4IFVB

Detecting allosteric sites of hiv-1 reverse transcriptase by x-ray crystallographic fragment screening
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
424
structure length
412
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
molecule keywords Exoribonuclease H, p66 RT
total genus 119
structure length 412
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ifvB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ifvB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ifvB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ifvB03
4YMEA 3QO9A 1RA7A 5J2NB 3MF5A 3H5YA 4IR9A 4GC6A 2XI3A 4IRKA 4NLGA 4ECRA 4ED2A 2WOMA 5KG6A 3PJXA 5DG7A 1LWCB 1JLEA 1S6PA 4NLWA 3Q8SB 2OPPB 2XI2A 4NLDA 5KFJA 3DLKB 1C2PA 2IA6A 1J5OA 2OPSB 5J2QB 5HLFB 3CJ5A 1QE1B 1D0EA 2CJQA 5KG1A 3Q8RB 1C0UB 1HQUB 3DOKB 1R0AA 3Q8PB 1UWBB 1IKVB 4IFVA 3TAMB 2FLNA 1QUVA 4RNMA 1TKZB 1FKPB 2VG6B 3D28A 3BQ2A 1YVFA 4MK9A 2B5JA 3GYNA 3CDEA 1LWEB 5KFOA 3BQ1A 4K4SA 2HNZA 4TY9A 1EETA 1ZTWA 4KHMA 4MIAA 5J1EB 4R0EA 5KT7A 1K1SA 4O3SA 2HNZB 4TN2A 1RTHB 2C2RA 4J9KA 3G6VA 1C1CA 2UUWA 1HPZA 2WOMB 1S1UA 2YKMA 1S0NA 4Q8EA 5KFFA 5HP1A 2AQ4A 2YKNA 5F9LA 1LWCA 3EPGA 3BJYA 4ECWA 4DL2A 4ED8A 4ED0A 3MR6A 4G3IA 2OPQB 3ISNC 4QW9A 5HBMB 4NLUA 3BSOA 1SV5A 1JX4A 3QO9B 5J2QA 5HLFA 4WE1B 3IG1A 3BGRA 2W9CA 5J2MB 4DL5A 2R8HA 1S0MA 5J2PB 3VQSA 1S9GB 1C0TB 3H4DA 4ED7A 4DL6A 3FQLA 3BQ0A 3CDWA 3DLGB 2J6SA 1S1TA 1KLMA 4ZP7A 5C25B 4YR0A 4IDKA 1BQMA 5K14B 4YP3A 5JXSA 5DQHA 4QWAA 1C1BB 2R2SA 3V4IB 1S1VB 3KJVA 2R2RA 2AWZA 4RNNA 3KHRA 1KHVA 4DL7A 1JLFB 1UWBA 2FVSA 2OPRB 4WYLA 5KFWA 4O3PA 4TQSA 5I3UA 5I42A 1RTHA 1QE1A 2C2EA 2YNHB 4ID5B 2V9WA 2YNGA 3DI6B 3BSAA 2FLLA 4LQ9A 2B5JB 4RW7A 4J9LA 3LP2A 1JIHA 4KE5A 4WFZA 3QZ7A 3DLEB 3DRPA 4NCGB 2IM1A 2VG5B 4RU9A 5KFSA 2W9BA 2J6TA 3GV8B 2RKIB 1RTJA 1S9EB 2XC9A 5JUMA 4O3OA 1SV5B 2BANB 3E51A 1IKXA 4YQWA 2AGPA 5KG0A 5KFDA 1N56A 4R8UA 2UVRA 2XCAA 4EEYA 2J6UA 2ZD1A 4K4VA 3QIPB 4R5PB 1IKXB 3MEDB 2JEFA 5KFIA 3LP0B 4LQ3A 5KFRA 2ZKUA 5F9NA 4YR3A 2QV6A 3OSNA 3DRSA 1WNEA 5EUHA 5HROA 5F8MA 4EO6A 3PR5B 3LP0A 2W8LA 4ZP6A 1TQLA 4ECZA 2XCPA 4K4TA 3HKWA 2D7SA 3IS9B 4H4MB 3M9MB 4IH6A 3DMJB 4LSNA 3HVWA 4ZP8A 1RT7B 4QW8A 3PR4A 3EPIA 2DPJA 5C24A 4KBIA 2BQ3A 1FKOB 1HQEA 1VRTB 3LAMA 3MEGA 1EETB 4NCGA 3QGGA 3LP2B 5C42B 1JLCA 1DTTB 1TVRB 1DLOB 3H2LA 3ISND 2I1RA 4EBDA 3T5JA 4DL4A 3OSPA 4K50A 4H4OA 4J9SA 3G6YA 3C6TB 3UQSA 3CJ4A 5C42A 3QGIA 4J9OA 5I42B 5I3UB 1U09A 1TVRA 2JC0A 5KFHA 2AGQA 4PQUA 4TY8B 4Y3CA 1HMVA 3JSMB 2GIRA 5DGBA 1S1VA 2V4RA 3PZPA 2WTFA 1QAJA 1TKXB 1N5YA 1BQMB 2E9TA 5K14A 4TXSA 1RA6A 3JYTA 1K1QA 2D41A 2GC8A 3FSIA 2YNGB 4MIBA 1SUQA 3NKYA 1JLAA 1J5OB 2QE5A 2HNYB 3NGDA 5L1IA 1RYSA 2FVQA 4MFBB 2E9RX 2UUTA 3OL9A 1N6QA 1RT5B 1S49A 4TLRA 5F8IA 3LP1A 3CJ0A 3MEDA 4ZHRA 4EO8A 4TQRA 3GIKA 5KFQA 4IDKB 3RAXA 4WYWA 3G6XA 2VA2A 3E01B 2WB4A 4KAIA 1MU2A 5FDLA 3QIPA 2BQUA 4GC7A 4O4RA 2CKWA 3BREA 1DTQA 4IOBA 3MR3A 4PWDB 5DLGA 3V81B 3C6UB 1JLBB 3ICLA 3H4BA 2AGOA 2WCXA 4KFBA 4Q0BB 3KHGA 3KLIA 4RW7B 1HMVB 3GIMA 3KK3B 3DLEA 3DRPB 5KT5A 4KO0A 1RT3A 4JUZA 4ECVA 2R8GA 3IGNA 2C22A 1S97A 2BANA 1S1WA 3FRZA 3HVAA 1HPZB 2VG6A 2YKMB 3DYAB 5KG2A 1VRTA 4ECSA 4J9QA 4G1QA 4PUOA 1T03B 3TAMA 4TYBA 5KFYA 4PQUB 5C24B 4TY8A 1TV6A 2XGQA 3RB3A 4ICLA 4IQXA 1XR6A 1RTIB 3C6TA 1RT4A 3N6MA 3H40A 2FLPA 3M8QA 4ZVGA 3FFIA 1DTTA 4DEZA 1W25A 1JLEB 1S6PB 5EWFA 1JLGA 3IG1B 1C0TA 1HNIB 3T5HA 3GQCA 1JLAB 4WXWA 5KFZA 4EBEA 1NHVA 2FJXA 2C28A 3KHHA 2BQRA 4RW8A 3GILA 1JXLA 1RYRA 5KT4A 3DLGA 3LP1B 4RNFA 3NAHA 4RW4B 5HP1B 4NLSA 3UDLA 3QZ8A 4IG3A 2IM2A 3I0RB 3M9NB 4ECUA 5DLFA 5J2MA 3LAKA 3V6DB 2B43A 5KG7A 2JLEA 2JC1A 4MFBA 3GIIA 2ASDA 1RT1B 1TL1A 2WONB 3I0SB 5KFBA 4RZRA 3BSNA 5DGAA 4KHRA 2ASLA 1VRUA 4R8UB 3T1AA 1C1BA 3PW4A 2EC0A 2ZE2A 4KV8A 4H54A 1C1CB 4IKAA 1JLFA 4K4XA 1S9EA 1VRUB 5DQGA 4ZPDA 2AX1A 3MECB 5KFGA 4B3OB 3LALA 3KLEA 1XR5A 3KK3A 1RAJA 4EYHB 1ZETA 1S9FA 4F4YA 1C0UA 1HQUA 1RT3B 3DOKA 1HNVA 3KHLA 2D3ZA 3KLEB 3KLIB 4Y34A 2B6AA 