4IFFA

Structural organization of ftsb, a transmembrane protein of the bacterial divisome
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
81
structure length
81
Chain Sequence
GPLKPEEHEDILNKLLDPELAQSERTEALQQLRVNYGSFVSEYNDLTKDYTRVNDDVAAQQATNAKLKARNDQLFAEIDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fusion of phage phi29 Gp7 protein and Cell division protein
publication title Structural Organization of FtsB, a Transmembrane Protein of the Bacterial Divisome.
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Cell cycle
total genus 32
structure length 81
sequence length 81
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.400 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4iffA00
4IFFA 1NO4A 3MTUE 3OA7A 1NOHA
chains in the Genus database with same CATH superfamily
2QJKC 5AW1B 3H1LE 2E43A 3A0BE 2Y9ZA 3L74G 1EDLA 1NTKK 5CHXA 5APXA 3TYYA 5B66H 1KILE 2I1KA 2QRXA 2ZYAA 2KOGA 4GKGA 3AEFC 3H1JE 2WSCJ 1HJ0A 1OIPA 3M0DC 5CBOA 1L0LJ 5BVZA 2BCCD 2G3AA 4H44D 5GTHE 3C1LA 1NKZB 1AJYA 3D6YA 3KXDA 1USEA 3V5BA 1H0TA 3GHGC 3L72G 3WU2H 4C7NA 3H1IJ 2YO2A 3L35A 1IZNB 4EOTA 3AEDC 1VQOP 5BU8B 1N7SB 5AVQB 3R2PA 2JO1A 4BWNA 1KB9I 1N8RQ 1T3JA 3HD7B 2GUSA 1J1DC 4WVZA 1EQ7A 1AVYA 1VF5C 1M8OB 1BSNA 4RKUJ 3OAKA 1LT1A 2C0XA 2Q3IA 2M3BA 1PGQA 3QWOC 2IYOA 2Q9IA 3MHVA 3CWBJ 3RBZA 2OARA 1SQBG 2FXMA 3B71A 1MFZA 3WUUA 2OYIA 4CPGA 1PPJE 4IL6E 1L0LK 3WUVA 3RL0D 1ZR4A 4ZNCA 2XU6A 3S9OA 3H1KG 3HTKB 3NTNA 1EXIA 3Q5SA 1HJBA 1JEKA 1KQFB 3SWFA 1Q86Q 3BRVB 1NTKD 5C39A 1T2KC 2VRSA 5B5EE 1MV8A 5AW2B 3PTZA 1M57D 1N7SA 4LGDE 4PJ0H 2ZYGA 1U7JA 4IOIH 3HD7A 3C9IA 1GK6A 2W6BA 2HODB 1NTZJ 2FKWB 2QM8A 3CCRP 3BCCD 2FYNB 1LTTC 2JDIH 1S5LX 2OYHC 1NGMB 2V7QJ 1NTKG 3LW5H 1HGZA 2IBZG 2V4HA 2N1TB 5B66E 1FZCB 1VQ4P 2P7JA 1UIIA 4IFDK 2FYUE 1W5CE 5CCHC 1N7SD 5CBNA 3Q5RA 3KYQA 3G6EP 4C46A 1GMJA 2KLVA 2I8DA 3VTPC 1MZ9A 2E42A 3HTKA 3HD7D 4GDOA 1BSHA 4TLFA 3JCUH 3II6A 1JY2P 3F89A 3WU2E 3M9HA 1YJNP 2OTJP 1FZBA 1BCCJ 1JY3N 3L74J 4N3YB 1RF0A 2E75B 3S1KA 4ASWA 1FDMA 2KSJA 2WT7B 2HODA 2JP3A 2NPSC 1L0LD 3V2QA 4ASVA 1M56D 3H25A 2I1JA 1UIXA 3L71J 4JYBA 1JCCA 4KHXA 4XFJA 1AFOA 4W7YA 5AW3B 3NFQA 5L8RJ 4BXLA 5APYA 5TJHA 2N1TA 3TF5A 2WSEH 4LLHA 1KC8Q 1USDA 3H1ID 2JR8A 2A06G 1GW3A 3E1IA 1NTME 1EC5A 1L4AC 1NWQA 1PZQA 3GLMA 3V2PA 5AVWB 3L72J 3D70A 2OYOA 5E79H 4OGQB 2XNXA 2HPCA 1EZVG 3CCEP 2R44A 1BGYJ 3C8VA 3N4XA 1AV1A 1JCDA 2L91A 2PGDA 2WSSH 4OVNF 2DW3A 1KMIZ 1BDDA 1KB9D 1ZW0A 1LWUC 2W27A 1LTSC 5AW8B 1K8AQ 3H1HJ 1FZEA 2IPPA 4U7JA 4PJ0E 4L74A 2LXBA 3IR9A 2BCCE 1CSBA 2N1TD 1H8AA 3CWBD 3L73G 3CCQP 2KSEA 3O6QA 2WT7A 1PL5A 4YPCA 2WMMA 3Q5PA 1GW4A 4BRYB 4H0LC 1YQ3C 1P84I 1SQBJ 3JC22 1LT9B 1NYHA 4U3FG 3I55P 2N9BA 1IFDA 2WPRA 5CJ0A 2QA4P 3V6IA 2B87A 5AW4B 2WSCH 2D2CB 2ZAEB 5KKZB 3CWBG 3H1KJ 1DD3A 1S72P 1KQGB 4I6MC 2O01J 4PD4I 1IFJA 1R5SA 1HF9A 3R4YA 1BE3G 2C0WA 4EI2A 3GG2A 1Q90D 2Y0CA 4EYYQ 5BU5A 1T8ZA 2LKMA 1LTIC 1JY2O 2E75D 2KK7A 5AVYB 3L36A 2IBZI 5KLVJ 2YMKA 3JCUE 5CCGA 5KLIB 1FS0E 2JWDA 2K9JB 2B9BA 2XZRA 2QJPC 1LNQA 3TGUJ 2FFDA 3W67A 1MFTA 2YNYA 2WTYA 1XTGB 2M8RA 2GM4A 3B5NA 4WBAA 4AQRD 1Q2NA 5APQA 4JBZA 1LTJC 3UIAA 1VQ5P 2P58A 1NTZG 4R4MA 1GDTA 1KB9H 3B8EB 3CC7P 4BRYA 3KQGA 3AE6C 1NTKE 4OGQD 1LT9A 2Y0DA 3A7OA 1SQBK 3E7KA 1N73B 1KYOI 2WPSA 3QH9A 4EIJA 2J58A 1SQVG 1LP1B 1OW7A 1SQXE 1NU1G 4D6TJ 3HUSC 1PP9E 5CCGD 1IO4A 1ZRTD 2H8PD 3M9QA 3BCCE 3L74D 5E79E 1IFIA 3VN0A 4AUWA 1ZMEC 5AVZB 2OTLP 1GL2B 2R5BA 2OYIC 3M91A 5KLVK 3CCVP 4H13B 1SFCA 2K9JA 4DZOA 1Y47A 2GUVA 1BCCG 1QVGO 1FC2C 3RK3B 3BATA 5DJTB 2D2CD 3AE7C 1EZVI 3JSVC 1G1IA 3L72D 1URQC 1ZR2A 1WRGA 2V7QH 4I7ZC 3L71G 1FDIA 2SPZA 5KAFH 3P8CD 1KILC 1VQPP 1IC2A 2E76D 3CMAP 4Y99B 1L0NJ 1N73A 1KQLA 4WWIA 5APSA 3SWYA 1PGPA 1QL1A 2XDJA 1LP1A 4WY4C 1KQSO 3H1HD 1M1JC 1RF1C 1NH4A 1SFCD 1SQPJ 1NJIQ 