4IEFB

Complex of porphyromonas gingivalis rgpb pro- and mature domains
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
423
structure length
422
Chain Sequence
b'GRMIVIVPKKYEEDIEDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDKWLGQALCIASAEGGPSADNGESDIQHENIIANLLTQYGYTKIIKCYDPGVTPKNIIDAFNGGISLANYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVAVNGDFLYNVPCFAEALMRAQKDGKPTGTVAIIASTINQSWASPMRGQDEMNEILCEKHPNNIKRTFGGVTMNGMFAMVEKYKKDGEKMLDTWTVFGDPSLLVRTLVPTKMQVTAPANISASAQTFEVACDYNGAIATLSDDGDMVGTAIVKDGKAIIKLNESIADETNLTLTVVGYNKVTVIKDVKVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gingipain R2 Pro-Domain
publication title Porphyromonas gingivalis Virulence Factor Gingipain RgpB Shows a Unique Zymogenic Mechanism for Cysteine Peptidases.
pubmed doi rcsb
source organism Porphyromonas gingivalis
molecule tags Hydrolase
total genus 147
structure length 422
sequence length 423
chains with identical sequence D, F, H
ec nomenclature ec 3.4.22.37: Gingipain R.
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01364 Peptidase_C25 Peptidase family C25
B PF03785 Peptidase_C25_C Peptidase family C25, C terminal ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4iefB03
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4iefB02
3.40.50.10390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Gingipain r; domain 1 4iefB01
2AI0L 4GXVH 1EHXA 4XPGL 5IMKA 5F1IB 1CU4H 5SWQB 5HHOA 1HEZA 2RCSH 3JVGC 3UPAA 3GMQA 3UCRA 1U8KB 1HSAA 1U95A 4L9LC 3HMWH 1DSFL 3QDJB 2HKHH 5TDNA 5KS9E 5C70A 4TTDC 2HBYA 3MLXL 4BFEA 2DD8H 5IKCA 4MGXA 2QQKH 3QXAA 4E42B 1NCDH 4LCIL 4NQDA 4DWHA 3TIDB 4XP4H 3WXVL 4N9GA 3T8XA 2C26A 2R4SL 3ZE1E 2VL5A 4LRNH 3BEWA 5ESVB 4FZ8H 5CZKA 4MNHB 4P3CL 2APWA 3HLAA 4P2RA 3WN5A 3KYOA 1BAFL 4GSDL 4I9WE 4JRYB 5F21B 5C0CE 1C08B 2X4NA 4UB0L 3OKOB 1NL0H 3SGEH 4MWFA 3V5HB 4HH8A 4ODUA 3D6MA 5EUOA 4XNYH 4LKCA 4PJ7F 5DFVD 1QBLH 2R9HC 1FO0H 3FO2A 1BFOB 3U6RA 5I9BA 1AE6L 1A1NB 1EO5A 5F3BA 2XQYG 3ARYA 1ZMYA 3WLWC 3EDEA 4PLJD 1OSPH 4JM2D 1FBIL 5KSVA 4EXKA 2J30A 1XCTA 1QFUH 1D6EA 3DOSA 4NHCH 3MLYL 3BZEB 2HT4D 4Y5YA 1YN6B 3HE6B 3MCKB 5FO9B 4IIQC 1IAIM 1U8JB 3OG4B 2OTPA 3JWDC 3PJSA 1FORH 5D7SH 2OYPA 2DIAA 3GBNH 4AQ1B 1KXQE 3MCLL 1LEIA 3VD3A 1TJHH 5JDSB 2CK0L 1JK8B 3DEKA 4I3GA 5D7KE 3HKFA 4OSUH 3RU8H 4ZO8A 4EHAA 3GJTA 4I8DA 3IU4L 2IGFH 3WIHL 2CGRL 3WFDH 2IH3A 2A9ML 4JB8A 5JXEA 2B39A 2BFVL 1ZHNB 3FQTB 4CN6A 4TULH 2VDPH 3KS0H 5L0QC 1QRNB 3R1GH 5HPOA 4PJGB 3U7AA 4BQ8A 4CAGA 4NOFA 5I8KL 3OAYK 3CFDA 4OM1L 5LQBL 2R0LH 3P77B 1ZA6B 2NY5H 3GKWH 4OB5L 3N50A 4HK3J 4QTIH 4LSUL 1MRFL 3HZVB 4MAUL 3GSWA 4A6YL 3LV3A 1I1YB 2DQJL 2PXYA 4GS7B 1I4EB 2XWBB 1FFOA 1Q1JH 2XZCH 3LOWA 4S1SH 4RIRB 3AB0C 5FGCB 2YD8A 4I9WD 2P43B 4RWHA 4ELMB 1Q9WB 5C0CD 1FL3B 2CUMA 3ETBF 1KBGH 2FIRT 5IMMB 1G84A 1OAUL 1NKRA 4NKDB 5KANI 4L29A 4PJ9A 1CLYH 4JJ5A 1MFEL 1ODAA 5I8OH 1BGXH 4B41A 4PLNC 3DX6B 1A1MA 3SDCC 1GGIL 2NW3B 3BIJA 1DBAL 5E6ID 1JTOA 4N0CC 5CD3B 5CEXA 4OD3L 1KULA 4NO5A 5JLZB 5DRNA 3DECA 5E8NB 3BD3A 1UT9A 2BMKB 4C56E 3ULUF 4LSSL 4TVPE 4EI6B 2NNAB 5D8JH 1RZFH 3ISWA 1NFDA 3S97C 1MWAH 1ZHBA 1MQ8A 3DNKA 4POYA 6FABH 3FO1B 5D6DA 2ZUTA 4XBEL 3LEYH 1RWXA 1U58A 1NAMB 1WZLA 3O4LA 1WV7T 5C6TL 4OF6A 5B8CC 1ED3A 5JR1L 5CINL 4X99A 4KZDL 2AK4B 2VLLA 3PQYE 4X6DB 5F7UA 1MFDL 5DK2A 3B9VA 1KCUH 4F15B 3EAKA 3IFOA 5L2KE 1JRHL 2Q3ZA 5C8JA 2J8OA 3RUGE 1MCPL 1EFXB 3P4OB 5IB1A 1MCDA 1LDPL 3DMMA 1FZMB 4OKDA 3IGAA 1IQWL 5J1AB 1JCKA 3RZCC 4GBXD 1FFPA 3CCHA 4B7LA 4MNGB 3FONA 3I9GH 4RBPK 4TQEH 1U3HB 5T33L 1QO3B 2BJML 1Q9KB 3E6FA 5GRUL 2AI0H 1MCBA 4XPGH 4Y8AA 3GMRA 3H11A 4KY1H 1F13A 1F8TL 3OAUL 3SN6N 1PJ9A 1VHPA 4OZIF 4RX4D 4HMCA 5B38B 3VI4F 1GGTA 1LD9A 3G5VB 4Y5XA 4U1JB 1DSFH 5CBAB 2CDGA 2NX5B 1KF9B 3PGCB 3KPNB 3H0TB 1YEGL 4G6KL 4LCIH 3OKNB 4F8TA 1AGFA 3SO3B 3MJ8A 3MRPB 4G8GB 2R4SH 3MUGA 4LVNC 5IQ9B 4LMQI 4P3CH 3S5LG 3PUCA 1G0XA 1BAFH 4GSDH 4NHUB 5DA0B 3W5NA 4EHDA 3LH2L 3ARPA 1CE6B 1T1WA 4UB0H 3MV8A 1CGVA 4PJFE 4QKXB 5FUCE 3UJJL 2VLKB 5EIVA 4U3HA 4U6XB 5ICYB 1J1PL 3Q6GL 1FV1B 5BZWA 2R29L 3VFTA 2VC2H 3GRWA 2IBGA 3PWLB 3P9MA 1CYGA 1AE6H 1IAOB 3FJTA 1QQDA 5CIPH 3NN8A 3PHOA 5TJWK 3SDAC 4EDXB 5KN5B 2VXTH 3PF2A 5HDBE 5J89A 1FBIH 3H7LA 4NO3A 2F54A 3PQYD 3VH8B 1OT1A 4MHHI 3T0WA 1EHNA 4PGCA 1G7IB 3HZMB 5L2KD 3ZKXB 3MLYH 3T04D 5DYOA 1AFVL 1MIEL 5HYQB 5BRZE 2ARJB 1HKFA 3QUYB 2V6HA 3K4AA 2H4WA 2NY4C 4MVBD 3KJQA 3QWRA 1N26A 3MCLH 1Z5LB 2VZOA 4P2YA 5I16B 4PRHD 2CK0H 3G6AB 5IK3B 5EDXA 3TO2B 4WJ5B 5HTSA 4UT6L 3GMMA 2PO6B 3SGKA 2OCFD 4DCOA 3U7YL 2F74B 3UO1L 4HUMB 4RFEA 2BFVH 5GXBB 3LN4A 4UBDD 4BQ6A 1GOFA 4MJIE 1WEJL 1UADC 2HG5B 4C58B 1IE5A 4HBQA 3HZKB 4Z77A 3NCMA 4O5LL 4ELKB 1OD9A 5I8KH 3EZ8A 4OM1H 4JO1L 5LQBH 3JXAA 3AROA 3EO1A 3FB7B 4HSQA 5JHLL 5F9JA 1S7UA 4QRPE 2H41A 1VGKA 4OB5H 5DQ9A 3STLA 2EZ0D 3H9SA 2F53E 5IBPA 4LSUH 1MRFH 2OXHA 4GQPH 3RWDB 2Z0BA 4MAUH 4Z76A 2VQTA 2F15A 3QI9A 4FQIH 3TN0B 4A6YH 4I2XB 2EDWA 5FAAA 2CXGA 5F9WC 4RZCB 3JTSB 5C09A 3V6BR 2IBZY 4NNXA 1RWVA 2CUIA 1XGRA 1WIUA 4Q2ZB 3EYVB 4MMZC 3ARUA 3WFHA 1BZ9A 2FX9H 4RFNC 5KBNC 4HEME 1MLBB 5BOZG 3T2QA 3BMWA 3LKQB 1AC0A 5ESAB 4PJXA 1NFIB 1KYOJ 