4IEFB

Complex of porphyromonas gingivalis rgpb pro- and mature domains
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
423
structure length
422
Chain Sequence
GRMIVIVPKKYEEDIEDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDKWLGQALCIASAEGGPSADNGESDIQHENIIANLLTQYGYTKIIKCYDPGVTPKNIIDAFNGGISLANYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVAVNGDFLYNVPCFAEALMRAQKDGKPTGTVAIIASTINQSWASPMRGQDEMNEILCEKHPNNIKRTFGGVTMNGMFAMVEKYKKDGEKMLDTWTVFGDPSLLVRTLVPTKMQVTAPANISASAQTFEVACDYNGAIATLSDDGDMVGTAIVKDGKAIIKLNESIADETNLTLTVVGYNKVTVIKDVKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Porphyromonas gingivalis Virulence Factor Gingipain RgpB Shows a Unique Zymogenic Mechanism for Cysteine Peptidases.
pubmed doi rcsb
source organism Porphyromonas gingivalis
molecule tags Hydrolase
molecule keywords Gingipain R2 Pro-Domain
total genus 147
structure length 422
sequence length 423
chains with identical sequence D, F, H
ec nomenclature ec 3.4.22.37: Gingipain R.
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01364 Peptidase_C25 Peptidase family C25
B PF03785 Peptidase_C25_C Peptidase family C25, C terminal ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4iefB03
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4iefB02
3.40.50.10390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Gingipain r; domain 1 4iefB01
4PJCA 5I1LA 2OZ4H 3X12B 5F97E 4LMQI 1AFVL 3QIWA 1ROWA 5BW7C 1UJ3A 1DSFL 5CEXA 3TYGL 3MA9H 1FN4A 1L6ZA 1BQLH 2JCCA 5MP6L 4S2SA 2HT4C 3I3BA 5EUKB 3SDYH 5F89B 4OIAA 1DQJA 3EFFA 5JZ7D 4NPYA 1TZGL 4GRLC 2OR9H 2I5YH 3BKMH 3NA9L 3W9EB 2NY6D 2RAMA 3Q0HA 5IAKA 2VOTA 3TO4D 2YKLH 4XB7A 4B7IA 4C56B 3D9AH 2EDNA 4XP1L 1NMAH 3CFBA 2ENSA 3F58H 1FN4B 4P57A 4NO0A 4U1SA 2B7DT 2ZOLB 5I16A 4ODVL 3S36H 1XCTA 2PNDA 2UZXB 1NCUA 3F7YA 4YFLI 1QLFA 3KHQA 3FOLB 3CZFA 3QNYA 2J31A 3T77B 2QLJA 3AM8C 3ZE2E 3U9PL 3RHWK 2P8LB 3ISWA 4G6JL 4R0LC 3SQOH 3TYFA 4QRSA 5TQ0H 4OBRA 4IHOB 1MFCL 3VFUA 2NN3C 5FO7B 2VDRH 4X0KA 4J1UA 3VFPA 4FFZL 2AK4E 2R56H 2X2YA 1J12A 1SM3H 2WBWB 4Y4HA 5CCKH 4LQFH 4ZSOB 2BOBB 4H0HB 8FABA 1N7ML 4X9BA 2VQ1A 4Y5VA 2AJVL 4PJIF 3F5WA 1WCBA 4QY8A 4ZUSA 2BHUA 1FNGA 4L8BB 3DGCR 5LGHL 4HQQH 1NEZB 2WUBH 5IBUG 1ZT4A 3C2AL 3QCVH 3V6MA 1DL7L 2HRPL 2UZYB 1NCBH 1G6RA 4FNLL 2W60B 1T6VN 2DDQL 4X9GA 1OWRM 1UM4H 5J11B 5IEKA 3AROA 3R1GH 4OFKA 1ZT1B 3DUSB 2VZVA 3UO1H 1EFXB 4J3OC 1MCQA 3MRKB 4DCOA 4BFGA 1D9KC 1VGEL 2YUZA 3RWDB 2W38A 3SO5A 3TP4A 1X5ZA 5HD8C 4EHDA 3GIVB 5D93C 1OLZA 5I74B 4F7EB 1DEDA 2CMRH 4EI5B 1LO5A 1HSBB 4JG0L 3E3QE 2J2ZA 1L6XA 4QRRB 2O5XL 5MENB 4YC2C 1S7SB 4P2RD 4G7VH 3MX0A 4H1LG 1EO7A 2NY5C 4ZFGL 5GSVA 4XP6H 5CEZH 1SC4A 1IM3A 4JO2L 3GJTA 1YY9D 3CFEA 3TH2T 2OL3A 3DSFL 1GGCH 3E6FB 1DFBH 4F15B 2V7NB 4NSKB 3VU2A 5F3HA 1FH5H 2LAGB 5F1NA 3VI3E 2EDOA 5I76B 3U0TA 1H3PH 4PLKC 1S7QA 5CCKL 4MNQA 5IVXA 1GZQB 1Q94B 1JYXA 3PWJA 4NP4H 3HG1A 5IB1A 4CVWA 3P73A 1AGFB 3Q6FB 1UB6B 4PY8I 4XWOC 4EXKA 2FJHB 1KB9J 4MXWL 3GDBA 4LRIA 3X11A 4NUGL 3MRFB 1ZLUK 1LO2H 4MA1C 1HKFA 5E08H 3Q6GL 1NFDE 1RWPA 5AAMA 1TVBB 4K07A 1BLNB 3LH2L 5T5FH 2BVEA 4X6EB 3BO8B 4HG4J 2DKOA 3BEWB 1YN7A 5DVOA 2B1AL 1BMGA 3KJ4B 1SQ2N 5JNYA 3SHSA 2FD6L 3ARDB 4Z6AT 1A5FH 5J57B 3PGDB 1YNTB 3QO1B 1TJHH 4AY0A 4EI6A 3I02B 2IGFH 4RNRA 3WO4B 1NBYB 2EDLA 3GSUB 2H2PC 4LPVA 4XPGL 4GXVH 5D8JL 2G2RA 1CXFA 4JGJA 4OLXL 2IANB 2AJXH 1OAYL 1ZVYA 1CICB 1Q9KB 3DUUB 3EOBB 5DJAB 3QDHA 4Z77B 2PW2A 2H1PL 3MRJA 2Z35B 3PD0A 1XR8B 3OXSB 2A73A 5I0ZA 4GOSA 1S78C 5I30H 1K3ZA 2DLHA 5EPMB 3S9DB 1FFPA 3DURB 3O4LE 4FQ2H 1H5BC 2GI7A 4HPYL 1UWEL 5CJ5A 4ZFOB 4BUHA 1WC7A 1A9EB 4H88L 1MFAH 5KSAA 3OR6A 5B38G 4K7PY 1KBGL 3NCYP 1YMMB 3X3GL 3G04A 4I9WD 4QXTA 5F70A 1H8NA 2GJ6B 2HAZA 2QR0B 2JLLA 6FABL 1FYTB 1UXSA 2HFEA 4YPGA 3ULSA 4L3CB 3NPZB 3BPNC 3P77B 5IQ9B 5HYJD 32C2A 4QGTA 1JWUB 2DYPA 4TPRH 2ICCA 4RIRB 4MHHI 4XVJH 3AU1A 3O2WL 5T3XD 3DIFA 4LCYB 2D3VA 5EO1B 3WNOA 3P0GB 5DQJA 3V3KA 3OR7B 2VISB 2ORBH 2YD3A 2JF1A 1JUFA 4FTVE 4NQDA 1OVZA 3I6KB 3PHSA 4JGUA 5DMYA 4ZO6A 4OCWH 4G3YH 3IJYB 3QULB 5CS7A 5C0AB 3R5JA 4L3EB 1TJHL 3RVVC 1M1SA 1U8OB 4D0CA 2VR4A 3ULUL 4EQ2A 1DUZB 2NY7H 4UT6L 4LPWA 1A1NB 3UC0H 3JV4A 3UZQA 2DLEA 1RJLA 3T4AB 2VDLL 3FT3B 2X41A 4Y19E 1ACYH 4PS4H 3HZMB 3WD5L 3P2TA 3SE4A 1SJHA 3DEIA 4XPFH 3TBSB 2ID5A 1TETL 2EDHA 3STLB 1OW0C 5GS0D 4PJFE 4YXHH 1CWVA 3WFDH 1A7BA 4P5TB 2OTUA 4N90D 5I1AA 4POZC 2AGJL 2M1KA 3IDYB 4U1JA 4BQ9A 4OF8A 2AXGA 2R4SH 3SE9L 1NMAL 4CW1A 1AXSB 2H3NA 3NFNA 3SDXB 5ACMA 1JPTL 2KPNA 2R15A 2CGRH 1LEIB 3OMZA 4NRZB 4AW9A 1RWNA 3SGEH 5TGBA 4GMSL 4OAWB 2X05A 5F44A 3X3GH 3WDHA 5D7JB 2IBZY 3H8NA 4HUVB 1I4OA 1YC7A 3IXAA 1TQCC 1OL0A 3MUY1 4GKSB 1KCKA 2CLRB 3B3IA 3KJQA 5EC1B 4E41B 1P5VA 1R3IL 1KIRA 4JFZL 4Y19B 3VE0A 3U46B 4QULA 1M4KA 4R8WL 1OP5H 3NPSB 4NOLA 1T7YA 2DIAA 3L3JA 4U1LB 3RIFF 1OAUL 2Q3AA 1MCSA 4GG6E 4OFPA 4P3CL 4PGCB 1ZEAL 12E8H 1I3OA 4X6FB 4HPOL 4OLEA 4U1HA 1S8DA 5MEOB 1GJIA 2VH5H 1MRFL 3WIHA 4HUWB 4S1RH 3BH8A 43C9B 2IEPA 2W1NA 3RUGA 2BP3A 2X4SA 1NANI 4Z0BL 3QUYA 4WI8A 3HG1D 4EN3B 2OMBA 5CP7B 3SGJC 2V9RA 1J8HB 5CBEB 1AH1A 1EO5A 2AKRA 1XGRB 4M62H 4MNQD 1G7PB 1U9KA 4Z7UF 4L3AA 