1L0LE 2IFMA 3L37A 2E74B 2O1KA 1BGYG 1DIPA 4YXDC 1NKNA 2H7HA 2NZ2A 2QJKB 1RH5B 2C9NY 3MGNA 3L73J 4GOFA 3RGUA 3H1IE 3V2RA 1SQBD 3VP8A 3FWLA 3CMEP 1IK7A 1VQMP 1KFNA 5CJ4A 3IFMA 3H1HG 2PFXA 5H2FH 1SVFA 3H1KD 2O1JA 2M5AB 4U3FJ 1P84D 2OQQA 1Q7YQ 5APWA 2H88C 4L73A 1K05A 1Z56A 2AEJA 2WPVB 3LIEA 1KB9E 4OH8B 2YIUC 4PV1C 4UB8H 3GHGB 4W7ZA 2KP8A 4DT0A 2KIKA 4K3AA 3CCSP 2XKMA 2O3JA 3SSUA 4JPZB 1BE3J 4PD4D 3Q1MA 5KLVD 1L0NK 3MZWB 3RK2D 3MD0A 1HUCA 2XNDH 3TGUD 4H13D 1J1DB 1IFMA 1JB0J 1SQPK 2IZ1A 2IBZD 3PLNA 3HE5B 3N7NA 1NO4A 1VF5B 2YMYA 3H6PA 3W68A 3RK3D 3KHUA 4GODA 2WPQA 5KLVG 1XTCC 3TSIA 1GTWA 1KTMA 2QIWA 3TGUG 3ITKA 1VQ9P 1CI6B 3M0DA 3L70G 2M5AA 1SQQE 3FWNA 2M0BA 1JMMA 2AXCA 4TT3H 1S5LH 1KZUB 3CX5I 1KYOD 4M3LA 1SQVJ 3E1RA 4N78D 3G3ZA 4NPFX 1IFPA 1NU1J 3A0HH 2H89C 2E74D 1YITP 2A45G 3GHGA 3GF7A 2AEMA 2GA1A 3CCLP 4GT1A 1W2BO 1DEEG 1P84H 2K88A 4D6TG 2O01H 2Q1KA 4YXWH 5KJ7A 3AE5C 3A3YB 4Z1MH 3TDKA 5AVXB 3P7KA 4QMAA 5AVRB 1LJ2A 1ZLLA 1RE4A 2CPSA 2OYHB 1YTZI 4PD4H 3L75G 2A06D 3P8MC 5DJUB 1TU3F 2P2UA 2KUBA 2KZJA 3M9BA 2QJYC 1L0ND 1EZVD 1NTZK 1CI6A 1GD2E 2W6JH 3U1CA 1SS1A 1J1EC 1FZAA 2ZT9C 5H2FE 3L74E 1JTHB 3EFFK 1VL2A 1SQPD 5CCGC 2KS1B 1FZCA 2FFDC 4OWFA 2QSIA 5KJ7D 1NTMJ 1SQVK 3H1JG 3O8ZA 4HKZH 1OMIA 1NU1K 2W83C 3B5NC 1L0NG 3L73D 3VYIA 1NHLA 1QX8A 1JO5A 4L75A 1FZFA 1LGHB 1SLQA 3AE4C 1SP4A 1JOCA 1OVUA 1SQPG 3L72E 1KYOH 3ZDMA 2WQYC 3H32B 2NPSB 4U3FD 3P8CE 1YHQP 3RBXA 5APTA 2OYHA 1U7MA 4B86A 3BVHA 3AEBC 4WB4A 3TNUB 3P32A 1A02J 2RH0A 1N2DC 2E76C 1PPJD 3H1HE 1BE3D 1YBKA 1L4AB 4H44C 1T2KD 1JTHA 4JF7A 3OJAB 2LR2A 3AEEC 1SFCC 2KS1A 3OA7A 1LTAC 1VQLP 1S5LE 1OXZA 1X0TA 2Y9YA 3MIWA 1M1KQ 3CXHI 1DH3A 1SQBE 1RHZB 3A0HE 1GU5A 3T97B 1FU1A 3KDPB 2CPBA 5AVSB 2FY8A 3EFGA 1PPJG 3G71P 1QEXA 3H1KE 3PJSK 3USSA 1NTZD 1P84E 3A2AA 1L2PA 3GMAA 2J59M 2KXPB 1W2EA 2AEFA 1X8YA 3G4SP 2HFED 1R8EA 3H32A 3AE9C 2NPSA 2WITA 1K9MQ 4H0LB 2ZYDA 1K04A 2W8ZA 2PAJA 5CCHD 2P1JA 1SQVD 2FXPA 1JUNA 4PD4E 5KLVE 5AW0B 2KNCB 4AYCA 2KB7P 3L70J 1NU1D 2A45I 3VP9A 1OFCX 2YKQA 3V4QA 2H43A 4EDFA 3CX5D 1DEBA 1E5WA 1JY3P 2YO3A 3RK2C 3RL0C 4R4LA 2IBZE 2WZ7A 4ZKUA 2Q7CA 2IFNA 3PRJA 1A02F 2WSEJ 3RK3E 1BDCA 2KI7B 1VQ6P 1SQXJ 3KPEA 1PP9J 2OGUA 1Q81Q 2NPSD 2RKLA 4HYTB 1Y8AA 2QM7A 2IDBA 1BCCD 3RK3C 3A5TA 3M0AA 3MTUE 2BASA 1FOSF 2QJPB 1PGJA 2WSFJ 2HR3A 3CC4P 3F5HA 3L75J 3Q2YA 2QVAA 4C7RA 3L71D 2Q6QA 4C7NB 3G9RA 1KYOE 1S9KD 4Y99C 1G2CB 1LTJB 1ZP0C 4N78E 3CPWO 4RJTA 1NAYA 1DD4A 1YJWP 1HVVA 1VQ7P 1R5LA 3FXEA 2E5YA 4YTPC 2KNCA 3H1LJ 4I1LA 1Y9BA 3PHLA 3LIDA 1N7SC 1EDKA 1S2EA 2HYNA 2P10A 1BGYD 4LC1A 1VPCA 3HUSB 3H1JJ 3KZIH 4DCKA 5K5GB 4NPDA 3HD7C 3BRTB 1EDJA 5KAIH 2N9YB 4JYCA 3MP7B 2WWWA 2A06E 2Q5UA 1NTMG 3SFEC 3WMM0 1SQXK 2OYIB 1L0NE 2XV5A 4H0LD 1EZVE 3CX5H 1HWTC 1JY2N 1FDOA 1N7LA 2MJZA 4GIFA 2AXTH 2QEXP 1RE3A 1SQPE 4HB1A 4HH2A 1GL2A 3MUDA 1G2CA 1KORA 1LTJA 5M1BA 3VMXA 1URQB 4I7ZB 2Z4EA 1KILB 3L73E 2BCCG 3IAOA 2WVRA 5KJ7C 3SFDC 1JY3O 3CCUP 4KJMA 2C9LY 5AVVB 2J5UA 2ZJSE 4WY4B 2JJLA 1RE4C 1WT6A 2KZIA 3HUSA 1M1JB 1RF1B 1OW6A 1S1CX 3CXHD 4U3FE 4L76A 1G1JA 2MKVA 4HJGH 3BASA 2ZXXA 3SWKA 1RF0C 1OW8A 2PRRA 3CC2P 3L4FA 2QG4A 4XE5B 2IZ0A 4XA4A 1YIJP 3CWBE 2KYVA 2FYNC 1DX7A 1GL2D 1JM0A 1BE3E 5KTBA 2E5TA 2N1TC 2JWAA 3L70D 3S4RA 2LXCB 2O01N 5TISH 1HGVA 1U57A 1MKMA 4DOJA 3RL0g 1FZCC 3ABVC 3K5BA 4ZKPA 1NVOA 1M90Q 1AA0A 1T3UA 5APVA 3IF4A 1URQA 2Y0EA 2PP6A 2YIUB 2RMZA 4PV1B 4NPEA 1KILA 2K37A 3PP5A 1SQXD 4IFFA 4D6TD 1YJ9P 1SQQJ 1PP9D 1NTZE 1ZN5A 1FJPA 3FXDA 1PFIA 3CLQA 1PGOA 4WY4A 1AQTA 1EDIA 3AE8C 3CCMP 1M1JA 1NAFA 1RF1A 1MUUA 5KAFE 3KZIE 2FYUJ 2R3CA 3L75D 2E75C 2M3EA 4DJGA 1HH0A 3AE2C 2HG5D 5KAIE 5GTIH 1SQVE 3Q3DA 1E79H 1YTZT 1NU1E 1SQXG 3TK1A 1PP9G 1FE6A 4GOEA 1VQNP 5AW6B 1URQD 2HPCB 4UB6H 3V2NA 3H1LD 3CX5E 3BCCG 3CXHH 3HE5A 4KT0J 4O9BA 1JNMA 4RESB 1KILD 2BEZF 1KN7A 2AXTE 3EWKA 