1MFEH 4UNVA 4P4KB 4AIZA 2ADIA 1BFSA 2IANA 5I0DA 1JFQL 1DBAH 5A16A 1RVFL 2GKIA 2NYYD 3ARDC 1P7QD 2Z8RA 2HTLD 3PP3H 1RUPL 4I5BA 3DVNB 3QQ9C 3LPFA 3T77A 3QEQB 1L6ZA 5BRZD 5M94B 5F1OB 3SKOA 2EIBA 2OS7A 2GJ6A 3BD5A 5F44A 2A6IA 3RZWA 1YYML 5HY9A 5C6TH 4DKAA 1CFTA 4HUUB 2DB8A 3MJ7A 4X5WB 3ROOA 1H0DB 1Y0LB 2IQAA 3F6LA 3RGVB 5JR1H 4TTDD 4KZDH 4LGSB 3CZJA 1I1RA 1MFDH 1R3KA 5I74C 1JRHH 5DZOA 1N7ML 3TBSA 3CC5B 1MCPH 3VJ6B 2VO5A 3VRLE 1LDPH 4F57L 2V5MA 4K7PY 2XKSA 4MJID 3QNXA 4R7DA 4HIHB 5E1AB 1UACL 4NRYB 1FL6A 5T33H 2R39A 1DVFB 2BJMH 3VDAA 5GRUH 2AEQL 4QRPD 3MV9A 1UKQA 3HB3C 1R5IB 1BIHA 4X4XB 5IOPA 1F8TH 4PJHA 2F53D 4IMKA 1AXIB 3VXPB 4K8RC 3QBTB 4X98B 5KVMC 4H0HB 4NQTA 2W60A 4OKVB 4X7CC 2VUOA 1A4JB 1N64H 3QUZB 3MLVL 4OZHB 3ILQC 1JWSA 4FABL 5INDA 3O8XA 1QLRA 1CD9B 1NDGA 5IFAL 2BNRA 1YEGH 4G6KH 3OJDA 2LU7A 1O7SA 1K4DB 2PCPB 4P9HL 4K23L 3EO0A 6CGTA 3JBG7 3GMNA 3L9RB 1KPRA 1RUAH 1VFAA 2ATPA 1WWAX 2VQUA 1TTFA 3VXQB 1ZLVK 4UTBL 5C0FA 1RZIA 4QHUA 3TPUA 1X4XA 4P23C 4R90L 1TJIL 2NY6D 3LH2H 3ES6B 5E56A 1Z9MA 1CFBA 2G9HB 3O9WD 5KVEL 2HKFH 3UJJH 3BW9B 2VL4A 2E6JA 1NGYB 2VAAB 1FH5L 4BK5A 3CVHB 3Q6GH 3VXRB 4KTDL 2KZ1B 1N59A 1U8IA 2R29H 1P6AB 3KLHD 2RIKA 5KSBB 3L1OL 3BGFB 4LOUD 1QR1B 4QUJA 1KJ2B 4MA3A 4MJ6A 3D69A 3MRGA 4HAFA 3INUL 1I75A 4OZFH 1KN2H 5EOTB 5K9KA 4WWID 4OCRL 4LLWA 4I0PC 4KKBC 2FJFB 4QYOA 4PGDB 4W4OC 1AFVH 1YN7A 1KC5H 1MIEH 3R5JA 5F89B 1ZGLA 1BIIA 5EBMA 3REWB 2YSSA 1CDJA 1V7NL 2ILLA 4PP1D 4BJLA 4GRWF 4Z7UF 5T1DL 5KVFL 2BCKA 3QNZA 3W39A 3D3VA 3FN9A 4UT6H 5FA3B 3T0AA 3RDTC 4ZVOA 1KOAA 2AJZA 2P8PB 3U7YH 4JQXC 1UH4A 4RGNC 2FWOA 5JORA 1NQBA 5D2LB 1RHUA 1B88A 5IBCA 1WEJH 3WJLC 2LV4A 1XF4A 4PG2A 1AQKL 3LKRB 4O5LH 3GJFH 4F58L 2VDLL 4JRXB 4Z7WB 3UTZB 4QXGL 2E27L 5GZOD 5JHLH 5EB9A 3S88H 2OMBA 1J8HA 4ONHB 3B9KA 2H3NB 5IMLB 4WUKH 2E9IA 3VFSA 2CXKA 2OBGA 5T1LD 4G6FB 4JY4B 4N0UE 1V3JA 4XZUB 3UYRL 3EFFB 3FHAA 2EIZB 5CCKH 5GGVY 3CU7A 1QLEL 3L5IA 5I15L 3VDBA 1X7QB 1Q94B 2CD0A 3FFCA 5DK0B 2BVUA 3OB8A 4LCWA 3KJ6H 5DJCB 2XA3A 3Q6FA 1N5AB 2A0LD 1UXWA 3IDJA 4MJ5A 3WHXB 3WS3B 3P73B 3OKLB 1RHRA 3NCYS 2D7OA 3GUTA 3RZCD 4MD4B 3E1F1 3LQZB 2P2CA 1JFQH 5J13C 3WS6A 3TP4A 2E7HA 5I6XB 1T83A 3A6BL 5KSUB 3MRLB 4RGOL 4PP2A 1RUPH 5D6CA 4YJZL 3MRQB 5D7JC 4TSAL 3D1MC 2M2DA 1IL1B 1TVBA 3LMJL 1KNOB 5LGJB 4NKMA 3RWIB 4OCNC 4U1NB 3D2UD 4P46B 3RTQA 2V2TA 4X6EB 3T0EC 2BHZA 1F4AA 1YYMH 2WQ8A 3ARFC 3LEXB 4JDVB 5DJDA 4X9GA 3RI5F 2EDTA 1GOGA 4M8QB 4P2OA 1TQBC 2Q1EA 5JW4Q 4FFWC 2XY2A 3QQ3A 1KIPB 3ZDYE 5I18L 4RA3A 1AO7B 3BDXA 3NFNA 2ZUQB 1T0MB 3QRGH 5E0QA 4F57H 4EN3C 4PUBH 2GUOB 2IADB 3T3PE 4OFDA 2KKQA 1NH6A 5H2BB 4YC2B 2ZUWA 3DLQR 2AERT 4HXAL 1XEDA 1AY1L 4WO4D 5DD3L 4Y4HA 1XGUB 1MAKA 4HKBA 3KPSE 1CGTA 2AEQH 1YMMA 1HOCB 1EAPB 2BVTA 4Y2DA 4AEIL 5I66B 3SJVE 1KMCA 3N0PB 1RY7B 5DQDL 4MDIA 4ONFL 3IDXH 3ZKMC 4XXDB 2AQ2A 1WBXA 3O3AA 2Q8AH 3GSNB 4XVUC 2EDRA 4JPIA 4PV8A 1XZ0A 5GSVB 3MLVH 2ITDB 3KYMA 3QEUA 5CD5C 3BDBA 3GBML 4GLRI 4FABH 4ETQB 5IFAH 3WIIL 1CD8A 3QCVL 4FG6D 1WFTA 4LCYB 1UB5B 3ZYZA 4P9HH 3O6FD 4APQA 4DTGH 4HPOL 1I4FB 1UJ3A 2J8UA 3RHWF 1XF5B 1GZPB 2GQHA 1AGBB 2XN9B 1UCTA 1MRCL 3QIWD 4MD5B 2M1KA 5FM5O 1NBZB 4UTBH 5FDYA 1F11B 4WI7A 3NCCB 2P8LA 4R90H 1TJIH 3BQUC 1DUZA 4XX1E 4PY7A 1ZLUH 3VFUA 5KVEH 3W82A 4FFVD 1FH5H 1YEDA 3QCUL 4MAYB 3TVMB 2LU3A 3I84A 4NNPL 3UMTA 3DEJA 1NC4A 4M7LT 1X5YA 3RIAF 4H25B 2BNQA 1MY7A 2YHGA 3RAJL 5KVGL 1RJZB 2ICWA 3INUH 4V1DA 3EW3B 4FQXD 2HT2C 3O3DB 2VUYA 1IM9A 3VXME 1DBML 4OCRH 1CDCA 2H2SD 2CDEA 2MJWA 5DSCB 5IBUB 1UYWL 5DHVH 4NN5C 4AENA 2W91A 4F7MB 3FAWA 1V7NH 4AG4H 4QOKE 5M7QA 4D0BB 3GGWA 4PRIB 4QRUB 3MRMA 4ZOAA 5MHSE 4LHJB 1HYRC 4XBPA 3UYOD 3LN5A 5T1DH 5KVFH 2FH8A 5EZOH 2EYTA 4S1QL 1G7PA 43CAA 1U0QA 1CFQB 3ULSB 3MZTA 4XAWL 3KPSD 4MXQC 5IM7A 4G80A 3KHOA 1AHWB 5FUZH 1EUTA 3HMXA 2Y5TA 3SJVD 3EYQD 1FFQA 2XKNA 3JWOH 4KI5E 1GC1L 5FO7A 4IOIA 3D85D 1HQ4B 5C0DA 5EZJB 3SDXE 5HYSB 3WLBB 3CSYB 5TH2A 1HI6A 4KRLB 2VDLH 3BXNB 3IXTB 1JGUL 4QXGH 2E27H 1A6TB 1YC8A 3DETD 2QBWA 4PJGF 1QNZL 1ZT7B 2Z9TA 3TEUA 5BS0A 4UTAL 2CJUH 5C0IB 1SMAA 4PJ5B 5K93A 4H1LB 1I8MA 4H8WL 3U2SB 1QLEH 1BQLH 4XHQA 5F7EL 1U8HB 3WNOA 4PJEA 1S78C 4WHYH 4M1GH 1KLUA 5ALCH 1VEOA 3IAPA 2DQTL 4C83A 2FSEA 4CW1B 2VTFA 4ELMF 3IF1A 2EEAA 4NOKA 1WZ1L 4NOMA 1NBYA 4DKEL 4JZJC 4LLYB 2XT1B 1UJTA 4JFEE 4QNPE 1JPFA 2D9QB 1G7MB 5DC4B 3A6BH 4RGOH 3SOBH 4MCZB 3UBXB 4IDLA 3VXMD 2BOCA 3MRNA 5JO5B 1J7VR 4DVBB 1MFBL 1O7VA 1U2HA 3LMJH 5I1AB 3BH9A 1D5BB 1KB5L 4H0IA 1FDLL 3FQWB 3VCLA 3HCVA 3UO8B 1HHJB 2AP2A 1SBSL 4PFEA 3OKYA 5IG7A 4QOKD 3VFOB 5IB3B 3BSZL 5MHSD 1FN4A 3BP5B 3GMLA 4ZUWA 1MHCB 3KJNA 4JPVL 3RWHA 3C60A 3MJ9L 3WE6B 5I18H 5EPMA 5A43C 2PW2A 4YNYA 3X3GL 1ND0B 5INCB 5HHPA 2NR6C 5C0AA 3OQ3B 3RWGB 5CP3A 4KI5D 2CRMA 4J3WA 2UYLB 2C1PA 4WTZA 5IFHH 4JM2B 1H15A 4I4WB 4BELD 4NZJA 4HXAH 1Q72L 2IPUG 4F8QA 4NRZA 5I71B 4PGJA 1AY1H 1PGRB 5DD3H 1WFOA 5IHZB 4F3FA 1P4LA 2FATL 2AXFA 3QDAA 3QQ4A 3RPIA 2ZSWA 2X4PB 4LAQL 2YC1B 3QCTH 1FYHB 5C0BE 3Q5YA 4JDTL 4JEGB 5K9QG 3OKMA 2MTPA 4M7JL 1U8LA 2UV3A 3CVIH 3F8UB 1CQYA 4KVNL 4L4TB 2CLRA 3GBMH 2NZ9D 3QFDB 4MA7L 5DO2D 1WBZA 1T7YA 3IXAB 4I0PD 1S9XA 3WIIH 2NXYC 5F7WC 3WFEL 1NMCB 4P99A 4YXKL 