXLB 4WWKA 2DAVA 5HHOB 3UTQB 3DRTB 5E08L 4BZYA 4JCLA 3LN5B 2CIIB 5IR1A 3RNKA 5CINL 3WFEH 1IM9A 2LAGB 4LLMB 4PRHE 3LRGA 3KLHD 5ANME 2OS7A 5B4MC 3BUYB 4L8DB 1EJ6A 1HN1A 3B9VA 4JRYB 1U58B 3TZVA 4JJ8A 3VFPA 2FBJL 2N7BA 4GW5A 2AJYL 2RAMA 2WIMA 3L3OB 1QFWL 3MLTB 3L5WA 2YD5A 3V4UL 1T5WA 2V7NB 1H8SA 1YEFH 5IB5B 4P49A 5IBRA 4KUZH 1RJCA 3RZCB 5IB2A 4HSQA 4MB3A 5I8CA 4PRIA 3CLEL 4JHZA 3L3GB 4L9LB 4HT1H 4KROB 3RWFA 4V2BA 1AR1C 4KQ3H 3FQRB 4L8CA 5EZLB 3WEXB 4XPGH 3BP5B 1JMXA 5A2FA 3QBTB 2DQDL 3FFCB 2VB5A 1SMAA 1P4BH 5DEFB 1MHCB 4L29A 2E9BA 3TBWA 4LCWA 2CNOA 2H9GB 3KLHC 4X4MA 2FQQA 2F53E 3VFRA 4PGEB 2QTEA 5KSAB 4EQ2A 3LQZB 4LQ1A 3BW9B 5FM5M 1RUMH 1FFPB 43C9B 2V2TB 3G08A 4KRMB 3ZE2E 2ZUWA 2JJWA 1CE6A 4OCWL 4WFED 5CMAB 1HYSC 3BJLA 1ADQA 3DXAE 2HBRA 3QCTH 3EOBB 4MXWL 2DM3A 3RVWD 4GXVH 2DDQH 2VL5B 3MSPA 2FJGA 5BV7H 1OGAE 4QUHA 2EC9U 2LAAA 5CIPB 3G5XB 3K7UA 1RZGB 4QRSB 4N5DA 5EFIB 4JR0A 1G7MA 2Q76B 1HHHA 4ZSOB 1VDGA 5F6IC 1IVLA 3PP4H 1NEZG 1IGFL 1D9KC 1QSFA 1KJ2A 4PLOB 5DS8A 4P3DA 3U83A 5HBBA 1F3RB 2NY3C 4QTXA 4WJ5A 3HLAB 4DGYH 4NQDB 5LGJA 1PKQE 5SX5H 3MR9A 1FNGA 5IW1B 2R2EB 3R8QA 1RMFH 1FAIH 4PGCB 4DVBA 1NGPL 1RK1B 3JVGC 3QPQD 4OM1L 4QRRA 1DR9A 2XXCB 3P4OB 5H0IA 2E7MA 4P4RA 4CUCA 1JP5A 4F3FB 1X5ZA 2IPUG 3KWWA 1F4WL 1A7QL 2WWKT 1NC4A 3FRUA 3VG0H 4LLVA 3MGOA 4GLRI 5KANG 4ZAKD 5E6YA 1I7UA 4JFDA 2BJMH 2N7AA 4WW2C 1HQRB 1IC5L 2Z92B 2XXMB 2ZP0T 1GGTA 1ZS8B 3DEIA 3KYOA 4A2LA 2A6IB 4CRPA 1MAJA 3P9LA 3C5JA 4M02A 4R4BB 4XHJC 3WN5C 1W8NA 3HE7A 4JHAH 4PRPE 4K23H 1C16A 1E4WL 2B2XH 4M4RA 1QR4A 3FQNA 4X0KB 4Y1AB 4K3JH 3SHSA 1IEAB 4JO2H 4FZ8L 3RJQB 1NUDA 1PYOA 2HBZA 2GTZB 2HJFA 4EHAA 3B4NA 4APQC 4Q97A 5JUEH 1XZ0A 5D6DA 1XGTA 4BQ9A 3KPRD 5L7XL 1DLFL 3ULVL 3W0WE 1RHRA 5D5ME 5SV4A 3QO0B 1OQXA 2JB5L 5IM7A 3ZTJG 4NZUL 1CK0H 1SJHA 4BQ8A 4U1IB 1NANH 4WO4A 4GAYB 1OT1A 4H1LB 2R0KH 4YX2L 2MHAB 2MJWA 1Z5LA 2XKNB 3GSWB 3QJFB 4N8VB 4JM2C 1HCFX 1IEBB 4LCWB 4DCPA 4HH9A 5FM4A 1I7TA 3FONB 3DVNA 4L4JA 5TH2B 3EOTH 3RQ3A 1QHOA 4K7PY 1I9JL 1GRWA 4HIJA 4HW6A 1S7WA 4ZUTA 4ODHH 3T0WA 43C9A 1H5BB 2I9LB 3KPLB 5T1MA 1OLZA 1FZOA 1MREL 2EDYA 4PY8J 3SDYL 3BSZH 5C0JB 1FIGH 1BF8A 1P6FA 4HV8B 4D9LH 1TDQA 1UKTA 1CQKA 1UM4H 1I1AA 2F54B 3RWCA 1P1ZB 4ZOBA 4OIAA 2WUBL 4YHLL 4A6YH 3O45A 2IPUK 5MENA 1YJDC 2NR6C 4LEXH 5DDHA 4KMLB 3GGWA 1A3RH 4L4VE 1AH1A 4BK5A 4EKXA 2CNLA 1KYOJ 5ICZB 4X6BA 4LEOB 1DVFA 3NFPB 4EZMA 1QSVA 4LLDB 1YJDL 4QT5B 1FZMA 3ALXA 4PGBA 1OCWH 3E8UL 3ULSB 1KXQE 1MCLA 2YMXH 4QHKJ 4OGYL 3P0GB 3UYPA 3IDJB 3KYMA 4G6JL 3ZKNC 5IW3A 1J05A 4POZC 1PJ9A 1OGAB 1KTRL 1J1PL 1E28B 1KC5H 5IFJB 1EVUA 4XC3H 3TPUA 4HUVB 2J88H 3IKKA 4PTTA 1OAZL 3HNVH 1N4XH 4CVUA 1T1ZB 3B6SB 5IVXA 1RQ5A 4YXKL 3RVWC 3S36H 3UJIL 3ZE1F 4DN3H 4JG1L 4U6HA 2DIAA 1PEZA 4ZNEE 3OF6A 2ESVD 5HDBE 4AIOA 5DQ9A 4P2CG 3TN0D 2XNAB 2NY1D 3U9UB 6FABH 1QRND 5ETUB 1I8IB 2D7PA 3HTLX 4DUXA 1HH6A 2YPLD 3MRRB 4LSPH 4OZHF 1NQBA 4GQPH 5CGYC 3VJ6B 2QQLH 4JY6A 5LCVH 1NMAH 2IF7A 4BM7A 3QUKB 1Q72H 4P5TC 4IBLT 1MCNA 3GRWL 1HK6A 1ZWIA 4ODSH 3ARTA 5I30L 4MDIA 6FABL 2XICA 2FNBA 2YD1A 2YWYA 2E6JA 2VUOA 2CLVA 5C07E 4Y4HD 2VXQH 4N8PA 2ADJB 