5AD0A 2EC8A 3HPJA 3O4LA 3IJYA 4KKLC 1A3RH 2MPAL 4NQDB 4XRCA 1C12A 2V9QA 4FFWC 1MWAL 4OLWL 5AYQA 3PQYB 2F58H 1BFOA 2IAMB 3EKCA 4I18A 4XNUL 2FB4H 1I7RA 4N7MA 32C2B 3W0WB 1WAAF 2CK0H 1IZKA 4QRPD 4RFNC 4YDKH 3IVKB 4HJGB 2DQGL 4KMLB 3EW3B 2VE6A 3G6JA 4M6NH 5B38A 2OSLA 4PB9L 4ZAKC 1JZ7A 4X98A 1KJ2B 2FIKB 3K4AA 3H9SE 4WHDA 1UQSA 1N3NB 3ZDXF 3GMLA 4G6JH 5SWZE 1FGVL 3PWLB 4WENB 3UX9B 1DE4B 3OR6B 1JHTA 3QDAA 3PP3H 4R8WH 4APQC 2F53A 4JFDB 3OG6B 3Q48A 4ZDHA 1B6DA 1T5XA 2BSRA 3MROA 4Y0GA 3QUZB 1YEEL 5ALBH 3BZEB 4O5LL 1G9NL 3MLVL 4H8WH 5T33L 5FKAA 1S7TA 4JHAH 4HWZB 4YBHA 3BSZH 3RIAF 5DJ8A 5KTEH 5GGUB 2R1YB 1P4BL 2VLJA 3MLRH 3MRJB 4NO2A 3V8CA 3C09B 3TBVA 2OLDA 3EOBA 5DJAA 1CICA 1A14H 3ZKXB 1JK8B 4FQXC 1QPPA 1I1YB 4AENA 1NC4A 4F8QA 1NGPH 3O6KH 4RRPA 1LP9A 1N8ZA 1CGWA 3PJSA 3TIEB 2BVUA 3TVMA 5IB3A 1GC1H 4E42A 4QHUB 5HDQL 1V3LA 5H2BB 3ET9F 2APWA 2XKNA 3WJJA 3QO1A 5DS8B 1UM4L 1QBAA 2KUTA 4WWKB 3S37L 5E8DL 4OUUA 4OZGE 5DA4A 1CU4L 4L4VD 1FFOA 2EKJA 3DMMB 5GRYA 1GGUA 2I27N 3MRLB 5AZ2H 1VGEH 4X6BA 1BJMA 4PP1D 3OHXB 3K0WA 2BSSB 4PJXE 1IGYA 4YK4C 4U6TA 3MRFA 4HWBH 5I1EH 1VDGA 4WWKA 1ACZA 5BO1L 3AFLA 1GL4B 5J13B 1WFOA 1YC8A 5GHWL 2A74A 3BVNB 3NMEA 4KY1H 5IVXB 3GRWA 2A38A 2RIKA 2Y5EA 1A47A 5I76A 3EYVB 4FQHB 3OWEA 3ZDXE 4AENB 4YO0B 2V7NA 3QNXA 1PVHA 2HT3D 4EHLA 1XGUB 3EFDH 5A43C 3O41B 3OGCA 3BGFC 4MDJB 4PIRF 2BFVL 3SN6N 3RWCA 2V17H 1GFWA 2FUNB 4N6OA 1JI2A 4WTZG 3S37X 1T4KB 2L4OA 1S7XA 4PJAE 1NFKA 2OI9C 3ETBF 2DDQH 3PD1A 3MGTA 1E4KA 3RNQA 5I19H 1GH7A 4G8IB 4P0DA 1F3DJ 5GS0C 3VGBA 1KMCA 4UIKH 3GHBL 4OZIE 4JRYE 3P4OB 5LBSH 2YPLD 2Z8VC 2R4RL 3PWLA 4YJZL 2FEDD 4OB5L 5C07D 3W11C 5GGSA 3QUMB 1PEWA 1U8NB 4M5YL 2HN7B 3S37H 1I9IH 2VE6B 3DLQR 3G6DL 4LVNB 2OJZL 1Q1JL 4TRPH 2FEDC 1TTUA 3ZKSD 4MSWA 3QPXH 3CX2A 5ICXB 1DSFH 1TXKA 2A9MH 1BVKA 1U3HB 1J0JA 3RA7H 1SJEB 4MZ2A 5E9DD 4BM7A 4FQIL 4LASH 5D96B 4JQVC 4QTIL 4P3DB 4NUJA 1IARB 4PJXF 5EUOF 5SX5K 5AD0B 1OD7A 2HH0L 2VKWA 1T66D 4I8DA 4U1MA 3ZL4H 3OKOB 1MJUH 4ZSOA 1CP3A 3KS0J 5CSZB 4P3WA 4F9LA 5AG9A 1S7VB 3V6OE 3EGSA 4V1DE 1ADQH 2NY5H 1CD9B 3VXUE 1JCKA 5HYIA 5EU4B 2ZOKB 5IEHB 3BDBA 5F9WC 2EIEA 5MEQA 2X6MA 2YXMA 3CJJA 3MV7A 1AKJD 1XF4B 1NMQA 1RHJA 2H9GB 4D8PB 5GGTH 2IBGA 3VRLE 3CFJB 5F1IB 3G5VA 5C0EA 4Y4FC 2VZSA 4OJFL 3HN3A 5D1ZB 3PP3K 1HE7A 1MHEB 3IJSA 4NNPH 4BZ2H 1FE8L 3VI4F 4V1DD 4X99A 5BVPL 1RUKL 2H4WA 3GSNL 3RRQA 3HZYA 4I0KA 5FV2A 2DLFH 4U1SB 2XTJB 2YS4A 3NS7A 4DWHA 3HS0A 3D18B 3V5KA 1HI6B 1N26A 1F4WH 3P9MA 4GH7B 3TLRA 4LLMB 1RUMH 5GIRB 3T2OA 2J6EH 1C5DB 4WDIB 1NFDA 1CBVL 4FQXB 2PKDA 3FB6B 3T8XB 1NCAL 5KANG 5JXED 3R6GA 2VZ1A 3RHWF 1LEIA 5FFLA 1G6RL 4CDHA 1KYOK 1MCFA 4GMTH 4KQ3L 4W68A 4LCUB 4PGDA 2F15A 1E28A 1HHGA 3ZHKA 3TV3H 3P11H 3ZE1F 5JLZA 4Z0BH 5JXEC 5D1QB 1L9NA 2XTLA 4HV8B 4U1KA 3FZUD 3SO3B 4JDVB 4JLRB 4RGOL 3X12A 4QKXB 2EIBA 3VD3A 2NXZB 3NIDF 2DQEL 4KK5D 4XP5L 5HYFA 3M8OL 1R24B 3DO7A 1X3DA 1BZ9A 4PJHE 4JFFD 2P8MA 2NY5L 3GJEB 5E8PB 4W4OA 3QT2A 2WZPD 3V4VH 3HRZB 1FIGH 3MNVA 1V3MA 2V5SA 4XCFL 1DUZA 1Z9LA 3R06B 5E2WL 2BNQD 1JGUH 1UA6H 3X13A 4M5ZH 5DD0L 3KHOA 4NKOB 1MRCH 2Z31B 1Q9LB 4OCRH 1ZT7B 3MCG1 5IVZB 3VXSA 4K55A 3FQWA 3VXOA 2XZAL 4HUXA 1PYOA 1KOAA 4RIRA 1V7NH 3OV6A 4GRLB 2R23A 5E5MB 3RVVD 2EIZA 4PRHB 3A67L 2LVEA 4LEXH 1UWXK 4HFWB 3WFCH 1QRNE 3V4PL 2XWBA 1YN6B 5DRXB 1BMQA 4M7LH 3WS6C 4JHWH 2IALA 2LVCA 1G7JA 3MUJA 5T33H 1RIUH 2ICWI 3FO9B 4PJ5A 4YXLH 5JORA 1CBVH 3L5HA 3RVXC 1OAKL 1MQKL 3JTTA 5JHDD 4KJWC 3DV6A 4ODUA 4KI5C 5D1XC 2DQIH 1F5WA 1U91B 5C08E 1P4BH 3HC3L 3MV8A 5EB9A 4HPOH 2D7PA 3TNNB 4XWGH 1KC5L 4MA1B 1NGXA 3WO3B 4R0LB 3GGWA 3S34H 3DSNA 1ZVSA 2VLKD 2D4FA 1F9EA 2XWJA 2DAVA 4PREA 4O02L 1FORH 3SKJH 4MGXA 1J9CT 3DX8A 4P9HH 3KPMB 4QU8A 1OAXL 3TZVB 2CGRL 3QDJB 4WHYH 5GSRA 1J0ZA 3MRRA 3HE6C 4ODTH 1AO7D 2J3SA 4HS8H 5EBMB 2DQTL 5DXWA 2C2OA 4OSUL 4EBQL 1BIIA 3ARGD 3UTQB 5D8JH 2QV2A 4NZUL 4LSDA 4WUKH 5T1LD 3BZFB 3BX7C 3PDOA 4L3ED 1NJ9A 1YNTA 2Q8BL 4OLWH 2F58L 3ARDA 3BE1H 2DWEA 3FO1B 3QIBD 5MENE 3FQRB 2XN9E 3LS5H 3B6SA 1VFUA 4RWYH 2X1QA 3EZ8A 2DQCH 3JBG7 3KYAA 3V6LA 3IDNB 3MCKA 4NZRH 1P2CA 1LD9A 1W0VA 2XA8H 2FECI 4QRTB 1HQRA 1FSKC 2ED9A 3WBDA 7FABL 1F2XK 1T83C 4A6YL 4ELKB 1P4LA 3ZT7A 1JHKL 2H6PA 3DUHA 3EHBD 1KGCD 4L8CB 1QTNA 2P24B 4R4BB 2A9NH 1NSNL 4QHLA 5DHVH 1GGIL 4DCJA 2APVA 5CSGA 1RJYB 3C60C 3UTTA 3PWJB 1H3VA 2BVOB 1S3KL 4HUKB 4F2MB 1I1FA 1KTLA 3GM0A 4PFEA 4LNRA 1QRNB 5IWLC 1KC5H 3FFCB 3D3VE 3HUJE 5F3BB 4PJIA 4QXGL 5D5MA 3IU3B 4JN1L 3VXRB 3P9LA 5FO9A 1A4JB 5A2LH 4GO6B 4N9GB 4UDTA 1ZHBA 4RSVA 1RZJC 2GSGA 3NCFB 4KDVA 3MRRB 1QRNA 4XNUH 1K5NA 4TUOB 3V6OC 1NBVL 3MBXH 1GCFA 1S7SA 3ARGC 1RJYA 4YWGH 4IRJC 5FYJH 1HHHB 4K8RL 5D1QC 3IBCA 2ZG1A 2O5ZH 5GGSY 1JWMA 3V5DA 4MVBD 3SJVD 2YSSB 1CFBA 1DN2A 2VDML 3GI9L 2R8SL 4UT9H 5ESQB 3GGWB 3OKLA 1P4LB 2NXZC 5D71L 4CNIA 4NOMA 4WW2C 1C1EL 4ZXBC 4NBZB 3AVEA 3NZHL 1T03H 1UM5L 4NJAL 1JZ3A 2HA1A 3HAEG 2CDRA 3MRNA 4BJLA 2PN5A 2VIRA 2HH0H 2WBJD 3TVMD 3O6MH 2CIIB 3MLSL 3GUTA 4M1GH 2C7UB 3PIQB 4NOKA 3V4UL 3FFDA 2VLME 5MHSE 1LO0L 1NAMA 25C8H 2IPUK 3LN4A 4EQ3A 4JDTL 1G9NC 3PDOB 4NHCL 4NYLB 4L4TB 5C0JB 1ZT4B 2A6KB 5I9BA 4H0IA 3HPLA 4ZFGH 5LWYH 3T2NL 3DRQA 4R4NC 4DQOL 4XMLL 1NEZG 