2ARJQ 4QY8A 1GYAA 1ZT4B 1P7KB 5KJRL 4PTTA 1KCLA 4M7LL 4PJDB 3FO9A 1PX3A 1SJEA 5EIIA 5KS9B 4JFED 2Y72A 1QSFA 1OP5H 2NXZD 4LMQE 3B3IB 3CLEL 1DQQB 3VI3E 1QSVA 3VGGA 4PG9B 4WV1B 4N5UA 3F6IA 3QCUH 4NNPH 2CDFB 2QSCL 4JO4L 4EIGB 1CXHA 5ABDE 4F33B 1BVKB 5KVGH 4BKLB 5C0CB 3QB7C 4DZ8A 5EORL 5GGRB 5JIPA 5DJ0A 4TOYL 3VGAB 1G6RA 1NFDF 4OLYL 4FZEL 3G5ZA 1ZLWK 3IU3B 1D9KD 4HGWB 1OGTA 4RRPA 5E6IB 2IPKB 1GGUA 1KXVC 1OAQL 3O11A 3RP1A 5DVLA 5JW4M 4LLMB 4N8VA 32C2B 1RZGB 4JJ8A 1HILB 4QUAA 4H5SB 1X3DA 4XAWH 3OGCA 5D1QC 2OQJB 5I1KL 4ZAKD 5LAXB 4LQFL 1INQA 3OKOA 5AZ2H 1RQ5A 5IB4B 4GRLA 4MJ4A 3KJ4B 3VD9A 4NQCA 1GC1H 3MFFA 1CICA 2D9CA 1DUYA 2YBRA 5AG8A 5C0BD 2DLEA 3F7RA 5T3XE 2LVEA 3WMSA 3QIUD 5IWLA 2JJUA 3AM8C 1ITCA 5C0EA 3IDYB 4BFIA 4U4BA 1JGUH 4UDTB 3NFPA 5JA8B 2BSRB 3TA3D 1QBBA 4P57B 4JFFE 2WINA 4UTAH 4EEEA 2ICEB 5E8EA 3ZE0E 2P5WE 3VXSB 1DQJB 4NQXB 4ZUVB 5BVPL 3P9LA 4H8WH 1KIRB 3WXWL 1OAKL 4PJCA 5F7EH 3PGFL 1J88A 1ORSA 4ODSH 5F9OL 5FUCC 3BKJL 1OVZA 3WKML 1FRGL 3D39E 1VFBA 4WWKA 4R9HA 3QXUA 4J6RL 1LO2H 3U9UB 4KTEL 3WO4C 2DQTH 1U8PB 1MHHB 5EC1B 3OMZA 2GSGA 4O58L 5IVOA 4FA8A 3BWAA 5DMGC 5LBSL 1WZ1H 1FZJB 4DKEH 1P69B 2P45B 1CFSA 1VENA 2YOCA 3OSKA 4UIKL 5HHNA 2DQDL 2XYHA 2XQBL 1F6FB 3DIFA 5DZNA 1I8IB 2VERN 4EI5D 3OXRA 3FT2B 3EFDL 3KPMA 4QU5A 1YDPA 4P59H 3O3BA 3F12A 2VZVA 1KB5H 1IEHA 4N0YL 3WEXB 1FDLH 3RVUC 5LU8A 2CDRA 5IB5A 4FQJH 1SBSH 2EIDA 1I1YA 1EMTL 1WC7B 5IF0B 5I8EB 5DJYA 3STZA 5CD5D 4JQZA 1MAJA 3BSZH 4Z18A 3UTSA 3VXUA 4EQ3A 5J3HC 4X8XA 2F8VA 3MGOA 2JKXA 3C8KA 2CIIB 4JPVH 1T6VN 3MJ9H 1A47A 2VISA 4LHUB 4DCPA 4GJTB 4QRQB 4YDLB 4WRLA 1VFOA 1RJLB 4Z9KB 5GGUA 3Q48A 2CNKA 5IB2A 3MRHA 1SYSB 2HFFB 3W9EA 2YEZB 2GITB 5T3XD 4CU8A 1XCQA 3PQYB 3QUKB 1Q72H 4I3RL 5L2KB 1XF3A 4L9LA 5E6YA 2N7BA 5J9PA 5F7NC 5IHLB 2J2ZA 1R0AL 1CP3A 1BQUA 1P9MC 4NC1E 5CP7B 3RUGB 5KSAD 4S2SB 3PWUA 3ARVA 2H8PB 4JFFD 3QG7L 4HLZH 1FJ1A 1NC2A 3HTLX 5LCVL 2P5WD 4XH2A 3ME0A 5I75C 5D1ZA 4LAQH 2MPAL 4HIXL 4PRHB 5ADOL 4DGYL 1JV5A 4M7JH 5L8KB 4HKJA 3HR5B 3UTTE 2HT2D 3U79A 5C7XH 3DRQA 4LLVA 2VABB 4QULA 5FEBA 2YPLB 2CUHA 5EU4A 5L88L 5HYEA 5CEZE 5BXFA 2V9RA 3D39D 3QXVA 4ZO6A 5GHWL 4YXHL 4MMXC 5IVZB 1B2WL 4PJAA 4YXKH 1I3RB 1E4WL 1U9KA 1TCMA 4PJ7E 3WBDA 3T1FA 4LDLB 1I85C 3LB6C 1W0WA 1JNHB 3E6HA 5IJVB 3FT4B 4HK0A 1RE1A 3QDGA 5DGRA 2GAZB 2G75A 3KYKL 1HK6A 2DWDA 4GUPB 4OGYH 5HDQL 4EQ2A 3VRIB 3FRUA 5ANMA 5AZEL 1R24B 1PG7X 4KHTH 4LNRB 3UYPA 3ARBD 4HUNB 5F7DB 4JO4H 1QA9B 5C07E 5H35B 3MUY1 3MA7B 4IIQA 4K3EL 1MAML 2QLBA 2P24A 5D96B 3T0DA 4TUOA 4GW1A 4ODVL 2DM3A 3X14B 4IS6B 4PJFB 5EORH 5CBAA 1FL5A 4G5ZL 4WU5A 1A3RH 2A6KA 3VFPA 2NW2B 4TOYH 1RK0B 2X4SB 4XTRD 4FZEH 5FK9B 3MJGX 3QUXC 5DMKA 4HC1A 3L5WB 4K2UL 2WIIB 1UWXH 3G5XB 3WHE1 4ACPA 3EOTL 1P7QB 4XI5D 4G8GA 5CSBA 3D25A 1OAQH 1V5JA 1PKOA 1V7ML 1DDHB 1S78D 4LCUB 4JN1L 3TBVA 3F65A 1UB6A 4HS3B 3CNKA 4NO0A 2E7LC 5C92A 5BRZB 3QA3A 5MEQA 3NKFA 1AD9A 3PDDA 2WSKA 3N1QC 5TGBB 1JZ2A 4HZLB 1FLTX 1D3CA 1RULL 3M1BB 1D5ZA 4UT7L 5I2IA 5E1HB 1D5XA 4ZFOB 1KXTB 3TO4C 3UTTD 3G04A 3BWUC 2VMFA 4Y4FC 2A77L 2C2MA 1QFOA 1QPPA 1CBVH 1N4XH 5CEZD 3I3BA 3DEIA 1XAUA 4PJHF 2AV1B 5DQJA 1C16B 4ZOBA 4MJIB 5D1XC 3VG9C 1OLZA 5AEAA 1ES0B 1BFTA 1FGNL 5TQ2L 5BVPH 4Z5RB 4CRPA 1VACB 1MJJB 3UBXG 3WXWH 1OAKH 1T21A 3PGFH 4QRPB 3SDCA 2GW5A 4PD4J 1I4OA 3BKJH 1V8HA 3IETB 3WKMH 4JFDB 4KVCL 2F53B 3L3DA 4HIIB 4J6RH 3HNSL 3ULUE 3CH1B 4KTEH 2EDNA 5IEHB 3VRJB 4ZPVA 4GKOA 2A6JA 5IAEA 5C07D 3Q1SL 5LBSH 5J12C 1REIA 4HJ0C 2ZSVB 4OAWB 2HG5A 4RSVA 4YHIA 3BE1H 2V7HA 1PZ5A 2DQDH 2JJTA 2XQBH 5E4EC 1KN4L 3VXNB 3GSVB 3EFDH 1RUQH 5CFHA 1TZHA 1FYTE 2OTWB 4NO2B 1RWKA 4N0YH 1CD1B 5DTFA 4ZFGL 4ORGA 2AJVH 2VITA 3BP6A 2NY6B 4MQ7A 3ZHDA 1EMTH 3ITNA 4HCRA 5IIEB 5D9SA 4OLXL 4L3AA 4TNWK 1P2CB 3EHBC 2X09A 3KPPA 2R1YA 2W0FA 2OJEB 4KDVA 1VEMA 1ADQH 1T20A 1FNLA 3HFML 5D5MA 3C5ZD 1X5XA 1YNTB 2M8XA 3BZ4B 2Z31C 3BYYA 4MA8L 3VI4E 5IW6A 1LE9A 4ZNEE 4J4PC 3QZWA 2VJXA 3HE7D 1R0AH 2WW8A 1GGYA 4YHNA 1A2YB 1ONQA 4UUJB 1ZAGA 4YBHA 1P1ZA 3ALPA 3OGOE 5LCVH 1VESA 2QR0B 1GPOL 3AB0B 3L7EA 2EYSA 4HIXH 1IZKA 3VWKD 1F6AB 4M6ML 1MCNA 4CUCA 4O2FB 1F00I 4P48A 1JYWA 3SQBA 3O2VL 3HAEA 1YA5A 3SKMB 5L88H 3UROR 5EUKA 4NCC1 5K59F 1KPVB 2P4AB 2V2XB 5GHWH 2UZIL 5F1KC 3FOLB 3MUJA 1IKFL 1C5DA 3ULUD 1B2WH 2YUZA 4Z78B 1DBBL 5DEFB 1E4WH 3NFSL 4XP6H 5ID1B 3HI1B 4UQ3A 4NKIL 4QRTB 4F2MB 1IM3A 3GSUB 2HVKA 2A2QT 2C2KA 3KPOB 4FMFA 2BP3A 3SDAA 3EBAA 4ODXA 5T1LB 3KYKH 3BGMB 3A6OA 5HDQH 1FZKB 4OUUA 1CDHA 5AZEH 1XIWC 3EOBB 2X4TA 1UCBL 4PJ8D 2VDNL 1FYTD 5HHVH 3U46B 5B8CB 5IGXL 1K3ZA 2CIKA 1I3GL 3HNVL 3GIZH 1MAMH 4AYFA 1LK3L 1EPFA 1GQFA 3MC0A 4NKOA 4ODVH 3BH8B 4JHBA 4WTZG 5CMAB 3QUZA 1KUMA 5ID0B 5KW9L 4G5ZH 5D72L 1IKNC 3IDNB 3I75A 1K5NA 5CGYC 3RZCB 3R7NA 1MVFA 3IDMB 4JO3H 1F4HA 5DHXB 2OK0L 4N7JA 3FCTA 4Z7QF 4K55A 4Y16D 4JKWA 3G6JF 3QFJA 5GRJH 2G2RA 2JELL 1TZIB 2K1MA 4MLSA 5C9JB 4GG8A 3RL1B 1BF8A 1V7MH 4JZNB 1FAKT 1BD2E 4M1CD 4JN1H 4L8SB 1T3FB 2R56L 1YYLL 1F4WL 3D2UB 1JUFA 3IRPX 2ENSA 3D48R 4PRNB 3L6FA 4QU8A 1C8PA 4ODBD 3BW9A 2B4CH 4WI8A 5ISZA 4M93B 1WZMA 1LK2B 1RULH 3HZYA 1KJMB 4PB9H 4UT7H 3NTCL 4FQQA 4Q6IB 2EDBA 1LEKA 4U1KB 3L3GB 3MNWB 2LFGA 2H26B 2BXZA 3QULA 4XP9L 