3MA9L 4F9LC 3NIGE 3ZT5A 1EAPB 4U6VL 1ZHBB 4F57H 1L4IA 3T3PE 3FB7A 1T83C 4F7PB 2QHLA 5C08D 2HVJA 3D85A 1NMBH 1ZLUH 3LN9A 1G0DA 1KENH 2X09A 3T0XA 2EDXA 2OM5A 4YWGL 4UAOB 1F3DJ 5ACMA 3GHBH 3BIJA 1JWSB 2NX5A 5IQ7L 1UA6L 3FFDB 2IALB 4Y89A 4OLZH 3NTCL 1CF8L 3MRLB 2P2CA 5DXWA 5EULV 2DQJL 2BNRE 4DN4L 4GXUM 3T09A 4HS6B 1B4RA 1FYTD 3GMMB 1C5DA 3OKLA 2H5JA 3PGCA 2OTWA 3T0EE 1MFAL 2OQJA 1KLGB 3O3DB 4OLZL 5EWIH 1H9VA 3ET9F 3FMGH 3ZKMD 4APQD 2RR3A 3QG7L 4Q9QL 5IABA 1IGIH 2FX9H 3BZ4A 2I07A 3UTPE 1NBQA 3T3ME 1FH5L 2VIRB 4MNQA 1KIRB 4XXDB 1CXEA 1A14H 2Y36H 1BQSA 1QYGL 1S7QB 5C09B 3ZKSD 1JK8B 2D03L 2HT3C 4O2EA 3REVB 1T5WB 2V7NA 4JFEE 5AAMA 4X99B 4I3GA 4P2OD 1RWPA 1CK0L 4APQB 1RZKL 3O2DL 1KPVB 4P57A 1M4KA 1X5GA 1RHUA 1DANU 1CYGA 1S78D 3ZMRA 2R0WL 4JPIB 1X5HA 3WV0A 4UBDD 2OLDA 4LMQE 4NRXB 4PG9A 2Z91B 1G7IA 4O9HH 1JFQL 4PRAA 4EN3C 3H9ZA 4I8DA 3MUGB 4P9ML 1NFIB 1EHLL 4XBPB 1XGYL 3P0VL 1TJHL 5E99L 4PLKC 4IDLA 3ALWA 3TV3H 1S7SA 3S34L 1F3JB 1G6VK 3PXHA 4YGAB 4DFIA 4X7TA 4O02H 1XH3A 1WZ1L 4FP8L 1LHZA 1U2CA 5IG7B 2DBLH 1KJ2B 5JO5A 4P2OC 3PNWA 2NR6D 1FJ1A 4OFDA 4HAGA 4DTGL 4FQQA 3EDKA 2ZG3A 4XPFL 5F7EL 4HWEH 3MRIA 3BKJH 1MJJA 3PP3H 4NQED 1F13A 2VITB 2CDFB 2LU7A 2QR0B 5D7JD 2R69L 1VESA 5EO0A 3K81A 3NH7H 1A3QA 4D9QE 3GJSA 1OSPL 4M1CC 4NZRL 4HUWB 2NY0C 1MIEL 1TVHB 5JXAL 3SCMB 3SPVB 3UBXI 4NWTL 4XX1G 4MB5A 4HQ0A 4K55A 4U0RB 1DCLA 2ID5A 4M5YL 4YBQD 2ZNXA 1HI6B 3MODH 3R06B 5E2VH 3TA3D 2XZTA 1L9MA 2Z8VC 4Y5VB 1QLRB 1KGCD 4WFHE 5SWQB 1GZQA 1N6UA 4P2RD 3UZQA 3QULA 1HILA 5IHLB 1G6RA 4F58H 3N9GH 3FN3A 1H3GA 5IMLB 4FABL 2X4QB 2N4IA 5DUML 3JWDL 1P7HL 2CKNA 3MXVL 1AGBB 2NY2C 2I5YL 1T7YA 1W0VA 3TGXA 1YPZF 2C4FU 1ED3A 2QLBA 2Y1LA 1CZ8L 4JFZL 3INUH 4R90L 3HG1A 2Q8BH 3OKYA 3C5JB 4JAMA 3QPXH 3MLWH 2X4NA 5JHDB 4MSWB 4XNXL 4OCRL 3TNMA 2KQNA 1XIWC 4WUKL 2GHWB 2XYPA 2IANA 2D4DA 2DQEL 1A4JA 4WW2F 3DNKA 3SQBA 5GZNC 4S1QL 3VMPA 1JNNH 5D7JB 3VW3L 1R3JA 2AEQH 1MWAL 5C0FB 3QEQE 4N0UA 3ROOB 3UEZA 1A6PA 2HFGL 5IBUG 3KXFA 1F90H 4JKLA 1UEYA 1BBJB 3ARDB 2XFXA 1YMHB 3SDAD 1N5YL 2R23B 3QR2A 3ARBC 4P4KC 2I27N 4FFZH 4JPVH 5C09A 4OJFL 5JQHC 4DW2H 4ZUSB 3SDDA 4K3GA 1KCKA 2DLFH 4NQCD 1B0WA 3U82B 3T2QA 2B1AH 2IQAA 3JTTB 2VSCA 2YKLL 2C2KA 2H2PD 1ZGLB 3BH9A 1FL6A 3K3QA 5EH1A 3QUYA 1W72H 1GHFL 5BS0B 3CXDH 3H1PA 2FWOB 1CU4H 4PJAE 2EZ0C 4M48L 4YO0B 1VFAB 5IHZB 1F4XH 4J2XA 5HYSA 3BVNA 4GSDL 5L88L 4EUPG 5DUBB 4GW4B 3TBSB 5F3BA 4MQTB 4W6WB 2GFBB 2W9EL 3OKEB 3UOAB 3OGCA 2MCPH 1A4KA 1YZZA 2QBWA 4GQ9L 3Q2CA 1CXHA 1S7TA 5EO9B 3U4AA 3KPLA 1MHHB 1F97A 4F2MA 4M62H 1E4XI 4LLDA 2ICCA 15C8L 3S4SG 4ZFOB 4M9OA 5EG6C 2BY2A 1I85A 4HBQA 2H6PA 1RK1A 3MOBH 4NBKA 4PJDA 4I3SH 4HIEA 4IRSD 2ATKA 4RQQA 3GNMH 3DMMD 4RNRB 4PJ5D 4N0UE 4NRZA 4KZEL 2BNQE 2IWGA 1TLKA 4QRUA 4LARH 2J31A 2W0KA 2NZ9C 1I1RA 3OXSA 4DAGL 4BZ1L 3O9WB 3LHPL 4YFLF 1VGEH 5A16B 2X1XR 4LLQA 4G6FD 2OR9L 4M7LH 3TN0A 3VFOA 1HQRA 4P9MH 2A77L 1KJ2H 1IGJB 4PRBA 1CFSB 5F1NB 2IMMA 1AD0B 2V7HA 3KPSE 4NJAL 2FD6L 3QISA 4AMKL 3EDQA 3LZFH 3GSQA 2COQA 4PV9A 2VDKH 1KB5H 5I1LB 4JDTL 3TNMB 5D1XA 4OGXH 1WV7T 2ZCHL 4R97C 5JOPE 1JGDA 4FEAA 2VXTL 1UXSA 3RVVC 1RIVH 