1ED3A 4HMEA 5FDWB 3E2HC 3A6CL 3LSOA 1FHGA 3B4NA 1F4XH 1MLBB 3T0EB 1DANU 1X4ZA 3L7FB 3QDJA 1HCFX 3RWHB 2P49B 5GGVY 1T2QL 1ZGLA 2R1WA 3OX8B 5C3TA 3M1BB 5ITFB 3SGDI 2E7LA 3BPLC 2DQUH 1J1XL 1CXLA 1NCWL 3BESR 1QSZA 4IHOA 5C07E 3OZ9H 1K9TA 2G5BA 1T21B 3WFEH 4LMQE 2B0SL 4WHTB 3CVHB 4LP4A 1ZANL 3MLZL 4HCRA 4PLJC 1AGCA 1QLFB 1DL7H 3T04D 1S9WB 4P9ML 4JLRA 2HT2C 3FL7A 4N8CL 1T0NB 2H5JA 3FO9A 3LIZL 3O6FD 4UDUB 4U1KB 2CXGA 2J8UF 1JZ4A 4LK4A 5ICZA 3DXAB 4OCNC 3QEGH 4JM4L 3P3YA 5KS9F 3K2MC 4FQ2L 3E0GA 4WCYH 2KKQA 5DR5H 5BZDA 2K7ZA 3GJSA 4LSVH 3OL2A 4H25B 1T7VA 4OLZH 1HHJA 4FZ8H 3U9UA 3V4UH 3DEJA 4FQXA 4ZSOE 1MCWW 1N5AB 1VACB 2ZKHH 4LLMA 3U2SA 4NQTA 4JZJA 3HNSL 1P9MC 4JM2C 2HBQA 3PCXA 4TUKH 3OKDA 4S0SD 5C09A 2CNOA 4Q9RH 4GW5B 3WSQH 2SEBA 4TSBH 4KTEH 1WIUA 2A1WH 2DQFB 4Q6IB 4L4VB 5F7FA 3VH8A 4G6KL 3P0VL 5JW3H 2GK0B 3DO7B 4PRAB 5KW9H 2QL9A 2X44D 2A0LD 2IFFH 3IKCB 3MRBB 3MJ9H 4WRLA 3C2AH 3QCVL 1S5HB 4AQ1B 5HYSA 4LQ1A 5AYUH 4AT6A 3UDWA 1J1XH 4KJPD 2IC2A 4U6HA 4YHIB 4TRPL 3T1FB 2EYSB 5C0CE 3VFTB 4HFUL 4RAVA 1GC1C 2Q6WA 4X9IA 3CVHL 4LLYA 3GJFB 4O51A 3OKOA 3CX5J 4MB5A 1JXQA 3KLDA 4LLWA 3CFKA 3D0VB 1C5CL 4LGRB 4ZYKB 5C70A 3LKOB 1WF5A 2HJLA 2E6PA 1OCWL 1IGIH 1P7KB 1EGJA 3IDXL 2X4RA 2Z91A 3ZKXC 4ERSH 4ZS7H 3QDME 1N59B 3TA3B 1BVKB 4OIBA 3P11L 3LKQB 1CK0H 4H8WC 1WWBX 1M7DB 2XN9A 2FRGP 5DR5L 3WIFB 4CVXB 3E8UL 3FO0L 1PAUA 2JK5A 5E4EC 2IGFL 3ARVA 4XP6L 4HSQA 2P4AB 1ONQA 5TE7H 2KZ1B 2H32A 1KIPA 4KK9C 1GGTA 2W59A 5I8EB 5FYJE 2JB6A 1KNOB 1U92B 1OW0A 2HKHH 5FECB 4KKAD 3SCMD 4DTGL 3VFNA 4XVSL 5C0BD 3RWJA 5F9OL 3QEHB 5MEPB 4XCNB 4KJQC 3FQXA 2MKWA 4FQ1L 2H54A 4MAYB 3EHBC 2ED8A 4RMVA 4EUPB 5GGQH 1S7VA 2QQNH 4EHNA 3U36A 4XP4H 1ZLVK 4NO0D 3ZHDA 3MGTB 4XH2A 4PB0L 4WEBL 4TSCL 4BFIA 3MRPA 1U3HD 2AQ3A 2FBOJ 4GG6F 2HTKC 2VZTA 5J13C 5IC4A 1E4KC 2V5YA 1MVUA 4GFTB 2GFBB 2J8HA 4ISVB 5IBTH 3ZDYE 3VFSB 1YEIL 2P5WD 3H3PH 1A1MA 1CYGA 4Y1AD 5L88L 2LU7A 1G1YA 4H1LB 2RGSA 3B5TA 5C6TH 4JQVA 4K3DH 4ZFFB 3HR6A 4Y4HC 2F8OA 4PJFA 1V5JA 4ZFZB 3B9VA 1BJ8A 3TCLA 1BQLL 2DM2A 5BQ7A 1RWOA 4OCXH 3GSVB 4XTRC 4QGYA 2BNQE 1KJVA 2NXYB 4Z7UE 4JAMB 3DRTB 1YEGH 1JGVH 5GGSB 1RWMA 3WUWB 1LO3H 4LQFL 5MI0C 4HGWB 3CMOH 3VFRB 4MJIB 4YZFE 4LPTA 1XEDA 2X4NB 3CVIL 3P4OA 4XT1C 3MYJB 3FN0H 5TDNB 1W8NA 2EYRB 3DNKA 4K94L 5BV7B 3GMNA 1DQMH 4M8QB 3RNQB 3FONB 4GUPB 5EU6D 3EYFA 4O2EB 3RI5F 1NEUA 5E99L 4CVUA 1WZMA 4ZQKB 1T1ZA 1FFNA 4C4KT 5IB3B 1G7LB 5HGBA 2X9XA 1FORL 1F3RB 2CNLA 1A21A 1MFAL 1FGVH 1QUNA 2GITB 2P45B 3EJYD 1RK0A 3CUPB 3GSWA 1ETZB 1NFIA 2A6JB 4HT1H 3DETD 3D6GA 1A7PH 3CSBA 4GW1B 3BVNA 1D5XA 5D1XB 5GGUA 1BFSA 1K85A 1NDGB 5F8QC 3L3GA 4MQSB 1I1AB 3QAZC 5EU6A 1PAMA 1YEIH 4ODHH 3UAJD 4NRXA 3CFDB 4LSSL 5FUCC 3FB8A 4OCSL 1MEXL 1T5XB 3MROB 3U4AA 4NZDA 4V2CB 1BREA 5E2UL 4FQCH 2NXZD 1UADC 2NY0C 5HY9A 5F9WB 3VRLF 5IB5A 1PG7W 4IRZH 1OGAD 4F7PB 3MUHL 2GIYA 2XKUA 4KK6D 5D6DC 1OOAA 1IGFL 1HEZB 5EZJB 1BAFL 5B38B 4APQD 4HKZB 1OWWA 2XKNB 5GRJH 5JMOC 1SY6L 5F7WC 1ZLWH 4LLVA 2ESVE 2D31B 1HXYA 3QDJD 4X8JA 3CLFL 4HZLA 3ILQD 5I15L 1IEBB 3GMOA 5JW4Q 4CN6A 3RWFA 2Q86B 1B90A 1Z6JT 3BQUD 5I6XB 1NANH 4PRHD 3UTZB 3HPJB 1G9MC 4OD2A 4JN1H 5FV1L 1UENA 5C2BH 5CEZE 5BO1H 3FT4B 4PJEE 1WCQA 2NMSA 3TIDA 4BA8A 3I85A 4ONHA 4JFDA 5IB2A 2AABL 3C5ZB 4NNXA 1QX3A 2E6QA 3SKUD 3S4SA 1DE4A 5LGKA 1MWAH 5AZ2L 3SCMA 3BKCH 4Z76B 3QIWC 5BW7A 4UT9L 3MBEA 2UYLB 2X89A 2BFVH 1L7IL 2G5RA 4NQEB 2J8OA 4LDLB 2KQMA 1JV5B 3GI8H 4MJ6B 3U4EA 5GS1B 5GZNC 3D6FA 3EYUH 3NIGF 4IMLB 4QLRA 2CO7B 4KK8C 2BNRE 3MV01 3BOVA 4HF5H 1LE5A 2VDKL 3BH9A 2DS4A 3W0WA 1HZHH 3M17A 2W65B 2WUCH 1K88A 2EDDA 4A2MA 1INDH 5FB8A 4UV7H 3LKPA 3B3IB 4YEEA 1AO7B 5KVDL 1YPZA 2PO6B 3MV9A 3L5XH 3O4LB 1NCCH 5E2JA 5HHNB 4OAWA 2R2BB 4FN0A 3L3IB 1AP2B 5C9JB 1D3CA 5GRVK 2PYED 4RFOL 4AL8L 3R8QA 5JW5B 1IC4H 3TO4C 2EDWA 2BNRD 5GRVL 4KRPB 4M43L 5JIHA 2R8SH 2GJ6E 4PTTB 3GHBH 4P5TA 4JE4B 2I24N 2OS7A 5GRXG 1U41A 2AV1B 4K71B 4JY6B 3CMGA 2R4RH 3IETA 3PWPB 4PP1C 3TNMA 2FB4L 4FQLL 2P43B 1N6UA 3BWAB 3FRPA 1PJ9A 2AEPL 1XR9A 4XAKE 1SYSB 4JQZA 2IQAA 3QBTB 2VL5A 2H5IA 5SWSE 2BSTB 3EO0B 3IFOB 3CDCA 2CJYA 3EO9H 4WCYL 5E5RB 4KI1A 3ZMRA 4PRHE 4KKCC 3ZYZA 3H7LA 4N6GA 4JM4H 1BPVA 1TNMA 2JJVA 2QADB 4FDLA 1AO7A 3F7QA 4OM1H 3O3BA 2WIIB 3HMXA 4QOKE 4BYHA 3PGFH 2EDKA 5FYKU 1JWUA 4JHBA 2ICWA 4NZUH 4HIJA 4M4RA 4OLZL 3C5JA 3MO1A 4BK4A 1QR1A 4B41A 3OJDB 4HLZH 2Y7QA 2J4WL 4NQEE 4E41E 5GS1A 4JR2A 2HFFA 4WUUA 3HUJA 4IDJL 3EZJB 4AEEA 5IKCA 1YMMA 1CE6B 4GG8B 4YZFF 1DBAH 3JZ7A 2P1YA 2A0LC 4PJFF 1QR4A 5IMLA 5L88H 4JREB 4YXKL 2HJKB 5IT2L 4DKFL 5HDBE 1PGRB 3ZDZE 1Z5LA 1FFRA 4AG4H 1T0MB 3DURA 5IESH 4L9LB 2HT4D 1MSPA 1EUTA 4Z5RA 2HVJB 2YD8A 2A73B 4Y16D 3ARBA 1AIFA 4QTXA 1JUFB 1L4IA 2QQLL 3MOAL 2Z9TA 4OCLC 5D7KE 3CPLB 3U4BH 4U2YA 3AMLA 2ARWA 2ZUQB 4WV1C 4UV4L 2EDYA 1S78D 5J9PA 3GMOB 3H3KA 1IEBA 2WP3T 3DPBA 4LAQH 4NQCB 3MXWH 3TFKD 2BZDA 3LN5B 2BVTA 4KROD 1BQHG 5FCSH 1MCDA 3BQUC 1UEYA 3QPXL 4D2NA 5DK0B 3BP5B 1CLOL 3G6JE 4S1DD 4QUGA 1MHHA 4QXTB 4FMKA 4Y2DC 2ILLA 1CFSA 4LGPB 2W9EL 3S3JA 2C4FU 4QRUB 4MYWB 4E0RB 3WL9B 2VDMH 1H3GA 3QFJE 4OQTH 4JZOB 3I9GL 5E95B 2GT9B 5D7IE 5EORH 4ZFOA 3SDAD 3ILPB 4PJ7B 3MLTA 3QUXB 4Q74A 4TVPE 4EEEA 1XF3B 3QNZB 5I8CB 