4YR2A 2ALZA 4WE1A 3ITHA 1TL3B 4IG0B 5F8GA 1T3NA 3NBPB 3I5CA 5J2PA 5KFKA 4KKOB 1T05B 3H98A 4IG3B 3LANA 4RW4A 4O3QA 5KFXA 4O44A 2HNDB 5CYQA 4O4GB 3DMJA 4LSNB 1EP4A 1KLMB 5KFAA 5KFCA 4QPXA 1T03A 3KK1B 2FVCA 4FS1A 3V6HA 4RNOA 5D3GB 1JLGB 4XO0A 3KLFA 4NLQA 1S0OA 5HROB 1S1UB 3NL0A 5KG4A 3KK1A 3T19A 4JV0A 1FK9A 4I7FA 3CDUA 5CYMB 4NZ0A 4QWBA 1DLOA 5J2NA 4FS2A 3JYTB 3DOLB 4EBCA 4WZQA 4G1QB 4PUOB 5KT6A 3MEEB 3HVTB 3KLGB 4NLRA 4NRUA 4URQU 3KK2A 2R2TA 1RT7A 3QIDA 3PW2A 3M8QB 3OL7A 4KB7A 4ZPCA 2I5JB 2OH2A 2OPSA 1RT1A 1JLQA 1BQNA 1IKVA 1LW0A 4IFVB 4O3NA 1MMLA 5KFNA 3MECA 4K4ZA 2I5JA 4RUCA 3BGRB 2W9CB 2AU0A 1S1XA 3QGHA 4K4UA 2AX0A 4K4YA 3TQ1A 2BE2A 4ECXA 4O3RA 1RTDB 1QAIA 2WK4A 4IFYB 2XGPA 5C25A 1IM4A 1S1TB 5KFPA 2VG7B 1N5YB 1FK9B 4I7FB 4KSEB 4O44B 3ITHB 4QWCA 3BSCA 1S4FA 2W7PA 4QWEA 1JKHA 1IKWA 3Q8QB 2FJVA 2HNYA 3PJWA 2V0NA 3IRXB 3DI6A 5L1LA 4I2PA 3CVKA 4U7CA 3IN5A 3H5XA 4IRCA 2IBKA 4ZP9A 3OL8A 3I5AA 2VA3A 2UVUA 3FDSA 4B3OA 3DYAA 2W9BB 3RB0A 4FBUA 3EZUA 3N6NA 2HMIA 4ZVEA 4QWDA 2IM3A 1RT2B 3N6LA 2B6AB 3GIJA 1RTIA 4KO0B 2BR0A 3IGVA 1IKYA 3UPFA 4IR1A 2YNFB 1LW2B 1RT6A 2BRLA 5KG5A 2FJWA 3DRSB 1OS5A 3KLHA 4Y2AA 3KK2B 3SFUA 2R2UA 1EP4B 1REVB 2VG7A 4IH5A 3CWJA 3KLVA 5KT3A 4RW8B 3MEEA 1GX6A 3IS9A 5F8HA 4NLXA 4HYKA 4DL3A 4Q45A 2DPIA 3SFGA 2ASJA 3I5BA 5F8LA 3MFHA 2BE2B 4U6PA 4NLVA 3DM2A 4RW6A 1RTJB 3RB4A 2IMWP 1JLBA 3H5UA 2OPPA 4TYAA 1RT4B 2XWYA 3DM2B 2JEGA 4RW6B 4JV1A 2R8IA 2V4QA 2IC3A 3FFIB 1D1UA 1RTDA 2BRKA 4IFYA 2OPQA 1SH2A 3PW5A 2C2DA 3QYYA 2IM0A 4WXOA 2IC3B 4NLOA 2ZE2B 4KV8B 1S1WB 5EWEA 1FKPA 2RKIA 1N6QB 3JSMA 1KHWA 1N48A 5J1EA 2FVRA 2YNFA 2FVPA 1RDRA 1TL3A 4IG0A 1NHUA 3MR5A 3M9OB 3RBEA 1SUQB 4I2PB 2JEJA 3MFIA 1Z4UA 2IJFA 1HYSA 2ILYA 5KFVA 3QLHA 3V6DA 3M8PB 2W9AA 3FQKA 4RNHA 4WFYA 1SH3A 5KFUA 3RAQA 4PWDA 1FKOA 3UR0A 3CO9A 3V4IA 4MKAA 3KJVB 1TKZA 4M94A 4JV2A 1LW2A 4XPCA 5DG8A 3KMSA 3H59A 4H4OB 4MK7A 4Y2CA 3OL6A 4EYIB 2HNDA 2R8JA 3NAIA 4F4WA 5DQIA 4LSLA 1MU2B 5FDLB 2F8EX 2HMIB 2RDIA 3I0RA 3GV7B 4RW9A 1LWFA 4ZVHA 1TKTA 3CJ2A 4MK8A 4J9MA 3DDKA 4ED1A 1SH0A 2YNIA 5EWGA 3OHBA 4ZPAA 3MTKA 3KOAA 2HWHA 2WRMA 5EDWA 4J9RA 1XR7A 4KKOA 1T05A 4FBTA 3PHEA 2YNIB 2RF2B 4XPEA 3OHAA 3TVKA 1S10A 2IAJB 3GV5B 5KT2A 3M8PA 1N4LA 3QLHB 1RT5A 4K4WA 4DG1B 1TP7A 5HBMA 4ICLB 2VG5A 4ED3A 5F8JA 1RT6B 1BQNB 1LW0B 2WHOA 1CSJA 2ILZA 2GIQA 4Q8FA 2HAIA 3BR9A 1S6QB 1REVA 4MH8A 3V81A 4NLTA 2IJNA 4Q43A 1DTQB 4ZMMA 3HVTA 4RUAA 3NMAA 1I6JA 2OPRA 1HQEB 3MEGB 4ZVFA 5T14A 3DOLA 3OLAA 3E01A 3MR2A 4IRDA 3RBDA 5CYQB 1JLQB 1TL1B 2WONA 3I0SA 2YNHA 4ID5A 4NLYA 3T5LA 2R8KA 1LWFB 2O5DA 1NNDA 4IH7A 3DLKA 1GX5A 3IRXA 2ATLA 2D3UA 5D3GA 4WFXA 2E9ZA 4F4XA 1IKWB 4KFBB 4Q0BA 4LSLB 4M95A 3G86A 4Q44A 4WZMA 2RF2A 4NLPA 4ECYA 5L1KA 1R0AB 4R5PA 1HARA 4H4MA 5KFLA 2ZD1B 2JEIA 4ZPBA 5KFEA 3RB6A 5KG3A 2UVVA 1HNIA 4HKQA 3NBPA 1JKHB 3D5MA 4MKBA 5L1JA 4J9NA 4F50A 4RW9B 4F4ZA 1T94A 3V6KA 3PW7A 1S6QA 1HYSB 2W8KA 2UVWA 4I2QB 3T5KA 3OLBA 1TV6B 2RDJA 1ZTTA 3V6JA 1S48A 1HNVB 5KFMA 2W7OA 4ECQA 4O4GA 1IKYB 1TKXA 3CJ3A 4I2QA 2YKNB 3CIZA 4ED6A 5C5JA 3SI8A 3HHKA 4NRTA 2IAJA 3C6UA 1S1XB 3PW0A 4URSA 3KLHB 5KFTA 3DRRB 5DG9A 5CYMA 3H5SA 4X2BA 1S9GA 3KNAA 3DRRA 4ZHRB 4OL8A 1LWEA 4DG1A 1TKTB 3PVXA 1RT2A 1JLCB 5L9XA 4J9PA 4ECTA 3KLGA 2HWIA 4URGA 3KMQA 3KLFB 4NYZA 5F8NA
chains in the Genus database with same CATH superfamily
4U67Q 3QO9A 1X4HA 2Q43A 4LFCJ 3MF5A 2F3JA 2W4CA 4CO3A 1YJNS 2DCUB 4USWA 1CJUB 2H65B 4ED2A 2DBBA 2NQPA 3HK2A 2YKOA 1YLXA 1SKWA 2RS2A 2E29A 3RBXA 1G7CB 2PEBA 4IUFA 2OPPB 2XI2A 4P74A 2BJ8A 4LSZB 3HD2A 2XQCA 1PILA 2AMCB 3DLJA 3FBFA 5KG1A 1C0UB 3Q8RB 1R0AA 4DV0F 2GIFA 4HDHA 1YI2S 1VBZA 3Q89A 5FIIA 1IKVB 4DPXA 3RW6A 2CUYA 4LIRA 2LECA 2BYCA 3CJRA 4BHQA 5BXIA 2VG6B 2V67A 2UV8G 2B5JA 2FB0A 2Z8QA 1O8BA 5CCMA 4A8MP 2P9EA 3FSXA 3QQCD 1HNZF 5KFOA 2AEFA 3CC4S 4K4SA 1X60A 2HNZA 2HS3A 3TZZA 1EETA 1FRHA 1R8CA 3DRYA 2C1EB 1YJ9S 4DR2F 1K1SA 3TEHB 2EPIA 4TN2A 4DL0C 1RTHB 2C2RA 3CMQA 1QVGR 1N5TA 4KY3A 1SJ4P 1C1CA 1ZYQA 3C2PA 2WVCA 