4CKVX 3BZDA 1AO7D 1NC2D 4RDQG 2BHZA 4M4PA 1X44A 1CIUA 2FO1A 2WBJD 3ISWA 5FYLE 4KV5F 4R4ND 4BSVA 1X5IA 3NBNA 4R7DB 5GS0C 2CXGA 1KTLA 4NP4L 1BEYH 3QH3B 2BK8A 1NFDF 1FRGL 3MV8B 1MJ7L 2Z8SA 4DKFL 5I1CL 4G43B 2AVGA 3CPLA 4UV4L 3GSXB 4JRYE 4ZXBB 3HS0B 4KFZC 1MCEA 3I3DA 4Q74A 5EU3A 1EZVY 4AYFA 5DVOA 5KN5A 5FYKD 4MNHA 1ADQH 4HCRH 4JFEA 5C07A 3ILPB 5INDB 4HEPG 5E8PA 3QUXC 3QFDB 3LRSB 3JVGA 4J3TA 2E9JA 2KBGA 2WUBH 4YHLH 5BZDB 1S9YA 1R3LA 4ODVH 4YHNB 4EI6B 3EZ8A 1CFTA 1ZE3C 3QUYB 2R0LH 3SDCC 1DDHB 3DWTA 4WDIB 1BVLB 1LO5A 4K71B 1U3JA 4ZFGH 5L2JB 4S1SL 1YA5A 2AXJA 4Y5YA 3LAFA 5HPMA 1MF2L 3WNLA 5F3BB 4XBGB 1AFVL 3BQUC 2HKHH 1QKZL 1U8LA 3BXNA 2J4WH 4Z0XA 3MLZH 5IKCA 4ZS6C 4OSUH 4MMZC 5ITBH 2D7OA 3RY4A 4KKBC 1LE5A 5BV7B 2AKRB 4NZTH 1BIIB 1IKFL 1I4EB 4LIQH 3WN5A 5IHBA 3V0AC 5LGHH 4ELKA 2YUZA 4M1DL 4XNYL 4HC1L 5FA3A 4AWAA 3I9GL 3O4LB 3WDJA 1UACH 4UIMB 1ZLUK 4RA3A 2IBZX 3SDXB 5DZNA 4WWID 2BVTA 3E6HB 1FFRA 2OL3H 1ACYL 3ILQC 1E4KA 4IMLB 1VERA 3PABB 4NQVB 4OD1L 3RX7A 3U7WL 4BUGA 5D6DC 4EN3D 4YQXH 5IJVA 1DANT 1MVUB 1I9RH 2OZ4A 3KGRA 3RVUD 2YPLB 3CSBA 3QXDA 4WHCA 5FF6A 4KVNH 4PP2A 1U41A 1VADA 1L7IH 2NW3A 1E4XH 4JRXA 5HYJA 1XCTA 1YNKH 3HI6H 5C2UB 4LSUL 3HE6C 4K7PH 3D48R 3F58H 2MCG1 2MPAH 3BYTA 4IOSD 3DIFB 1OAYH 5J13C 2OTUA 3ARWA 1R5WA 4LOUC 5B39A 5FECB 2C7UB 2OMNA 1TNMA 2QR0A 3HCVB 1B0RB 4KI5F 1LK3H 3S9DB 3K2MC 5EO1A 2V5MA 1CWVA 4XPTH 5E1AA 1X5AA 4XCYB 1TQCC 1Z6JT 1GZPB 3T0EC 3IDXH 4JGMA 4GRMA 5HGAA 5CD5C 4KTDL 2WM0A 4RFNB 2OZ4H 2G2RA 2G60L 3GM0A 4HIXL 2N1KA 1NAML 1R0AL 1S9XA 3X12B 2I60H 4U1HA 2NTSP 1T1WA 4EDXB 1I4FB 5E6IC 1T0NB 4U0RC 5DD6A 1IGTA 2X89D 5CKAA 5EIIA 3EJYC 1YQ2A 4NCC1 3HB3D 1RIUL 3QG6B 4JPWL 4QEGA 1HKFA 2EC8A 3P30H 1JHLH 5C6PB 3EYOA 1KN2L 1TVHA 3RHWK 3QDGA 3MRLA 4L4VA 3EYQD 5SWZA 4NWUL 3MV9B 2BVQA 4PFEA 4Y5VA 1ZHLB 5DVLA 3ILQD 5HI3D 4WEUD 2AJVH 2P46B 1KJVA 4N0RA 2Q7NA 2DJSA 3V6ZA 1A14L 1YEEH 1JHLL 2EIEA 5GHWL 4F7EA 4X4XA 1KXTB 4LSRL 4NWUH 2EH7H 1RY7B 4FZ8H 4LCWE 3DUSB 4DJMA 3VXMA 2P5WB 3UTSB 2IPKA 4ZPVA 3QDAA 1OLLA 2YUVA 4MNQB 4F37F 1FBIH 1VHPA 1XGPA 5I8EA 2J12B 4YHOL 4F37K 1LEGA 5FB8B 4HH8A 1L6ZA 4P23A 4PJEB 1J87A 4YE4L 3ROLB 4GG6F 1ZA3B 5LG1A 2OI9B 3QDMD 4MX7A 3NFSL 2AQ2A 3MACH 1MJ7H 1MUJB 4IHOA 2VRAA 1BZ9A 4ZTOH 5IMMB 1I9IL 4IRSC 5E2TH 3ARFB 3VMNA 4PJDE 3S8EA 3PIQB 1MCFA 2R8SH 1WAAE 3BDXA 4YWGH 3KPPB 4PRNA 5DFVD 2VNCA 3JWOC 3T8XA 3D0LA 4YNYB 4JM4H 3W39A 3PDOB 2K1MA 1IEHA 3C2AH 1RZJH 5C8JA 2HRPL 4KRNA 2APFA 3ZSSA 2SEBA 3JUYA 3STZB 1CVRA 4XNUH 3SKUD 5I71B 4OQTH 3O4LE 5JDSB 4U1JA 1NFDB 2KH2B 1CLZL 3VXQA 4BFIA 5I66A 3SDXE 1UWGL 5FGBC 1DEDA 5TGBA 3AY4C 4HIIB 2OJEB 4G8IB 2CLVB 5MEOA 4LLUA 2VLKE 3EBAA 5EDXA 4XP5L 5D4QA 5I1IH 3EDJA 3TBTB 1PYWB 5EO1B 3LMJL 1KPUA 3ABZA 1NBZB 3MGTA 4K94C 3IJYB 1A6UL 4UDTA 1DQQA 1KOAA 4IEFB 2HA1A 1JBJA 4DZ8A 1U93B 4MD4B 2E8ZA 1MCSA 3GSNB 3M1BA 5GGSY 2Y07H 3SE4C 3P0YH 5IB4B 3DGCR 5I1AB 3RL2B 3MRNA 4PJXB 1ICEA 5C71A 1I1FB 3BIKA 1QRNB 2X7LB 5IROC 2GJZB 3QEQA 2A6JA 4JG0H 1B3JA 3K2UH 5HY9A 3EDFA 3C8KB 4HUKB 3KDMB 3RDTC 4YC2C 5B3NA 2CUIA 2P5EA 5E00A 5I8OH 4OFPA 1RURH 2HVKA 1H15A 1FZKA 2GSGB 4NNYA 5JW3L 