1RJYB 4HS8L 2CKBA 1V3KA 3IRZA 3FB6A 3FQXA 4E0RA 1BJ1H 3C9NA 5HBBA 2WUBH 3VFGL 5IMOB 4XXCC 1T7WA 3MYJB 3G9VA 5MENB 3FN3A 1YPZE 1S7QA 5GGSY 3K2MC 5I19L 5TQ2H 5I30L 1PYWA 3K8MA 3ZLQC 1JZ4A 4WO4B 1MCRA 5E9DE 5DRZB 4U7SA 5J3HD 1AQDB 4PLKD 4QU9A 1NJ9B 1JBJA 4KVCH 3GO1L 3WUZA 2R0WL 4N0UB 3VMNA 3HNSH 4R4ND 1GRWA 2B7DT 4ZUUA 4XB8A 2DLIA 1C12B 4ODTL 4WUUA 3Q1SH 1SHLA 2ZUVA 5EN2A 2C2OA 4RRPG 4DN4L 1S9VA 4XNMB 4LSZA 2BVYA 5DVKA 1XH3A 2FLBT 3V5KB 1YY8A 4LHUG 2W65A 3WDJA 3O6FB 1T2JA 1NCCL 1KN4H 4RMWA 3WSQL 4TNVF 1YY9D 3FQUA 4CMHC 3TYGL 3JTTA 1DCLA 3RX8A 5GJTL 1AR1D 1TQCC 4JREC 2QLVB 4ZFGH 2W9EL 2R2CA 5GS0L 5FYLL 5IQ7L 3E8UL 5I17B 4XZUA 4JDZB 2IALA 4NQEA 2WBJD 3FB8B 4KJWD 3DTXA 5EFIB 1P4BH 1BD2D 2Q7YA 3NPSB 1FNEA 1OHQA 2YD7A 1KTLB 3HFMH 2F8XC 3F7YB 1RZ8A 3MPCA 1PG7L 3X3FH 2QADC 4FQXB 3OTTA 2H2PD 5HGDB 3S7GA 3DX7B 4MA8H 1RHQA 2BVPB 5DFWH 2ATKA 1HHIB 2V5TA 3GJEB 1IAKB 4KJYA 1XMWA 3MODL 4L8CB 3FB5A 2NY1D 5ICXB 4JM2F 2B5IC 5I1DA 3V8CA 5F9DC 3O41A 2LAAA 5IJKC 4YHZL 3RNQB 3DROA 2D0FA 1NUNB 1GPOH 1MHPH 4U1SB 4M6MH 4P46A 2ICWJ 4OT1L 3LKNB 4WHCA 2JK5A 3N9GL 2JIXD 3I02B 3O2VH 3KPSB 4JFOB 4U1HA 2GSIA 5E9DD 3T4AA 5LGHH 4M7ZC 3MGTB 4OFPA 3SJVB 3UJTL 4P23A 4JE4B 2A6DA 2AJSH 4CVXB 2UZIH 3QUXD 4PBXA 1IKFH 3ZYJA 4RFOH 1W72B 5FM5M 3BAEL 3L7FA 3NFSH 3QUMA 4KHXL 4PV9A 2ESVA 1KPUB 2EDQA 4KK8C 1NDMA 4L3CA 3CZFA 4NKIH 4IRJD 1A5FH 4KQ3L 5ACMA 1ZGLM 5JW4N 1Y6NR 35C8L 3TBYA 4PJEF 1M4KA 4PJDF 3N85L 3I2CL 4OCYL 3T4YB 3N1GC 1HN1A 2MFNA 4GKZA 1UCBH 2V5SA 2VDNH 3ARED 4OI9A 3ZYIA 1U42A 4W4OA 5IGXH 5DJAA 3D87B 3F7VA 1CXLA 1J0KA 3HNVH 5IHUH 5JW3L 1T2QL 4MD0A 4XXDA 4ZFFA 4PRPE 2CPCA 5I74B 4HUVA 1SC4A 4YGVB 1OTUC 4GRWE 5KW9H 4Z7UE 5D72H 2WK2A 4HCRL 4HIJB 3GB7B 1MUJA 4XCEB 5HGAB 1NMQA 3RDTA 3JV4B 1QHPA 2OK0H 3MBED 4PLOB 4GAFB 4GW5B 2F58L 3S4SA 5DUBB 4QXUL 1A14L 3U30B 1KTDB 3VXMB 3WJLA 2GK0A 4L8DB 1KYOK 4UV7H 1H3VA 5EU6A 3UAJD 1ZLSL 1N5YL 2AKRB 1U8OB 1HSBB 4R6UA 5T5FH 3B8SA 5IW1A 4U1IA 2ZG2A 2HMIC 2J1KA 5B3NA 4W70A 2VNCA 4LPTA 1FLRL 1R5VA 5BV7B 4HGKC 3RX5A 4G6AC 3MSPA 4YBLC 2D03H 3DEHA 3SE9L 1FNFA 2EKJA 3RJMA 4JCMA 1NGQH 4U6HB 3V6FA 5IP4A 2ERJB 2XIDA 4OZ4A 1NAMH 4XP9H 3L3HB 4HS8H 1JGLL 3CIQA 1P4IL 3QDME 5IAGA 2MWCA 3VWJD 1GIGH 3ET9F 1RZ7H 3OHXA 3SDXB 5C0GB 5SV4A 5A3IC 5ESQB 1HXMB 3MLTB 5I30H 4M1DL 3SCMD 1F42A 2DS4A 3IVKA 4HKXB 3SGJC 4PPTA 3KXFE 2VKWA 4JANA 4XRCB 2HRPL 2R0WH 3MV11 1AP2A 2X10A 3C08L 5DJ8A 2A73B 5D7JA 1DLHA 1M71B 4LCCC 2F5AL 1TVDA 1MH5A 5BO1L 3IFNH 4ODTH 3QIBD 3PL6D 4U31A 5EO9B 4Z95H 2QQLH 1CT8B 1DE4A 2XKUA 4PRPD 4DN4H 2PXYC 4I0PB 3WL9A 3ARFA 4LF3B 2FIKA 3TZVC 1NCCH 5DJZB 3IXTA 4NM4L 4P9HC 3TYGH 1HHHA 2AV7B 4ZMAT 2XNAB 5I1LB 3L5JA 3STBA 3BZFA 4PS4L 4ZYKB 4MA1B 5GS0H 5FYLH 1YQVL 5IQ7H 3E8UH 2D31B 1G7JA 2NXZB 3PWJB 1HQRB 5K9OA 1AGEB 1Y18B 1R3LA 4HLJA 3LDBC 1AKJD 4MNQE 1MCOL 1OL0A 1BJ1J 1OAXH 3TJHD 1WLHA 3JV6B 3U4EB 1SMOA 1HH6A 1JYNA 4NQVB 4W6YB 3ZKND 1IEBB 2MKLC 4IRZH 3BO8B 2MNUA 4X7TA 2PTVA 1PG7H 2E9BA 4YDVB 3RWJB 2GK2A 1ZA3A 4J3TA 3QPQD 4Y5VC 4IYRA 2Y4SA 1J5OL 3PWPB 3MR9A 2OR8A 4BZ2H 1FVDB 3MV7E 5HPMB 3Q3GA 4L8BA 4XWOD 3MRKA 3C6SB 3U0PA 5MEPA 4YQXL 1D9KB 3CX2A 4AW9A 1KJ2L 4YDJA 2DBJA 4RMSA 3QDMD 2D2OA 3NZ8B 1UVQA 4WDIA 4YHZH 1S9WB 3MXVL 2IAMD 3BN9C 2D4FA 3BVNA 5AUMA 1G9EA 1HNFA 4YFLF 3FOMB 3K4ZA 5H94A 4OT1H 3N9GH 1BBDL 4GH7B 4DUXA 1I7ZB 3KXFD 4YEFA 3LS5L 1FPTH 4J1UB 3HI6L 5LVEA 4GAYA 1Q9LA 2X70A 3GNML 2OL3A 1GSMA 1H3UA 2J5LC 3HRZB 1K8DA 5C0BB 3KNBB 4KHXH 3BP4B 3G08B 4JRYE 1QTYT 2D7NA 3RWGA 4U3CA 4Y19A 2LU4A 1RWWA 4LLUB 4KQ3H 1ETZB 4OCMC 1SVCP 4PJCF 2BVQA 4P5TD 3OB0H 3TA3B 5IESL 4P4RB 35C8H 5HHME 4GFTB 3N85H 1EHLL 2OR7A 1RK1A 4JPKL 1GXEA 2W0LA 3ZE2F 4P5MB 1X9QA 3I2CH 4OCYH 2XTLA 3B83A 2E9WA 4GXUN 5IBLC 4PJBB 4PRAA 1T1XA 1WAAF 1T2QH 5JW3H 1T1ZB 1SEQL 1A1OA 2GJZB 4MNQD 1T4KB 3RKDC 1WCQA 1AC6A 5AAWA 3REVA 1A9BA 3QZWG 3CAFA 4YK4B 4EN3B 4GRMB 3CFEA 4WIQA 2NY3C 1GVIA 4LDEB 5KZCD 3OAZH 4PJFF 1IJ9A 2I25N 3EOYG 3PXJA 2VIRA 4IRSC 1IC1A 3ZSSA 4QXUH 1JZ3A 1A14H 1J0IA 4EI5B 3MV7D 5EO1A 1RUML 3FFDA 2EH7L 4LEOA 2JB6A 1MFCH 2IC2A 5FA4B 1N5YH 5HDBF 2D4DA 2NY0D 3HAEG 3L3IB 1FSKB 1X6LA 2FYYB 3T08A 1I1AD 8FABB 2PTTA 1XR8B 2IBZX 1FLRH 5HHOE 4FN0A 4Z7VA 2E6QA 3V5DA 5D7IB 5SWZA 3WDHA 4U1GB 2RB8A 3QT2A 4EUPB 1RFDL 2BOBB 3SE9H 1YEKL 5H37G 5CEYA 1JGLH 1B0RA 5JOFA 3GMOB 4NQDE 1KJVB 2OM5A 3QNWA 2A74A 4JRYD 4M1DH 3P0YL 3BQUB 3QUML 5KSAB 4XB7A 4P2RE 1I1FB 4D0DB 1NGXA 5HHMD 1N2RB 2P5WB 1OM3H 1N8ZA 4PJAF 2NY7L 5TDOA 2F5AH 4QTHA 4GMTL 4LIQL 5EUOE 1F3DH 4QF1B 5BO1H 3UBXI 3MLPA 1T66C 1M6OA 2QADD 4NFBA 4DOHE 4HBCL 3GHBL 1CDYA 3EO9H 4OD2A 1MJ7L 3D39B 4HIEB 4G6JL 3VMPA 3W11C 2DQEL 5ITBL 3GSNL 3KDMB 4K7PX 3PP3K 4DW2L 1MLCA 3P4UA 3U0WL 2O5XH 4NM4H 3VE0B 4B53A 5JDJA 4XNUL 4U1MA 1JNLL 3QO0A 2FL5B 2HLAB 4U6YB 5JPMB 4K7FB 1UC6A 4PS4H 1YJDL 5FYKE 1U8QA 1X44A 3X13A 4KPHL 3SPVA 5FDWB 5E8PB 1YQVH 4GBXA 5A1AA 3LKSB 2R0KL 1NCAH 2MHAA 3QWOA 4NQXA 3FTGA 1MCOH 3CSPA 3F7QA 2DTML 1IC5L 4NZTL 5E2VL 1MI5A 2QJDA 2I9TA 3GSRB 1ROWA 5I76B 1G7QA 1OW0C 5J6GB 5CUSL 2WWMD 4KDTC 4EBQL 4ZFZA 5GGSA 5HHOD 4KK8D 1AXSA 1A7OL 4DQOL 5BZDB 4JO2H 5DDHB 4OF5A 3DUUA 4PGBA 3CVHH 2C3VA 5EIQA 4BUGA 4TSCL 4WW2C 2E7MA 5E08H 4YQXH 5HGBB 