2WOMB 1EIYB 2CPIA 2HVDA 3EDRB 5HP1A 4F3MA 3ET6B 1LWCA 2AEJA 2Q6BA 3QWUA 3T6BA 3J81j 3BJYA 3F73A 4ED8A 2BKPA 1W2IA 3MM7B 4DUZF 1NKEA 2DR9A 2BJEA 1SBRA 2HK3A 5IFMA 3HD1A 3W9IA 2B0GA 1EARA 4NLUA 3BEGB 3CTRA 3GZ7A 5J2QA 5HLFA 4L73A 4L72B 1VFJA 1VK3A 2C2KB 2HG4A 3AB2B 3BN4A 2W9CA 3MD3A 4DL5A 1YHQS 1TFWA 3VQSA 1KP6A 4PG4A 1G4CA 2IVFB 3BH6B 4X66J 4CT9A 4HACB 4Q2LA 4CCHA 3UN5A 1S1TA 4OJ3A 1KLMA 4RJVA 5C25B 1ZZFA 1A6LA 4IDKA 4LREA 4NZ6A 5K14B 4ZN3A 4ZJOA 4OYIA 5DQHA 2H5EA 4QWAA 1FNXH 2R2SA 3V4IB 2CJXB 3KJVA 2IA0A 3N0VA 1XMBA 1UWBA 3TW0A 2OPRB 4WYLA 3R9LA 5I4MA 4PEOA 5KFWA 1KDNA 3POTA 2H48B 2R7RA 4AQYF 3I6PA 4LF7J 2AJQA 2NYIA 2IRXA 4ID5B 1CULB 1UZDA 2ZC4A 2B5JB 3LP2A 1WTBA 1T95A 2QLXA 4RPFA 4QR1A 2W9BA 2VG5B 3F56A 5KAKA 1G6BA 1RWUA 4DQRA 3M6VA 1NZ8A 2OHDA 1RTJA 1S9EB 2CG8A 5GAGU 5JUMA 2YH1A 1KQGB 4ZPTR 3E51A 2HSEB 1EB0A 3HP6A 5KG0A 1N56A 1HBOA 4LF8F 1AZSA 2UVRA 2XCAA 1JB0C 3A1YG 4LR7A 1RISA 2VDHA 4OZ2A 4LQ3A 5KFRA 4BDPA 1CQMA 2ZKUA 1M5VC 1WOPA 5DJBA 2NS1B 3NWRA 1R6YA 5GAEI 5HROA 4JI4F 3PR5B 3LP0A 1OWXA 4OV6A 5FLXY 1X9WA 3G9CA 1T9UA 2DHXA 1ZETA 2KN4A 1TQLA 2BXJA 4HVZA 2N7CA 1WHWA 2BW7A 3IS9B 1N52B 4H4MB 1WORA 3BBFA 3HKWA 3DMJB 4LSNA 2BMBA 4QIFA 5GVQA 5D6GA 2V4JA 3EPIA 1SJ1A 5D0RA 2DPJA 2LYVA 2AW0A 1NPRA 2ZITA 4DXLA 3K5OA 1UA0A 4WU3A 1SKSA 4QYZJ 2DXDA 3LP2B 1JLCA 4LR8A 1DTTB 7AT1B 2HQGA 1IUJA 1DRZA 1DLOB 3ISND 2I1RA 1RU1A 3HHDA 1UJ6A 4DL4A 3Q8VA 2XS7A 4ZIWA 3C6TB 1FERA 2CQIA 5C42A 1R7IA 2DNOA 2H5JB 4P7VA 2DGQA 4WKYA 5KFHA 2JC0A 2YPYA 2ZZNA 1YX2A 2Q66A 4P75A 2BOPA 4CO1A 1IBKF 2WTFA 2QZ8A 2E9TA 2FLOA 1RA6A 2D41A 4ZVRB 2PI5A 2IDEA 5M2UA 3MAQA 2AYGA 4MIBA 2UU9J 3KUHA 1FRJA 3N5BA 2ADBA 3NGDA 2HEKA 2FVQA 2UXDJ 3NEKA 4L6V3 1KQKA 2CJKA 5LT5A 4LFAF 1S49A 4OYMA 3SDEB 4MT1A 1HNZJ 2CZ4A 1GMWD 1RWKB 3CJ0A 3MAAA 2V4JB 2HRYA 4OZ1A 3ZNUA 5KOWA 4WYWA 5KFQA 3EDQB 1W2BR 3NOGA 4KAIA 2HFNA 2V34A 2BQUA 3AT1B 4GC7A 5HQLA 2VH7A 2GQCA 2JH3A 2EFOA 1KD1T 1FESA 2J0XA 4PWDB 4M5HA 3V81B 4WIIA 1A9NB 3H4BA 2AGOA 4Q0BB 1UEVA 1W7WA 1B7FA 3KJFB 4RW7B 1HMVB 3FEXB 3LO3A 1EHWA 3KK3B 3DLEA 2H4WB 5EN1A 3MGJA 2EK6A 4NEYA 4EGLA 3O5TB 3GJTB 3I55S 4X4VA 1WEZA 3RTVA 4ECVA 3IGNA 1FJEB 1VQ9S 2ZH4A 2F8MA 1NKCA 3ONQA 3NNAA 4ZCKA 1RAAB 2VG6A 1VLYA 4NCAA 4J9VA 1VRTA 2MLZA 4QR2A 3UD5A 1T03B 2Z58B 4TYBA 3CGIA 1LK5A 1WDDA 3EJMA 5KFYA 2XNRA 4IQXA 1U6FA 3IM9A 1XR6A 3TJ8A 4M5GA 4IO1A 1RT4A 1GFWB 4OZNA 3M8QA 4ZVUB 5BYRA 4X4NA 3UN3A 4A4JA 1FWPA 1VQPS 4PRFA 3PX6A 4QPTA 5EWFA 2GX8A 3EE3A 3IG1B 3D1QA 1MW7A 1NJYA 1NK4A 5KFZA 1V6HA 3K5NA 2DH8A 3NGUA 2VPZB 3S6EA 1OYDA 2FJXA 3TO8A 3KHHA 2KM8B 1EQMA 3G8SA 2BQRA 4JP8A 2OJ3A 2CWKA 3QAEA 3LP1B 5ETNA 3BDEA 4ILRA 2CQ0A 4NLSA 2E5IA 4NE9C 3I0RB 2VQEF 4B9UA 2HQDA 2UUBJ 3GFZA 3LQVA 5KG7A 1AW0A 2CRLA 2FDNA 1GH8A 2X7IA 1HIYA 2BEFA 4FXWA 4ES2A 1FO1A 4C2MA 4QIVA 5K8NA 3NGRA 2BX6A 4CLPA 4B3SF 3N28A 2Y1LB 4BWJA 3OBIA 3DHWC 5HJYA 1C1CB 1FXDA 1LXNA 3IBCB 3SEOA 2M8DB 1JLFA 2FHMA 1X5OA 4S0MA 4AL6A 3P3DA 2D1CA 3PRBA 4B3OB 2E7VA 2M7SA 2VPXB 1L3SA 4EYHB 3BGFA 3CPWR 3W2VB 4F4YA 3DOKA 1RT3B 2O3DA 3TQEA 4ETXA 4FKYA 1FJCA 1CS4A 2XMAA 5E3RA 5G4DA 2XY5A 3KLEB 4X65J 2HHWA 2BJ9A 1RAIB 3H7HB 3R3TA 5B7WA 4YR2A 1S12A 4DV2J 2RB7A 3NBPB 1FT8A 4OLPA 3T1HF 2R42A 4UOGA 3HFZB 1KQFB 4RBTA 1TELA 3MM5A 1GTEA 4O44A 1MWZA 3FZ2A 3R6LB 4J5OA 1SVDA 5CYQA 2QA2A 3DMJA 4LSNB 3MPYA 1UA1A 1YITS 1N33J 3D4JA 1VGYA 3QRRA 4DFPA 4FS1A 3V6HA 1VI7A 4AD6A 3J81Y 1WSRA 4RNOA 4XO0A 3E2EA 1S0OA 5HROB 1S1UB 2FD2A 2ZBRA 2EFVA 2DVIA 3KK1A 1UZHA 4JV0A 3H2UB 3UE2A 1I94F 4DWIA 1FK9A 4I7FA 1ZA1B 4C9DA 2B8QA 3IM8A 1KFDA 1DLOA 3CIMA 3ZZYA 2HZAA 5G0RB 4DCPB 3LTOA 3EVWA 1K8AT 3JYTB 3DOLB 1V5VA 3P6YC 4WZQA 4PUOB 4GO5X 2DRBA 4UOCA 5D15A 1N8RT 2HBQB 2PGCA 2BV3A 3HVTB 1QY7A 3HHNB 2Z30B 3TOQA 1YIJS 3KK2A 2AZ3A 3PYEA 2R2TA 1GQEA 4DN9A 2IA6A 3DFEA 3AQOA 1RWWB 1Q8BA 3A13A 3IR6B 3BGUA 3Q8YA 1JLQA 1X0FA 2XMUA 4AXIA 1N0UA 5J1PA 2ZM6J 1UL3A 4QJVA 4K4ZA 2GQ2A 4QYRA 2I9SA 4NI2B 5BYQA 2OFGX 1U7LA 2HHPA 3ZZRA 1RLDA 1N34J 4O3RA 2N3OA 1NHKL 5C25A 5B0EA 