3FAXA 35C8H 2OBGA 1I3RA 3BMVA 1I1AA 3KPRB 3AXLA 1HDMB 1T7XA 3KPNB 4UB0L 3DXAD 4H1LH 4X5XA 3MLPA 5D1XA 3KJ6L 2YMXL 4FQ1H 1QSFA 5K9KA 4GKZA 3P4LA 4N9OB 5F7EL 4JDTH 1R5WB 4N0CC 4Y5YB 1ORSA 4JFYB 2IANA 4JJ5A 5ACZA 4LLUB 5INDB 3BDYL 4PJIE 5CD5D 1X5KA 4FFYL 4M1CD 3C08L 5F9AC 1G7LA 1MJ8L 4EUPH 1P84J 1Q9WB 3U30B 5JOEA 4ELMF 1OSPL 2C5DC 2VABB 1MLCB 4NDMB 4N5ED 2EDTA 5GSVB 2AK1H 4H26B 4MMXC 1JPSH 4WO4A 3SY0B 3HHRB 4LCWD 3E4CA 4XPHL 3QCTL 2Y07H 4P99A 1F3JB 1RUML 4IM8A 1YYML 4EI5A 1KBGH 5DD1H 3PWPA 2X4OA 5I71B 3PWPE 3VXNB 4JQIH 2V2WA 4HUNB 5J1SC 3BKJH 2QHRH 4MJIA 4P5TC 4R4FL 3VFRA 1ZGLM 1QOKA 1D5BB 1RZFH 3QFJB 1P6AB 4OD3H 4F7CB 1PYWA 5LU8A 2FL5A 5IFAH 5DYOA 4M6NL 2ZPKL 4HH9B 4EIZC 3D39D 4OQTL 5DK2A 1A2YA 3UP1A 1IEAA 1G9MH 3CH1A 4ZFZA 1K86A 3NIFF 3U0TB 4Q6YA 1OAXH 2GSIA 5E8DH 3MLWL 1IJ9A 4ETYA 2EC9U 3N85H 1L0XA 3E6HA 1WICA 4Y1AB 3BIJA 1KULA 5FA3B 4R7NA 3PNWB 3NCJL 4YHKL 1MIEH 1WCBB 1UACH 1WBYA 2LU4A 4QY8B 1R5VB 3FB5A 4C83A 5ISZE 5CD3A 5EU5B 1FE8H 3VGDA 3KPPA 3KPQB 5BOPA 2BOBA 4NWTL 1U42A 3R0MA 1Q9OA 1U93B 3U36B 3OF6A 4HJ0D 4OM0H 5K9QI 5IHUH 3WN5A 3RIFK 4HKXB 5FHAH 2J88H 3QHZH 2A6IB 4ZUTB 1OY3B 4OKVA 3VFUB 3PF2A 1AHWB 3VXQB 1KNOA 1M7IA 1UB5B 1GC1L 3B9KD 1IGCH 1YEHH 3DUSA 5C0BB 4HIHA 3OD5A 3GSXB 3LEYH 4UT7H 1LDSA 4YX2L 2NY1D 4M4PA 1AD9A 3EYSL 1AR1D 5D70L 2IPKA 2IFGA 1FCCA 8CGTA 5LXGL 4PJ5D 2J12B 4EXPX 4JQIL 1SEBA 1PLGL 1WBXB 1MJJB 4CUCA 5ISZB 4O4YH 4P2QE 4HLZG 3VD7A 2W0FA 4OD2B 4GRWH 2XQYG 4PPTA 4JCMA 4PRDB 5JHLH 3HNVH 2Q87A 1TVHA 4LSUL 2BVYA 4W70A 3GBML 3VWJB 4WV1A 5GS2D 5DGQA 3O45B 1DQJB 1EAJA 3RVXD 3O2VL 3W82A 4CJ0A 1A4KA 4Z7OE 2JCCB 3VFTA 2EYSA 3G5YA 2FCBA 2FSEA 4Z9KB 2K1MA 4J1UB 1D9KA 3HE7B 4OZIF 5EZJA 3H0EA 1MRCL 2B4CL 2YR3A 4PJDB 2MQ0A 2A9ML 1MRFH 3V0VA 5BV7L 5I1LB 4F7PA 4N0UA 5K93A 2XZAH 5SX5H 1FG9C 5I1DB 4YHML 4G8EB 4XGZB 1DLFL 5IUSA 2FLBT 3CZFB 5CBAB 1LNUB 3C5SB 2WMPA 4NRXB 5CGMA 2NTFA 3TBTB 4PG2A 4G6FD 2R29L 1DQDH 4CMHB 4JHAL 3IXTB 3CU1A 2RCSL 5AEAA 1VACA 2CDEA 3HI1B 4NQUA 1U2CA 3WKMH 2X4UB 1NC4D 5LWYL 1WTLA 1G7MB 5CD5C 1KG0A 4Y88A 4WTWA 2CSPA 2VLJD 3QG7L 4GXUM 3L95A 1P7HL 1X4XA 1G6VK 5FM5O 2FJFB 2AEWA 2EDJA 3H9HA 3PXHA 4DVRL 1UM6H 3WXVL 1DANT 1G7HB 3RGHA 5C71A 1I7ZB 3QIWB 4FABH 2VC2H 5I73B 4Q6IC 4I4WB 4I1RA 4JVWA 4QF1B 2R9HC 3MXVL 3EOAB 3ABZA 4D3XA 3NGBB 3SDDD 1KPVA 1E4JA 2Q8AL 4XVTH 2WBJC 1NUGA 4G8GA 3L9RA 1DEEA 1U3JA 1MI5B 1RULH 3DRTA 4NKQB 4DGVL 1D5MB 2AJYH 3SDXE 2EDXA 4PLJD 1XGPA 3MA7B 4KI5F 5ICYB 1JZ8A 4OZ4A 3A0OA 3O11B 4ZUWB 4GW4B 1HWHB 1WZLA 5FYKH 4KQ4L 2WQRA 5GS0H 3L7FA 4YHMH 3RPKA 3QJFA 2YXFA 4PJ8A 3N50A 1U8PB 3PHOB 1LE9B 1DBKL 5GISL 4RFNB 3K4ZA 1Q72L 2P5WE 3MJ9L 1QSEE 5L2KA 5C2UB 4PRYA 1E4WL 1INEH 3ARFA 3K7UA 3I3DA 3S5LG 1TQBB 4MXQD 5C0RL 4LKCA 3TA3C 4YE4L 4CGTA 3MOBH 3OB0H 1BOYA 3RGVB 4TSBL 2PW1A 1BF8A 1T1XB 4GSDL 1FPTH 4KZEL 1U6AL 4JY5L 1OLLA 5HGGS 4UMGA 4OZFA 4ODSH 5A3ID 1YMMD 4D3CH 3BRDA 4NCC1 5IMKB 2C2MA 1EHNA 3EO1A 4OLVL 5ESQA 4WUUD 4DKFH 2G9HA 4XXCC 4FQLH 5SWSB 1J8HE 1K4CA 1JWMB 3RZCD 3PP4H 2Y1VA 3WJJC 4CVXA 3WIFA 5C3LD 2ZUYA 2ICWJ 4XMPL 1BD2B 4M3KB 2FWOB 2DTMH 3CH8A 1BAFH 3OF6D 1FDLH 2NX5E 3V79C 4NO5B 4X6DF 3WYRA 4WFGD 4G6ML 2A6DB 5AG8A 4KKCD 3QO0A 3QCTH 1GZPB 2WWMC 1ZA3B 1ZHBB 4G5ZL 3LCYA 1A7RH 2FZ3A 4POUB 4D9LH 1P9MA 1HXMA 1OB1A 4JM2A 5E7BA 2R2EA 4FFZH 1NMSA 3D0VA 3R5KA 3ZKMC 1TJIH 4WWKC 3FCTA 4HCRL 3ARYA 3IB4A 3GJFA 4KHXL 2PYEB 5CGYC 1OGTA 2YA0A 1WITA 3FAWA 4HDIB 1F45A 4HBCH 5IW1A 1I1CA 4QHMB 3L3DB 2P24A 2OX5A 3ALWA 5LGJA 3WHE1 1ES0A 1LEKA 5IR1B 4YFDB 1DLHA 4QCIB 5LG1A 2JJTC 3FO2B 4KJQD 5TF1H 1A7OL 1W72H 5IBPA 5IHBA 3ULUE 4QYOB 3C6LA 3V6FB 1MPAL 1GSMA 2NX5D 5I74C 4PGZA 5KOVC 3ELAT 5DEFB 1ITBB 4YXLL 1CFTB 2FJGB 1BBJA 5DWUL 1YNKH 5FUCE 3VG0L 2SEBB 3JTSA 5KBNC 4F7MB 2L7JA 2DL9A 5GGQL 3DHMA 4M93B 5HYEA 4MJ5A 3BRGC 1A9BA 1JJUA 2ERJC 4Z7WE 5E70A 5HGDA 5EZLB 5C09E 5BS0A 1H15A 3MV9D 3RL2B 1F4WL 1YEGL 1T6WA 4BK5A 3WE6A 3RAJL 1KLGB 3RJMA 3IF1B 3MUGA 3C08H 2P5EA 1FJ1A 2M8XA 4NZRL 4HS6B 4F15C 3GHEL 5HGHA 5E8OB 1ICEA 2ENYA 3SPVB 4LPYA 5GSRB 2C9AA 1HYSD 1CDIA 5H0IA 5KSBF 1JPFB 1S7UA 3T08A 2GTZB 1JTOA 4PREB 4U3CA 2FQQA 2UZIL 5JIKA 2I60L 5SWQB 2R0WL 4X4MA 3V6ZA 4DCQA 1ZVSB 4V2BA 1KSRA 3KNBA 1KENL 1CGTA 3FTGA 1MIML 4HGMA 1R0AH 3H1PA 1IGJA 3RPIB 3STZB 2V6HA 3GM8A 2P44B 3UJTH 4KHTH 1CN4A 3DV6B 4M6OL 4ODUB 4OD3L 1WAAA 2VLKB 3EYOB 3F6IA 3BE1L 1I4FB 1WZKA 4CU8A 5C1MB 1CK0L 3QR2A 4ODXA 1RMFL 4ONGL 4WW2A 3V0WL 1E6OH 1AC0A 1ZGLB 3MODH 2JTDA 3GRWL 4J8RB 2W9DL 5C7XH 3K46A 2HLFC 4ZOCA 2ZCKH 1PKOA 5E4IA 1MLBA 3N1FC 4J3VA 4HUXB 4HS3A 4P46B 3CIQA 5IBUB 1L7TL 4MLIA 5E2TL 3FQWB 1L0YA 3U9PH 3VXOB 4MMZC 1S7WB 4DW2H 1RHHA 4QUBA 5T1LB 1CICC 3JV6A 2XYHA 1A3LL 1NAMB 4N0YH 2D4DA 3I75A 3OAUH 1G0XA 2BXZA 3DVFA 2NW2A 3MA9L 1I4EB 3D39E 5I1IL 2NY0D 1FGNL 2LE9A 1X6NA 1NCNA 3BKJL 1IGJB 3RPIA 1N0XH 3RBGA 4MA7L 4Q58C 3UBXB 1TCMA 3ARSA 3CFCH 3VD5A 1JP5A 4ZPTB 2R0LH 4Z7QF 1Y0LB 1F4XL 4NOBA 1U0QA 5IVXE 5FOBA 4F37F 4YHZH 5FUOH 3D39B 3F58L 3DEHA 3MFGB 5JA8B 5DC9B 4AIOA 3EUUA 4P9HL 3HE6B 5LAXA 5E24E 4HD9A 5DD3L 5C0FB 3MYZA 1DQTA 4KKBD 4HS8L 3G5XA 4J7RA 3VXRD 5E6YA 4PLOB 4PJIB 4OLUH 3DYPA 1FV1A 3QIUA 1MCPH 1FZOB 2ADFH 4ZTPL 1NGWB 4CN4A 5EOCL 1R3HA 