3NXSA 1CW5A 5CMZA 5EFWB 3H1JD 1HBWA 2ITAA 4WY4D 4OGQC 2Q3EA 5AVUB 1AVOA 1ZRTE 3M06A 3OW2O 1QVFO 1BCCE 2YKPA 1IFNA 1M7LA 3H1LG 1YQ4C 1X9VA 3PH0A 2FXOA 3O6QB 1QL2A 1SQQK 1JMBA 2QE7H 3L71E 4MN4C 2A45H 1S9KE 3FGAD 1ZOYC 4UB8E 2Z5HA 5AVTB 1VF5D 2FYUK 2B87B 1FAVA 3U1AA 2Z5IA 1PIXA 3CCJP 1PV3A 3AEAC 3V4WA 3EQ2A 3WUTA 4I2LC 1LT9C 2ZXEB 1L0LG 4Y28J 1Q82Q 2RN0A 2FYZA 2WSFH 1BGYE 2QJYB 1LTBC 1CZQA 4A7PA 1GK4A 4PV1D 5TISE 2W6AA 3CI9A 2R3SA 2D2CC 3GF3A 1RQVA 1J1EB 2POHA 2R5DA 5KKZC 1X22A 2K1AA 2ZT9B 3AECC 3D6ZA 1VQ8P 2B89A 2ZVOB 2BCCJ 3I5CA 1OZHA 2W90A 3H1IG 1LTGC 3VMAA 5AW9B 1HTLC 2YXRB 2FFDB 1FZGA 2ZFCA 1KV4A 3A0BH 2CK3H 1ZXGA 1N86A 4K35A 3B5NB 5CCHA 4IFMA 2IX7C 3LW5J 1H88A 3HE4B 5KLIC 1QGKB 1YYCA 2K9YA 3IN6A 1J2JB 2JKVA 2P67A 2YXQB 1NTMK 1LWUB 5APUA 3GW6A 2IYPA 2UWJE 1FOSE 5GTHH 1VQKP 1OVRA 2ZVNB 1GZLA 1WMKA 2NRGA 5GTIE 3U59A 2G8YA 2YKOA 1H89A 1RQUA 3VMYA 1N73C 2E76B 2HLOA 2OTKE 4UB6E 2JEEA 1SQQD 3CXHE 4H44B 3I56P 1OVVA 1T6AA 5AW5B 3D71A 2B88A 4JQ0D 1EXJA 1RY3A 4ZMDA 3TNUA 1SFCB 5AW7B 2FYUD 1IK9A 1FJKA 3TGUE 3AE1C 1L4AA 3CD6P 1NTKJ 1RE3C 3L70E 1KD1Q 3FX0A 1YI2P 1GL2C 3MUDC 1SQQG 3HE4A 3VOPA 4H13C 2KLUA 3NMDA 4IL6X 2L5GB 1S3JA 3CL3D 1KFMA 1LWUA 3T97A 2FYUG 1NOHA 4IL6H 1ZV8A 1D7MA 3BCCJ 1GU4A 1S4XA 2ZT9D 1IJDB 4D6TE 1AQ5A 3AE3C 1QLED 1OWAA 1H0TB 1OX3A 5B5EH 3VMZA 1L4AD 3B4SA 2FBWC 3RK2B 3RL0B 3L75E 3B5ND 2K3RA 1X79B 1NTMD 1FBMA 3HRNA 4W80A 4RO0A 2E74C 2BEQD 2R32A 1K73Q 4N6JA 1VDFA 3AEGC
chains in the Genus database with same CATH topology
1IFJA 1NTZK 1CI6A 5KTBA 1GD2E 3U1CA 2C0WA 1J1EC 1FZAA 2N1TC 5AW1B 1HGVA 4DOJA 2E43A 1JTHB 1FZCC 5BU5A 1NTKK 5CHXA 5APXA 3TYYA 1T8ZA 2LKMA 1LTIC 1JY2O 2I1KA 5CCGC 1FZCA 2KOGA 4ZKPA 4GKGA 5AVYB 3L36A 2FFDC 5KJ7D 5CCGA 1SQVK 3O8ZA 1T3UA 5APVA 1NU1K 1URQA 3M0DC 2XZRA 2FFDA 3B5NC 2PP6A 5BVZA 2YNYA 3VYIA 2WTYA 1NHLA 1KILA 3PP5A 1JO5A 1XTGB 1FZFA 2M8RA 1LGHB 1SLQA 4IFFA 2GM4A 1SP4A 3B5NA 4WBAA 1NKZB 4AQRD 1JOCA 5APQA 1LTJC 1ZN5A 3UIAA 1FJPA 1GDTA 3B8EB 3V5BA 1PFIA 3CLQA 3GHGC 4WY4A 4C7NA 2YO2A 3KQGA 3H32B 1M1JA 1NAFA 2NPSB 3L35A 1RF1A 1MUUA 4EOTA 1LT9A 5BU8B 1N7SB 3P8CE 5AVQB 2R3CA 3A7OA 3R2PA 5APTA 1SQBK 2OYHA 4B86A 1N73B 1HH0A 3BVHA 2WPSA 4EIJA 2HG5D 4WB4A 2J58A 1T3JA 3HD7B 2GUSA 1YTZT 1J1DC 3TNUB 1EQ7A 3P32A 1A02J 3HUSC 1N2DC 3TK1A 5CCGD 1IO4A 5AW6B 2H8PD 1URQD 3M9QA 1L4AB 2HPCB 3OAKA 3V2NA 1T2KD 2C0XA 1IFIA 4O9BA 3HE5A 1JNMA 2Q3IA 1JTHA 4RESB 3VN0A 2M3BA 1KILD 4JF7A 4AUWA 3OJAB 1SFCC 5AVZB 3OA7A 3NXSA 1CW5A 1LTAC 2Q9IA 5CMZA 1GL2B 2R5BA 1OXZA 2OYIC 3M91A 3MIWA 1DH3A 5KLVK 1HBWA 1SFCA 2OARA 4WY4D 2FXMA 1GU5A 1MFZA 4DZOA 1FU1A 5AVUB 2OYIA 3KDPB 2CPBA 5AVSB 3M06A 3EFGA 1L0LK 2GUVA 2YKPA 3RL0D 1IFNA 1ZR4A 1M7LA 2XU6A 1X9VA 3HTKB 3RK3B 3BATA 3NTNA 1QL2A 3A2AA 2J59M 1SQQK 1G1IA 1HJBA 1W2EA 1URQC 1ZR2A 3SWFA 3BRVB 1WRGA 1X8YA 2HFED 1T2KC 2VRSA 3H32A 2A45H 1MV8A 5AW2B 2NPSA 1S9KE 2WITA 3P8CD 1KILC 1IC2A 1N7SA 4LGDE 4Y99B 2PAJA 5CCHD 2Z5HA 5AVTB 2FYUK 1N73A 1KQLA 2P1JA 5APSA 1JUNA 3SWYA 1FAVA 1QL1A 2XDJA 5AW0B 2Z5IA 3U1AA 4AYCA 2KB7P 3HD7A 3C9IA 2A45I 3VP9A 3V4WA 4WY4C 3EQ2A 1GK6A 2YKQA 3V4QA 2H43A 2W6BA 2HODB 1M1JC 1RF1C 1NH4A 2FKWB 1SFCD 4I2LC 1LT9C 2IFMA 2ZXEB 2QM8A 3L37A 1DEBA 1LTTC 2O1KA 2FYZA 1E5WA 2OYHC 1JY3P 2WSFH 2YO3A 3RK2C 3RL0C 1LTBC 2WZ7A 1CZQA 3LW5H 1HGZA 1GK4A 1NKNA 4ZKUA 2W6AA 3CI9A 2Q7CA 2H7HA 2IFNA 1J1EB 2POHA 2N1TB 2R5DA 1A02F 2C9NY 3MGNA 1FZCB 3I5CA 2P7JA 1LTGC 3V2RA 3VP8A 4IFDK 5AW9B 1KFNA 1HTLC 3KPEA 5CJ4A 2NPSD 2FFDB 3IFMA 4HYTB 2QM7A 5CCHC 1N7SD 3RK3C 3A5TA 3M0AA 1SVFA 1FZGA 3MTUE 2ZFCA 2BASA 3KYQA 4C46A 1FOSF 1N86A 2O1JA 2KLVA 3B5NB 5CCHA 4IFMA 3VTPC 1MZ9A 2IX7C 5APWA 2E42A 1H88A 3HTKA 3HD7D 3HE4B 1Z56A 4C7RA 1YYCA 3LIEA 4OH8B 4C7NB 3II6A 1JY2P 1S9KD 4Y99C 1J2JB 1G2CB 1LTJB 4N78E 3M9HA 2P67A 1NTMK 3GHGB 1LWUB 2KP8A 4W7ZA 5APUA 1HVVA 