2GSIA 1EIBA 2O5YH 1YY8B 2DJUA 4JB8A 3MOQA 1WSST 2V5TA 4Z0BH 3QDMA 4HXAL 1J88A 4KHXL 3IFPB 3T0ED 3OSKA 2FX7L 1S9VA 2Z31D 1EEYA 5M7QA 3ULVD 1EO8H 1LP9E 5JW3H 1DQTA 4L9DA 4M93B 1DBBH 1AGCB 1LE9B 1PDKA 1A1OB 2BNRB 1CD0A 1GIGH 5LKNA 1CFQA 1P7QB 3S8WA 4YDKH 1T0PB 5EBWB 3TH4T 2YWZA 4J8RA 2J8UB 4QNPF 3T0EB 5KSAA 3TBYB 4QHNA 4F80A 2O5XH 1BVKB 4D9QD 1RUAL 4ONHA 4PRAB 5CEZH 1LO3H 1R3HB 3OB8A 2NLJA 3SQOL 4KMTL 3U2SB 3QCUH 4Q7DA 4RGOH 3ULUH 5AWNH 4KROD 12E8H 3ETBF 4Q9RH 1AI1H 2EE3A 4ZPTA 1J0ZA 2W0LA 5HHPA 1NUNB 4RGNC 4P5TB 2NCMA 3I02B 3V0WH 1QEWB 3Q48A 4NO3B 3DX8A 1PY4A 3D0LB 4YNYA 1AXSB 2O5XL 4HFUH 3TIEB 3IF1B 4Y1AD 4GRLD 3FONA 4M03A 1OAKL 5ALCH 4NNPL 3A67H 3V7MA 4NQEB 1TITA 1MFAH 3AREB 3BHBA 4DZBB 5L2KD 4FQXD 1WT5A 5KS9F 5C0RH 2BNUA 1Q9OA 1CFTB 2R2HA 4X9HA 3GSRB 4KDTA 4KZEH 3CSYB 3TF7C 2RQ8A 2Y0BA 2QHRH 4BZ2H 1UB5A 1NDMA 1IAMA 4HV8A 2GK0A 4WEBL 1BGXL 1LVEA 3LD8C 4JPKH 3HI5H 4ZXBC 3IU3A 1GGBL 5D1ZA 2YS4A 1G9ML 2CJYA 1TJIL 3GMQA 1C5BL 5IWLC 1UADC 4MXQC 4ZTPH 3JWNC 2P1YA 3H42L 1KCVL 3PWLA 4UBDC 4GO6B 2EICA 1ZA6B 1N8ZA 2FLBT 2HFEA 1NLDH 2F58H 1INEL 4LLMA 2WANA 3PHSA 5F7KC 3VFOB 1GSMA 3LKQB 3LKRA 4ONOA 2WBJC 4NFBA 3UTQA 5I19H 3AROA 1AD9A 1P4LB 2PCPB 5A2JH 2Y7QA 1CTNA 2CGRL 1XF2B 3FHAA 2HKFH 2FEEL 3GJEA 5CS7A 5IB5A 3CXDL 1JCKA 4IOIA 2HN7A 4NM4L 3BPNC 4EDWL 1PZ5B 4BH7B 1OTSD 1UZ8A 4GW5B 2AK1H 4KK8C 3TYGH 3QUYC 3SDCB 5AZEH 1MI5E 5D2LF 3U36B 2NTFB 2HJFB 4L4TD 5L6YH 1R5IA 4MCYA 5D8JL 4LDEB 2CK0L 2IADB 3GKZA 2AR9A 1S9VB 5CD5D 3WS3A 4M61A 1MWAB 4GG6A 4LQFH 1VKXA 1F9EA 1PG7L 5HI4C 2DQCL 4K7FA 4AEFA 2W9DL 5HYQA 4O4YL 4I0KA 1A0QL 3OV6A 4EI5C 3HE7B 5B39B 3TVMB 2JF1A 4WUUD 5A3IC 1S7UA 1H0DB 4NQTA 5IQ9B 2P7TA 3GJRA 4LL9A 4GKZA 2EYSB 3B9KD 1PSKH 3L7EB 1T4KB 4IJ3C 4PLKD 3SOBL 4XP9H 1I7TB 2CJXA 2J8UA 2NY7H 4FQCH 1JF6A 4IRJD 3OHXA 4ZFGL 5FKAB 1LQSR 4YFDB 4QUDA 1H3WM 4JFPA 4P5TD 1MNUL 3VFRB 1HXMA 3H3BC 3C6LA 5F3HA 2C26A 5C2BH 5GIRA 4U1LA 3F6LA 3OGCB 5BRZD 1CLYL 5JHLH 1B4JL 4Y4HC 4HDIA 1V05A 4KKNA 1H3XA 3EFFA 3QO1A 1I4OA 2OX5A 4GJTB 4TSBL 4AG4L 3HLAA 4MJID 4PBXA 4ZO8A 3H11A 2YC1B 1FCGA 1W72B 1F8TH 4Z7QE 1RZIB 1KIPA 3EGSB 2ARWA 4K3EH 4K3HA 1A6AB 2ERJC 1HHJA 1T2JA 1B4JH 4URTB 1AO7A 2CDGA 3TFKD 3QEQD 4QGTA 5AAWA 1U8OB 2AERT 3WLWC 2XA8H 5BS0E 1FO0L 4OLWL 4RISL 4RFOL 3HUJE 3LPGA 1T89C 3P3YA 1GQFA 1GOFA 1NGWA 2BZDA 4LIQE 2ZG1A 4IMLA 4XXCA 5H37H 3T2PA 4QCIB 1A21A 1MFDH 2CKBH 1D5MA 3G6JE 4PRPA 4KAQH 4WHDA 3PGDB 3W39B 4LSUH 5GRVL 2AK4B 3DRQB 5I2IA 2CRMA 1YPZA 4H25A 1CCZA 3HRZA 5DRWB 4LU5L 5EU5A 1QSEA 3QCVL 5AD0A 5IOPB 5DJ0A 1BP3B 4R3SA 2YSSB 2FH6A 3VGDA 3PL6C 1WFOA 3H7BA 4U6YB 4NRXA 4PG9B 5TFSH 3TO2A 2GK2A 2ITCB 5TE7H 1ZTXL 3MRMA 3SKOA 5H35A 4HK0A 2VABA 1QX3A 4HKZB 1RWMA 3CVHB 5CLTA 2I60L 4RMRA 2QSTA 4BJLA 5CZVH 3VXSD 3MBEA 3U0WL 3KYKL 3DGGA 4EN3B 4LF3A 1Z9MA 1I3RB 5CFHA 4HUMB 1NEUA 4Y5YC 3RVTD 1DZBA 1ZANH 2IBGA 4L8SB 2YRPA 1EO7A 3P4UA 1HSBA 4X7CC 2A6KB 3MYJB 4WW2A 1JPTL 1IC4H 4F8QA 3BW9A 3LS5H 1FCCA 1BWWA 5K9KA 5KSBB 1A8JH 3IDIB 5IFHH 4K94H 5H94B 3C60C 2EKSA 1LP9B 1I7RA 2Y9RT 3Q5OA 4G8EA 4PJGB 3RX8A 1SMOA 3TM6A 4X4YB 4YQXL 1IGCH 3KPRB 4Z95H 3M1BB 4QHMA 