1TZHA 2YD7A 2OL3L 3BGAA 1QQDA 5AZEL 3DMMD 4HZAA 4JCLA 4F3FA 1U8IB 1YDPA 2GUOB 1DVFB 5GRUL 1MJ7L 5DJCA 4C4KO 1GGYA 5CJ8A 4MS8D 5C0EB 4K2UL 4XAWL 1UH3A 1X5LA 2XA8L 3K8KA 1JNHA 3I9GH 3EBAA 3ULUH 1FL3B 1EAPA 1FNEB 3MCKB 1HN1A 1A7PL 5I17A 3QFJD 1D6EB 3RKDD 3VCLB 4HWNA 5KAQG 2OCFD 1U8KB 4LKXA 1K8DA 4OFDA 4KVNH 4PG9B 2CLZA 4LKCB 4GJTB 4AL8H 4X8XA 3KXFB 4IOSD 4OI8A 4U1MB 4WI2A 1JGVL 4QHKI 1QSVA 1PKQE 2BMKA 3BZFA 1PD6A 3R1GL 4BUGA 5I1JL 1CL7I 2XPGB 2VUOA 4WO4C 3O6KL 3LHPH 3TPUB 4RDQG 5IB4B 1K8IA 3LY6A 3MCLL 4IIQC 3TO2B 2Q76B 2VXQH 1TZIB 1TQCB 2JKXA 3GK8L 1SEQH 4U0RC 3O2VH 1G7IA 3BUYB 2X4TB 2Y9RT 2FYYB 2DL2A 5DRWB 2Y36H 4BQ6A 5ENWB 4NZTH 4OT1H 1L0QA 1ADQA 5F7DB 3CLFH 5C6WH 3P30L 2BC4B 4ZXBB 3EO9L 4OLUL 2DIJA 5DJ2B 4LOUC 4LGSB 4JKPH 5SWZB 4XHJC 2ZNWA 3SDCA 1MCCA 3GSQB 4QF1A 4GKNB 1OAQH 3B2UD 4NNYB 5HPMA 4GG6B 1WBZB 1ZWIA 2O26U 4TOYH 3RGVA 4PJHF 4IRSA 3T4YB 4PJAF 2YWZA 4HHAA 1INQB 3EDKA 3QI9A 1F4YH 1E4XH 2ZG2A 2XQBH 2NY3B 3KPSB 4YHOH 1S7XB 1SYVA 5L8LB 1EK3A 5L2KB 3C60B 4PJEA 4WI9A 1F58H 1EX0A 3S35H 4PRHA 1WFNA 3JSSA 2CLVA 5JDJA 1H3TA 2XFXA 2JJSA 3QPQC 2I26N 2IH1A 5FEBA 3WNMA 2VKXA 3VWJD 4B50A 1OP9A 5I0DA 5KSBE 3SGJA 2CDEB 1BBDH 2AJZB 3MRHB 4M62L 4X5WA 5TQ0L 1IAIL 3NCYS 3KPSE 2XXMB 4YE4H 1MUJA 5GRJL 4YGVB 4WWID 3QQ4B 5CKGA 4LNVA 1XH3B 4FXKB 2BNUA 3UTSA 1FSKB 5EC2A 1INEL 1I8IB 1UCBH 3NABH 3C5SA 5A2JH 1VADA 2PF6A 2BSSA 1CGYA 3BRFA 5HJ3A 4HK3N 3S36X 2FATL 1A6VH 1FPTL 2XNAB 4KZEH 4IRJA 2RFXA 3G6DH 1MI5D 4TN9A 4G42A 5DJXA 5IT2H 3D48R 4G3YL 4JDVA 4QOKA 5TE4L 2IG2L 3HE7A 5E6IB 4KU1A 5C0IB 4I9WE 3GBNH 1UZ6F 5I1HL 1A4KB 1CGSH 3CLEL 4LEOA 1J1PH 4FQXD 2N1KA 3GNMH 2NY2D 4QXWA 2AS5M 4GQ9L 4R26H 1RWWA 1G7MA 4XC3L 4EDWL 1MCKA 1QSEB 4H5SA 1UWEH 2BVQB 2X42A 2PTTA 4NBLA 2XWTA 3DVGB 5DURD 2R1YA 2VLJB 1EVUA 1H3XA 4Q0XH 1U8HA 3U7YL 5CGTA 5F1KC 2E9WA 4WI6A 1WBXA 3VWJC 2ICEB 5IAEA 3HZYB 2EZ0D 4XI5C 1QBBA 2C3WA 2OP4L 1CFQB 3ES6B 2VXSH 1ZSDB 4WI3A 4XBGB 2A1WL 3WKNA 4XX1E 3EOTH 1PZ5A 2FHBA 5IK3B 1KJMB 1UB5A 4RFEB 4TTGA 2X4QA 1IEHA 4FTVB 5C08B 4P59H 4L8DA 2R1XB 5CEZL 4WFFE 4MNHA 2BHZA 1MHCB 5HD8D 1B6UA 3MV7B 3WDIA 4PJHA 3VGGA 1MOEA 4HT1L 2VR9A 5DMJB 5EU4A 5IEHA 1BD2D 1FL5B 3WMSA 1C8PA 2P2CA 5T1MA 2QL5A 5B3JE 3E2HB 3KPPB 4HVAA 1JF1B 4CMHC 1KCRL 3VD4A 3D3VA 3HAEB 4LU5H 3O81A 3PGCB 1C12B 3VFGL 1XIWC 2Q7NA 3UPAA 3KJNA 4BSVB 4U0RB 5I8OL 1G7PA 1D6VH 1MFDL 1XGRA 5DD5L 4LCCA 3QDGE 1J8HA 2W9LA 4WW1B 1R6VA 1A2YB 3S98A 4EN3A 1FL5A 5JHDE 4U1GB 2KL6A 3F8UB 2NW3A 1KENH 4OGXH 5CJOL 5IROA 4LSTH 3WJLC 1NLBL 4OV5A 3O3AA 4LSRL 1W0WA 3KG5A 4AH2B 2UZIH 1M7IB 3JV0A 2COQA 5C08A 3KLAA 2GTWA 3RQ3A 2X4QB 4ENEC 4TVPH 4HKXA 2YPKA 4EN3C 5IK3A 4X4YA 1JYVA 4XVTL 4GBXA 1N64L 5TE6L 3U1SL 1CXEA 2XN9D 3QDGD 4R90L 3LEXB 5AZEH 2H8PB 1J7VR 2QKIB 1KIRB 1T0PB 4NDMA 4UQ2A 3EIFA 5JMRA 3NCMA 3OGCB 4MDJA 4WEMB 2YPVL 1N6QH 3KPTA 1VPOH 4UUJB 4JFHE 3SDXA 1AXTH 1NGZB 1JMXA 2AEQL 2CQVA 4P23B 1MQKH 4NQXA 1QSFE 1EHAA 4JO4L 4PV9A 3EYQC 5FIEA 1QTYT 1HDMA 4GAYA 4K7PX 1WIOA 4U1JB 2EE3A 4RDQF 1I3RB 4TUJA 1E27B 1FGNH 1BVLA 5E2VL 2VO5A 4WFFD 5KS9A 1XF3A 3QNZA 3TBYB 5D2LA 2XNAA 3CDGB 1M05B 3RZCA 3BZ4A 4TNVK 1I7UB 4MA7H 1RIVH 5I18H 1N6VA 5GGRY 3QDJE 4IOFD 1VFAA 2C3VB 4E0RA 1VADB 1T1YB 3FT3A 3HMWH 4XNYL 3WIHL 2XY2A 3RZCC 3QQ4A 4OFIA 2CJUH 5HHOE 2ZUTA 5D70H 2P7TB 2X7LB 5F88B 5H2BA 4CU7A 4I77H 2I25N 2QBWA 2AJZA 4YDLC 1VA9A 4HX1B 4FZEH 4K3DL 5DMKA 4NBKA 4P4KA 4OGYH 4LLUA 3AMKA 1T20B 4JO2H 5HYJE 1MQ8A 5J3HD 3TJHD 3ARUA 2FX8L 2Q3ZA 2W0LA 4J6RH 4RBPK 1AI1H 4X5XB 4PJ8D 5EOQL 3KPSA 4Y5VC 1JWSB 5FKPB 1F4YL 2J6EL 3LPGA 1MRDL 4PJ9D 3QI9B 1INQA 2EDQA 2NR6C 3PL6D 2XV6B 4LAJH 4J2XA 3BZEA 3SO3C 1KIUA 4NQSB 1NFDF 4FQJH 4E5XA 4OIIL 2VDPH 4YHKH 5MI0B 1R3JA 2GJZA 2FDBP 4WI4A 2IMNA 2PYFA 3CK0H 5DT1L 4KZDH 1WTGT 4NQED 3I6LE 2NY4B 3N0PB 3QISA 2Y7QB 5DD6B 4O58H 3O3EA 3BT2L 1UZ6E 5BV7C 2R69H 5B8CA 2BOCB 1KJ3L 1TZGH 5ERWB 4RZCB 4PRPE 1G7IB 3BUYA 4PRPA 3HI5H 1OSZA 5I18L 3FOMA 2RCSH 4M93C 1FG2B 1I9RH 2G2RB 1NAML 4P46D 3F12A 3FN3A 4BSJA 3CPLA 1NBYA 4XPGH 3O9WA 1UKQA 5DK3A 1BQUA 4EUPG 1I85A 2GQHA 4E41D 2O5YL 4G9DA 5JOFA 3NR2A 5I9TA 4NFBA 3B8SA 5D9SB 5A1AA 1AQKL 1LEGB 3QXUA 2VMFA 1UZ8A 5CJXA 3L3OB 4AIXA 1W72B 3VXME 2IQAB 3R4DA 2CLZB 4OF0A 4PG9A 4HMDA 3PWNB 3V95A 1QFWM 4HG4K 4JFFA 3VCLA 1HHIB 3IGAA 1AY1H 1DVFD 5D93B 5HVGB 4OM1L 5F1SA 4ZAKA 4U1HB 4D0BA 5IP4A 2WQ8A 3VG9B 5IKCB 2BXYA 4PGCA 5CJXC 5T3ZH 1BVLB 1OTSD 5J6GB 4TUJB 3LZFL 1H3WM 1L7IH 2ZSWA 3BP7A 1DVFA 1C16A 4K3HA 4KHTL 1ORQB 1SM3L 4I0PC 1WQVT 1U8IA 1YDPB 4LRIC 4OZFH 3TPKA 1OAQL 1QO3A 1FVCA 2B20A 1F90H 3BKYL 5JW5A 5SX4I 3C5JB 5FM5M 4Y2DA 1HH6B 1NGZA 3CNKA 3KYMB 1YEJH 3O8XB 4D94A 2CK0L 4O2FB 4X6DA 4U6YA 3GRWH 4D0DB 1G9EA 3I6LD 2CLRA 3V8OA 5FYJD 1B4RA 1QYGH 5HVFB 2OL3B 2LFGA 5GGTL 1W0YT 3S35L 4M00A 2HFTA 4M7JL 5CP3A 1I1AC 3QAZB 4MXVE 3DX9A 1GQFA 3LEXA 2J8UE 4RFOH 3UTTD 2QEJA 3MRGB 3MLVH 3BWAA 3D0LB 3GKZA 4J4PC 5IV2B 2I9TA 4K71C 2YMXH 4EZMA 1WWCA 4Z78A 2UYLA 5T5NG 3RWDA 4PD4J 3RDTB 5EZOH 2I5YL 3GZKA 2VSDA 3UDWC 2AV1A 1KELL 4MVBC 1EZVX 4PTTA 3C5ZA 3MJ7B 2NW3B 4OKDA 3T4AA 3DTXA 1LDPH 1DBBH 2AR9A 4ZVUA 3H42L 3I75B 3OKKA 3NN8B 1A6ZA 2QTEA 3BHBB 3D87B 4JVPA 5TE4H 3OKEB 2IPTL 4GAJH 4L3EA 4RQQB 