2XKMA 1FOSE 1FZBA 1L0NK 1JY3N 3RK2D 1GZLA 3MD0A 1HUCA 4N3YB 1RF0A 3U59A 4I1LA 1FDMA 2KSJA 2WT7B 2YKOA 2HODA 2NPSC 3V2QA 1H89A 3LIDA 1J1DB 1IFMA 1N7SC 2HYNA 1SQPK 2I1JA 4JYBA 4LC1A 1VPCA 3HUSB 3VMYA 1JCCA 4KHXA 1N73C 2HLOA 3HE5B 1AFOA 2JEEA 3N7NA 4W7YA 5AW3B 1NO4A 3NFQA 2YMYA 3HD7C 3H6PA 3BRTB 5APYA 2N1TA 2WSEH 4JYCA 4LLHA 5AW5B 3RK3D 2WWWA 2WPQA 1GW3A 1XTCC 3E1IA 1RY3A 2Q5UA 3TNUA 1SFCB 3TSIA 1L4AC 1GTWA 1NWQA 5AW7B 3V2PA 1IK9A 3WMM0 1FJKA 1SQXK 2OYIB 5AVWB 2XV5A 1CI6B 1HWTC 1L4AA 2XNXA 2HPCA 1JY2N 1RE3C 3M0DA 1N7LA 3N4XA 1JCDA 2MJZA 1GL2C 4GIFA 3HE4A 3VOPA 1JMMA 1RE3A 4HH2A 1KZUB 3NMDA 1LWUC 4M3LA 1GL2A 3MUDA 2W27A 4N78D 3G3ZA 1LTSC 1G2CA 1LTJA 2L5GB 3CL3D 3VMXA 5AW8B 1URQB 2A45G 1KFMA 1LWUA 3GHGA 3T97A 1FZEA 1NOHA 2IPPA 1ZV8A 2Z4EA 3IR9A 1KILB 1CSBA 4GT1A 2N1TD 1GU4A 1H8AA 5KJ7C 1IJDB 1AQ5A 2WT7A 1JY3O 2O01H 1OWAA 1GW4A 2C9LY 5KJ7A 5AVVB 3A3YB 4WY4B 2JJLA 1RE4C 5AVXB 1WT6A 3P7KA 3HUSA 1M1JB 1RF1B 5AVRB 3VMZA 1L4AD 1LT9B 1ZLLA 1G1JA 3BASA 2N9BA 1IFDA 1RE4A 1RF0C 2CPSA 2WPRA 5CJ0A 2OYHB 3RK2B 3RL0B 1YTZI 3B5ND 3P8MC 3L4FA 5AW4B 4XE5B 2WSCH 1X79B 4XA4A 2P2UA 1FBMA 3HRNA 4W80A 2KYVA 1DX7A 1GL2D 3M9BA 2R32A 4I6MC 4N6JA 1VDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IFF A;  1NO4 A;  3MTU E;  3OA7 A;  1NOH A; 
#chains in the Genus database with same CATH topology
 2QJK C;  5AW1 B;  3H1L E;  2E43 A;  3A0B E;  2Y9Z A;  3L74 G;  1EDL A;  1NTK K;  5CHX A;  5APX A;  3TYY A;  5B66 H;  1KIL E;  2I1K A;  2QRX A;  2ZYA A;  2KOG A;  4GKG A;  3AEF C;  3H1J E;  2WSC J;  1HJ0 A;  1OIP A;  3M0D C;  5CBO A;  1L0L J;  5BVZ A;  2BCC D;  2G3A A;  4H44 D;  5GTH E;  3C1L A;  1NKZ B;  1AJY A;  3D6Y A;  3KXD A;  1USE A;  3V5B A;  1H0T A;  3GHG C;  3L72 G;  3WU2 H;  4C7N A;  3H1I J;  2YO2 A;  3L35 A;  1IZN B;  4EOT A;  3AED C;  1VQO P;  5BU8 B;  1N7S B;  5AVQ B;  3R2P A;  2JO1 A;  4BWN A;  1KB9 I;  1N8R Q;  1T3J A;  3HD7 B;  2GUS A;  1J1D C;  4WVZ A;  1EQ7 A;  1AVY A;  1VF5 C;  1M8O B;  1BSN A;  4RKU J;  3OAK A;  1LT1 A;  2C0X A;  2Q3I A;  2M3B A;  1PGQ A;  3QWO C;  2IYO A;  2Q9I A;  3MHV A;  3CWB J;  3RBZ A;  2OAR A;  1SQB G;  2FXM A;  3B71 A;  1MFZ A;  3WUU A;  2OYI A;  4CPG A;  1PPJ E;  4IL6 E;  1L0L K;  3WUV A;  3RL0 D;  1ZR4 A;  4ZNC A;  2XU6 A;  3S9O A;  3H1K G;  3HTK B;  3NTN A;  1EXI A;  3Q5S A;  1HJB A;  1JEK A;  1KQF B;  3SWF A;  1Q86 Q;  3BRV B;  1NTK D;  5C39 A;  1T2K C;  2VRS A;  5B5E E;  1MV8 A;  5AW2 B;  3PTZ A;  1M57 D;  1N7S A;  4LGD E;  4PJ0 H;  2ZYG A;  1U7J A;  4IOI H;  3HD7 A;  3C9I A;  1GK6 A;  2W6B A;  2HOD B;  1NTZ J;  2FKW B;  2QM8 A;  3CCR P;  3BCC D;  2FYN B;  1LTT C;  2JDI H;  1S5L X;  2OYH C;  1NGM B;  2V7Q J;  1NTK G;  3LW5 H;  1HGZ A;  2IBZ G;  2V4H A;  2N1T B;  5B66 E;  1FZC B;  1VQ4 P;  2P7J A;  1UII A;  4IFD K;  2FYU E;  1W5C E;  5CCH C;  1N7S D;  5CBN A;  3Q5R A;  3KYQ A;  3G6E P;  4C46 A;  1GMJ A;  2KLV A;  2I8D A;  3VTP C;  1MZ9 A;  2E42 A;  3HTK A;  3HD7 D;  4GDO A;  1BSH A;  4TLF A;  3JCU H;  3II6 A;  1JY2 P;  3F89 A;  3WU2 E;  3M9H A;  1YJN P;  2OTJ P;  1FZB A;  1BCC J;  1JY3 N;  3L74 J;  4N3Y B;  1RF0 A;  2E75 B;  3S1K A;  4ASW A;  1FDM A;  2KSJ A;  2WT7 B;  2HOD A;  2JP3 A;  2NPS C;  1L0L D;  3V2Q A;  4ASV A;  1M56 D;  3H25 A;  2I1J A;  1UIX A;  3L71 J;  4JYB A;  1JCC A;  4KHX A;  4XFJ A;  1AFO A;  4W7Y A;  5AW3 B;  3NFQ A;  5L8R J;  4BXL A;  5APY A;  5TJH A;  2N1T A;  3TF5 A;  2WSE H;  4LLH A;  1KC8 Q;  1USD A;  3H1I D;  2JR8 A;  2A06 G;  1GW3 A;  3E1I A;  1NTM E;  1EC5 A;  1L4A C;  1NWQ A;  1PZQ A;  3GLM A;  3V2P A;  5AVW B;  3L72 J;  3D70 A;  2OYO A;  5E79 H;  4OGQ B;  2XNX A;  2HPC A;  1EZV G;  3CCE P;  2R44 A;  1BGY J;  3C8V A;  3N4X A;  1AV1 A;  1JCD A;  2L91 A;  2PGD A;  2WSS H;  4OVN F;  2DW3 A;  1KMI Z;  1BDD A;  1KB9 D;  1ZW0 A;  1LWU C;  2W27 