4IRJA 5FDWB 1NAMA 5F70A 3IFOA 1IARB 3LH2L 3PP4L 1NBYA 5IFHL 1FIGL 3DECA 2B5IB 2OQJB 3S98A 2C2MA 3QZWA 2NX5B 5EU4B 3UDWC 2ZKHL 3GM8A 4PB9H 5E8NB 2XQYK 4BQBA 1AXTL 4OGXL 4J6RH 4N5EC 5HHNB 5DFVC 1I75A 4YHMH 5IHUH 1I7ZA 1PG7X 1B6UA 4F15B 4JFDE 1U6AL 3IXTB 1YYMH 3S5LA 2EDJA 2J5LC 2EDFA 3QEUB 3O2DH 1IL1A 3RBSA 1LO0L 5I15H 3BGAA 2OP4H 1OAQL 5TQ2H 2PTTA 1Q9KB 4PJ8D 5FUOH 4UNUA 4WHYG 5MERB 4U31A 2XTJB 2F5AH 3V6FB 4M93C 1QP1A 2AQ3A 3AS1A 3SGEI 4K7PX 4HWNA 3U2SA 5LAXB 4EI5B 4XC1L 1KCLA 5HGHB 5IUSA 2GW5A 4RFEB 3OMZA 2APWA 1SY6L 5HHQB 4AQOA 1LE9A 5DQ9B 5KSUB 3IAGC 4PJCB 2J6EL 2XZCL 1FAKT 1K4CA 8FABB 4WW1A 4U6HB 1WFTA 2X4TB 1E4WH 2B2XL 4NKMB 4WFEE 1WCBA 1KPVA 1XT5A 1Y6MR 1B0RA 1OTTD 4FZEL 3RKDD 1U8PA 3HMXH 1OSZB 1H3PL 3L5JA 5DSCA 4XCYA 3SE9H 3IVKB 4Y0GA 4AT6A 1KEML 1N3NA 3DO3A 3P9MA 4ZS6D 2BHYA 3WE6B 2ADJA 5HYSB 3RTQB 4X5XA 1XR9A 3EJJX 2UUDH 2YPLE 1K85A 5HYSG 4P5MB 5H2BB 4G9FA 4PBWD 1HWHB 1MRCL 3SCMA 1H3PH 2VLRB 2QLFA 2KKQA 1CDIA 3QA3B 4OCYH 3NIDF 5CEYB 4GS7C 2DMBA 1IGTB 5DJ6B 2Q6WA 1PQZA 4AEHL 1BD2D 4MJ5A 4X4ME 2NNAB 4NJ9H 2RHEA 4OD1H 2IALA 2HTKC 3RL2A 2BERA 5T3ZD 1X9QA 3LIZL 2AEPH 2Y06L 3SY0A 1ED3B 3MA7A 5K9KB 1L7IL 1YN7A 1T7VA 3BKCH 3I84A 3SPVA 3PGCB 5DRZA 1SY6A 2M26A 4F7EB 5TDOB 3KS0H 3ZDYF 2WIIA 3QIUA 7FABL 4OB5L 1JZ4A 1C1EL 3FOMA 2FGWH 3C5SA 1K4DB 3LKOB 3VW3H 1QRKA 4YJZL 1QZ1A 1G6RB 2JK5A 2VAJA 3RZCD 4UINH 1ODAA 4DGIL 3SGJA 5DK2B 1CVSC 1JGVL 5KVEH 2AP2A 1BQLH 4QGYA 3NVQA 4Y19A 3PWNB 4YXLL 1U2HA 4JGUA 4K7FB 2A6DA 4G7YL 4YDLC 3VXTA 1I3OA 3QNXB 5E9DB 5E2UH 3VCLB 2X9WA 3ECBA 1FN4A 1KPRB 4Y19D 5I6XB 3F12B 1DQDH 4JQXC 3V6OC 1LO4H 2E27H 3ARVA 3T4YA 4RIRA 3RI5F 3WD5H 4WHYH 2Z91A 1ZV5A 3BRDA 1RU9H 1GHFH 5F7YC 5EIVA 5ID0A 1KFAL 5GS2D 4S11A 5E5RB 3LS4L 3FT4B 2OL3B 3MOAH 4NFDA 1BJMA 5ACZA 3DV6A 4NT6B 3SCMC 3DVIA 5FGRA 3NAAL 4FOMA 4NSKB 4FFVC 3C08L 1FL3A 4GUPA 4KKAC 4XNZB 3VXSA 5CJOH 3NGBC 5DC9B 4NNXB 5D2NE 1U8QB 3DMMC 5KZCB 4Z7WE 4JFEB 2AXFB 3L5IA 3K2UL 5DK0A 1QQDA 1JNHB 5TF0A 1AKJA 3ULUD 1BIHA 1F6AB 4OF6A 4Q58C 3QFJA 1BGXH 3FQTB 1OB1A 3NABL 3CFJA 5IROA 3L3DB 3OB0H 4LPVA 1PGRB 1NLBH 1G9MH 2R56H 5IVZB 1YECL 2DTSA 4IRZL 1BQHA 3RDTA 3HZYB 4F57L 1YEHH 1KCVH 5EU6D 3QXAB 2F74B 3MLPA 5FCSH 2Z8RA 1S5IH 3ESUF 1JN6A 1G7JA 4LCCC 3W9DB 1AGEB 2GFBA 3OKEA 1SEQL 3VWJC 2DS4A 4OV5A 2DI7A 3M17A 4IIQC 3GSVB 4MA8L 5FDYA 3BD3A 5FOBB 4Q6YA 3B9EA 3PGDA 5D5MF 3I50H 1VCAA 4PD4K 5SWQA 1FLRL 1REIA 4P2QA 5D1QD 3RI5K 1JF1B 1YEJH 4FQJH 4GG8A 3RVVD 4LLQB 3VA6A 1ZEAL 1SY6H 1JGUL 1CXFA 2E7LC 5EZOH 4HFWA 5DI8B 1LO3L 3ZL4H 3OD5A 3MJ9H 4PGZA 4RMUA 5BZWA 3SKNA 2J6EH 5MEQA 2MFNA 3FQWA 4CVZB 5L9DL 3U7AA 4Q9RL 2PUQT 4ORGA 4Z7VB 1BMGA 4ZOEA 3U6RA 3CLFH 4JANA 1A6WL 4JR2A 1AKJD 4TSCH 1A1NA 1A6VH 2R9HC 4OV6F 5IB3B 1DQJB 2VC2H 2YD3A 1Y6KR 3MRDA 1P84J 1T6VN 3HG1E 1F4YL 5ALCL 5EN2A 3RUGA 5FKPB 5I9TA 3BOVA 2EDWA 2H2SD 1MLCA 2DKMA 3BKMH 4OF0A 2BVPA 2CQVA 4HMCA 1AQDB 4UB0L 1XF3B 2JELL 3CXHJ 2V7HB 5IW6B 3BN9D 1ZLVK 1C16B 2QADC 4H8WH 3UO1L 3BPLC 4HKZA 4U6XA 3RTQC 3X13A 1Z9OA 5LQBH 1EEZA 2VXUL 5AYUH 1CICC 2EDBA 4KDTC 3RWFB 3ZDYE 1YY9D 1I1CA 1CLYH 2MSPA 1GC1C 1MCDA 1UYWL 1XMWA 