5HHNA 2OR8A 2YC1A 1H8SA 3F62A 5T1LA 1YPZB 1TFHA 2WLYA 1QP1A 2VB5A 1GAFL 5D7LA 5KSBB 2J7LA 3WFHA 4JM2F 4HS3B 4R26L 3WEXA 5FM8A 1T22B 3NA4A 1NGQH 4F37K 3BH9B 1LE5B 1NC2A 3MNZA 2EH8L 3VA2C 3KJ6H 5E03A 2QLBA 1Z0NA 1XF5A 3G5ZB 2HFEB 4PY7A 2HFGH 4R9HA 4WU7B 3U7YH 1I4FA 4MCYB 1MHCA 1RV6X 5C07A 3EYOA 5IFJB 2VLKA 1JL8A 2FX9L 2Z92A 1AE6H 4N5UA 1JI1A 4NKDB 5KSAB 3DI2B 1A9EA 4K3JH 1I9JL 4HXAH 1KB9K 1XF2A 3FOLA 4MLSA 1T83A 5HI3C 4NWUH 5GZND 3ARZA 3JWDH 4P2RB 1QVOB 2E5EA 5HI4C 1F2QA 3WN5C 4HJJH 3L3GB 5EU6E 4LSZA 3ILQC 3RA7L 5BJTA 2VDOL 2P5WB 5L2KD 2NY2B 4GSDH 4Z77A 4WEUD 3SGEI 1JZ5A 4GQ9H 1OCWH 3RWFB 2J6EA 4AZ8A 1HKLH 1P1ZA 3N9GH 3G6AB 4NKMA 4BH8A 1RHQA 1T2XA 1CIDA 2YD1A 3IF1A 5J4MA 3LEVL 5F89A 4AM0A 4DGIL 2NZIA 4ZQKA 2ADJA 3S34L 1NQBA 1RHUA 3ZKMD 3I50H 3AB0B 3KR3L 1IQDA 3PGDA 1G9ML 2DTML 4FXGA 3D25B 1Q0XH 4UT6H 2CJUL 2CR6A 5GGRB 1FP5A 2YBRB 4YDKL 4PJEF 1CFTA 2FJGA 5ETUB 1C5BH 4G8GD 2APTA 3V6FA 3GFUA 4GKOA 1RIHH 3VXUA 2GKIA 3W9DA 3QXDB 1NMBH 1VB9A 1P6FA 4PJBA 4WU5A 5C08D 1K2DB 4JGMA 5DEGA 2DLIA 4EOWL 4HGWA 3UTPD 3I6GB 2P46B 5L7XL 2ESVB 3FRUA 1OARH 2P47B 3OQ3B 1PKQB 1HQ4A 4AEHL 5JUEL 2BHYA 3L6FA 2UY6A 2VLRE 5EU3B 3RL1A 4I18C 2NNAA 2I9LA 3IBFA 2EEBA 3IRPX 4LARH 4NRYB 4PJFB 1UVQB 5HTSA 5ANMB 4ZUVB 1HHKB 2AXJA 2VLLB 4OGZA 3GSOB 4NT6A 1CICD 1RSFA 1WT5A 5C0DB 3HCVA 4FFYH 4L5FL 1OTTC 3TT1L 3VJ6B 4YX2H 4XCEB 5KSVA 2KZWA 3DVNA 1I1AD 1T7ZA 1J1OH 3WUZA 4FP8H 1SC1A 2PETA 3OAYH 4PGEA 4EUPA 4EDXA 3N9GL 3BT2H 1IAIH 4HAGA 4Y16A 2EYTB 4QRRA 1WBZA 1ZWIB 2WM0A 3D2UD 1PFCA 3OAZH 1NKRA 3S5LB 4ZOAA 3NAAL 3EO1B 2BDNL 3ZE0E 1KLUB 4LVEA 2AJ3B 3H7BB 5IMKA 4FTVD 2ZUVA 2AJ3A 1KPRB 3H7BA 2CNKA 3MRKA 5CZVL 4WY7L 3GKWH 4KK5C 4HQ0A 1VGKA 2C2ZA 3MV7D 4HK0A 1KJVB 4TNVF 2O5YH 3QUZC 2EYTA 3AAZA 1BD2E 4QRPA 2OL3H 4NGHH 2Q8BH 3RJQB 4YWGL 2FYYA 1TDQA 3QHTC 1FYTD 2FD6H 4Y5XB 3C8KB 4I0CC 1I8KB 3MLXL 3ROLA 3VJ6A 5L7XH 3H11B 4XAWH 2FR4B 3H11A 3UJIL 3T0XA 4K9EL 1N2RA 4NT6B 1P7QA 3F5WB 3P4NA 5BXFA 4ZUVA 4Y5XA 4AWAA 4NJ9L 4CAGA 1IGMH 2PYEE 4XXCA 4GW4A 4PJGA 3VG0H 3WLBB 1G1CA 2CDGB 2H1PH 1QKZL 4G43B 3RWJB 1FNEA 3RAJH 2J88L 1K4DA 3QHZL 2AXFA 4L4JA 5GRUH 2AJUH 4XNXH 1Z3GL 3OXRB 4LF3B 3VFWA 2JB6B 1AO7E 4K3EH 4RGND 9CGTA 1UCTA 3MCLH 3ULVD 4NM8L 2ATPA 2CK2A 3NZ8B 2VH5L 5DSCA 1RVFL 4KTDH 2NLJB 1CGVA 4PJDF 1EPFA 4P5TD 4LCIH 3D25A 3QDGB 3NKFA 2BNQB 2FEEI 1NGWA 1II4E 1VHPA 2BDNH 3RWIA 1EERB 3DJ9A 1FO0L 1FZOA 1FYHB 3PHQA 1ACYL 2Z31D 4FG6C 4PS4L 2XI9A 2VLKE 3QA3B 2R69L 5CWSA 5F9OH 4WFED 2AI0L 3TJHC 1AQDA 4OGYL 2QLVB 2CKBB 4H20L 5E1AB 1P1ZB 4NPYB 1ZS8A 3HE6A 4WUKL 1KJ2L 3QI9C 2AGJH 2NNAB 3WHE0 5DO2C 3MZTA 3ARED 1OT1A 2LQRA 3RWIB 1KLFA 1PKQA 2EDRA 1A6PA 2AABH 5INCB 2XY1A 4ZPTA 4IRSD 1NMEA 4NHCH 3IKCA 3SKJL 4PJCB 2A77H 4GBXD 3T1WA 5TF0A 4PJ7F 1L7TH 5LGHH 3UROR 4KFZC 4L8SB 5I1DA 1MFEH 3F65A 4NKDA 3W9DB 4EHKA 2VUYA 4H8WL 2K7QA 1T21A 3GI8L 1H0DA 3UBXI 1XZ0B 2ED7A 4GAGH 2H51A 4P2OC 4MD4B 2YUWA 4XZUA 5C09B 3M1BA 4WO4D 2R0KL 3MGOA 1HILA 1WZ1L 1QD0A 4JFXB 4XNXL 5BVJA 3JV6B 1A14L 5KS9E 4N0CD 4PR5A 4XXDB 1BFTA 4R97B 3V2AR 1J8HD 3QWRA 4GLRI 1CS6A 5HVHB 5ACLA 3L5XL 5J06A 3G6AA 4NKMB 5KW9L 3DRQB 3W0WD 3DYMA 3HKFA 1LP9E 4P4KC 4XCCH 2OTWB 3D3VD 4MDIA 3SDYL 2X4PA 3VGFA 4ODXB 3VW3L 1EEUA 3H0TA 3RUGE 3MBED 2E7CA 1KT2A 4JFHD 4QRPB 3CU7A 3AAZB 1IM9D 2VIRB 1CG9B 3I2CL 4P23C 5EUOB 2BK8A 2H32H 4JFEA 4XBPA 1CU4H 4X7TA 3L1OL 4R2GD 3NZHH 4LVNC 1T03L 4I5BB 2VXQL 1KPRA 1PQZA 3RDTA 4PRNB 3AS3A 4MB4A 5JOPD 4DCQB 2DKSA 4K3GA 4MCYA 4OZIB 1ZA6A 3RWEB 4MNQE 4NM4L 3MRGA 4Y16B 5M95B 2DM7A 5B39B 4HEPG 5J6HA 5EA0L 2R0ZH 1K5NB 4GMSH 5EU5A 2F54A 5CD3B 4HS6A 1FJ1B 2GSGB 3GO1H 3K3QA 5FO9B 3U79A 3VXRA 2Y5TA 3VFMA 2VSCA 3HPLB 1PG7L 3E6HB 1NGQL 3MV9E 3ARBD 1RZJH 4NYLA 4YHPA 4X6DB 4XTRD 3BHBA 3LN4B 1GOHA 1IGTB 4FA8A 4NRYA 1KTLB 4HLJA 2ADGB 1IEAB 1T89A 3CH1B 2HWZH 5GS3A 4F80A 2EDFA 3KPLA 5C0RH 4K94C 1VKXA 3CD4A 2QQNL 3RY6A 3UTTE 1OGAA 4DN3H 5FYKE 1KEML 3C6LB 4R4BA 3ULUD 4ORZC 2BCKB 4L8CA 1REIA 3QP3A 5JOPE 4ELKA 3NFPA 3CFIC 2B0SH 4BH7A 3H3PL 4U33A 1FZKA 1XGTA 1IC5H 5DLMH 2V7HA 2YRPA 3MJ9A 5JO5B 4HXBH 1A6AA 1OM3H 5I8OH 2I9TB 3VXUB 3L3DA 4Z18A 2WBJB 3BDXA 4KQ4H 5GS0L 4L1HA 5ETUA 3BIBX 3BI9X 1ERNA 5CINH 5JIPA 5I1KL 5GGRA 3L3OA 4JRXE 3L1OH 3FCTB 2XQYK 4TUOA 2BJML 4WI7A 5D9SA 2ADJB 2ARJA 1NGYA 4DVBA 3S8EA 3P9LB 1GIGL 3T0WA 2DQDL 5EBMA 1PSKL 4JVUA 3DV4B 3IDMB 3EYUL 4YR6A 5LUBA 2UWEB 2A6DA 3GMRB 4NC2B 1I1FB 1MCBA 2P5WA 2WUCL 4L4TE 4QHNB 3Q5YA 3OG4B 1WFTA 1IBGL 3KPRA 1Z9OA 3FJTA 4ODSL 4TPRL 2ZSWB 1C5BL 4OZGA 5GQBA 3T0BA 3NTCH 4LLDA 3LB6C 3QEGL 4OZHF 5GPRA 1ZLSL 4EI5C 1RPQA 3IDJB 3IDNA 4JB8A 3VD9A 4QHKJ 1IM9A 4ZVPA 3QEUA 4DN3L 5TJWK 2V5MA 4NNPL 1OF2B 5I1IH 5HDOA 5LU9A 3ZE1E 5H35A 1W72A 4HFUH 1YNKL 5I19L 1UC6A 2GCYA 3ARFB 1G7JB 2CKBH 4PJAA 1GGIH 2UVFA 1OARL 2I07A 1EBPA 1FLRL 4S1SL 5C6PB 1U8JB 3IT8D 1LE9A 1T20A 3F12B 2G60L 2AJUL 5ID0A 4K8RC 5DUML 3MRDA 5ANME 1OSZB 4HIEB 2YK1L 3EYQD 4N0RA 4ONOA 3FN0L 1F6LL 1YJDH 3RGVC 1AGBA 3NVQA 2HVJA 5AAWA 4QU5A 3EJJX 2ICES 3OKMA 3QWQB 3QH3A 1RE1A 1UT9A 3HRZA 5EOTA 4G8GB 2EE2A 3DTXB 2X89D 3RU8H 1VFAB 2C3VA 5LUAA 5HHQA 3QHFH 5D7IB 4N1EA 4MD0B 4OLYH 4Y8DC 3L3KB 4DGYL 3RFZC 4DZBB 5KN5B 4XHJD 1JNLH 3EDJA 3RDTC 