A;  1LTS C;  5AW8 B;  1K8A Q;  3H1H J;  1FZE A;  2IPP A;  4U7J A;  4PJ0 E;  4L74 A;  2LXB A;  3IR9 A;  2BCC E;  1CSB A;  2N1T D;  1H8A A;  3CWB D;  3L73 G;  3CCQ P;  2KSE A;  3O6Q A;  2WT7 A;  1PL5 A;  4YPC A;  2WMM A;  3Q5P A;  1GW4 A;  4BRY B;  4H0L C;  1YQ3 C;  1P84 I;  1SQB J;  3JC2 2;  1LT9 B;  1NYH A;  4U3F G;  3I55 P;  2N9B A;  1IFD A;  2WPR A;  5CJ0 A;  2QA4 P;  3V6I A;  2B87 A;  5AW4 B;  2WSC H;  2D2C B;  2ZAE B;  5KKZ B;  3CWB G;  3H1K J;  1DD3 A;  1S72 P;  1KQG B;  4I6M C;  2O01 J;  4PD4 I;  1IFJ A;  1R5S A;  1HF9 A;  3R4Y A;  1BE3 G;  2C0W A;  4EI2 A;  3GG2 A;  1Q90 D;  2Y0C A;  4EYY Q;  5BU5 A;  1T8Z A;  2LKM A;  1LTI C;  1JY2 O;  2E75 D;  2KK7 A;  5AVY B;  3L36 A;  2IBZ I;  5KLV J;  2YMK A;  3JCU E;  5CCG A;  5KLI B;  1FS0 E;  2JWD A;  2K9J B;  2B9B A;  2XZR A;  2QJP C;  1LNQ A;  3TGU J;  2FFD A;  3W67 A;  1MFT A;  2YNY A;  2WTY A;  1XTG B;  2M8R A;  2GM4 A;  3B5N A;  4WBA A;  4AQR D;  1Q2N A;  5APQ A;  4JBZ A;  1LTJ C;  3UIA A;  1VQ5 P;  2P58 A;  1NTZ G;  4R4M A;  1GDT A;  1KB9 H;  3B8E B;  3CC7 P;  4BRY A;  3KQG A;  3AE6 C;  1NTK E;  4OGQ D;  1LT9 A;  2Y0D A;  3A7O A;  1SQB K;  3E7K A;  1N73 B;  1KYO I;  2WPS A;  3QH9 A;  4EIJ A;  2J58 A;  1SQV G;  1LP1 B;  1OW7 A;  1SQX E;  1NU1 G;  4D6T J;  3HUS C;  1PP9 E;  5CCG D;  1IO4 A;  1ZRT D;  2H8P D;  3M9Q A;  3BCC E;  3L74 D;  5E79 E;  1IFI A;  3VN0 A;  4AUW A;  1ZME C;  5AVZ B;  2OTL P;  1GL2 B;  2R5B A;  2OYI C;  3M91 A;  5KLV K;  3CCV P;  4H13 B;  1SFC A;  2K9J A;  4DZO A;  1Y47 A;  2GUV A;  1BCC G;  1QVG O;  1FC2 C;  3RK3 B;  3BAT A;  5DJT B;  2D2C D;  3AE7 C;  1EZV I;  3JSV C;  1G1I A;  3L72 D;  1URQ C;  1ZR2 A;  1WRG A;  2V7Q H;  4I7Z C;  3L71 G;  1FDI A;  2SPZ A;  5KAF H;  3P8C D;  1KIL C;  1VQP P;  1IC2 A;  2E76 D;  3CMA P;  4Y99 B;  1L0N J;  1N73 A;  1KQL A;  4WWI A;  5APS A;  3SWY A;  1PGP A;  1QL1 A;  2XDJ A;  1LP1 A;  4WY4 C;  1KQS O;  3H1H D;  1M1J C;  1RF1 C;  1NH4 A;  1SFC D;  1SQP J;  1NJI Q;  1L0L E;  2IFM A;  3L37 A;  2E74 B;  2O1K A;  1BGY G;  1DIP A;  4YXD C;  1NKN A;  2H7H A;  2NZ2 A;  2QJK B;  1RH5 B;  2C9N Y;  3MGN A;  3L73 J;  4GOF A;  3RGU A;  3H1I E;  3V2R A;  1SQB D;  3VP8 A;  3FWL A;  3CME P;  1IK7 A;  1VQM P;  1KFN A;  5CJ4 A;  3IFM A;  3H1H G;  2PFX A;  5H2F H;  1SVF A;  3H1K D;  2O1J A;  2M5A B;  4U3F J;  1P84 D;  2OQQ A;  1Q7Y Q;  5APW A;  2H88 C;  4L73 A;  1K05 A;  1Z56 A;  2AEJ A;  2WPV B;  3LIE A;  1KB9 E;  4OH8 B;  2YIU C;  4PV1 C;  4UB8 H;  3GHG B;  4W7Z A;  2KP8 A;  4DT0 A;  2KIK A;  4K3A A;  3CCS P;  2XKM A;  2O3J A;  3SSU A;  4JPZ B;  1BE3 J;  4PD4 D;  3Q1M A;  5KLV D;  1L0N K;  3MZW B;  3RK2 D;  3MD0 A;  1HUC A;  2XND H;  3TGU D;  4H13 D;  1J1D B;  1IFM A;  1JB0 J;  1SQP K;  2IZ1 A;  2IBZ D;  3PLN A;  3HE5 B;  3N7N A;  1NO4 A;  1VF5 B;  2YMY A;  3H6P A;  3W68 A;  3RK3 D;  3KHU A;  4GOD A;  2WPQ A;  5KLV G;  1XTC C;  3TSI A;  1GTW A;  1KTM A;  2QIW A;  3TGU G;  3ITK A;  1VQ9 P;  1CI6 B;  3M0D A;  3L70 G;  2M5A A;  1SQQ E;  3FWN A;  2M0B A;  1JMM A;  2AXC A;  4TT3 H;  1S5L H;  1KZU B;  3CX5 I;  1KYO D;  4M3L A;  1SQV J;  3E1R A;  4N78 D;  3G3Z A;  4NPF X;  1IFP A;  1NU1 J;  3A0H H;  2H89 C;  2E74 D;  1YIT P;  2A45 G;  3GHG A;  3GF7 A;  2AEM A;  2GA1 A;  3CCL P;  4GT1 A;  1W2B O;  1DEE G;  1P84 H;  2K88 A;  4D6T G;  2O01 H;  2Q1K A;  4YXW H;  5KJ7 A;  3AE5 C;  3A3Y B;  4Z1M H;  3TDK A;  5AVX B;  3P7K A;  4QMA A;  5AVR B;  1LJ2 A;  1ZLL A;  1RE4 A;  2CPS A;  2OYH B;  1YTZ I;  4PD4 H;  3L75 G;  2A06 D;  3P8M C;  5DJU B;  1TU3 F;  2P2U A;  2KUB A;  2KZJ A;  3M9B A;  2QJY C;  1L0N D;  1EZV D;  1NTZ K;  1CI6 A;  1GD2 E;  2W6J H;  3U1C A;  1SS1 A;  1J1E C;  1FZA A;  2ZT9 C;  5H2F E;  3L74 E;  1JTH B;  3EFF K;  1VL2 A;  1SQP D;  5CCG C;  2KS1 B;  1FZC A;  2FFD C;  4OWF A;  2QSI