3QB7C 3FFCA 3QUZC 4P5TA 4X9GA 2BP3A 3RL1B 1ZK9A 3JTTA 3D69A 4LHQB 4PRDA 1P6AB 5GZOD 3T0AA 3EOAA 4LCCA 1AI1L 3GUTA 5E4EC 3TBSA 3C6LB 4EEEA 4HUUA 1SJHB 4CN6A 3DOSA 4LKCB 3QUXB 1BJ1J 5K59E 2ITDB 4GW1A 2VTFA 2H9GA 2FGWL 2VO5A 4OD3L 1MQKL 4M7KH 1E27B 2AXFA 3E2HB 1OHQA 5GGVL 1SEBB 4X98B 4YO0A 2WBJA 3TA3C 2ZWLT 3HPJA 3OX8A 2P48B 5C0DB 4A6YA 3F6IA 3MBED 4WEMB 3SGDI 5C0JA 2HFFA 1G7MB 4PPTA 2M1KA 5DUPH 4AQ1B 3OJVC 5D8JH 3BPOC 4PJAB 3AM8C 3C6SA 5D1XD 3MRCA 3VXOB 4QU0A 5I76A 3RWCB 1R24B 3R06A 5IESL 1IGYA 3Q6FA 4PJ9D 2EE2A 4QTIL 2FCBA 2VKXA 3K8KA 1QNZH 3JWDH 4EUPB 3U1SL 1CGXA 1P4IH 1HILB 2WINB 2H1PH 1AXIB 1QO3B 4OZHA 2H6PB 3QCVH 1DBML 4P3DB 1W0VB 3DTXB 5HHOA 1RI8A 2XG4A 3VXME 2H3NA 2BNQD 4WFHD 2QADD 1CI5A 1JRHL 2MTPA 5EORH 5LWYH 4HLZG 3S6CA 5JHDA 1KCSH 2VLME 3O81A 5F1NA 1G1CA 3BGMA 1WIOA 3IVKA 2GY7B 4LBEB 2VISB 4PP1C 4Q6IB 5CZVL 1YEDB 3TN0B 4J3WA 3ZHLA 1NH6A 3HE6B 4J3XA 4FQHA 4DGYL 2DQGH 1YEIL 3IDGB 3S88L 4YZFF 2XZAH 4JFFE 2FEDD 3HMWH 5IFAH 4XI5C 4BZ2L 5CJ5A 1RHHB 2IG2H 3UXFA 3EHBC 4UI2A 5SV3A 4XB7A 5GRYA 1ZS8A 4Z78A 1JPTH 3VFPB 1MELA 5DEFA 4KRPD 4HKXB 3NCBB 3FQXA 4ELME 5F9OH 1FRGH 4MCZB 1PD6A 3U48A 4Z7VE 3WEXA 1W0WA 1T2QH 5D1QC 5BQ7A 9CGTA 5F6HI 1DL7L 4BFEA 2H65A 4P2OA 4QHUB 2V2TA 2K7QA 1JWUA 1INQB 2CKBL 2IH3A 5A2KH 2FB4H 5KG9B 2XWBA 2P4AB 3AMKA 5E9DD 5GGTL 3IRZA 5FO9A 3OKDA 2VWEC 4YHPB 4WI4A 4JJ5A 1OD7A 3D69B 4PRDB 3QRFM 3GMRB 3REWA 4NQSA 3VWKA 4JDVA 2UWEA 3HNSH 2HTLD 1KNOA 4E41B 2QV2A 4G7VL 4HKBA 5KVFH 1T0NA 5DD6B 5I16A 3UJJL 3RWGA 4MD5A 1DE4B 3FTGB 1TMCB 4PS4H 4KQ3L 1QA9A 4AW9A 2X5PA 3O6FC 5K9OB 4XVJL 4MXQD 4UB0H 5FYLH 1QSFB 5I1DA 2I9LA 1K4DA 2XRAL 4Z7WB 5E95B 3WYRA 5JR1L 3JTSB 1TQBC 4Z8FL 5DJAA 5LUBA 1CF8H 4DOHB 1BLNA 3S35L 1T1YB 2HTLC 1N6VA 2QSCH 2YZ8A 4R0LA 5DQDH 5CBAB 1O0VA 5I6XC 2IQ9H 2JLLA 2A6DB 5I1JH 4HWBL 5F1OB 3C2AL 2A1WH 1NAMH 3W9EB 2YOCA 4FQ2H 3SBWC 4WI2A 2UV3A 5EOTA 5AYQA 5I8KL 3ECBB 1UJ3C 4KPHH 4G6KL 1JPFA 1MCRA 2IFFL 2PTUA 2AV1A 2X1WL 4QRRB 5D72L 2FLRT 3T4YB 5LBSH 3QDHA 2EEDA 3RWEA 4DEPB 5HTSA 4D0DB 3H9SE 4LVOB 4G80B 1F5WA 5D1QA 3THMH 2C4FT 4FQ2L 1R3HA 1W8OA 3TO4C 3TJHC 4ZVUA 3FQTA 3NCYP 1FSKB 1U8KB 4WV1C 5TE7L 4Y2DA 1ZTXH 3KPPA 3ZE0E 5DF0A 1RMFL 5HGDA 1DN2A 1ZXQA 1K8IB 1KIQA 5A3ID 1AXSA 1NMQA 4QXTB 4H26A 5I8CB 1U8QA 3EYSL 3RIFF 1GGYA 3QHFL 1QBLH 2XWJA 1NKRA 2NW2A 4FFYL 3BYYA 4NQEA 3VJ6A 3SJVD 4H1LG 3JV4B 2EECA 5FECA 2W91A 5ADOL 2X6MA 1GC1H 2DQUH 5JNYA 4KK9D 1WZKA 4P9HH 5ACLA 1IFHH 1DUZA 1TJHH 4YEFA 4JKPL 2B4CC 4RSVA 2KDGA 4WCYL 2NNAA 1RHQA 5EBLA 2EXYC 2C5DC 4KZDH 4UZGA 4XP1H 1OAZH 1FGNH 3VGBA 1GZPA 3DXAB 4UT9L 3L5HA 2MQ3A 4WENB 4DN3L 4P2OB 3IDYC 4BQ6A 1NMSA 4PJ8B 4XCFL 5HVWA 3P30L 4PJCF 1YC7A 4EI6A 3B2VH 5SX4I 4DUWA 3QDGB 3KLAA 5C6TL 1NEZB 1RULL 3D9AH 3BEWB 4O5LH 5ISZE 3GSWA 3C8HA 5SWSB 4S1DC 2VXSH 3V6MA 1NPUA 3ARSA 5SWSD 4GRWB 5T1DH 4PLNC 3IGAB 1HHHB 1E4JA 1WBZA 3JSSA 4ZSOA 4R26L 2EYRA 4K9EC 3V5DA 4WGWB 4Z7UA 4R96B 4UUJA 5F71A 1IILE 4FMKA 2AGJH 3OKLB 1QA9B 3V6ZB 4MVBD 5BVPH 2NY6C 4MNQD 3ZYOA 1WEJH 2PETA 4O2FB 1J10A 1RZ8B 5T1DL 5ICZA 3UBXG 5CJQL 2F54A 1RVFL 1EJOL 1ZVHA 4X7FC 4MS8D 1YY8A 5E1HB 2QL5A 3F7PC 