3TX8A 3W66A 1SC4B 3J7Z5 1S1TB 1DARA 2DHAA 4O44B 3ITHB 3MWBA 3BSCA 4ATNA 1S4FA 4QWCA 4QU6A 3AFGA 1BC6A 1JKHA 2F5GA 1KVKA 2QLWA 1M5SA 3LWMA 1IKWA 1DBDA 1ZM9A 1IQTA 2FJVA 4USVA 1FX4A 2PIIA 2V0NA 5B0AA 1KBRA 1CJTA 4HHJA 1D9FA 4HI1A 3IN5A 4JI2F 4KR0B 2DGSA 3E3XA 2XLJA 3JSYA 2FGOA 3MHYA 1QSYA 2IRYA 1TUGB 2KT2A 2Z56B 3I5AA 4DV1J 4B3OA 4FYWB 4DV4F 3RB0A 1BWVA 2Y0SD 3TI0A 2UUAJ 1YDLA 4F3OA 2KVQE 3EM1A 4ZCMA 4OIXA 3OD2A 1S0VA 2E7XA 1Y3KA 3N6NA 2HMIA 1WD6A 2DGXA 2WBRA 5F3ZA 2IM3A 4C98A 4B3TJ 2DT9A 1Y00A 3PKYA 2HYIB 1RTIA 4P71A 3C3LA 4QIGA 4HACA 4F26A 3IGVA 1IKYA 3EUNA 4DR2J 5I3QA 2YNFB 4IR1A 2M88A 1LW2B 2MDAA 1RT6A 1SKUB 2FJAB 3W63A 2FJWA 2VQFF 4C8YA 3DRSB 1XTZA 2DH9A 4XIUA 4PXDA 1OS5A 3KLHA 3OUYA 2A6MA 1EP4B 1REVB 2PMHA 1WC3A 1WC4A 3KLVA 1PBAA 3M05A 1UVIA 3TVZA 3AH6A 3IS9A 1VHIA 3BPSP 3V2UC 4MMOA 4BBYA 3S8SA 4DL3A 2BJ3A 3ETOA 1LEOA 3C16A 2DB1A 2DY9A 3DM2A 4GRSA 4WJBA 2OSRA 2VL1A 2DNRA 3M6XA 2RRNA 2DGOA 4Y2IA 2B3TB 1XMQF 2OPPA 2JEGA 4CTAB 5CABA 3MMCA 2R8IA 1AUDA 3HHLC 2MKCA 3OTBA 4IFYA 1S57A 3PW5A 2WW8A 3CULA 3FEYB 1QAYA 4P2FA 4DV6J 4MKYA 4H4KC 2ERRA 1KNZA 1NM2A 2KL8A 3MPVA 2ZE2B 4KV8B 3M2RB 1S1WB 1SKRA 4CH0S 1YJTA 2L3MA 4CP5A 4CLSA 3LGNA 4W98A 1KHWA 3EGWB 4X84A 1CEZA 1CBKA 2AYBA 4M5NA 1TL3A 4IG0A 1WHVA 2WSEC 3TP2A 2G0CA 1RJJA 3M4XA 2EBGA 2HZCA 4PWUA 2IJFA 2ILYA 2RNEA 4RWXA 2ZJQQ 2HVZA 4JI1J 3VHQA 3M8PB 3D68A 1SCJB 3FQKA 4WFYA 1SH3A 2LXIA 3U1LA 5BR8F 3RAQA 1RE1B 1KR4A 1LV5A 4MKAA 3KJVB 3EX7B 4F2RA 3OW2R 3NXZA 3CCWA 4DR3F 2V8VA 1LW2A 5AJ3F 4JV2A 4LF8J 3FCVA 5U47A 1NJXA 4UUWA 1HR0J 3KMSA 5D77A 4EYIB 3OL6A 5H9FJ 3NAIA 4F2SA 3D0IE 1K0TA 2MKYA 2CDQA 2F8EX 5D0HA 2HMIB 2ZH6A 1PO6A 2PA3A 3ZTPA 3CT9A 3PIOQ 1VJQA 2RU9A 3B78A 1LWFA 3CJ2A 4DU8A 4DV3J 3DDKA 4JYAJ 5A2QU 2V2VA 4LF7F 3NG8A 4ILLA 4DR3J 4ZPAA 2C2NA 3V4MA 5EDWA 3MM7A 4DR7F 3GFHA 4DSKA 1F60B 2HQCA 3VV2B 4FBTA 4M5KA 1N32J 1LQ9A 4NYOA 1CC7A 3A8JA 3TA0A 2MHNA 2NPIA 2ZNZA 5KT2A 2XB2D 3QLHB 4X4SA 2VFVA 3HXMA 4ICLB 1ZAVA 4M5IA 2QLJB 3HT0A 1U1QA 1BQNB 2L9DA 3ZTSA 3ZXWA 3UCUP 4U8VA 2V50A 5IM0A 2IYIA 4OHYA 1S6QB 1X7VA 4NLTA 2HHQA 2UP1A 3IC1A 2DITA 1VBYA 4ZMMA 1XNQJ 4CH7A 4RUAA 4DV6F 3OFEA 1ZS6A 2QRRA 4AL5A 4PG8A 4Z37A 4ANDA 4CM2A 4ZVFA 2K2PA 2X1AA 2X51A 1TMJA 1VQSA 1T9WA 3K58A 5CYQB 1JLQB 3I0SA 1HW8A 3T5LA 1Q7YT 3GG1A 3M2VB 4NLYA 2UXCF 1XNRJ 1S7IA 1APSA 2BACA 2V5HG 3ILLA 1GX5A 4Y28C 3BN7A 5D8HB 5KTQA 5M2RA 2CNKB 3MCMA 4F4XA 2E9ZA 3S01A 2HVIA 4M95A 1X31C 1DFDA 1JMTA 3G4SS 1HW9A 4KH0B 2FIUA 3THVA 4C0BA 4CNYA 3EWGA 4C0OC 4OLOA 4GVBA 1FXLA 3OXFA 3MEKA 2BJ1A 5L1KA 1HARA 2PO4A 4DCOB 3B54A 2KVIA 3ET6A 2NPFA 1U1OA 3WIVA 2KRBA 3F41A 4ZPBA 4CO5A 2BE9B 2DHHA 5KFEA 2CQ2A 3UCGA 4A8OA 5DM6Q 4X64J 3D5MA 3D3CJ 2IRUA 3S7RA 3QJPA 3FC9A 1WG1A 5LMUJ 4ZLLA 1X9SA 3SCKE 2W8KA 2UVWA 1YJRA 4I2QB 1DQ9A 1TV6B 1WF1A 2MTLA 2RDJA 7FD1A 5KFMA 2YQ1A 2W2PP 2GO8A 2CQHA 4FF2A 1XN9A 3CJ3A 4DV1F 2ROEA 3WDOA 1IM6A 1RHMB 4JV5F 3HHKA 4NRTA 1S1XB 3VGVA 4URSA 2HGMA 3LF0A 4PQAA 3KLHB 2XSJB 2BKOA 2HZVA 1H0HB 4L75A 3DRRB 2DJWA 2LU2A 3AD7C 3FVYA 5HVHA 4DUYF 2COLA 1TL4A 1X5TA 3QWPA 3H5SA 2IHR1 4WK3A 8RUCA 1VCTA 4FDFA 1VQKS 3DRXA 4ZHRB 5JVHQ 3IWLA 3Q8UA 4NXMJ 2YX7A 3GU0A 1VIXA 2JOQA 3HHLA 5CZXA 4J9PA 4HH1A 3K89A 2MLXA 1E6YA 3KLFB 2NCKL 2OGUA 4TVAB 4PABA 4NYZA 3SQGA 2OIHA 4N77A 5CHCB 1RA7A 1JJHA 2HWTA 2JHEA 3AA9A 4QU7A 2YWWA 4GC6A 1KKHA 2K7JA 2IMOA 2QMXA 2Y0BB 4ECRA 4USJC 3N5FA 3PJXA 2Z2LA 2KKHA 1Z2LA 1LWCB 2LFVA 1JLEA 4NLWA 2PMWA 3KYLA 3TRGA 2QL9B 5HVFA 3DLKB 1C2PA 2WSCC 1J5OA 3M6UA 3BSNA 4ECQA 1WDTA 1QE1B 2YPZA 4K5SA 4DR5F 2MQPA 3Q8PB 2HHXA 4ED4A 3PFOA 4PKDB 2KZMA 4X64F 2HQ3A 4I6AA 2NLWA 2POKA 1Z1ZA 3TUJC 3C15A 1VR6A 3G82B 4RNMA 2HGNA 1VJWA 2FY8A 3B4MA 2N4CA 1BXNA 3M30B 5HI7A 1YVFA 4MK9A 3GIKA 3VAJA 1NJWA 2W2MP 3IFEA 1UEUA 4YB6A 1ZZNA 3I9ZA 4W92B 3HJVA 4DBQA 1GXTA 2WW4A 4MIAA 4R0EA 4WP8A 1U6ZA 4B3MJ 3L9ZA 3GR0A 4O3SA 2ZDOA 3MAHA 1IJFB 1YRUA 5CQGA 3ELHA 1F5BA 1P9QC 3GFXA 3FSYA 3M32A 3UD3P 1FX2A 4OI6A 1FNMA 4C4WA 1Y7PA 2DGTA 1NU4A 4YDXA 5KFFA 4Q8EA 