A;  5KJ7 D;  1NTM J;  1SQV K;  3H1J G;  3O8Z A;  4HKZ H;  1OMI A;  1NU1 K;  2W83 C;  3B5N C;  1L0N G;  3L73 D;  3VYI A;  1NHL A;  1QX8 A;  1JO5 A;  4L75 A;  1FZF A;  1LGH B;  1SLQ A;  3AE4 C;  1SP4 A;  1JOC A;  1OVU A;  1SQP G;  3L72 E;  1KYO H;  3ZDM A;  2WQY C;  3H32 B;  2NPS B;  4U3F D;  3P8C E;  1YHQ P;  3RBX A;  5APT A;  2OYH A;  1U7M A;  4B86 A;  3BVH A;  3AEB C;  4WB4 A;  3TNU B;  3P32 A;  1A02 J;  2RH0 A;  1N2D C;  2E76 C;  1PPJ D;  3H1H E;  1BE3 D;  1YBK A;  1L4A B;  4H44 C;  1T2K D;  1JTH A;  4JF7 A;  3OJA B;  2LR2 A;  3AEE C;  1SFC C;  2KS1 A;  3OA7 A;  1LTA C;  1VQL P;  1S5L E;  1OXZ A;  1X0T A;  2Y9Y A;  3MIW A;  1M1K Q;  3CXH I;  1DH3 A;  1SQB E;  1RHZ B;  3A0H E;  1GU5 A;  3T97 B;  1FU1 A;  3KDP B;  2CPB A;  5AVS B;  2FY8 A;  3EFG A;  1PPJ G;  3G71 P;  1QEX A;  3H1K E;  3PJS K;  3USS A;  1NTZ D;  1P84 E;  3A2A A;  1L2P A;  3GMA A;  2J59 M;  2KXP B;  1W2E A;  2AEF A;  1X8Y A;  3G4S P;  2HFE D;  1R8E A;  3H32 A;  3AE9 C;  2NPS A;  2WIT A;  1K9M Q;  4H0L B;  2ZYD A;  1K04 A;  2W8Z A;  2PAJ A;  5CCH D;  2P1J A;  1SQV D;  2FXP A;  1JUN A;  4PD4 E;  5KLV E;  5AW0 B;  2KNC B;  4AYC A;  2KB7 P;  3L70 J;  1NU1 D;  2A45 I;  3VP9 A;  1OFC X;  2YKQ A;  3V4Q A;  2H43 A;  4EDF A;  3CX5 D;  1DEB A;  1E5W A;  1JY3 P;  2YO3 A;  3RK2 C;  3RL0 C;  4R4L A;  2IBZ E;  2WZ7 A;  4ZKU A;  2Q7C A;  2IFN A;  3PRJ A;  1A02 F;  2WSE J;  3RK3 E;  1BDC A;  2KI7 B;  1VQ6 P;  1SQX J;  3KPE A;  1PP9 J;  2OGU A;  1Q81 Q;  2NPS D;  2RKL A;  4HYT B;  1Y8A A;  2QM7 A;  2IDB A;  1BCC D;  3RK3 C;  3A5T A;  3M0A A;  3MTU E;  2BAS A;  1FOS F;  2QJP B;  1PGJ A;  2WSF J;  2HR3 A;  3CC4 P;  3F5H A;  3L75 J;  3Q2Y A;  2QVA A;  4C7R A;  3L71 D;  2Q6Q A;  4C7N B;  3G9R A;  1KYO E;  1S9K D;  4Y99 C;  1G2C B;  1LTJ B;  1ZP0 C;  4N78 E;  3CPW O;  4RJT A;  1NAY A;  1DD4 A;  1YJW P;  1HVV A;  1VQ7 P;  1R5L A;  3FXE A;  2E5Y A;  4YTP C;  2KNC A;  3H1L J;  4I1L A;  1Y9B A;  3PHL A;  3LID A;  1N7S C;  1EDK A;  1S2E A;  2HYN A;  2P10 A;  1BGY D;  4LC1 A;  1VPC A;  3HUS B;  3H1J J;  3KZI H;  4DCK A;  5K5G B;  4NPD A;  3HD7 C;  3BRT B;  1EDJ A;  5KAI H;  2N9Y B;  4JYC A;  3MP7 B;  2WWW A;  2A06 E;  2Q5U A;  1NTM G;  3SFE C;  3WMM 0;  1SQX K;  2OYI B;  1L0N E;  2XV5 A;  4H0L D;  1EZV E;  3CX5 H;  1HWT C;  1JY2 N;  1FDO A;  1N7L A;  2MJZ A;  4GIF A;  2AXT H;  2QEX P;  1RE3 A;  1SQP E;  4HB1 A;  4HH2 A;  1GL2 A;  3MUD A;  1G2C A;  1KOR A;  1LTJ A;  5M1B A;  3VMX A;  1URQ B;  4I7Z B;  2Z4E A;  1KIL B;  3L73 E;  2BCC G;  3IAO A;  2WVR A;  5KJ7 C;  3SFD C;  1JY3 O;  3CCU P;  4KJM A;  2C9L Y;  5AVV B;  2J5U A;  2ZJS E;  4WY4 B;  2JJL A;  1RE4 C;  1WT6 A;  2KZI A;  3HUS A;  1M1J B;  1RF1 B;  1OW6 A;  1S1C X;  3CXH D;  4U3F E;  4L76 A;  1G1J A;  2MKV A;  4HJG H;  3BAS A;  2ZXX A;  3SWK A;  1RF0 C;  1OW8 A;  2PRR A;  3CC2 P;  3L4F A;  2QG4 A;  4XE5 B;  2IZ0 A;  4XA4 A;  1YIJ P;  3CWB E;  2KYV A;  2FYN C;  1DX7 A;  1GL2 D;  1JM0 A;  1BE3 E;  5KTB A;  2E5T A;  2N1T C;  2JWA A;  3L70 D;  3S4R A;  2LXC B;  2O01 N;  5TIS H;  1HGV A;  1U57 A;  1MKM A;  4DOJ A;  3RL0 g;  1FZC C;  3ABV C;  3K5B A;  4ZKP A;  1NVO A;  1M90 Q;  1AA0 A;  1T3U A;  5APV A;  3IF4 A;  1URQ A;  2Y0E A;  2PP6 A;  2YIU B;  2RMZ A;  4PV1 B;  4NPE A;  1KIL A;  2K37 A;  3PP5 A;  1SQX D;  4IFF A;  4D6T D;  1YJ9 P;  1SQQ J;  1PP9 D;  1NTZ E;  1ZN5 A;  1FJP A;  3FXD A;  1PFI A;  3CLQ A;  1PGO A;  4WY4 A;  1AQT A;  1EDI A;  3AE8 C;  3CCM P;  1M1J A;  1NAF A;  1RF1 A;  1MUU A;  5KAF E;  3KZI E;  2FYU J;  2R3C A;  3L75 D;  2E75 C;  2M3E A;  4DJG A;  1HH0 A;  3AE2 C;  2HG5 D;  5KAI E;  5GTI H;  1SQV E;  3Q3D A;  1E79 H;  1YTZ T;  1NU1 E;  1SQX G;  3TK1 A;  1PP9 G;  1FE6 A;  4GOE A;  1VQN P;  5AW6 B;  1URQ D;  2HPC B;  4UB6 H;  3V2N A;  3H1L D;  3CX5 E;  3BCC G;  3CXH H;  