5D7LA 3RKDC 1LO2H 2VR9A 5T3XD 4CADA 4GMSL 4F7TB 1TTUA 5BCAA 4Y5VC 3QEHA 3F62A 1MRDL 5CBAA 4HJGA 4LRNH 5IFJA 2C2OA 3EJZD 4KUCF 2D31A 4JFDB 2V2WB 1LO2L 5DJYA 4H0HB 3QUZB 3VFUB 3T8XB 1LP9F 2XYGA 4Y1AE 3LKNA 3RIFK 2YN3A 3REVA 4P46B 1I8IA 1CE1H 3CGTA 3PXJA 1Q72L 2QKIB 4CMHB 3P9LB 5JORB 2IJ0C 3P9MB 2XNAA 1ACZA 1NUGA 1IGIL 2FX9L 5H37G 3DUHA 5J6GA 4RX4D 1HXMB 2BOBA 1OARL 1WIUA 2VDRH 3MV8E 2GTZA 2DJ4A 4K23L 1CD1B 1OP3H 3GK8L 1K8IA 1KIQB 2PO6D 2L4OA 1N59A 1VFMA 1R24A 3UC0H 3ZTJH 4JO2L 1G7QA 2XWJB 4F7PA 3UTTD 2X4PB 4XC3L 4JJEA 1N0LA 4M8VA 2IAMA 2ZNWA 4Y5XC 1IRAY 4OFIA 1MFNA 5HJ3A 2VQTA 1NL0L 4QTHA 1QBML 3D5OF 3B2UC 1UA6H 1RHMA 3VFVB 4XNQB 3KXFE 2B5IC 5I8KH 2B0SL 5JOPD 3PF2A 4KPHL 1PLGH 2FYYB 2EXYD 1XGYH 3LKQA 4GQ9H 2BVQB 4M5ZL 1NGWB 5EU7C 5C0BB 3MOAL 1QBMH 1V3JA 2HVJB 1G7PA 3D85B 1K9TA 3B5HA 5F7UA 1ZT4A 3LRHA 4PY7B 5JDJA 2VLRE 5ILTH 1OP9A 1FNSH 3R8BB 3UPAA 3DX7A 1JPGA 5GS1C 3LD8B 5D7IF 4Z76B 4EXPX 5I17A 1N5AB 4N1HB 3DARA 4NOJA 3HZVA 1E4KC 3KAAA 3O45B 4W6YB 1GGUA 2FEDC 3DURB 5CGMA 3VDCA 1PBYA 4JKWA 5IOPA 2VZVA 4LARL 1XIWD 1T7ZA 1TTGA 4M9PA 4XMLL 4M6OH 1KB5A 4Z7UB 3TYFA 3TO2B 4NUGH 3QWOA 4FQLL 3JXAA 3MJ6A 3SE4A 3SOBH 1U95A 4PJFB 5EIQA 3WIHL 4OIIH 3C5ZA 2NY7L 4FQCL 2ATPA 3HE6A 5D96C 4GKNB 4V1DD 4HS8H 3VE0A 4XZUA 2Y23A 1QUNA 1B90A 3KPQB 4P48A 5HVHB 4PJDF 3NFNB 4OIBA 4J8RB 2VLMD 4PG2C 4Q2ZA 1I8MB 4UT9H 2PO6C 5HGGS 5F7WC 1JYWA 4R97B 2H41A 2ZG2A 5ID1A 3QDGD 4QHLA 1QQDB 1JGUH 3GI9H 5FM5O 5T1LD 5IB1B 1DLFH 2J7LA 5TDNB 3U0PA 1J12A 2DI9A 3DXAD 2NY0B 2CGRH 2BRQA 1WC7B 4WUUA 1E6OH 1T3FA 4KJPD 1LILA 1OPGL 1YEFL 1IAKA 1NDMB 2XV6B 4UV4H 3DX8B 1JV5B 2WBJB 3KPRA 3P11L 2V17H 1MFEL 1U8MB 4JQXA 3GO1H 3OTTA 5J6GB 3GSRA 2NY1B 3BAEH 4FQXC 2IEPA 5ALBH 4D3CH 3NACH 3MJGX 5J6HB 1J8KA 1AC6A 5I73C 3R5KA 1I9JH 4MA3B 4I5BB 2YD4A 2P8LA 3VXOA 3MNVB 5GS1A 4B41A 1S7TB 5EO9A 1DQLL 3ARPA 5CJXA 1FJ1B 4I18B 3M45A 5CD3A 4H5SA 4X6FA 4NQEE 4K07A 5LWYL 2FX8L 5CZKA 1W72A 2NY4D 5J1SC 3C8DA 4TOYH 4TSAH 5DI8A 3VFMA 2A0LD 2BX5A 4NCDA 2IGFL 3DMMA 5I1GH 4XMPL 3TV3L 2Y5EA 4KJWD 3C08H 3ZSTA 1RZKC 1SQ2N 3D6HA 1WAAF 1CICD 4U3HA 4PJIB 3FT3A 4EVNB 2ATKB 4D9RD 1AD9B 1P4LA 5C0BA 3QIWD 5BV7C 1AJ7H 4HWUA 5CHNA 3GSNL 2OSLA 4KI5E 4DTGH 2CDEA 3G5YA 1WAAA 4QRPA 1WF5A 2X4NB 1R5IB 1CIDA 3PP3K 1PX3A 4IRSA 4P5KB 4PJEE 3IETB 4Z76A 1T03L 3PL6B 1NCAH 2AJXH 1R3JB 4L1HA 3SGDH 1GCFA 3MLTA 3Q5YA 1S7XA 1UXSB 1QSEB 3QDGE 3KXFB 3GJEB 4LVHB 1DBKL 2VLJE 2Z92A 3PQYA 2ORBH 3V4PL 4ISVB 1QSFD 1DL7H 4NOMA 4Y2DB 1SC4A 3SKJH 1FH5H 4KKCC 2W38A 5GGTH 3QUML 4M8QB 3SKMB 3BUYA 4ONGL 3GSXA 4RFOH 5LQBL 3ULUL 5DURD 1EPFA 3WNOA 3AY4A 2VN7A 5BS0D 2XN9E 3WIIL 2Z4QA 1P4IL 2BNRD 1BF2A 3BWUC 3QWRD 5IB2B 3AM8A 4UIKH 5J3HD 1PQZB 2BXZA 4HXBH 3X3FL 3TCLB 2AJYH 5EBLB 4ENEC 2FR4B 4C54A 4ZVRA 5I75C 3G04B 4HS3A 2HMIC 3C60B 3RWIA 4M6ML 2VR4A 5FYJE 5KJRH 1JYNA 3ZO0A 1BHGA 4O2CB 3TBVB 1HZHL 1DP0A 5JHLL 5I1KL 2HYMA 1FV1B 4U6VH 4XWOC 1T0MA 4Y4KA 3MLRH 1KF9B 4K9EH 5KVGL 1PKOA 4R96A 4UUJB 4M7LT 4NM8L 4WO4D 3VWJB 4N0CD 1V3KA 1TCRA 1NGZA 2HFGH 4PJ7B 4GOSA 4KK5D 3BDBA 5C0GB 1A6TB 3EOBA 4OF7A 2Q8AH 2PN5A 2F5AL 3BVNB 4XP6H 4RGMC 4CNIB 3G5XA 