2E5HA 2YKNA 1T9XA 3FBBA 4DV7J 4DL2A 1NDCA 3C19A 4E2FB 3CMAS 4NCBA 1KONA 4P52A 4HLBA 2I6WA 2PA8D 2EFPA 2JNJA 4EUVA 6FDRA 1T3OA 4EMDA 4P10A 1XNQF 2LXUA 4JI0F 2VC0A 3QO9B 3GR1A 2LQ9A 3BGRA 1S77D 5J2MB 1BY9A 2F9JA 3HFVA 2XWXA 5J2PB 4C3MA 2R8HA 2BJ7A 2K1RA 4DF8A 4P72A 1TMMA 3FQLA 3DLGB 3PRDA 8AT1B 2HFVA 2W7AA 3K5LA 5HN0A 1N36J 3VVTA 4ZP7A 2MQ8A 1L5UA 2EVZA 1BQMA 1QUPA 1R6VA 4YP3A 3IAM9 2VKRA 1VISA 3JQKA 4N47A 3CB4A 3IAS9 2AWZA 4RNNA 4BLGA 3KHRA 4DL7A 2G9OA 3W2WA 1PC4A 4LF1A 3PIPQ 3Q0AA 3OPKA 4JI6J 5I3UA 5I42A 3QFHA 4M8LA 3CD0A 1RZMA 5CA5A 1QE1A 2C2EA 1AFJA 2V9WA 3TNVA 3BSAA 4YHHF 5LMNJ 1FWLA 4FZVA 4J9LA 4KE5A 4WFZA 1H98A 2M3DA 1RAOA 3DRPA 4NCGB 2VFSA 3BKFA 3DGVA 2MHEA 3M6WA 3SQOP 4F0KA 4ZLJA 2O1PA 3L3CA 3GV8B 2OMLA 2RKIB 2AJ1A 4WCEQ 1M5KC 2FHKA 3K5PA 2R4FA 3RAXA 4ES1A 4EU0A 3N01A 1CLFA 3C15B 1CJTB 2OFHX 1RCOB 1RAFB 2KRRA 2C3UA 2LDYA 2WBMA 4EEYA 2F4FA 2CPDA 3TA1A 3UDEA 2KG1A 2DCLA 1J5EF 3N4WA 4XK8C 5KFIA 5E3QA 2MQNA 4HL9A 5E0OA 3OSNA 2M5YA 1XWLA 4JI8J 1WNEA 5F8MA 4OI0A 1ZM2A 5D0EA 4OX9F 4B02A 2E5LJ 1G1XA 1HD0A 3HULA 4F36A 2EKNA 1VQMS 3GE9A 1F5CA 2ABYA 2QEXS 2D7SA 4ZPWR 3AXKA 4ZP8A 3BZQA 2K3IA 5C24A 1WHXA 1LFWA 1GMUA 2GMJA 2VZ9A 2LXFA 3MEGA 2M0GB 4DR1J 4LR9A 4DR4J 3D3BJ 1MROB 1L3TA 3JTOA 5IT4A 2QGFB 4H4OA 3M8SA 3G6YA 2A1BA 2QSFA 4RL1A 4C8NA 3P45B 4DFKA 2ACMA 2AGQA 1U09A 1TVRA 1UFWA 2C3MA 2K7KA 3GJSB 4Y65A 5A0YB 5DGBA 1S1VA 1HWIA 1FDBA 1T9TA 2X1GA 3PZPA 1KRPA 4Q5VA 2NUUG 5G0RA 2MKKA 3MM6B 4ZOSA 3VAKA 3JYTA 2KYXA 5DZ7A 3TEGA 1WC6A 5DETA 1UVMA 2KT3A 1SUQA 2XMTA 2VOOA 1FKAF 3P96A 4LRCA 2UXDF 2HNYB 3POTB 5L1IA 1H2VZ 3GMGA 2CQBA 3HX9A 3RG6A 1QSLA 3J7YI 1N6QA 1WG5A 5DDRC 4TLRA 2GAGC 1RWNB 3NS6A 3RR8A 3MEDA 4ZHRA 1RWPB 2NXNA 3NY0A 3EGVA 4IDKB 4TQRA 3G6XA 5AE3A 4RBVA 2CQDA 3QIPA 3CC7S 3EGNA 3GSIA 1Y11A 1VLOA 3CNQP 3EXCX 1UMJA 2A10A 2LQJA 3MR3A 1YKWA 1ZPVA 1JLBB 4OYXA 1S6UA 2ZH8A 1YBUA 3MUVP 2F4VF 3DN9A 3KHGA 2P2CB 4NXNJ 3BGLA 3GIMA 3PFEA 4K8RA 1MLAA 1N54B 5AE1A 4EI2A 1RT3A 1YBAA 4V1Ak 4CO2A 5MLCV 3LWLA 4C0HA 4U9RA 2MLYA 3R7BB 3LGHA 4KGZB 3OJUA 1SQFA 2BANA 2W4PA 1MROA 5IWAJ 3L7PA 3HVAA 1WSVA 3ENWA 2UU9F 3DYAB 3A3OB 4LVNP 5KG2A 1N32F 4PUOA 3PEJA 3TAMA 2G13A 4CIOA 5C24B 2XGQA 5SUHA 3C6TA 3M1VB 3H40A 2HHTA 3BPDA 2XZWA 4FN5A 3FFIA 1DTTA 2UUBF 4DEZA 1S6PB 2RSQA 3NS5A 1C0TA 3T5HA 3GQCA 1JLAB 1B0VA 4WXWA 3CMES 3ZZ0A 3DDNA 3Q86A 4EBEA 2C28A 3PO4A 4FVCA 3HHLD 5HSPA 4RW8A 4C3LA 2MEWA 2MJUA 4LVOP 6AT1B 4GMKA 3UDCA 2UXBJ 4DR6F 3GIRA 4WP9A 4ELTA 2W24A 1FE4A 3D1HA 4RR5A 3UDLA 4JI4J 4C3KA 1IVZA 2HQIA 1R3NA 5DLFA 4ANCA 3LAKA 1KTVA 2Y1RI 3M8YA 1Q95G 1YWXA 2RAQA 3FMWA 4OI2A 3IMQJ 4Y00A 3U7JA 5D0GA 1NJIT 1TZ0A 5D4LA 3M8WA 4MFBA 3GIIA 4B3MF 2Q6CA 2ASDA 5KFBA 1TL1A 2WONB 3K8VA 2CPHA 1P27B 2DNNA 4MJKA 3BV8A 5T7LB 4FXVA 4MIWA 4DSEA 2BM0A 1D9DA 3T1AA 1X4AA 1C1BA 1U1NA 3D0GE 2ZE2A 4KV8A 3M2RA 2FZKB 4H54A 4KHPJ 4OYZA 2MKSA 2ZZTA 4K4XA 1S9EA 2LQ8A 3CD7A 3MECB 5KFGA 1MG7A 1XR5A 3HPOA 3KK3A 1QAXA 1HQUA 2E1MC 4DU7A 1HNVA 1UPMB 4NXNF 3TAPA 1B70B 2EI5A 4M63A 3MDFA 2F4VJ 1R8BA 1TAUA 2VU5A 4WE1A 4AT1B 1TL3B 4IG0B 5F8GA 2ALZA 4BS2A 1Q78A 2AP6A 1D9AA 1VMBA 2YXLA 3AOAA 2I0XA 5J2PA 2D69A 1T05B 2EFQA 3H98A 2W4DA 3MD1A 3MM8B 2UUAF 4O3QA 3MMJA 3VZHA 2ZUGA 3DHXA 3TJ9A 4DZ6A 1VQ6S 2B4OA 1EP4A 1KLMB 5KFCA 4QPXA 1FJGJ 1ZAXA 4U96A 3OXLA 3EGZA 4ZPVR 2ZH2A 1RUSA 1AYEA 2LLZA 2AD9A 4UQGA 2IDLA 4ZS6A 1JLGB 1BE4A 1WKKA 2GS8A 3HKZD 2VQFJ 3NL0A 1HI0P 1YJUA 5AXNA 4DS5A 1M1KT 1KVJA 2MZSA 4LF9F 1VK8A 1V3SA 3QAUA 1R0CB 3IBWA 3MI7X 2PSZA 2J9DA 4NZ0A 4OYAA 2GHVC 2P9GA 4QWBA 4USTA 3L4BC 4LBIA 4X62J 1RSCA 4F4KA 1WI8A 4UZCA 1REGX 9RUBA 3B8HA 1ROFA 1FEEA 4I0WA 3SMZA 3VR1A 2V8HA 1JWWA 2IIHA 4TU8A 1UJ5A 1Q86T 4HT5A 2R7WA 2R7UA 1RT7A 4HTJA 2RRAA 2MKIA 3CO0P 2HIQA 2CXEA 1WEYA 1YRTA 2H1YA 1VQ4S 1RT1A 2KT5A 3DU6A 2ZM6F 2ZH1A 2G4BA 2QT7A 1H2UX 2J5AA 3L7OA 4F0HA 3MMCB 1FJ7A 3MECA 1U24A 5J1NA 4M5DB 5L39A 2B56A 1RABB 3K0JA 1SC6A 2OI2A 3QGHA 2AX0A 1S5ZA 3TQ1A 3HJFA 3MZIA 2VODA 1RTDB 4X62F 4CT8A 2MZQA 2CQCA 3TZYA 4JOUA 