4FFVD 4ZNEE 1IGIL 4I3SL 5CILH 4NGHL 2H45A 4R7DA 1RMFH 4IOFC 4G80A 1C7TA 1HHGB 3LD8C 4Y2OA 5E5UB 3MLWH 2ZZUT 2C1PB 3HE6D 4MAUL 4RAUA 1CLYH 2OQJB 3LRSA 4MX7B 5C7XL 3V4LA 2DMCA 4UNTA 5E5MA 3QQNA 4PB9H 5BMFL 4X5LA 4G8FB 4XMKH 3SE8L 3MSPA 1UWXH 3CXHJ 4TSAH 4OTXL 4M7KL 6FABH 3HI1A 1CLZL 4ZVQA 1P5UA 4MXQC 5F88A 4J3TA 5DO2D 5FGCE 4O2FA 5JPMB 4DTGH 1T7WA 1N0LA 5IFHH 1DP0A 2X9WA 2XQBL 4DOHB 2MPAH 4LHUA 1BGXH 3L5WA 1IAII 1W8OA 4G9FA 3TNMB 4LL9A 4XWGL 5D1ZA 1I7UA 4N5DA 3G5VB 3N1QC 4WJ5B 5GS1C 3EDRA 1N0XL 4KK8D 5IAJA 4I2XA 4YHLL 2JB5H 3VG9C 1A64A 1NCBL 4M9PA 3MLZH 4YDVA 4HV8A 5D1QA 3OPZL 1KIQB 2XKSA 5I1GL 5IGXL 3PWNA 5ESVA 3EGSB 3RVWC 2HBYA 5C9JA 1LK2A 2Z93B 3V5HA 4ONFH 3HNVL 3O45A 2HBRA 1NKOA 4LDOB 4M43H 3O6FC 4YXHL 3TJEH 3HI5L 2BY0A 4TTDD 3HC0A 2NY6B 4PJBF 5K9OB 2VZ3A 1YMME 2F5AH 1RU9H 1Z9MA 3M8OH 5E9DE 1JYNA 2NY2C 4Y4KB 1A6WL 2VNCA 1JF1A 5FB8B 3X14A 4EHAA 4PRIE 5HHOA 5I75C 3O6FA 3SEPA 2FO4B 4XX1G 3HLAA 3VI4E 3DETC 1EMTL 4QUJA 5JHDB 4XCFH 3TFKC 3REWB 3HI6H 4X99B 3I50L 2YWYA 3WXWH 1FC2D 5F7UA 4PJHB 2AAVA 4QTHA 4HBQA 1SBBA 4XPTL 2WV3A 4MNHB 2PYFB 4ZO7A 5E99H 1QYGL 3JUZA 3UZVB 1BOGA 2FGWH 2KH2B 3UPRA 1TJGL 3O3AB 4J6RL 5D72H 1QLRB 2B5IB 1EVTC 1JZ6A 1ND0B 3HLAB 4P2YA 4BSWB 1NBQA 2E27L 2EXYD 2QADC 4BSVA 3QUKB 1FFQA 5J3HC 1MCPL 2Z4QA 4ZTPH 1GHFL 2PTTB 1IRAY 1U8LB 3QIUC 4R7NB 2ITDA 5JQ6H 3KWWB 1KELH 1BQHB 1MCEA 4KZDL 1FBIH 3MPCA 4DKEL 4XNYH 4PJ9C 3HMXL 5EBLA 1IL1B 1UWGL 3ARGB 5EFIB 5FO8B 5GHWH 4O02H 2J33A 3H42H 1QHOA 4YDIH 3PWVB 3OBAA 3VRJA 2HN7A 1DN0B 4XP9L 4JB9L 1CZ8H 4OGAC 3B2UC 3C6SB 4EDWH 3GMPA 4G42B 5EN2B 3QIBB 3ULVL 3BPCA 3B2VL 1IGYB 4IBLT 4UBDC 2IBBA 2DI8A 2YD9A 2X4OB 1F4AA 4UV4H 4XC1L 4LASL 3SJVA 3MRLA 1F3JA 3BMWA 3TBYA 1EGJL 1FQ9C 1FAIL 3MR9A 3T2QA 3UTSB 2ITCB 5F1OB 3J8F7 3SY0A 1FRGL 4TNWF 2C1OA 4M1DH 4QRRE 4YGVA 2ICEA 4POYA 3VRJB 3FB7B 5K9QG 3MNWB 1IKNC 4KXZI 5JPMA 1QFUL 5IW6B 1T4KA 4Z95H 3T2NH 1U8HB 4X5WB 5IVOA 3SBWC 2AJVH 5IF0A 4HPYH 5FGSA 5A16B 1O5DT 3UYRH 1IGCL 4LSTL 5GISH 3T0EE 1RFDL 3CUPA 1FO0A 3KYKH 4OB5H 4GRWE 2VDPL 4PJXA 4FQHA 2CRIA 4G8FA 3RJDA 1DBAL 1PY4A 2ITDB 2D03L 4KTYA 4JM2D 1RUQH 4MX7A 4FNLH 2IQ9H 5HGBB 5DJ6B 3M07A 5A16A 1KB5H 1IKNA 4PJEB 4GS7C 1FFNB 4UQ2B 1J0YA 3P30H 3MNWA 5H37G 4GUPA 4MQXC 4X6DE 3OZ9L 4QNPE 1N5YL 4K23L 4HEME 2IMMA 4LLQB 4BZ1L 2DQUL 4IRSB 5TDNA 5BZWB 5T3ZD 4O00A 1I7TB 5HJ3B 4R2GB 1HZHL 4OLVH 3R8BB 1IT9L 1JHTB 5FGRA 4C57C 4ELMB 5I2IA 3CMOL 2GTWB 1E4XL 4KC3B 3T3ME 5SWZA 3CSGA 1UQSB 1CFSB 1CQKA 3QIBA 4M6AA 5EN2A 5C0GB 1I8IA 1T80A 1O7VA 3MBXL 1W0WB 1KJ2A 3LQMA 1EBAA 2YK1H 4LSPL 4JAMA 3FFCE 5F7DA 3MXWL 1AHWC 4K7PL 3AM8A 2RJMA 1RD6A 4KKAC 5C09D 3ARRA 5ENWA 5DUPH 5JPNA 1DQLL 5FAAA 4YQXL 5BQ7B 5JHDA 1IL1A 5EFIA 5EBLB 4OF3A 4OFYA 4NO3A 4IMKA 5C0ND 4LCCB 4OD1H 1RIHL 2E6JA 1BQHA 1S3KH 3PQYA 5IBCA 3TO2A 5GGVL 1HKLL 2AQ2A 4OSUH 4EBQH 3TN0B 4QUHA 4M1DL 4TUKL 5EZIL 3LRHA 1CFNB 1HK6A 3HMWL 2YKLL 4BSWA 3QUYC 3VXSD 5H94A 1HH9A 4RMSA 2CRYA 1IM9B 1D5IL 5TFSH 4KRPD 1CCZA 1KIQA 1J87A 3EOTL 4DUXA 5DD0H 4M48L 3QEHA 3V7AG 2O5ZL 2X1WL 4OQTA 1IBGH 4JPIB 4PJ7E 3IDJA 4FTVA 2M2DA 3HUJB 4YBQD 3K2UL 2WANA 5T3ZE 3IRZA 4TTDC 4Y4FB 3IVKA 3L7EA 3U6RA 1QQDB 5JUEH 2VDNL 3DXAE 4P2OB 4KUZH 5HHOB 3ARWA 3LQAL 1MF2L 2Z91B 1TZIA 1T3FA 4OLXH 3MLYH 3GHEH 3B83A 2XTJC 4JG1H 5IB4A 5DJZB 4U3XA 2QADD 4PV8B 5F9DC 1F3DH 1R5IB 2XPGA 1S9XA 1NGYB 5DHVB 1HCVA 4DVBB 3K81A 3MJ8B 5LAXB 4ZO9A 1RWKA 4KDTA 4YHLH 3V5HB 3PXJA 4ERSL 2C1PA 4JJEA 1AXSA 2VQTA 2ZUXA 4JJHA 3BJ91 1YYLL 3AS0A 3EYSH 3AS2A 5ESVB 2X4SB 2H4YA 1DQQA 3T1FA 5C2BL 3ZSSA 1R0AL 1DBMH 2CRMA 1UYWL 1RJCA 1A6AB 4BZYA 4QU0A 1XGTB 1Y6MR 3DVIA 3U0WH 2HLAB 3UBXA 2VQUA 5DJ0B 4F57H 1MELA 4K9EH 3MOAH 1X9QA 3V4PH 3L5WB 4YNYB 1AD0B 3NACH 4F3FB 1RJLB 2DQGH 3VA6A 5HHMD 1OAZH 3OKMB 3ZLQC 5D96C 1A7NL 2VTFA 5L6YL 2EO1A 1VENA 2J32A 5EC1A 1CLYL 1AGBB 4E41A 3D85A 3PQYE 2E7LC 1NCDL 2Y5TB 5DQJB 2E3VA 4H25A 3DGGA 1N6QL 1JTPA 2VDQH 3FQTB 2F54B 1YEFL 5CUSL 3AU1B 4NRZA 4PRPD 4Z7VE 2VL4A 5JIIA 4EHFA 4PGJA 3NFNB 3FMGH 1RZGA 1GOFA 3L3HB 2MFNA 4OGXL 1FVDB 4QWWD 4V1DA 1XGQB 3WFBH 3UAJC 4HJJL 3H9YA 3MBEC 4PJAB 2R29H 2NXYC 4UDUA 4RISL 4G9FE 3MLRL 4EJ1C 1YYMH 3S7GA 1AGCB 1NMCB 1YECH 5KN5A 3SCMB 1EEYB 3X3FL 1UJ3C 1BEYH 4JFEE 3JWDC 1FAKT 4FQCL 3SE3A 4J4PA 4H20H 4X7TB 4JFEB 4XBPB 4DZ8B 1RURL 5EUOA 3RTQA 1SJVA 4YHYB 3LEVH 5DJ2A 3TIDB 1KT2B 1R3KB 2XG5A 1ODAA 2IFFL 2Z8RA 2BC4A 5CMAB 3QXTA 3WJLA 2ZCHH 3N06B 3QQ9D 1Q0XL 3QYCA 3FT2A 5FYLE 3AUVA 4MAYD 3BGMA 2GTZA 4HIXH 5KG9B 3BEVA 4KJYB 1S7WA 5KJRH 3T0EA 5E9DA 4M61A 4P4KD 3SOBH 5ID0B 3DIFB 3WUWG 3AREC 3P45A 5EZOL 4L4VE 3LQZA 3LRGA 3TJEL 2ZKHL 4X8JB 5IQ9A 2C3XA 1YPZE 1L9MA 5ADPH 1DLFH 3K74B 4YAQA 3U0PA 3JWNC 3VWKC 4OCMC 1MY5A 1A9BB 1NLDH 1FVEB 3QFDA 4YPGB 1YEJL 3HI6L 2AV7B 3QWOA 4XZUB 3O6ML 4ZXBD 1EHLH 2CIIA 1K8DB 2XZQL 3GUTB 5E2UH 4KI5D 4KY1L 5E56A 1K6QH 1YEFH 5CUSH 2YPLA 1I1RA 2NXYD 3FO0H 3GSNB 1YY8B 5FGBC 4C54A 1FZKB 2VAAB 1QFPA 5CJQL 5TQ2L 4XPTH 4KRNA 1DLHB 4QO1A 5TH2B 5FYLD 3A6BH 2HG5A 4EJFA 5SWQA 1OAKH 2Z31C 1P53A 2GUOA 4DOHE 1KN4L 3VXMA 1TJGH 5IANA 2GAZA 1NDGA 2EH7H 4QUAA 2PW2B 1AR1C 4NWTH 5D71H 5TDOA 4WGVB 5CEYA 5IG7A 5E8OA 4BZ1H 2CJXA 2GYSA 2R2EB 4YR6B 1BF2A 1AQDB 1J18A 4N9GA 