1A3LL 2GTWA 2HJKA 3W0WA 4D94A 4ZUUB 2JB5H 3CD4A 1UCBH 5E7FA 4JQVC 1M7DB 3WLWD 3QSKB 4RFEA 4I2XA 2EH8L 4ZFOL 2WV3A 4Y4HA 3P4LA 3KPTA 3O3AB 4D2NA 3FB6A 2DKOA 3JV6A 3X17A 1DN0A 5L0QC 4NBLA 5FUCE 4MAUL 2G9HB 3O6LH 4PS0A 4IYRA 5HI3C 4QRUB 3ARBA 4P4KA 3TA3A 4QUJA 3DV6B 4NT6A 3L6FA 3MLZL 1II4E 2R0ZL 3R6LA 3VXSB 2VZSA 1MJ8H 1ZLSL 3OF6D 25C8H 5D7JA 2HBYA 1SC3A 3WKNA 2O5ZL 3CDYA 2CIIA 3HMXA 4K3DH 5DK0B 4DK3A 2EDEA 1DLHA 1EXUB 2NW3B 2XWTB 3H0TB 3A6OA 3QEGL 4KK6C 1NGXB 3BISA 3MRMB 5H35B 3SKOB 4W4NA 2Q20A 5IIEA 1GPOL 5HGAB 4KTEH 1G7LA 2OL3L 1RZJL 4YPGB 5HHVL 4XWGL 3ARYA 1UWXH 3I2CH 4HX1A 3VI3F 5BW7A 5A1AA 4AT6B 5B38G 4ZG1A 4YLQT 5MENE 4OFYD 3U4EB 1EEQA 4QXWA 1RJLB 2ADFL 4P3WA 1BQHG 2BVOA 2WWMC 1V8HA 3FO9B 1BFSA 1XF5A 5TJWK 4PGJA 1KPUB 3W9DA 5C2BL 2P45B 5E6ID 1OTUD 1ZT1B 2AXGB 2ZZUT 1I7RB 1BX2B 3KNBB 1NEZA 2DLFL 4UDTB 2NY4B 3KJ6H 5IK3A 3MCLL 1BQLL 4WVRA 3HC0B 1JRHI 2BSTA 3QXWA 2VDML 1ZGLM 4G8GA 4A6YL 3SBWA 1AFVH 2DDQL 3PWVB 3OBAA 4Z0XB 4NZTL 4JO3L 4PIRF 4KV5E 2W0FB 1EV2E 4AWBA 1QTYT 2ZSWB 4GAFB 1MJUH 2GT9B 3PE9A 4ZPVB 1YN7B 2I25N 5HPMB 1BIIA 1YJDH 2FRGP 1MI5D 1KBGL 1YYLL 4S0SD 2FJHA 3OGOE 4HIJB 3VDBA 1MRDH 4J3VA 4Y4FC 4HPOH 3TO4A 3MBXL 2G5RA 5TDOA 4Y8DC 3WDHA 2KPNA 4OLYH 3KPRE 3PHOA 4R90H 5J4MA 1ONQB 3B9DA 15C8H 1KTDA 5F9OL 1VB9A 4RAVB 5HGHA 1IZJA 2MKWA 1BZ9B 5IMMA 4UIMA 3TC9A 3F65A 2JJVA 5IKCB 5DD5H 5INCB 2CJUL 5J06A 3DYPA 2VLRD 4LEOA 4UTAL 4U49A 3UTSA 4AEHH 3DRQA 1MLBB 1U8IB 2A74B 3E6HA 4IRJC 4ZVSA 1IT9L 3BQUD 7CGTA 8FABA 2DQJH 3AS2A 1BFOB 5AEAA 4ETQA 4PTTB 4G80A 1LEGB 2VLJD 1FN4B 3L95B 4D3ZA 3F7YB 3PHQA 3LB6C 4ODTH 5IBTL 2A83B 3HKFA 1OAUL 3V52H 4TTGA 2J2ZA 1QHPA 4LHUG 4EI5A 1SJVA 2Z93A 4JKMA 1GXEA 2FO4A 1JNLL 3BPLB 2VKWA 1FL5A 4O5LL 1OGAA 2VABB 3FRPG 2OJEA 3LPWA 1OTUC 1LK3L 4JRWA 4ODSL 1VA9A 3F7VA 3OJMB 3UMTA 2AW2A 4KI5D 3QUXA 1X5JA 4ZS7L 4MXVE 3QA3A 3N1FC 4YGVA 4XX1E 1ZANL 4PTUB 2ZUVA 1JNLH 3AS3A 3DIFA 5EUOB 5H2BA 1MPAL 3W82A 2AJZB 2DTMH 4EQ3A 2E9WA 4I0PC 1U8MA 4D0BB 3S3JA 3BUTA 3S36L 1SHJA 3VH8G 3FB5B 3CAFA 4KZDL 2PYFA 4NNPH 3BI9X 4HC1A 3T04D 2EH8H 1MIMH 4TVSa 2P47B 3R0MA 5DFTA 5D2LA 5JIPA 2X9XA 4LLYA 2VLKA 2FP3A 1U8JB 4M62L 5HVHC 3CFKB 3STLB 1FVDB 2NXZD 5ESQB 3NIFF 1KLFA 2QLJA 3BN9C 3B43A 3VI4F 3THML 4L4VB 3WKML 5ANMA 5L2KA 4FDLA 3S35X 1WZLA 2D7TH 5EU4A 4RCAA 4X6DE 2H3NB 5MEND 3DUUA 2V2XB 4OGAC 1QACA 3IDNA 5MENB 3MREA 5TH2A 3B8SA 4HWEL 4XPFH 4PYHA 4FXKB 3VRIB 3ZKXB 3HB3C 5JOEA 2DKUA 1BOYA 3ROLA 3PWNA 5JXAH 4NCC2 1JYVA 4LEXL 4OZFA 4QRPB 3T77A 1U95B 4PJFA 1GOHA 1T66D 4P5KA 4YZFE 4YHZH 5ISZB 1UZ8B 4X6CB 3RVUC 2DIBA 5GRJH 5DR5H 3L1OL 5CLWA 4X7SH 4E0RA 5KAQG 4QRQB 3ZTNL 4XP4L 4CMMA 5TDPA 3KLDA 1CGUA 1WFNA 2ADFH 1NMEA 1EUUA 3KJ4C 1FL3B 4GUPB 5LUAA 4JZJA 3BN3B 4HKXA 1NC4B 3FRUB 2AJ3B 3D25B 3WFDL 3R7BA 4GMTL 3QYCA 4LLVB 3RWHB 4ONFH 1KCRL 3TVMA 2CUHA 1U8NA 1HEZB 2VXTH 3HZMA 3S3SA 4PRHD 3T0EA 1RULH 1V3LA 2B0SH 5E4IA 4QKXB 1HQ4B 4MJ6A 3V0VB 1P7QA 1WWBX 1PG7H 3MLXL 1CGYA 1AGDB 5E4EB 1U8HB 4UQ3B 1Z3GH 4OUUB 3QP3A 4JO1L 3VFTB 2F19H 2IQAB 3BMVA 1CXKA 1RZ7H 1JV5A 1URLA 3GMRA 3REWB 3GB7A 1JUFB 4AENB 5DTFA 4Q0XL 4X5XB 5D7LE 4X80L 5CBEA