3HE5 A;  4KT0 J;  4O9B A;  1JNM A;  4RES B;  1KIL D;  2BEZ F;  1KN7 A;  2AXT E;  3EWK A;  3NXS A;  1CW5 A;  5CMZ A;  5EFW B;  3H1J D;  1HBW A;  2ITA A;  4WY4 D;  4OGQ C;  2Q3E A;  5AVU B;  1AVO A;  1ZRT E;  3M06 A;  3OW2 O;  1QVF O;  1BCC E;  2YKP A;  1IFN A;  1M7L A;  3H1L G;  1YQ4 C;  1X9V A;  3PH0 A;  2FXO A;  3O6Q B;  1QL2 A;  1SQQ K;  1JMB A;  2QE7 H;  3L71 E;  4MN4 C;  2A45 H;  1S9K E;  3FGA D;  1ZOY C;  4UB8 E;  2Z5H A;  5AVT B;  1VF5 D;  2FYU K;  2B87 B;  1FAV A;  3U1A A;  2Z5I A;  1PIX A;  3CCJ P;  1PV3 A;  3AEA C;  3V4W A;  3EQ2 A;  3WUT A;  4I2L C;  1LT9 C;  2ZXE B;  1L0L G;  4Y28 J;  1Q82 Q;  2RN0 A;  2FYZ A;  2WSF H;  1BGY E;  2QJY B;  1LTB C;  1CZQ A;  4A7P A;  1GK4 A;  4PV1 D;  5TIS E;  2W6A A;  3CI9 A;  2R3S A;  2D2C C;  3GF3 A;  1RQV A;  1J1E B;  2POH A;  2R5D A;  5KKZ C;  1X22 A;  2K1A A;  2ZT9 B;  3AEC C;  3D6Z A;  1VQ8 P;  2B89 A;  2ZVO B;  2BCC J;  3I5C A;  1OZH A;  2W90 A;  3H1I G;  1LTG C;  3VMA A;  5AW9 B;  1HTL C;  2YXR B;  2FFD B;  1FZG A;  2ZFC A;  1KV4 A;  3A0B H;  2CK3 H;  1ZXG A;  1N86 A;  4K35 A;  3B5N B;  5CCH A;  4IFM A;  2IX7 C;  3LW5 J;  1H88 A;  3HE4 B;  5KLI C;  1QGK B;  1YYC A;  2K9Y A;  3IN6 A;  1J2J B;  2JKV A;  2P67 A;  2YXQ B;  1NTM K;  1LWU B;  5APU A;  3GW6 A;  2IYP A;  2UWJ E;  1FOS E;  5GTH H;  1VQK P;  1OVR A;  2ZVN B;  1GZL A;  1WMK A;  2NRG A;  5GTI E;  3U59 A;  2G8Y A;  2YKO A;  1H89 A;  1RQU A;  3VMY A;  1N73 C;  2E76 B;  2HLO A;  2OTK E;  4UB6 E;  2JEE A;  1SQQ D;  3CXH E;  4H44 B;  3I56 P;  1OVV A;  1T6A A;  5AW5 B;  3D71 A;  2B88 A;  4JQ0 D;  1EXJ A;  1RY3 A;  4ZMD A;  3TNU A;  1SFC B;  5AW7 B;  2FYU D;  1IK9 A;  1FJK A;  3TGU E;  3AE1 C;  1L4A A;  3CD6 P;  1NTK J;  1RE3 C;  3L70 E;  1KD1 Q;  3FX0 A;  1YI2 P;  1GL2 C;  3MUD C;  1SQQ G;  3HE4 A;  3VOP A;  4H13 C;  2KLU A;  3NMD A;  4IL6 X;  2L5G B;  1S3J A;  3CL3 D;  1KFM A;  1LWU A;  3T97 A;  2FYU G;  1NOH A;  4IL6 H;  1ZV8 A;  1D7M A;  3BCC J;  1GU4 A;  1S4X A;  2ZT9 D;  1IJD B;  4D6T E;  1AQ5 A;  3AE3 C;  1QLE D;  1OWA A;  1H0T B;  1OX3 A;  5B5E H;  3VMZ A;  1L4A D;  3B4S A;  2FBW C;  3RK2 B;  3RL0 B;  3L75 E;  3B5N D;  2K3R A;  1X79 B;  1NTM D;  1FBM A;  3HRN A;  4W80 A;  4RO0 A;  2E74 C;  2BEQ D;  2R32 A;  1K73 Q;  4N6J A;  1VDF A;  3AEG C; 
#chains in the Genus database with same CATH homology
 1IFJ A;  1NTZ K;  1CI6 A;  5KTB A;  1GD2 E;  3U1C A;  2C0W A;  1J1E C;  1FZA A;  2N1T C;  5AW1 B;  1HGV A;  4DOJ A;  2E43 A;  1JTH B;  1FZC C;  5BU5 A;  1NTK K;  5CHX A;  5APX A;  3TYY A;  1T8Z A;  2LKM A;  1LTI C;  1JY2 O;  2I1K A;  5CCG C;  1FZC A;  2KOG A;  4ZKP A;  4GKG A;  5AVY B;  3L36 A;  2FFD C;  5KJ7 D;  5CCG A;  1SQV K;  3O8Z A;  1T3U A;  5APV A;  1NU1 K;  1URQ A;  3M0D C;  2XZR A;  2FFD A;  3B5N C;  2PP6 A;  5BVZ A;  2YNY A;  3VYI A;  2WTY A;  1NHL A;  1KIL A;  3PP5 A;  1JO5 A;  1XTG B;  1FZF A;  2M8R A;  1LGH B;  1SLQ A;  4IFF A;  2GM4 A;  1SP4 A;  3B5N A;  4WBA A;  1NKZ B;  4AQR D;  1JOC A;  5APQ A;  1LTJ C;  1ZN5 A;  3UIA A;  1FJP A;  1GDT A;  3B8E B;  3V5B A;  1PFI A;  3CLQ A;  3GHG C;  4WY4 A;  4C7N A;  2YO2 A;  3KQG A;  3H32 B;  1M1J A;  1NAF A;  2NPS B;  3L35 A;  1RF1 A;  1MUU A;  4EOT A;  1LT9 A;  5BU8 B;  1N7S B;  3P8C E;  5AVQ B;  2R3C A;  3A7O A;  3R2P A;  5APT A;  1SQB K;  2OYH A;  4B86 A;  1N73 B;  1HH0 A;  3BVH A;  2WPS A;  4EIJ A;  2HG5 D;  4WB4 A;  2J58 A;  1T3J A;  3HD7 B;  2GUS A;  1YTZ T;  1J1D C;  3TNU B;  1EQ7 A;  3P32 A;  1A02 J;  3HUS C;  1N2D C;  3TK1 A;  5CCG D;  1IO4 A;  5AW6 B;  2H8P D;  1URQ D;  3M9Q A;  1L4A B;  2HPC B;  3OAK A;  3V2N A;  1T2K D;  2C0X A;  1IFI A;  4O9B A;  3HE5 A;  1JNM A;  2Q3I A;  1JTH A;  4RES B;  3VN0 A;  2M3B A;  1KIL D;  4JF7 A;  4AUW A;  3OJA B;  1SFC C;  5AVZ B;  3OA7 A;  3NXS A;  1CW5 A;  1LTA C;  2Q9I A;  