4K0KJ 1IM4A 2GHWA 1PSDA 2J9CA 3UW1A 4GKJJ 2EG1A 1S79A 1N5YB 1KQSR 1TU0B 3D7SB 3J80Y 3ILOA 1HHTP 1ZH5A 3P4UB 2UZAA 3IXQA 1E6VA 5DM7Q 1R8AA 1SXLA 2AYEA 3TWZA 2V94A 1H7XA 3HT3A 3IRXB 3DI6A 5T41A 2J9EA 2MJNA 2AJ0A 2BE7D 4A8FA 1RACB 2VV5A 4I6WA 3OL8A 3SYZA 5DRKA 3UNGC 4FP9A 3M32B 3FDSA 2FHJD 3OR2A 2W9BB 2Z0GA 1RADB 1FHTA 1DURA 1W26A 3PNIA 3VGTA 4ZK7M 3MMAB 2B7CB 1HBMA 4NI2A 1YG0A 2XYGB 1RT2B 1ZBTA 2CQGA 1MN7A 4QWDA 3HLUA 2VJVA 3T3FA 4WP3A 2YY3A 3QGPA 3SSSA 3PX4A 2BR0A 4HDGA 2RU3A 1XC9A 4DPYA 2CVIA 1NLKL 3JQMA 3US5A 3PO5A 2BRLA 3O2IA 4A8XA 2ROGA 4C8OA 1FDNA 1VOMA 3LOUA 4ZKAA 3PX0A 5HMYA 2VFTA 4XAKA 3KK2B 2KO1A 2YWEA 4K5RA 2ZVSA 2ZWPA 4RLEA 1NSQA 5KT3A 4RW8B 2CPYA 1ZPWX 3QT8A 4ES3A 5F8HA 1PC5A 2DPIA 2Y8YA 5FLXU 2ASJA 1RKJA 3TA2A 3W8PA 1HA1A 2KFNA 4M5LA 1ZOTA 4RW6A 2CJAA 4QZVB 2B4UA 3T1HJ 1IBCB 1PJ5A 3RB4A 2G0JA 2GVZB 1JLBA 3CE8A 5A8RA 3T41A 2IMWP 2JLFA 2XS2A 2R7SA 2V63A 4RW6B 1VQLS 4KQZA 2VHGA 2BRKA 1RTDA 2Z4PA 3GYXB 3RU0A 1YBTA 3FKBA 2KZZA 3IR5B 2IM0A 2RMLA 1VQ7S 2IC3B 2GVDB 3FZBA 1NB7A 1GK8A 4NLOA 2AHOB 3OXGA 3Q22A 2DY1A 2QA4S 2Z2ZA 3PTWA 1FKPA 2HVEA 1N6QB 3JSMA 2MZTA 4KGVB 4ZITA 1N48A 1KSPA 1NK9A 2B4PA 4ANEA 1RDRA 3VF0B 4B3RJ 3M9OB 4NASA 2KHCA 1SUQB 2JEJA 4JI1F 3RJMB 1Z4UA 2DNKA 5HAOA 3M1VA 1Q8LA 5KFVA 2ZHBA 2Y8WA 2W9AA 1Q81T 3C14A 2BZ2A 3M7VA 2QSWA 4WBFA 5DDQC 4UUXA 3T6JA 3CO9A 3V4IA 5HMXA 1NPPA 1TK5A 2N3LA 3T1YF 4XPCA 2H4YB 2M70A 4DR6J 1U47A 3U1MA 4DV0J 2PD1A 4H4OB 3A4TA 3EZOA 3IP0A 3MCNA 3GG0A 3R1HA 4LSLA 1NK5A 2G0IA 2HHHJ 3FUYA 4I67A 2KTQA 2RDIA 1NCLA 3G87A 1BWEA 4PPDA 4ZVPB 2EFNA 2C2OB 1XMQJ 2JZ5A 1HI8A 4RW9A 3K17A 3MOZA 4XTTA 1TKTA 4ZVHA 4J9MA 1JJCB 1URNA 3MCOA 3W5XA 1RQ0A 1BLUA 2WRMA 5IS2A 5HK4A 1T05A 2LA6A 4E98A 4HH0A 3ETMA 3X3UA 3WHIA 3OHAA 1D8YA 4M5MA 4LF4F 2F1FA 3TVKA 4ALZA 1S10A 2IAJB 1VC0A 1KS2A 3GTYX 2KJVA 5IQQA 4LF9J 1F9HA 1NDPA 1RGVA 3JTNA 2MMYA 4LFAJ 4M5DA 2GJIA 4DG1B 1WWHA 1TL5A 1WOSA 5HBMA 4XDCA 2VG5A 4L3NA 2I2YA 4KPYA 1LW0B 1X4EA 2HIYA 4AL7A 1VQ8S 2WHOA 1BMQB 4WTOB 2ILZA 5ETKA 1JXEA 2G2OA 4BCAA 1FXRA 3BR9A 5AXLA 2CYYA 3V81A 4B9SA 3CJQA 4JV5J 5D4PA 1DAXA 2CWXA 2OPRA 1IBKJ 1HQEB 2V6AA 2DNLA 2GGPA 3DCAA 2JVRA 4JI7J 3HVRA 1K44A 1TR0A 3M2UB 3MTJA 2RQ4A 4JI2J 4YN3B 3ULHA 3BDPA 3IRXA 2HRUA 3TUZC 1VQNS 1SL2A 2R8JA 3LPYA 2D3UA 3ZTOA 1R27B 5D3GA 3VCDA 1S6OA 2D3OR 3KWMA 5LL6d 3MURP 4Q0BA 4LSLB 4C11B 4N5SA 2Y3YA 7FDRA 4WZMA 1LNQA 1RXOB 2RF2A 4NLPA 4LF6J 4ECYA 3QJJA 1DQ8A 1U2RA 3NS7B 4YS2A 4GKJF 2XLKA 2N4DA 1VHFA 2PEHA 3SBMA 4WFAQ 2VJUA 2ZD1B 1FFWB 3JB9k 4YUDA 2ZOGA 3RB6A 3KOAA 1HNIA 4HKQA 3L09A 4OMFG 5D78A 2ZBCA 1OYEA 5IT9U 1SB6A 1T94A 1RI7A 1RWOB 3G96A 2DXFA 1VC6A 1Y0HA 1HNVB 2W7OA 4O4GA 1IKYB 1X4CA 3OR1A 2EC2A 1TKXA 5F0WA 2NR0A 3VGSA 2SXLA 2HHHF 3HSGA 2YKNB 4NMLA 3F44A 1M0SA 1PYTA 2HK2A 4G1PA 4HEA9 5C5JA 1X9MA 3IWNC 2R7TA 4B08A 1SPBP 2DK2A 2ZUAA 2BA9A 2NSCA 3CF5Q 3H25A 3P5BP 5KFTA 5K20B 4ELUA 2R3VA 2VFRA 1OY6A 4JI3F 3I32A 3CJ8A 1KOHA 3W65A 1VQ5S 2BUNA 3MAAB 3I96A 1NBEB 1JLCB 1X4BA 4ECTA 3KLGA 1R8HA 3F0NA 4WK1A 2YWFA 4URGA 4B3RF 5EGYA 1NDKA 2MGZB 4F3QA 4RUBA 3NLCA 3B6BA 5E41A 2WSFC 3TZXA 1N0VC 1U49A 5J2NB 1SL1A 3H5YA 4IR9A 5E3AA 2XI3A 4OX8A 4IRKA 2RHSB 2N7YA 4Q7AA 1U0HA 5GADU 1B4SA 3MM8A 4OHWA 1PYOB 2FGCA 4PXEA 2AJ4A 2EW9A 4NLDA 3Q8SB 4YDDB 5KFJA 1RK8A 2ACYA 4X4TA 3JAMY 2OPSB 4YHHJ 2YVSA 4K4TA 1D0EA 2V9KA 3W3SA 4LF2A 1HQUB 3QBCA 5K5MA 2HAFA 1S99A 2JJ4D 1YRXA 1UWBB 4DUZJ 1UVLA 2QG9B 3D0HE 1UW4A 3KG0A 3M30A 4DV5J 1IBLJ 3RZAA 3UVJA 1VBXA 1HBOB 2FLNA 1J27A 4UZBA 3O6QA 1OSDA 1Q82T 2KFZA 4UOHA 2OEMA 4KHPF 4A48A 4OQJA 1MMNA 3CDEA 2DGUA 1FVSA 2DR5A 1M1HA 1U02A 1QDUB 3BQ1A 4B3SJ 3QJLA 1WOOA 1P1TA 4TY9A 4HHUA 1ZTWA 1QSSA 2W2OP 5J1EB 3SV4A 2EKYA 2BW2A 2WVFA 3G6VA 4F04B 2NYHA 1S1UA 2KXHA 1S0NA 3R8YA 1NSPA 3FBEA 3GCWP 2AQ4A 2YWHA 3K2YA 3JS9A 2VBZA 3CJKB 5C2GA 5F9LA 3O1LA 5ITHA 4ECWA 4ED0A 3D6FB 2EXUA 2YX4A 4A8WA 2OPQB 1AUSL 4LRDA 2UXBF 4N8OA 1E6YB 3SQGB 1I51B 1YJVA 2ATCB 5HBMB 2J76E 3IBFB 4YY3F 3BSOA 3SV3A 1JX4A 5E7OB 1TAQA 1RHJB 1RWMB 