2Q3AA 1KJ2H 1WISA 5E8OA 2UWEA 4NQDD 3T2PA 2HFTA 1UH2A 1NBQA 3MXVH 7CGTA 4HWNA 4H20H 3RNKA 4JY6A 1UA6L 3V4VL 1EZVY 2HRLA 4PRDB 2HJFA 3CLFH 1UWGH 4G6MH 1BBDH 2PNDA 4P2RD 2VOTA 3V52L 4R2GC 1CI5A 5FHAL 4YWGL 1PAUA 1KELL 1PQZB 4O4YL 4C56A 2Y7QB 3GNMH 3UPRB 1DN0A 2BSTB 4JZJB 3SIRA 4OTXL 5K20A 4X8JA 1GC1C 1I7UB 1W8OA 1BVZA 2XPGA 4XP1L 4QRQA 4ZUSA 4ODWA 3UTTB 4M61B 4K71B 4AT6B 3ULVL 1JGVH 4Z6AT 1X4ZA 4CVUA 3L3KA 4JG1H 1NPUA 4AH2A 2V17L 5I8CB 3RVXC 4JPKH 4KKAD 5J4MA 4XPBL 2X4UB 1NFDE 1I8KB 3EDFA 4NRXA 4QCIB 1PG7W 1TCRA 5FYKD 3U36B 4H8WC 3O4LE 1UG9A 5E2TH 5LWYH 3QG6B 2EECA 3SGDI 3C5JB 3VDCA 5CSGA 2R1WB 3OJ2C 4U3XA 4NSKB 1B4RA 4JLRA 2VXQL 5C07B 2AXJA 2X4RA 5DRWA 3UTQB 5JXED 1AD0B 5DMJB 4Z8FH 3EYSL 1FIGH 2YXMA 3NIFF 1YNLL 1RUMH 4Q6YA 2ZCHL 3AM8A 3S34L 3MX0A 3GEWB 4U1LB 5D2NC 3O6ML 3IJYA 3EJZC 3VFWB 4RAVA 1I1CA 4OF0A 4QXWA 4CDGC 2XG4A 2Z4QA 2VLJA 1KEGH 2YD4A 1OB1B 5EZLB 3LSOB 1JF1A 1RFDH 3LKPB 3SDDC 4FQLL 1SJHA 4LSPL 5DJ6A 4YHYB 2EC9U 3GJFK 2DM2A 1S7TA 3RVWC 3U83A 4M03A 2F19L 3C5ZB 4BFBD 4MZ3A 4OQTL 1RK0A 4S1RL 4IOFD 1XF2B 1RWPA 2FZ3B 1K88A 3ESVF 2ZUYA 2OL3L 4PJ9D 4NJAL 2EKSA 3V7MA 2VDOL 3HE7B 3P0YH 4JVPA 4WNQA 3P0GB 1QVOA 1XGTA 5ITFB 2UZYB 3QUMH 3VFNA 4Q0XL 2OSLB 4NBZB 4FMKA 4HUKB 2WZPD 4RAUA 1E27A 3CFKB 4LCUA 3MV8E 5DS8A 4HS3A 3CMOL 4K3DL 3AS3A 3VWKB 4GMTH 4LIQH 4OV6F 5IVNA 4XHJD 3BIAX 4L3EE 1QLFB 3NGBB 1FVEB 4AEEA 4HBCH 4CKVX 2Q6WB 5HI5C 2Q86A 3O4LD 4YHPA 1RIHL 1MJ7H 1TTUA 4G6JH 3X12A 4FXOA 1JGEB 2EO9A 3O4OC 1HKLH 3S4SG 2Z35A 2F54E 5ITBH 3KLAA 3O2WL 3GSNH 5GISL 1MFNA 2Z92A 2HBRA 5HYJA 4DW2H 2LQRA 4XNUH 5CWSA 2FECI 1JNLH 3PDGA 4KKNA 1SVZA 4JKKA 3ZYOA 2FRGP 3R6LA 2OTUA 4UV4L 1YJDH 3S3JA 4KPHH 1FO0A 2QEJA 2YZ1A 2YZ8A 3DMMD 2Y5EA 1ES0A 4M5YL 5BOPA 4YGAB 5D1QB 2SEBA 1J0ZA 1JZ5A 2DTMH 5DEGB 1IC5H 4NZTH 2FBJL 4QRPA 5E2VH 3P4MB 4PJ8B 1FYTB 3ZTJH 1DFBL 1P9MA 4OV5B 1QG3A 4XC1H 1WWWX 3OKDA 5CUSH 4DZBA 4EBQH 4G8FB 3D9AL 1A7OH 1ZHLA 4UOW1 4DQOH 3BHBA 1A6UL 5FF6A 3DGGA 1AR2A 4YFLI 5HI3C 1DQML 4EVNA 5F1NB 1KFAL 5EU5A 1BQHB 3LRHA 1NCNA 2DM4A 5HVHC 4KJQD 1JMZA 4Y16B 2OX5A 3H9SE 3U4BL 5BVJA 3B43A 3D6GA 5CZXD 3CMGA 4JZOB 4AK1A 3KPQA 4CVZA 5E00A 1BP3B 3ELAT 1JJUA 3OG6B 1OWWA 4QRSB 3MLUH 3RWFA 5C0ND 4S0TD 3GKZA 1IT9L 1G6VK 1I85A 5C09E 2H32A 4JFPA 2CKNA 3V52H 3EDKA 5JIHA 4W68A 3O9WA 1EEZB 4YWGH 1KELH 4XNZC 2FD6L 1UWEL 3BP7A 4O4YH 1A6PA 1H8SA 5DA4A 3MV8D 1Y6MR 3K81A 5A2JH 2WBWB 5HXMA 5ELIA 1V3LA 3ILPB 4YDKH 4LVHC 4LU5L 4PJXE 4XP1H 2E9JA 4L3ED 4KMTL 2W0PA 4Y1AA 2PKDA 2GFBB 2IANE 2AEIT 5C08B 3L3JB 4R0LC 3ULVH 2APFA 2HWZH 3M17A 3NVQA 4N0FB 3C6LC 5TQ0H 3SIPA 3VXRE 3BIKB 1KIQB 2V17H 3MNZB 4QWWD 2F54D 4BSVB 5IVXA 4GKNB 3BEVB 1EEYA 4G42B 1ZLUK 1T04B 4QT5B 2X5PA 3OKKA 2DQUL 1OTSC 2DF3A 3OWEA 2GJ6E 1UJ3C 2VWEE 1QUNA 4FFYL 5CSZB 2E6PA 5EZIL 2YRZA 3QWRD 2DJSA 1F6AA 3WNMA 2D3VA 3IBCA 5EOQL 2Q76A 4DFIA 3QJFA 2WLYA 4HKZA 4H1LH 4W6WB 4LQ1A 2PETA 4H26A 2VH5H 4NUJB 4ZXBC 2E7LA 3ZO0A 2VXQH 4KXZH 4PREB 3QHZL 1KJ3H 3IJSA 3BISA 1MWAA 1T22B 3DBXA 1WTGT 4XMPL 1K4CA 2DI7A 2QL5A 3EYSH 4ZPTB 4WTXA 3BRFA 4JM4L 4ZS6D 1MEXL 1YNLH 15C8H 1M05A 4R7NA 4WHTB 2ZCHH 4NBYB 3TO4A 4NPYB 1ZT1A 2J7LA 3S34H 5BJTA 4JGMA 3O6MH 4Y4FA 4NN7C 2J32A 2HJLA 5DJXB 3MV9E 1DTUA 3H9SD 1A4KA 2HYMA 4PJHE 3DXAA 1UZ6F 4BFGA 4ISVA 2XWJB 3P11H 2WBJB 3QI9D 3GSQA 4OLZL 5ERWB 1BD2B 1KT2B 5D93B 1CLZH 5L2JA 5ALBH 4POZD 4FQLH 4LSPH 5C09D 3ZDXF 5IFJB 1RD6A 1YNKL 3PHQB 4IMLB 4M6NL 3OR7A 4I18B 4X4ZA 3UZEA 4EJ1C 4N5DA 4HV8A 2F19H 3MOAL 2ZNWA 3IFLL 4OQTH 2P8MB 2AW2A 5E94B 3MLSL 1IBGL 4S1RH 4TVPL 1A9EB 2HN7B 2R2BA 1G7HA 1KACB 1PLGL 1H5BC 5GIRB 3VGFA 4NJAH 3WFZA 4I3SH 4XPAL 5HHQB 5IV2B 2NY1B 2IAND 1TZIA 4QLRA 2YS4A 1QSEA 3GHEL 3V6OE 2Z8WC 3V6ZB 4MCYB 3RL1A 3VXRD 1QFWI 2YMXH 4QHMB 1IEAA 1I3VA 2OJZL 3RVVC 3NR2A 3IYLW 3CXHK 1MVUA 3CMOH 4X7SH 2YK1L 4K3DH 2EYRB 1YPZB 3TNNA 1N6QL 2R1XB 1ZWIB 4PRNA 1E6JL 4Y7MA 5DURD 5IARA 4QUGA 3L95A 5E9DB 2JIXB 4I48B 2GJ6D 3KGRA 3BESR 3CX5J 4RBPH 1FCGA 2PYFB 4MX7A 3ARGC 1RIHH 3AAZB 3OPZL 4KAQL 4NCC2 3QUXB 2IMNA 1CS6A 4G43B 4U1KA 3CJJA 3O2WH 5GISH 4HQRA 3TNMB 4KC3B 1KG0B 2MCPH 1BF2A 1QSZA 5AD0B 1ZK9A 2EXWD 2YPKA 4HH9A 4IRJB 4GW4B 2CRZA 1M7IB 3J8F7 4UV4H 1AGDA 1YUHB 1NCBL 2I60L 5C0JA 4MYWB 2O26U 4E41A 4NWUL 3GSXB 3MYJA 4M5YH 2P1YA 2GIYA 3S9DB 3GI8L 5CIPA 3W9DA 12E8L 2Z31A 4KGLA 3THML 4WO4A 3MQIA 4J4PA 3CFBA 3DYMA 4XPHL 3V79C 3C8HA 5J6HA 2FBJH 3OX8B 4HDIB 3AREB 1EVTC 2XXMB 5L7XH 1JHTB 1DFBH 2CJYA 2R69L 4LVOC 4G9DB 1HDMA 2GTWA 5KVDL 5DR5L 3MV9D 5HGGS 4J3OC 2K9UA 3NCJL 4KK5C 4HXBL 3TFKC 2I07A 1KSRA 3GK8L 4EHHA 4OI7A 1DQMH 3D0LA 4LLQA 4JFXB 1KFAH 3WIFB 1ZKAA 2H4YA 4X5XA 2I9LA 4ZVQA 3VG9B 5DF0A 3O8XD 5D7LB 1ZS8B 3V5KA 1R5WB 2KL6A 1J8HE 5DWUL 3MBEB 4MLIA 4KJPC 3C60C 3GMPB 3U4BH 4XCYB 2ZCLL 2PUQT 2DYPA 5E5MB 1EO8L 4LP4A 3QIWA 1RHHA 3EIFA 1X4YA 2EXYD 4PRBA 1IT9H 2DI9A 3S6CA 2ZOKA 2DQFB 4FFZH 3SGDH 3RKPA 1U8NB 4JGJA 3F7PC 3O45A 1UWEH 3HMWL 2XN9E 4LCWE 1L0YA 1WCBA 1FC2D 4G8EA 4YO0B 2B4CC 1INEL 1UFUA 2DQGL 3DUHA 4QRRA 4DEPC 1R3JB 2ADJA 3L3OA 4LU5H 1XIWA 4OGAC 3H9HB 1RU9L 4KMTH 4A6YA 5IEKA 5IBTL 2FJHB 4UQ2A 5B21A 5EH1A 1OP5K 1HHIA 1A6AA 2DM7A 5J56B 4ZFOL 1IKNA 4R96B 4F7EA 3MACL 1GGCL 3SCMB 2DQUH 5GS1B 