5CMZ A;  1GL2 B;  2R5B A;  1OXZ A;  2OYI C;  3M91 A;  3MIW A;  1DH3 A;  5KLV K;  1HBW A;  1SFC A;  2OAR A;  4WY4 D;  2FXM A;  1GU5 A;  1MFZ A;  4DZO A;  1FU1 A;  5AVU B;  2OYI A;  3KDP B;  2CPB A;  5AVS B;  3M06 A;  3EFG A;  1L0L K;  2GUV A;  2YKP A;  3RL0 D;  1IFN A;  1ZR4 A;  1M7L A;  2XU6 A;  1X9V A;  3HTK B;  3RK3 B;  3BAT A;  3NTN A;  1QL2 A;  3A2A A;  2J59 M;  1SQQ K;  1G1I A;  1HJB A;  1W2E A;  1URQ C;  1ZR2 A;  3SWF A;  3BRV B;  1WRG A;  1X8Y A;  2HFE D;  1T2K C;  2VRS A;  3H32 A;  2A45 H;  1MV8 A;  5AW2 B;  2NPS A;  1S9K E;  2WIT A;  3P8C D;  1KIL C;  1IC2 A;  1N7S A;  4LGD E;  4Y99 B;  2PAJ A;  5CCH D;  2Z5H A;  5AVT B;  2FYU K;  1N73 A;  1KQL A;  2P1J A;  5APS A;  1JUN A;  3SWY A;  1FAV A;  1QL1 A;  2XDJ A;  5AW0 B;  2Z5I A;  3U1A A;  4AYC A;  2KB7 P;  3HD7 A;  3C9I A;  2A45 I;  3VP9 A;  3V4W A;  4WY4 C;  3EQ2 A;  1GK6 A;  2YKQ A;  3V4Q A;  2H43 A;  2W6B A;  2HOD B;  1M1J C;  1RF1 C;  1NH4 A;  2FKW B;  1SFC D;  4I2L C;  1LT9 C;  2IFM A;  2ZXE B;  2QM8 A;  3L37 A;  1DEB A;  1LTT C;  2O1K A;  2FYZ A;  1E5W A;  2OYH C;  1JY3 P;  2WSF H;  2YO3 A;  3RK2 C;  3RL0 C;  1LTB C;  2WZ7 A;  1CZQ A;  3LW5 H;  1HGZ A;  1GK4 A;  1NKN A;  4ZKU A;  2W6A A;  3CI9 A;  2Q7C A;  2H7H A;  2IFN A;  1J1E B;  2POH A;  2N1T B;  2R5D A;  1A02 F;  2C9N Y;  3MGN A;  1FZC B;  3I5C A;  2P7J A;  1LTG C;  3V2R A;  3VP8 A;  4IFD K;  5AW9 B;  1KFN A;  1HTL C;  3KPE A;  5CJ4 A;  2NPS D;  2FFD B;  3IFM A;  4HYT B;  2QM7 A;  5CCH C;  1N7S D;  3RK3 C;  3A5T A;  3M0A A;  1SVF A;  1FZG A;  3MTU E;  2ZFC A;  2BAS A;  3KYQ A;  4C46 A;  1FOS F;  1N86 A;  2O1J A;  2KLV A;  3B5N B;  5CCH A;  4IFM A;  3VTP C;  1MZ9 A;  2IX7 C;  5APW A;  2E42 A;  1H88 A;  3HTK A;  3HD7 D;  3HE4 B;  1Z56 A;  4C7R A;  1YYC A;  3LIE A;  4OH8 B;  4C7N B;  3II6 A;  1JY2 P;  1S9K D;  4Y99 C;  1J2J B;  1G2C B;  1LTJ B;  4N78 E;  3M9H A;  2P67 A;  1NTM K;  3GHG B;  1LWU B;  2KP8 A;  4W7Z A;  5APU A;  1HVV A;  2XKM A;  1FOS E;  1FZB A;  1L0N K;  1JY3 N;  3RK2 D;  1GZL A;  3MD0 A;  1HUC A;  4N3Y B;  1RF0 A;  3U59 A;  4I1L A;  1FDM A;  2KSJ A;  2WT7 B;  2YKO A;  2HOD A;  2NPS C;  3V2Q A;  1H89 A;  3LID A;  1J1D B;  1IFM A;  1N7S C;  2HYN A;  1SQP K;  2I1J A;  4JYB A;  4LC1 A;  1VPC A;  3HUS B;  3VMY A;  1JCC A;  4KHX A;  1N73 C;  2HLO A;  3HE5 B;  1AFO A;  2JEE A;  3N7N A;  4W7Y A;  5AW3 B;  1NO4 A;  3NFQ A;  2YMY A;  3HD7 C;  3H6P A;  3BRT B;  5APY A;  2N1T A;  2WSE H;  4JYC A;  4LLH A;  5AW5 B;  3RK3 D;  2WWW A;  2WPQ A;  1GW3 A;  1XTC C;  3E1I A;  1RY3 A;  2Q5U A;  3TNU A;  1SFC B;  3TSI A;  1L4A C;  1GTW A;  1NWQ A;  5AW7 B;  3V2P A;  1IK9 A;  3WMM 0;  1FJK A;  1SQX K;  2OYI B;  5AVW B;  2XV5 A;  1CI6 B;  1HWT C;  1L4A A;  2XNX A;  2HPC A;  1JY2 N;  1RE3 C;  3M0D A;  1N7L A;  3N4X A;  1JCD A;  2MJZ A;  1GL2 C;  4GIF A;  3HE4 A;  3VOP A;  1JMM A;  1RE3 A;  4HH2 A;  1KZU B;  3NMD A;  1LWU C;  4M3L A;  1GL2 A;  3MUD A;  2W27 A;  4N78 D;  3G3Z A;  1LTS C;  1G2C A;  1LTJ A;  2L5G B;  3CL3 D;  3VMX A;  5AW8 B;  1URQ B;  2A45 G;  1KFM A;  1LWU A;  3GHG A;  3T97 A;  1FZE A;  1NOH A;  2IPP A;  1ZV8 A;  2Z4E A;  3IR9 A;  1KIL B;  1CSB A;  4GT1 A;  2N1T D;  1GU4 A;  1H8A A;  5KJ7 C;  1IJD B;  1AQ5 A;  2WT7 A;  1JY3 O;  2O01 H;  1OWA A;  1GW4 A;  2C9L Y;  5KJ7 A;  5AVV B;  3A3Y B;  4WY4 B;  2JJL A;  1RE4 C;  5AVX B;  1WT6 A;  3P7K A;  3HUS A;  1M1J B;  1RF1 B;  5AVR B;  3VMZ A;  1L4A D;  1LT9 B;  1ZLL A;  1G1J A;  3BAS A;  2N9B A;  1IFD A;  1RE4 A;  1RF0 C;  2CPS A;  2WPR A;  5CJ0 A;  2OYH B;  3RK2 B;  3RL0 B;  1YTZ I;  3B5N D;  3P8M C;  3L4F A;  5AW4 B;  4XE5 B;  2WSC H;  1X79 B;  4XA4 A;  2P2U A;  1FBM A;  3HRN A;  4W80 A;  2KYV A;  1DX7 A;  1GL2 D;  3M9B A;  2R32 A;  4I6M C;  4N6J A;  1VDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...