3E6FA 4LHUG 2ERJB 1IM3B 1T1ZB 3QCUH 1RVFH 5L0QC 5FDYA 3K80A 5F8RC 4O2EA 2IAND 4NZTL 4OT1L 5KVFL 4WWKD 3QDGA 5TDOB 4YEFA 3DHJA 5DMGC 4PG2C 1KCUH 1ZGLP 4N8CH 5D1XD 4NC1C 4MS8C 5MERB 5FOBB 5SX4H 1HSBA 5EA0H 1WEJH 3V0AC 5FYKL 3WIIH 5C0AE 3C6LC 3GIVA 4RA0C 4UBDD 5T1DH 5GXBB 1BX2B 4MB3A 3UJIH 1OTUD 3OXRA 3VFWB 1T1WB 4OLYL 5CZXD 3SDAA 5HXMA 4N0YL 3X11B 5ILTL 3ZKNC 1RZJL 2XOTA 5EU7C 2XZCL 1JGDA 3Q6FA 1CG9A 5CIPH 2VZUA 2DWEB 3FO1A 4G7YH 4KMTH 5FUZH 3Q2CA 2NY4C 1FL6A 1Q38A 1CR9H 4FQPA 4XBEH 4JPWH 3N1GC 4WFHE 5JXEA 2F9BT 4BKLA 5F3HB 3D6MA 3LD8B 3MFFA 2GFBA 4OV6F 1U8PA 4Y4KD 2V2XA 3V7AE 1RZKL 5CKAA 3C8KA 3INUL 3GMQA 3QG7H 3CCHA 3MRPB 4GRWB 4BFIB 3IS0X 1DCLA 2D7TL 4HC1H 1YEKH 4KJYA 4YUEH 4AK1A 1Y6NR 5MENA 2FWOA 3QG6A 3SQBA 5BVJB 4M1CC 2MWCA 1UM6L 3WXVH 3W5MA 5K33A 3FQXB 4HK0B 4PJGF 2F5BH 2G9HB 1QA9B 2VYRE 5JW4R 1QPXA 3IAPA 5FO7A 1GPOH 1QNZL 3JUYA 1DVFC 4UINH 3DARA 4RA3A 5MP6H 3PUCA 1DJSA 5I8EA 3CVIH 4F7TB 3ULUC 3MV8B 5DC4B 2ZWLT 4YPJA 3QXWA 1ZT1A 1WWWX 5CSBA 5IEKB 3D1MC 3FTGB 4Q9QL 5INCA 4B5EA 5I16B 1DBBL 4RMWA 2VITB 2X4PB 1FC1A 1N59A 4JO1L 1IQWH 3TA3A 4NOFA 2FHFA 2LABA 1P4IL 3ARFC 2VLJE 4HFWA 1RZGB 3NIFE 5F7YC 1ZHKA 4L8BA 1IAOA 4OQ1A 4JPKL 1MREH 3MC0A 5FA4B 2CKBA 3CFKB 1EV2E 4F57L 1HHKA 4U2ZA 4M1GL 4RGNE 3EFFB 1HYSC 4KROC 3BP4A 2X1OA 1KLGA 4NKOA 15C8L 3D85B 4S2SB 2OP4H 4JPWL 2HT3C 4F58L 4AIZA 4MJ5B 2FO1A 4PD4K 5L8KB 1WZ1H 1AKJB 2YUVA 5B3JF 2BRRL 5CIPB 1RUPH 1MI5A 1DEEB 3NH7H 5I9QB 3GK8H 3EOAA 4PRAA 4I1PA 3B9DA 4HIIB 5D6CA 4UNVA 2O61A 3HZVB 5EORL 2X9YA 2QSQA 1KTKE 5DJ0A 4JFPA 2HLAA 3V0VB 4ALAH 3F7YB 5ADOH 2ESVD 4NWUL 1JIBA 1ES0B 1LO4L 1RAMA 4L9LC 3BP6A 3MZGB 3OKDB 4QHMA 3G5YB 1DQLH 3IFLL 5EO9A 2A83A 2BNRA 2QQLH 5A2FA 2Y06H 1CD1B 1MCJA 1N5AA 3CC5A 5HHVL 5D2LF 4F9PA 3U9UB 1X5IA 1ZS8B 1HHJB 3BSZL 3GB7A 3PABA 2DTSA 2HKHL 4M6MH 2JE8A 4LAQL 3MOBL 4PRIB 3RY4A 4BH8B 5FA4A 4PRBA 3KVQA 3X3FH 3MOQA 3ORJA 4WDIA 4NQDD 1IAOB 2GHWB 2P42B 3MRMA 5CP3H 3VGAB 2HMIC 5IJKA 1VESA 5BJTB 5GIRA 3AB0C 5JFTA 4NIKB 1GZPA 4HWEH 5ISZA 2MQ3A 1HI6A 1N4XH 5EDXA 4IS6B 5ICZB 4PGBA 2P8PB 1QZ1A 1JNJA 4NN5B 2X70A 4PTUA 4YHZL 1UKSA 2DWDB 3L7EB 3U6RB 4LCIL 4TVPD 3RGVD 3P4MA 3JWOC 5SWSA 3RNKB 3LOWA 3FQUB 1FDLL 5C6TL 3RWGA 3SGKA 3LB6D 2WP3O 3O4OC 5E2TH 2Q7YB 4ELME 1IGML 1MCNA 1RUKH 4ZUTA 3OKNB 3S5LA 5SWSD 5DZNA 4WU7A 3U48A 1RY7B 4KTEL 4JFDD 1XF5B 3ME0A 3I3EA 4EDXB 1J5OL 4RMUA 1F00I 3RWHA 4KPHH 4FRWA 1LGVA 5BXFB 2WWKO 3RVUC 2FX7H 3K4DA 3LDBB 5L6YH 1VPOL 4FG6D 3MFFB 3PNWA 2IG2H 1RFDH 4GMTL 4M03A 3KGRA 4BKLB 1LHZA 3OKEA 1OT2A 1MJJA 2Y6SC 3GNML 1FL6B 2VLMD 2Y07L 3FFDB 1AD9B 4DAGH 4OZ4B 5IFHL 2FL5B 4X7SH 4QNPF 1MIMH 5FYLL 1JRHH 4XP5H 2WWKT 3BKML 3I6GA 3IDXH 2F5AL 3VXQA 3WHXA 1KLUA 4CNIB 2ARJQ 4AEHH 4I0PD 4KUCD 4OKVB 5ESAB 3QXDA 3T3MF 1QFHA 1I7TA 1YEHL 3UOAB 5C0CA 5MERA 4CU6A 3DI3B 1NCTA 5DEZA 4G8IA 4AWBA 4UOW0 5I1GH 1QFWL 5IGXH 2OXGA 3QEQE 1X7QA 1KCUL 3N85L 4GAFB 4X4ME 1H9VA 5HHOD 3QIUD 3RU8L 3WNKA 3RWCB 5ID1A 2WSKA 3O41A 2RR3A 1UM5H 1KFAL 2PXYB 2YN5A 4K2UH 2CUHA 2VDQL 3UO1L 4S0TD 2VLLA 3WFCL 4U6YB 1FO0B 5DFWH 1UACL 4NJ9H 3KYMA 1QSFB 1QLEH 4NC0B 1NMCC 5HI5C 2ZUSA 3IXTA 3L6FB 3QUYD 3FKUS 1LO0H 1FVCB 4AMKL 2L7UA 4X80L 5DYOB 2CKBL 3GBLA 2CDFA 1CI5A 2C1OB 4CVZB 2V2TB 4YDJA 1X5XA 5F72S 1K6QL 5F7EH 3H6JA 5TH2A 3SKMB 5KTEL 3MR9B 1KCLA 4LCWB 1I8MA 1LNUA 3MLTB 3MODL 1ULVA 2VAAA 4YFLF 4DQOH 1QACA 4URTB 3VXNA 5CJQH 3GSNA 2KBGA 1XFPA 4N0UB 4RGMC 1R3LA 3BPCB 2ATKB 3G9AB 1YQVL 2NY3C 3LQAC 3INUH 2NPLX 5F6HJ 4R6UA 4KKNA 2F19L 1UZ8B 4I48B 4JR9L 1DQDL 4PY7B 1IQDB 3TH3T 2Y36L 5EULV 5JHLL 3O6LL 3U0PB 2AQ1A 4NP4L 4LSUH 4E42B 2P48B 1TITA 5DJYA 1NC2B 1OPGH 2AXHA 2E7HA 4NQCA 4G6MH 4PUBL 1BIHA 1N8ZB 1S9YB 2AI0H 2UWEE 1YJDC 5K59F 1EJOH 3VWJA 3KJFA 4U1NA 3BXNB 3KWWA 5E9DB 1DQML 2BRQA 5KSBA 4PRPB 4DN4L 2Z4QB 4NHUB 4LRNL 1XCQA 3LKNA 1AIFB 1LMKA 4Z8FH 4LCWE 2ZNXA 3BGMB 4RQQA 1MJ8H 2K7PA 5C0CD 4RCAA 1SEBB 4G7VL 1VERA 1QVOA 5BV7H 3V6BR 1ZHLA 1T0MA 4Y4HD 3UTPE 3WIIL 1A6UL 2W9EH 1R3JB 2GJZB 1AXIB 1EEYA 4UAOC 4NQSA 3WS6A 1E6JH 3C5ZC 3ULUF 1KB5L 3ALPA 2VLRB 5JORB 3EDEA 5IV2A 4L4TD 3KPOB 1FRGH 1XGQA 3IFNL 4V1DB 2DKUA 4JO3H 5LQBL 3IU4H 5FHAL 3DX9B 1T22A 3KPQA 4HULB 3LDBC 4IDJH 1Y18B 3ROOA 3FQTA 4C83B 2JJUA 3MGAA 5FHBL 5ISZD 4P4KB 4XPBH 3SBWA 2GY7B 4WHYG 1LQSR 2FGWL 2FBJL 4ZUUB 1SVCP 2MQCA 3ARBB 3HC0B 3Q3GA 3ZT5A 5BS0D 2IQ9L 1RZIB 3BD3A 3HC4L 3IFOA 1LK2B 2Z93A 4L9LA 4M9RA 5DK2B 1W2KT 1CDJA 3GJEA 5F9JA 1XR9B 3C6LD 3D69A 5DD1L 2GK2A 5A3IC 1JNNH 1R24A 4N0FB 3QFJA 3OGOE 4OF6A 3HNTL 3IETB 3STBA 1FIEA 5JQ6L 3VFGH 3MRQA 3THML 1X5GA 4JJ8A 2JJWA 2C4XA 1FZJA 4ODBD 4UZGA 2XZCH 4NCC2 2ORBL 3KDMA 3D0LA 5JLZB 1F02I 4PV9B 3SDCC 1JPGA 1RK1B 4YHYC 2JJTA 1OHQA 5JW4N 4LCUA 3EDQA 4UT7L 4XHQA 2ICWB 2WBKA 2YA1A 1LEGA 4H26A 4P2QA 2R2BA 1IC1A 3HTLX 1KB5B 5JOFB 4G9DB 2VABA 2JIXD 4FXLA 1R5IA 1FCGA 2Q20A 1MREL 5JA9A 1U8QB 4ZUUA 1C5DA 1F13A 1RZ8A 1GGCL 4HUVA 2YOCA 4O9HL 3LKPB 4JKPL 5JDSA 4D0DA 2EH8H 1RWXA 1Y18A 2D7TH 4P2QB 4Y5YA 1ZV5A 1YPZF 3DWTA 2RQ8A 3LRSB 2W65A 3T3PF 5GRWA 1TTFA 4N8VB 1SYSA 5B8CB 4Y4FA 1RZ7H 4IMLA 3Q5OA 2DIBA 4X4ZA 3O3EB 1ORQA 5DD6A 1C16B 2B4CC 1KCVL 2AK4D 5J6GA 4CBPA 4RGNC 3MRQB 5I8CA 5DUMH 4Z0XB 2BRRH 5D7IF 4N0UE