2BVOA 4JAMB 4EDWL 1IMHC 2F5BL 3BPOB 1E4XL 1NEUA 3CFJA 3RNQA 4Z7QE 1WICA 4FFYH 5ACZB 1D5IH 3G6JE 3VFRB 4ZUTA 5EZIH 4UIMB 1BZQK 1FO0L 3Q5TA 3A0OA 5IR1A 1CR9H 4PJBF 5EOQH 3RVWD 1R3HA 4ZVPA 3TC9A 4QHLA 2Y07L 3IKKA 1GZQA 3QIBB 3D3VD 3PL6B 4XT1C 2Z91A 1VADB 1EO7A 4OI8A 3QHZH 4YH6A 2GTZB 5FKPA 1JWMB 1FC1A 3LPGA 4PRIE 3QR2A 2HTKD 1SJXA 3D85A 5DT1L 1JPGA 4H88L 4JM4H 1WUNT 4XPFL 1Z9OA 4JFYB 4GRWB 1MEXH 2MQ3A 5EO0B 5I73B 4O2CA 3MLZL 4H0GA 1I9IH 4JVUA 1BREA 4C4KT 3QH3A 1HHKA 4U0RB 1PKQB 1J8HD 1YMME 3B9KD 4KRPD 5DI8B 2MOVA 4K7PH 4WGVB 2DJUA 1NEZA 1A7QL 1BLNA 3I6GA 1AKJB 4ZSOA 2HH0L 1DLFL 4LLDB 5C2UB 1CD0A 1S7RB 3K3QA 3PABA 2VDPL 1C5BH 1CFNB 1YNKH 4YIQA 5D7IF 2BY0A 1MCQA 2R2EA 2XN9D 4LCWD 2P5EA 3WKNA 3IFLH 1AGCA 3F58L 4KRNA 3NBNA 4FQHA 4I0CC 1VGEL 4CNIA 2R0LL 1IBGH 4LRIA 4HHAB 2NY5L 3VFMA 1NSNH 2R23B 4QTIL 3EZJB 1G7LA 4XPAH 1CICC 2LVCA 2ED9A 3H7BB 4GAGH 1EH9A 1S9YA 3LPWA 3GHEH 3PDOA 2X4QA 1I7RB 1T0NB 3VXMA 1T80A 3QDMB 4JCLA 4PGEB 5IW3A 2XRAL 1HHGB 1S7VB 3U7WL 2IAMB 2YK1H 3QEHA 4C4KO 3MUHL 1WQVT 2QTEA 4JB9L 1N6QH 4PYGA 5F6IB 3B6SB 3RTQD 3F62A 3T2OA 2DWEB 3OV6A 3HE6C 4QOKA 2BNQE 1Z3GH 2V2WB 1CGWA 1CLYL 4JJEA 1G0DA 2EC8A 4HX1B 4V1DE 3OPZH 4C57C 3MREB 4P2OD 5I1HL 2H9GA 1S7WB 5I1IH 1CK0L 4MSWA 1MCLA 1SJVA 1UH3A 4PRID 3C09B 1K2DB 5FKAB 4P5TB 3SDXA 1RZFL 2FH6A 2PN5A 2QSTA 1FFNA 4KK6D 2NLJB 4ENEC 1BQHG 4HAGA 2C1OB 1QP1A 4OQ1A 5FO8A 4OZFA 4XPHH 5E5RB 2FR4B 3CUPB 4O02H 4XGZA 3DRTB 2YA0A 4Y4HD 4Y4KD 2V5YA 3PXHA 1I3UA 2VAJA 1YMMD 3DYOA 4D0CA 3HUJB 1LGVA 5KVDH 4Y2DD 1C7TA 1CGYA 4TPRL 5IJKA 2CH8A 5EU3B 3NCJH 4OJFL 1UXSB 4FDLA 2E5EA 4MNQB 1ZLVH 3AU1A 3GK8H 4TNWF 4KROD 5FECA 3HS0A 4GS7C 4FHBD 1OQXA 5ECJE 4HS6A 1S7XA 5KZCB 3EJYD 1HE7A 1ZXQA 2QKIB 3I9GL 2N1KA 5DWUH 3BPCB 4TQEL 1LO5B 3N1PC 3NCEB 4ZDHB 3TBWA 5BS0E 3W2DL 2R8SL 2GJJA 2J88L 2ZCLH 4L4TE 1MCCA 3RL2A 4APQD 3KYAA 4LPXA 1EO8H 3VXTB 1FVCB 2XNAA 3PV6B 3PIQB 3MRCA 3MV7B 4NBXB 3SHSA 1CG9A 2PW1B 2J4WL 4JFEA 4KY1L 3I6KA 4UT9L 5FUOL 1OD7A 1IQDB 4LHQB 2NY0B 3GJFA 3KG5A 4L4VB 3OR6B 4UAOB 2XYCA 1I1AB 1HXYB 3OXSB 4PJDE 4PJEE 1HWHB 4NC0B 3LKOA 4BH8A 4D3XA 5F6HJ 5KOMC 2ITCA 3WO3B 1INEH 5JPNB 1E28B 2DQGH 3KPLB 3UJIL 3VW3L 4YAQA 2JTDA 4CADA 1YEFL 3BO8A 4B0MM 2MQCA 1RU9H 2N4IA 1NC4D 4QEGA 3MROA 3B2UD 5IBTH 4BZ1L 1OSZB 5D1ZC 4WEMB 1K8IB 4YDVA 2BNQD 1NCUA 1HYSC 4S1DD 4P3DA 4CMHB 1FVDA 4V1DD 3DVGB 2A1WL 4F7CA 4MDJB 3OZ9H 3VXOA 4BUHA 3E3QC 2ZUXA 1IM9D 4WEUD 1S5HB 5FCUL 1F45A 4G9FE 3MACH 1A8JH 1GGCH 1U93B 1ZV5A 3LAFA 3NZ8A 4OBSA 4NNYA 5HI4C 4EDWH 1CDIA 1EEUA 1JI2A 2F5BH 1E4XH 4ZQKB 3QHFL 3G5YA 1PSKL 2P7TB 5HHMB 2APBA 2VC2L 2O5ZH 4X0KB 2O61A 2WDPA 4WW1A 1T5XB 4ZAKA 2Y07H 5JHDA 1YMHB 2VXTL 3DVFA 2QADB 3HC0A 1U3HC 3KPTA 5I1CL 3MRJA 4N5ED 1FZOB 4OIBA 1EDQA 5DT1H 4DGVL 5C0BA 1WIPA 3QIUA 4H88H 5MEOB 1NANI 2ID5A 3MBXL 4XPFH 2HVJB 2NTFA 3MLZH 1JMXA 3ZHKA 1AIFB 3K2UL 5FGRA 5JW5B 1W0VB 4P4RA 3S36X 4M48L 2KUTA 1K86A 4P5MA 5BS0D 5GS0C 4ONOA 4L4TD 4JR0A 1A7QH 3IDIA 2CO7B 1K9TA 1BECA 1S9KC 1IC7L 4M7ZB 2HH0H 1AJ7H 3GIVA 1DLFH 4K3JL 4RNRB 3SO3C 4OCXL 5AYQA 3O81A 4HW6A 3PHSA 2FB4L 3UZQA 1BBJB 3WFCL 3TYFB 4I77H 5IMKB 3SGJA 5J11B 3VXSE 3QO1A 2UWEF 2H32H 4D2NA 5HHOB 3F58H 1VGEH 3IAQA 4LCCA 4KWUA 1HSAB 4XNXL 1U95B 1NUFA 5TDNB 3ZSTA 3Q2CA 5IKCB 4FQIL 1CL7I 1LNUA 3QXAB 2ENYA 4YFEA 4NQDB 4J3VA 3A67L 4X4YA 2XRAH 4HFWA 2C3WA 3TV3L 3U7WH 4P5KA 3Q0HA 3TZVA 5KG9A 4N9GB 3T8XB 4CMMA 3ARQA 4G9FD 2WWKT 3IT8D 2VL5B 4JB9H 4KK5D 5EU7E 3BEWB 4EZMA 3ZKXC 2FX9L 1DJSA 5KTEH 3HLAB 4P2RB 3WN5B 3KYOB 3QUYC 4HG4J 2G5BB 1QHOA 4MQXC 2X4NB 2P47B 4EUPA 4MWFB 1JNJA 5I1HH 4ODUB 2PF6A 1F3RB 5EUOB 4LKCB 1CK0H 3FO2B 3FRPA 4DOHB 3U6RB 2BSSA 1RWOA 1F5WA 5F3BB 1WBYA 2PO6C 3EOAA 3GM0A 2AJXL 3MRDA 4LBEA 3WNNA 1RWMA 5KSVB 4Y5VA 1Z9SA 1X5JA 5DD0H 1W72L 1XCTB 4J8RA 5DD1L 1D6EB 1I1FA 4Y5YB 2JJTC 5CGMA 4JFFA 5LKNA 4TPRH 1M7DA 5DHVA 3RJDA 4IEFB 3PJSB 3WUWG 4M3JA 4N6OA 4OJFH 2B1AL 4X6CA 1VKXA 1LEIB 2AVGA 1A7RL 2AJ3A 2WWKO 1Q9OA 4B7IA 3TN0C 1S3KH 2VQ1B 4XAKE 3V6MA 3VXSD 4DN3L 3M07A 2BXYA 4PRHE 2IH3B 4DCJA 4HVAA 1M72A 5FM8A 2R8SH 3W2DH 1IAII 2J88H 3VMOA 1OARL 2D7TL 2XFXA 2YPLE 2HLAA 3PNWA 2VRAA 2EE3A 2J4WH 4KK9C 1J11A 4UT9H 5FUOH 3BUYA 3CFDB 1JXQA 3RVTD 2VLRA 4P4KC 4PJCE 4IHOA 5T3ZH 1LEGA 1N64L 3DURA 1TNNA 4U05A 2XA8L 3LS4H 5A40E 4XC3L 3ROLA 1U92A 1QPXA 4NQSA 3ZE2E 3ARBA 3GSWB 3LV3B 3UJIH 3VW3H 43C9A 1FFOB 1VA9A 1BOGA 1YEFH 5F96H 3NCFB 4OF3A 1MRDH 1WAAE 4BZ1H 3D5OF 5F7HA 1RUAL 4QHKJ 4KKLC 1FG2A 4OD1L 4PY8J 2A1WH 4NT6A 1RWNA 5GSRA 3MO1A 3V4OA 3RGVC 4L29B 3GSOA 5HD8C 3FQNA 5FCUH 4PJ9B 5HGBA 4JJ5B 3S35X 1RHMA 5MERA 4KU1A 3FT3A 1TVHA 3LDBB 2HKFL 1A1MB 1GL4B 2Y6SD 3F5WA 1KTRL 1K3IA 3QHFH 5CEXB 3KYNA 2EO1A 1PSKH 4NO5B 2H65A 4IRSA 4LHUD 3B5GA 3UTSE 4X80L 4XPTH 5MP6L 3EYOA 4F7PA 3H13A 4R4BA 1NFDB 2YKLL 1KN2L 5ILTH 1ZHBB 3BKCL 4LP5A 4DK3A 5AWNH 1XR9A 1DVFC 5I1CH 4JQIL 4GRLD 1U58B 3U4AA 1UM6H 3K46A 3O4LB 4NQCD 4DGVH 4GOSA 1ED3B 1KC5L 1IVLA 1KCRL 4X99B 3MBXH 4JR2A 1U91A 2VLLB 5DK2B 1UM5L 1FNAA 4FXGA 2FLRT 3K2UH 5C8JB 4XAKD 4U2ZA 3QUZC 4M48H 1S5IL 4B5EA 1MPAL 1JGDA 5IB1B 3DMMB 1CQKA 1KLGA 2XWTA 3R06A 1XGPA 1BQSA 5GRVL 3IGAB 3DV6A 4PJ7A 2WP3T 5L9DL 3V4LA 1LE5A 1FFPB 3CCHB 2YPLD 1IC7H 