2DHSA 2PDAA 4K59A 1GXLA 4BC9A 2CNOB 1C0TB 3QMQA 5GMEA 4Y2KA 3MUTP 4TU9A 4KRWA 1SQEA 3BQ0A 3UCZP 1ZM3A 2J6SA 4DPOA 2LEPA 2MZ1A 2AEMA 5ETOA 4YR0A 2GV1A 4LFCF 3VQTA 5JXSA 4K0KF 5ETMA 2R2RA 1OJ4A 1XIQA 2F65A 3AOCA 2EWHA 3GONA 3HMJG 1JLFB 4DQSA 1EJ7L 2NSBA 4TQSA 3CCUS 3ZTQA 3OTDA 1RTHA 2YNGA 3W1YC 4LQ9A 4B17A 1Y5NB 4Y0FA 3QZ7A 2KG0A 2J6TA 3KKFA 5KFSA 1U1KA 1B99A 3NP5A 3W5YA 2D3O1 2PC6A 1TUWA 4O3OA 3UI3A 2AGPA 4GVBB 1PJ7A 5ADZA 3GCXP 1I5OB 3GJQB 2M4MA 4R8UA 2OMOA 4P9SA 2IVYA 3QIPB 1ELOA 3CCJS 4R5PB 1IKXB 1V5IB 2MPUA 3OFHA 3MEDB 3W5ZA 5LMNF 2APOA 3BS9A 2YBVA 1NEEA 2WAQD 3W62A 5F9NA 1VC5A 1ULRA 2ZFHA 2UV8A 1A0OB 2LMIA 3PKMA 3CDBA 4ZJLA 4ZVQB 5GAHU 1KWMA 2HBZB 2XCPA 3AODA 4N7TA 3O8WA 1U8WA 2Z57B 3HVWA 4QW8A 3RYLA 4USUA 5E2QA 2AV5A 4CZCA 1N36F 3J7ZT 4I64A 1X4FA 2LEAA 5A8KB 2ZH5A 1FKOB 2LP4A 1VRTB 4NX9A 3QGGA 4NCGA 1VQYA 2XO6A 1UCNA 2V2KA 4ITSA 4WF9Q 3IO1A 1TVRB 4F0MA 3H2LA 3G6ES 4C7QA 3OSPA 4K50A 1HHQA 4ZVTB 2RVJA 3UQSA 1FNOA 4YY3J 1TK8A 2O67A 5I42B 5I3UB 1Q8IA 2E7WA 3AHPA 4CI0B 1EZZB 4CLKA 2W1BA 1HMVA 4Y3CA 2UUCJ 4OHXA 3VAMA 3ILJA 3AD9C 4ZJQA 2V4RA 2HLTA 1QAJA 1TKXB 1R0BG 4HTIA 1N5YA 3WZ0A 4TXSA 1F5AA 1NJZA 3BGOP 3VZIA 3IRWP 4DV4J 2J9DE 2OO4A 4UY8T 1JLAA 3AJDA 4O23A 4QIWD 2QE5A 5B0DA 4C8KA 4DX5A 4WFBQ 2CQ1A 2WVBA 4QR0A 4DQPA 2QLFB 1YJWS 2YKQA 2NZ4A 3BBBA 4G6VB 3LP1A 2MY7A 4O0NA 1JQGA 3IR7B 4CLZA 3BKUA 2DR8A 3TZWA 1MU2A 5FDLA 1YGYA 2XMWA 3DKDA 1WKLA 3NNCA 3J7A1 1U45A 2GAHC 4O4RA 2OUGA 3BREA 4IOBA 2UUCF 5DLGA 1TL7B 5SZTA 1TUVA 4A8YA 1PCAA 2HW3A 2WCXA 4DUTA 4KFBA 1FDDA 2DXEA 4CWBA 1T02A 3DRPB 3WX4A 4KO0A 3EXYA 4R25A 1WACA 1IQZA 3ZZZA 3AD8C 1JJ4A 3I31A 4JUZA 1B0TA 4U7UK 1S1WA 5HANA 5CD4A 1HPZB 2YKMB 2HRTA 2IFXA 1R89A 2RDDA 3R5JB 4CLFA 4G1QA 1CJVA 3I82A 3W9JA 3A8EA 4PQUB 4TY8A 1TV6A 1T7PA 1UVNA 1CVJA 2FTRA 4USKA 1RTIB 4CYUA 4NXMF 2FLPA 2HLUA 3HZEA 2LQ5A 4Z2XA 4KC5A 5CZVA 1MNEA 1RLCL 1XBWA 2K1RB 1HNIB 1BGXT 1OPIA 4OYWA 4ZVSB 1NK7A 3Q83A 2FJDB 2RH3A 3CC2S 4ZIVA 4DSJA 3D1OA 4I68A 3GILA 4USMA 3FK4A 1JXLA 1RYRA 5KT4A 1HR0F 5AJ3J 1DQAA 1RTZA 1U0SA 4MAKA 3SDEA 4RNFA 3NAHA 3QATA 1R8PA 4IG3A 2C3PA 1Q5VA 2RD5C 3M9NB 2L9NA 4UQTA 1RAEB 2A3JA 2IVMA 1H6KX 2QC3A 2F7VA 2QJ3A 3EVMA 2B43A 4K2XA 3DLBA 2H51B 3EICA 5LMUF 2JLEA 3BYPA 1VS3A 5F41A 1S7HA 1UVJA 1MWQA 5DGAA 3AQPA 4KHRA 3R6GB 2QX0A 4B9LA 4FYVB 2DRDA 2X3DA 4FPRA 2AF6A 1NO8A 3CEDA 4C97A 4RU2A 4DSLA 1VRUB 4DCJB 2GQQA 3NCQA 3LALA 3D6HB 3MM9A 1BUXA 4PG6A 1GT8A 1RAJA 2V8DA 3P8BB 4DX6A 1Y3JA 1S9FA 2GMHA 1U6BA 4DDFA 4YOEA 4P2SA 3KHLA 2VASA 1LOUA 2YKPA 1CC8A 2D3ZA 1XNRF 1NRKA 4C8ZA 3QPIA 3KLIB 4Y34A 2JSXA 3ZTRA 3ITHA 2XULA 4L76A 3MCSA 2DKOB 3I5CA 3OV7A 2V2ZA 3LGMA 2CA9A 4A8KA 2DNQA 2M2BA 4IG3B 5FJ4A 4RW4A 2HVHA 2HNDB 3ZZOA 4FYDA 5BJRA 3PV8A 1KFSA 2NXJA 4MTPA 3R97A 1PJ6A 3KK1B 2FVCA 1HHSA 3D54A 5F0UA 5CXTA 2XHCA 5D3GB 2F8HA 3HHLB 3KLFA 4NLQA 3M8RA 3HFKA 4OZJA 1SJ3P 2E5LF 4OX9J 2QYGA 3FBCA 4DPTA 4A8SA 1KVIA 3T19A 4I4BA 4OHZA 3CDUA 4M1KA 2E1CA 2DEJA 2DIUA 5J2NA 3TJAA 2ZVIA 3WBZA 3O44A 3VWSA 4EBCA 3RGIA 1PYSB 3ZO7A 1UW9A 3HSJA 3R7NB 3FRYA 3CCTA 2JRSA 3M8ZA 4WFNQ 3KLGB 2E1RA 2CDRB 3DOMA 3GFYA 2XMMA 4NRUA 4URQU 5EX0A 2MQMA 4ZDNA 3Q24A 4DV3F 2IJRA 4PYAA 4KTQA 4ZPCA 1AXQA 5JMNA 2XO7A 2OPSA 2OH2A 4O3NA 1LW0A 1IKVA 1JK9B 1SI9A 2AZ1A 1AA1B 3I4PA 3CW2C 1WI6A 3BGRB 3T9ZA 1K47A 1FFGB 1S4EA 2C3YA 2VFUA 4LUBA 3FGVA 2FZCB 4MKVA 4K4YA 1PBUA 4JI6F 2BE2A 2JDJA 2VBXA 3PM9A 2CJBA 2LA4A 1LWXA 4ECXA 2NXCA 2JFDA 1P1LA 2W25A 3D6TB 5E5NA 2WK4A 3VVUA 4CLTA 1Q4RA 4B9NA 1Q1KA 4YB1P 2QL5B 1E6VB 2GMLA 2VG7B 3H8YA 5KFPA 1FK9B 4I7FB 4KSEB 2BVZA 2F40A 1L3VA 2J7WA 3NNHA 3B4DA 5LXRA 3SIPB 1UETA 3A12A 1CS4B 1H73A 2NREA 2CPXA 4J37A 3PJWA 3BYRA 4I2PA 3CVKA 3H5XA 2IBKA 5IOLA 1GAOA 5LOQA 1WKJA 3EVOA 1BHNA 2V2QA 3RR7A 2PN6A 2GNKA 4FBUA 2C2ZB 3ILIA 2E5GA 4DV7F 3AOBA 1NKBA 2F63A 3C14B 4ZVEA 5K9FA 5A8WA 2A0FB 1N5VA 3NGKA 2HFZA 5GMKa 5LJ3Y 3GIJA 2Y1IA 4B9MA 4KO0B 1EAYC 4G65A 4N56A 1NK0A 3UPFA 1Q16B 3D2WA 4A47A 2KH9A 2HHSA 1IWGA 3FMBA 4KGMA 2P8IA 5KG5A 1RAGB 