3FONB 1T1YA 4K3JH 1U8MA 4OCXH 1YEJL 2FB4H 3WFCH 3ZT6A 2YUWA 5DD6A 1EXUA 3H11B 1BWWA 5SX5H 4WWKD 1I7TB 3C5SA 4HF5L 3MFGB 4PJAE 4YEEA 4JY5L 4MS8D 4DKFL 3S88L 1NCTA 1LD9B 4XNXH 4Y5XB 4ZTOL 4WUKL 3JV5A 4JFDE 2CDGB 1ORQA 4ENED 4NZDA 2C3GA 1BFVH 4FQ2H 3BGFC 5CCKL 4LNVA 3QDGE 2PYEA 3A67H 3P4NA 3TV3H 4X4MA 1AGFB 3S3PA 3MJ8B 5HVGB 5ANME 3MUGB 3KJ6L 1Z2KA 2HLFC 2G60L 4JN2A 1ZVYA 4XBGA 3BFOA 2DICA 4E9LA 1IRAY 3NA4A 1YPZF 4CJ1A 2WP3O 1T1WB 5JZ7D 2NY3B 2BHUA 2K7QA 3MV8B 3D0VA 3UTSD 5GZNC 2C2ZA 5DHYA 5IVXF 4X7FC 3ZT5A 5BZWB 4L3EB 3VFTB 1UENA 1IAIL 3P9MB 1IGYA 2DLFL 1J8KA 1EA9C 1OW0A 4HUXA 1QQDB 3NN8B 3KS0J 4KDTA 3PHOB 4RGMC 4QTYA 2AJXH 4MXVF 4NO3B 2F54B 4ODHH 3UC0H 3AUVA 1W72H 1DEEA 4PGCB 5DD1H 2NMSA 3EDDA 4UU9A 3ZDZF 3PD0A 3NA9L 5DYOB 5LJYH 4X9BA 4WW2A 1N3NB 1T7VA 2XTJC 3MYZA 1CF8L 5EBLA 3AFLA 4KQ4L 1IGFH 4RMQA 1NC2D 3QYCA 2B1AH 5TDPA 3QRGL 2K7PA 1T5WA 1A7RH 3CGTA 1YZZA 2EDYA 5T1KA 1CGXA 4PUBL 3CDGA 3IS0X 3GMMB 5FB8A 4DN3H 3I50H 4YPGA 4RFEB 1V05A 2CNLA 3QXDA 3LN4B 3TWCL 3FQRA 1OARH 2D7TH 4ZVUA 2OI9B 2CLVA 4Z77B 3TLRA 1QDUA 4JFDD 1L6XA 3PP4L 2R9HD 4M3KB 2QL9A 3EO1B 3IDXL 5ETUB 2FO1A 1J05A 3DWTA 3IJHA 1H3GA 3PWVA 1S7UB 2FO4A 2Q8AL 5F9JB 1VGKB 3WLWD 3QDGD 5DQ9B 3STLB 3H9SB 3UP1A 5B4MC 5FOBB 2XA8H 4XC3H 4JFQA 5BQ7A 4Z76B 3QI9B 4O2EA 3R7BA 2PR4H 1MQKL 1F02I 1WFUA 4X9FA 4OZGA 2AXGA 5C09B 4NNXB 4DTGL 1XGRB 3LRSA 4P46C 4DGIL 2Q8BL 5BV7H 4OD1H 3WFHB 1PYOA 1BZ9B 5HSFA 2BC4A 4OZFG 4WFGE 1A6ZA 4PJXB 5DUPL 4AIZB 3BYTA 1BVLA 3T0XA 2ADIB 2IANB 3H2WA 4FXKA 1HNGA 3AXLB 3MNVA 4OZIA 2O93L 5CKAA 3FN0L 4F7TA 5A16B 5DRXA 2ZUQC 2YN5A 4FQ1L 4ZNEA 2LTQC 4ZVRA 3NIFE 4MZ2A 1F1JA 4I5BB 5T3XL 5EBWA 2HT3C 4X80H 4ZNCD 5MP6H 1X5FA 3WYRA 3T77B 1EGJH 5T3ZE 2YKLH 4NO0D 3SE8H 3DX8A 1MHEA 2VDMH 3BKCH 5D2NA 4CU6A 5DURB 3SKOB 2J6EL 2GJ6B 4JQIH 2A6IB 3QRFM 4GG6A 1H3PL 1KB5A 5HY9B 1CFTB 2BNUA 3MJ7B 5ICZA 1IGJA 3ROOB 2IQAB 3HR6A 5IUSA 1KCRH 1J1OL 2VXUL 1B0GB 1R3KB 1UM5H 2VR5A 5CBEA 2JJWA 3SDDA 2V7NA 1M1SA 4P9ML 4AG4L 1A7BA 1NGZA 2Y1VA 3TBSB 1S5IH 1KIQA 2FEDC 3MJ9A 4HMEA 1MPAH 2ZOLA 5EZOL 1YJDC 3HPLA 3X11A 1T04A 3LQMA 1D7FA 1WT5C 5L9DH 4R7DB 5FUZL 1WVZA 4QHNA 1FL6B 3EYFA 3JWOL 4HUWA 5AAMA 1QEWB 1HCVA 1YEJH 3PGDA 3SDCD 3MV9B 3P9WB 2XYGA 4N0CD 5MENE 1A7PL 1UQSA 3KWWA 5IOPB 1VFMA 4PJHB 5KOVC 4HF5H 4HWBL 4NUJA 4YBQC 1BM3L 4JY5H 4QGTA 2W60B 5CHNA 4DKFH 3M45A 4ZTOH 3MRIA 2RHEA 4MAYC 2CJUL 1JWSB 4NYLA 4ZG1A 4ZTPH 5INDB 3O8XB 5T1MA 1FNHA 1QLRB 2BNRB 1LO4L 1LILA 3T3ME 3I85A 3OJDB 5GRXG 1BQLL 2M26A 3EO0B 4WFGD 1MCWW 5EC2A 3T0VA 3GMNB 4GKSA 1KPRB 1VFAB 5TF1L 4JFHE 5TPWL 4M1GL 2FEEI 5ALCL 1YQ2A 2ATPB 5DVNA 3QJHA 2G60H 5C0FB 2Z93A 4BSWA 1RZIB 3TPUB 2DKMA 5ERWA 2DQIH 2C7UA 4TSBH 3TCLA 5T3ZD 4DUWA 1X5KA 1N59B 1U8IB 3SOBL 4Z0XA 1IAIH 2DLFH 4MA3B 2DKUA 1AHWC 4MJ6B 3D69B 3MRGB 1PEWA 2X7LA 3LN9A 2X05A 5K9KB 1NGWA 3ULVC 4QHKI 4EOWL 2CSPA 4LLWB 1CIDA 1JTPA 4QYOB 3NA9H 1YN7B 1OTTC 1D5MB 1F4XH 4QHMA 2ADGA 5B22A 1ZGLB 4HEPG 1CF8H 1MCFA 4KQ4H 1BIIB 5EBMB 5B39A 2YSSB 2HJKA 2P42B 5EA0H 1S7SA 3HUJF 2GEEA 4R3SA 2BCKB 3QNZB 3EDQA 2HBQA 2H6PA 1HH9A 3W39B 3D3VB 5IFHL 1GGBH 4FNLL 2AJZB 4P3WA 5MEND 3KLSA 4AEHL 1Q38A 2FWOB 4R4FL 5JORB 3TNMA 1FNGA 1G0YR 2KZWA 4KRMB 3TWCH 3S96A 1XF4B 3T09A 1MJUL 4ALAL 3PP4H 4DVRL 3GSXA 3ARXA 3QCTL 3OL2A 1J8HB 3B9KB 4KRPB 3MRBA 4R0LA 2AS5M 3E4CA 3SDAD 5CS7A 3C6LA 3CVIL 3VFSB 3TIEA 1E0OB 2DKSA 4LSTL 4X9HA 1EERB 3S36H 2X9XA 4XMKL 1EV2E 2APTA 2W1NA 4JFHD 1MQKH 4N1HB 4WUUE 1BZ7A 3FRPG 4M62H 5GQBA 2BZDA 1EFQA 4CU7A 2BK8A 4Z7OF 1S8DA 3WCYA 5ENWA 2NY4D 5DC9B 4NFCA 2AEPH 2RFXA 4DGIH 4LCWB 4FP8L 2Q8BH 3Q6FB 4YHML 4HWZA 1FP5A 1UXWB 2DDQH 3HRPA 3IDJB 4MJ5B 3SGEI 2HBZA 3D18A 4EUPH 1LP9A 3V0VA 5DUPH 3GUTB 2XOTA 2R4RH 4ZXBA 5DFVC 3T2NL 4PTUA 1JWUA 3FN0H 3K7UA 3P0VH 4D8PA 1P5UA 3QFJD 3W0WA 4FQ1H 2YD1A 3OJVC 4G8IA 5F88A 3ZTNH 3MJ6A 4NQEE 4PP2B 5D6CB 4PLJC 1TTGA 3LEVL 1YECH 5T3XH 1UZ8B 1ZHKA 4JM2C 1TVBB 2UVEA 4NKMB 2X40A 1J0YA 3HG1A 3QISA 2VB5A 4DCQA 5C6WH 4RDQG 1BEYH 2QLFA 3RTQB 2HT4C 2V2TB 2J6EH 1MCKA 2KQMA 3FMGL 3G6JB 1H3PH 2QHRL 2YUVA 5DJDB 5ISZD 2K3TA 3QWQB 3MRRA 1R3JA 1UZ6E 3CH8A 1J1OH 2VXUH 4P2OB 3JZ7A 2H1PH 1A3QA 4P2QA 1B9ZA 3QQ3B 4Y0GA 3ZDXE 2DMKA 1EVUA 4P9MH 3SY0A 1URLA 3NFNB 5MI0B 3DV4A 5EULV 3VWJA 1Q0YL 3AMLA 2GCYA 1ADQA 1CTOA 5EBGA 3UX9B 1J0HA 4HT1L 3ULUL 4PJIF 1IBCA 5AZ2L 1NMCC 4K9EL 4XNZB 1H5BA 1OF2A 4Y4HB 4Y4KB 4HKBB 1YMMB 4I1RA 1BHGA 4Y2DB 5D71L 3V2AR 2RBLA 1A7PH 3ARDD 4MDIB 1KV3A 4HWBH 1BPVA 1WBXB 3QQ9D 4XCNB 2XI9A 1BM3H 3GI9L 3KPRA 3O3AB 4WHYG 3S5LA 4KROB 2EDJA 4JPIB 2ESVE 3KLDA 4PV8B 4WUUD 1XZ0B 4PRPA 3KYMB 3QEUB 1U41A 2OZ4A 1ZVSA 3QEGH 1LO4H 4AMKL 3ARGA 1P84J 4Z7UA 2CK2A 3CPLA 1TPXC 3DO7A 4LVEA 3GJRA 4FTVA 2XTJD 4APQB 1UJ3B 3DARA 4ODSL 3CD4A 3PWNA 2C9AA 1SEBA 1EBAA 5TF1H 5TPWH 2B0SL 3ORJA 3VGAC 1LO2L 4NOBA 2A9NL 5HDOA 2X1QA 3UXFA 5E6IC 4NQED 1DUZB 5JNYB 4PY7B 3VFUB 2H54A 2IH1A 3DUSA 4OM0H 3SKNA 1DL7L 1LMKA 1KCKA 1YEDB 3M8OL 1NC4B 5GS2H 5L8LB 1IC4L 2BNQB 3HB3D 5EUOF 1KB9J 4RGNE 5F72S 1D6VH 4V1DB 1F3JA 4JFZL 4P59L 4K8RD 4BH7A 5CILL 1IM9B 2X9YA 4EOWH 5IAJA 1VFUA 4AM0A 4FQJL 1W0YT 3ILQD 2CDEB 5JQ6L 4WU7A 1EZVX 3PWPE 5CEZH 3IDYC 4AENB 1BX2A 1XGQA 3K1KC 3P45A 1JTTA 5FYJE 1A6VL 1MCJA 1RIVH 5ISZE 3S35H 3LD8C 2JF1A 1WZKA 3KR3H 3GGWB 4XNQA 3PG2A 3RWCA 3MRMB 1KGCE 4GBXC 4RMVA 4XBPB 3LN5B 1RJCA 3KXFA 2EYTB 1G7PB 4N8CL 43CAB 3KAAA 4X6BA 5IM7B 4Q58C 4G80B 3V9FA 4FNLH 4N6NA 2HFEA 2Y5TB 4UDUA 4P23D 4AEHH 4R4FH 2XKNB 2FJGB 5HGHA 3ZMRA 5FO7B 1ZSDA 4IJ3C 5IABA 5C0DB 4YR6A 2WNGA 2EH8H 2JCCA 1OGAA 5TH2B 2ESVD 2NN3C 1MJUH 1K2DA 1HI6B 4ALAH 4DVRH 3E2HB 1NMBL 3GFUA 3HC4L 5JXAH 1Q0XL 5DZLA 3S98A 5BS0B 2XZTA 4XVSL 5C7XL 4LSTH 4O51A 2I5YH 3IFPA 4XMKH 4PGZA 3IDGA 4KKBD 25C8L 3DX9A 1VSCA 5EU3A 2OMNA 3BJLA 2VZ3A 5CZVL 3T0EE 4PJEB 4NKQB 4E5XA 5F3HA 4FP8H 1KLUB 1H8NA 4QO1A 4YHMH 2YD2A 4LFHG 4PJBE 4C83B 1GJIA 2FSEB 3VGDA 2APXA 3IF1B 2DL9A 1SY6L 1JZ8A 1NBYB 3RDTD 4OGYL 3EGSA 3T2NH 1KENL 1JPFB 5BMFL 1RIUL 2JB5L 4RGND 4OIIL 4KHTL 5F1IA 4G3YH 5DVOA 5SWQA 2BOCB 3LEVH 3MRNB 1IQDA 5DMIH 4D9RE 4G9FB 3O2DL 3BH9B 4DJMA 2XICA 2G5RA 3U0TB 1U8KA 4GQ9L 4Y89A 4PB0L 3PWPD 3VCLB 3HCVB 3QDJA 1A3RL 3FMGH 1X5AA 5FYJD 2QHRH 1E28A 5IG7B 5I1EL 4MVBC 4E42A 1EK3A 1KGCD 1FN4B 3GMLB 3TIDA 1WWCA 2NY2C 4HK3N 5L8JB 3RWHB 3AGVA 3C60B 5EPMB 3BMVA 1PW3A 2PW2B 5D7IE 3CX5K 5TE6L 1Q0YH 4UILL 5HHPB 5ESVA 3IS1X 5C0AB 4MNHA 1B0WA 1UKTA 4ZS7H 1QD0A 2B8OT 2C1PB 4HT1H 3QP3A 3ULUH 1H15B 4JRYA 4X6CF 1C08A 1P6FA 4UBDC 1O5DT 4K9EH 4NRZB 3V5HA 5GRYA 1OP3H 4A2LA 4QUEA 4RDQF 4P49A 2AQ1A 4F3FB 1BFOA 1P4LB 2AXFB 3V7AG 1Z9LA 5D71H 8CGTA 4BQCA 4O00A 1A1NA 3QQ4B 3RPIB 1T5XA 2ZSWB 1W8NA 2VE6B 5D7JD 1JP5A 3GI9H 1CBVL 3WNLA 1N4XL 5CAYB 3UOAB 3OKMB 1U8LB 3BPLB 4Y19E 5HDLA 4J2XA 2CLRB 3BZEA 1YN6A 3HE6A 3MCKA 1WBZB 3T0ED 5FO9A 1S9XB 3ARFD 3VA2C 4AMKH 3I6LE 2HVJA 1U8JA 2D0GA 5JW5A 4QY8B 4K3GA 4FFWD 5JDSA 1OT2A 4PTTB 1I8LC 3FO9B 4OCWL 4DFHA 1JK8A 2B0SH 1SJEB 3LCYA 5EIIB 4F9LC 2A9NH 4ZO9A 3RJQB 1CE1L 4EN3D 1PY9A 2VZSA 2W9LA 1FIEA 1H3WM 4UINL 1ZHNA 3FQTA 2UY7A 2HTLC 4D9RD 1DL7H 1CGSL 1CXKA 1PFCA 3BE1L 1QRNA 3M8OH 4PJGA 3R6GA 2J33A 3BX7C 3IAGC 1PBYA 3R0NA 1MY5A 4D9LL 3QAZB 4HQQL 1IC4H 4LPVA 3P77A 1RUQL 1ZA6A 2H48A 4JFZH 4DZ8B 2UY6A 3ZKMD 2Q7NA 3U1SL 2X1OA 4NN6C 5CILH 4XVUD 1JNNL 3HZVA 2AJVL 5DJ0B 3NS7A 4LPCA 1G6RB 1QX3A 1JPSH 1JRHI 5C2BL 3G5ZB 4J3SA 2XWBA 5C3LD 5JQ6H 4YFDB 4GLRH 1OGTB 4RIRA 3WNPA 4C59B 1A6VH 4Q9RL 4ELMA 3SE3C 1Q9WA 4Z7VE 3O11B 1FL3A 1ADQL 4HLZG 2GY5A 4M4RA 5SWZE 5IMMA 4L1DA 4N8VB 4NKDA 4N8CH 1NMEA 2G5BA 4JQVA 3OGCB 4R97B 4LSRL 1O0VA 3CXHJ 1INQB 2ZUUA 4ESKA 4GRLB 4RQQB 5DC0A 3DX6A 2H5IA 2V9QA 2NW3A 4NQCB 3OKEB 4ZD3L 3MFFB 3BQUD 1CICB 1DUYB 2KPNA 5F1SA 5CD3A 2YBRB 5JLZA 5E8NA 3BDYL 2BMKA 3WV0A 4EI6A 4Y19D 5C0EB 2NNAA 4BFIB 2J31A 1NMBH 5K9JH 4M6AA 3NFPB 3HC4H 2OZ4L 3FO1A 4RWYL 3I6LD 1NAMA 1Q0XH 2WINB 4XVSH 3DJ9A 4BM7A 5E8EB 4LL9A 2WV3A 5C1MB 2AK4A 25C8H 1NFKA 4X6DA 3P9LB 4PJCB 2ZUSA 1ORSB 4XP6L 5CZVH 1M7XA 3RIFF 3KJFA 4EKXA 1EFXA 3P4OA 1VFBB 1HIMH 4WWKB 1FZMA 1H3TA 2NY6C 5J1AA 3EJJX 2VQ1A 2GSGB 3O9WC 1H9VA 5CJ8A 4MNGA 3BWAB 2NY5C 2DKOA 1SY6H 4MXQD 1U3HA 4HWEL 1KENH 1CFSB 1QO3A 3KLHC 1Q9KA 5HHNB 1RIUH 2JB5H 4LOUC 5BMFH 4OIIH 4PJXF 5HHVL 5B39G 3UDWC 4Z0BH 2DQCL 3DIFB 2VXSL 3GIZL 3OXRB 4EHFA 2CLZB 3KPMB 5B38A 1YDPB 2ADFL 3O2DH 1NLDL 1MI5E 3O3BB 4GQ9H 3F12B 3G5VA 4PB0H 5A2FA 1DBKL 4U1JA 1TFHA 1T03L 2NX5A 1LWRA 2FGWL 5IB5B 3PGCA 3KPNA 4X5LA 5I1EH 1Y6KR 5JA9A 3STZB 3H0TA 5DJYB 4JO3L 3VXUB 5SWZD 3UTSB 3OKNA 4HZAA 2IQ9H 3MGOB 4PP1C 4JVWA 1IGIL 1MREH 3C8KB 5GRJL 3MRPA 2VISB 3RFZC 4WW2F 5ACLA 5TE6H 4UILH 5IQ9A 4YHOH 2UWEE 2YR3A 4TNVK 5GGUB 4NHUA 4WI6A 3MRHB 5IB2B 3W9EB 2P49B 5GS2D 1CE6A 1XCQB 1OY3B 5T5NG 3HI5H 3CFCL 4EIZC 2VLKA 2B4CL 1XF3B 4AL8L 4L9LB 5J9PB 5M95B 4U6XA 1N0XH 5ICYA 1FV1A 3ESUF 4PB9L 3PWUB 1OAYL 2IPTL 3PWLA 5I9QC 1INDL 1IAOA 5GZOC 3ARSA 1FJ1B 1NC2B 1N0LA 2X6MA 2ZG3A 4XH2B 4EDXA 4RMUA 3H42H 3VD7A 5KN5A 1OCWL 5D1ZB 2JLLA 1WK0A 1J0JA 3TT3L 3VH8A 1JV5B 1G7IA 4HKJB 3HZMA 4AWAA 1U3ZA 3DRQB 2WUBL 4LLVB 2ORBL 3DHMA 3MGAA 5EU4B 5HYQA 5JFTA 2ARJA 3QUYA 5BXFB 3C87A 4YE4L 5D7KD 3BKYL 4JR9L 4PJAB 3MOQA 2COQA 1I9RL 2A0LC 3DSNA 1Z5LA 1JZ7A 5I16A 3T1FB 4OCWH 5FYKU 4OZGF 3G6AA 5IK3A 2GI7A 1W0WB 3TO2A 4WJ5A 3E6HB 2NR6D 2PO6A 4HK0B 3QNYB 3P40A 3QDGB 1CE1H 2F74A 1EIBA 2G75B 3H9ZA 2DWDB 4UINH 3FRUB 5ANMB 3SBWA 1CGSH 3OF6A 1MI5D 3HZKA 4ELKA 5BW7A 1P5VA 4L8SC 4XCFL 4IIQB 1I7TA 4D9LH 4WFHE 3FB7A 2P24B 4HQQH 4TUOB 1NBVL 4GW1B 4M00A 5I1JL 3U1SH 1FL5B 4M93C 2X89A 4WU5B 3RWDA 2A6KB 1JNNH 3VFPB 4J12A 3MLXH 2IG2L 3TN0A 2XZAL 5C2BH 4I2XA 4Q6IC 4K3HA 4I1NB 3ZZ1A 5DMKB 4QTXA 4RZCA 1J87A 1P4BL 2DRUA 3JTSA 4JPWL 4GG6F 2NXYD 4Q2ZA 3WXVH 4Q9RH 5F93C 3EYVA 4ERSL 3D25B 2VLJE 2DMBA 5L0QB 2GY7B 1MLBA 1HCFX 3TBVB 1UB6B 3LKQA 3X3FL 4NO0B 4CBPA 5ESAA 1NFIA 3QA3B 5FIEA 5MEQB 1AD9B 4LSRH 4P4KA 4WO4C 4C56D 3AY4C 4TVPD 1T7XA 4ZD3H 1ERNA 1SYVB 1D5ZB 1SC1A 4L3EA 5I2IB 1A7NL 3SKUD 5ADPL 1D5XB 3BDYH 3DVNA 1FE8L 2HA1A 4J3XA 1X5IA 3G04B 3QEQA 2IJ0C 1JF6A 4ZVSA 2MCG1 4WI3A 1MHPL 3CDFA 3V8OA 2OZ4H 4RWYH 5JIKA 5DQJB 4FG6C 3MV01 5JQHC 4HUUA 4GRWH 5LGHL 4X5WA 3EYUL 1H0DA 1Y0LA 3RGVA 5C08E 1N3NA 3O6FC 2AJSL 3CFIC 1T0PB 5LU9A 1T21B 3Q5OA 4RFOL 3SDCB 1G9NL 2NY2D 3QIWC 2UUDH 3CC5A 3VJ6A 3L3DB 1A5FL 3WDIA 2EDFA 1L7IL 3IU4H 5HYJE 4TYUA 4U2YA 4KUZL 4ZPVB 4HIHA 4XCCL 3WIHH 2CGRH 2Y1LA 4JQYA 5E1AA 2E7CA 2A6JB 4FFVC 5EG6C