3OTOJ 3A8KA 5ETVA 2P9CA 2ZOMA 4Y2AA 1GTHA 1T11A 3CWJA 2MYFA 3DLLQ 3MEEA 1F9EB 1GX6A 5HQMA 2ZJRQ 4HYKA 1ITPA 1RBLA 2HPUA 3L95X 2PI4A 1T9VA 4DV5F 2K8GA 5F8LA 4V19J 4RX6A 3MFHA 4B9TA 1PAEX 2LU1A 3CSKA 4P7TA 1YZ6A 4A46A 1FI4A 4C48A 4QQBA 4KGXB 2KM8C 2MQLA 3NGSA 4B3TF 1PG5B 1IN0A 2C3OA 1RT4B 2C42A 2H3EB 2CFXA 2ZBIA 5L8RC 2VQEJ 4ZCLA 2V4QA 2ADCA 4PYDA 1D1UA 4ENOA 3HHEA 5AE2A 1YZ7A 3ENQA 3QYYA 2J8SA 4WXOA 1ICEB 1RCXB 2D9OA 4CM0A 2GW8A 5D4OA 5EWEA 2EEYA 2VONA 2C2MB 4NMXA 2CPEA 4ER8A 3K7RA 2FVRA 5HMWA 1WUUA 4WTYA 1YK9A 3UWTA 1BD6A 2FHJA 5B08A 1T9YA 3RBEA 3ZC4A 4I2PB 2FC8A 3MFIA 4UW2A 1QJHA 1RWVB 3V6DA 5D4NA 3BO2A 3ZZPA 4RNHA 2CJYB 5KFUA 2X3GA 2QMWA 4PWDA 2GJ2A 1FKOA 1NH7A 2G2ZA 3BB5A 3UR0A 1FD2A 4OZ0A 1OSCA 1FF2A 1TKZA 2CPZA 4PZVA 3N79A 4DPUA 5T7LA 3C8YA 4CNZA 5LSRA 4M94A 1FTRA 4TU7A 1N34F 1VRQC 1CG2A 2KJWA 2WVDA 3U02A 3H59A 3LUYA 4MK7A 4Y2CA 2U2FA 2ZEJA 5AXMA 3BH7B 3UDVA 3WC0A 3UO0A 3JXOA 4F4WA 1MU2B 5FDLB 3K59A 4B9VA 1DHMA 1SC1B 1YSJA 5A8WB 4DZDA 2FUG9 2RQMA 3GV7B 3NCPA 2KHDA 3M2VA 4MK8A 2HKEA 4ED1A 1SH0A 1UFKA 2YNIA 3ZZUA 2VICA 3T1YJ 2DNPA 3KG4A 3MTKA 1F9FA 2I38A 2HWHA 3VAIA 1XR7A 1HWLA 1VDHA 3HF5A 2DNZA 2YNIB 1CQNA 1QTMA 2RF2B 1FTCA 3ISZA 2B8PA 3DOMB 4DLGA 2LQBA 5A8RB 3RAMA 1N4LA 4L3KA 1X4GA 5DDOC 4DFMA 1TP7A 5F8JA 5EX3A 1RT6B 3KUEA 1F1BB 5CD4H 2FJBB 3A8IA 1RBAA 3CCZA 3MOJB 2GIQA 4WIQA 4Q8FA 2CQPA 4KPCA 4MH8A 3KNGA 1HNXJ 1HL6A 2M8HA 3R2DJ 2HFUA 1DTQB 1RHRB 2UXCJ 1CJKA 1HD1A 3IA0A 1YQHA 3UVJB 5T14A 2NUHA 2QMUB 2AYMA 3TUIC 1C4CA 3E01A 2CADA 3MR2A 1H2TZ 1RP5A 3MMBB 4X4RA 2OLWA 4IYQA 1TL1B 2WONA 2R8KA 4ID5A 1CULA 1HNWJ 1P9YA 1LWFB 2O5DA 4OJGA 1NNDA 1L3UA 3RBZA 4C11A 2XY7A 1FRIA 3VAFA 4KT0C 2ATLA 3TAQA 4WFXA 1KOOA 3I87A 3WX8A 1IKWB 2ZZMA 1K0VA 4DR7J 4N8NA 3G86A 1U1RA 1U0HB 3KJQB 4UOFA 1AZSB 3R27A 4FF4A 2MSTA 3CDAA 1IBMF 2ZHAA 4F25A 2AKWB 4R5PA 2ZBPA 4H4MA 4UF4A 2B9EA 4OZLA 5ETQA 4DN0A 1X0PA 1Y9OA 1RHKB 1U2CA 2W01A 3OTOF 5H9EK 1LKZA 1V3ZA 2R7QA 4OI1A 3U27A 5KG3A 4X4QA 2UVVA 3KTQA 4CLLA 3IWXA 4F50A 5L1JA 4J9NA 3V6KA 1T3NA 4RW9B 3PY8A 1D3WA 2GCFA 3MR7A 4JYAF 3ZNJ1 3RUBL 2H5IB 1XMOF 3LA0A 3JAMU 3OLBA 3V6JA 4F4AA 2EK1A 2HURA 2KB2A 2VBWA 2FJEB 3W2VA 3TARA 2DTJA 5B09A 5A76A 4I2QA 2PT0A 2QTWA 2KFYA 4Y2MA 3SI8A 2CNLB 2IAJA 3C6UA 1HFEL 1V3RA 3PW0A 3UFCX 3HDSA 3NCRA 4W90B 1MMDA 2XM3A 3RRKA 3JSBA 5IQ6A 3OT9A 3K5MA 1M5PC 2DHGA 5BR8J 3PRVA 5GMDA 2B9YA 3KNAA 5E33A 3DRRA 1URRA 4OL8A 3DNCA 2ZNYA 1TKTB 4ZVOB 3PVXA 3OFFA 2R7XA 5L9XA 1TKDA 2HWIA 1X5SA 1DJ0A 5A6WA 4DQQA 1MN9A 4DHVA 1RBOB 4YMEA 4UT4A 4RO0A 3JQJA 3KDOA 1O5JA 1U26A 2QA4G 4OI4A 3SSQA 3MPUB 3BO4A 5HATA 3OUYB 4NLGA 4TNOA 2WOMA 4HR2A 5KG6A 4X66F 2V68A 3GB0A 1FEHA 1VYAA 5DG7A 3NGTA 3CJKA 3J80U 4QCLA 4FF1A 1S6PA 1H72C 2VBYA 4KYZA 4F02A 2ROPA 1F2GA 2EFGA 2CJ9A 1FRMA 2XNQA 2BOAA 3GWCA 4FYXB 5IM0B 4DV2F 5J2QB 5HLFB 1WJ9A 2FPHX 2CJQA 3CJ5A 2BKNA 4G1IA 3DOKB 3DXSX 4X65F 1S76D 1U25A 4DPWA 2JLGA 4AQYJ 3K8WA 4IFVA 1S59A 4AFFA 3TAMB 2FYXA 4J9UE 2GGPB 1TK0A 3SXLA 1QUVA 3H90A 1TKZB 1FKPB 1TL7A 3D28A 1AROP 4FKXA 2BBEA 3AXMA 3UR3C 5B0CA 3GYNA 4YFUA 3BQ2A 1IBMJ 3OVBA 4LF6F 2DH7A 1LWEB 5CH7B 5E3PA 1V9OA 5L9NA 2RE1A 2RRBA 4FXDA 2M52A 3LH2S 2B9XA 4WWSA 4KHMA 2Q3PA 3PCOB 5KT7A 4IQMA 4DSIA 5IXUA 1RU2A 1MSWD 2HNZB 4P2XA 2DEIA 5HQ8A 4J9KA 1U8SA 3KJNB 2GVZA 3H42A 2UUWA 4OZ3A 1U48A 1HPZA 2YKMA 2W2NP 3ZZTA 1I1GA 2BABA 4OI3A 1P6TA 4U95A 4OV1A 3EPGA 1XERA 2GJFA 4OJHA 2ZWOA 3MR6A 4G3IA 3ISNC 1GNKA 2GO9A 1FA0A 2RQKA 1UWAA 1R43A 4NEZA 4AYBD 2V69A 2YTCA 4QW9A 3AJ2A 1H7WA 1H74A 1SV5A 3ADAC 1HNXF 1GMWA 3P49B 2E5JA 4WE1B 1FRXA 3IG1A 1GXUA 1Y4ZB 1NZAA 3HSDA 4J7CA 1S0MA 5H1SV 3WC2A 1S9GB 2CPFA 2XEXA 2DYAA 3R5CA 3CD5A 3H4DA 4JI3J 5MAOA 4ED7A 5L46A 2B9WA 2DO4A 2QIFA 3SCLE 4DL6A 4NA3A 4TLQA 2ZOFA 3CDWA 3T9NA 4DOZA 2Z2MA 3UNYA 2MZJA 2HGLA 2XSFA 4YEAA 1Q8KA 2PMZD 3MM6A 1GMVA 4Y6IA 3U1NA 1C1BB 4I69A 4P73A 5HVGA 1S1VB 3NRBA 5CYJA 3O3LA 1KHVA 2YX1A 2FVSA 4KGKA 1CJKB 3PG9A 4O3PA 2B51A 2O01C 2WVEA 4DX7A 4JI8F 1YTYA 2NZCA 1U1MA 3HO1A 2YNHB 3HI9A 3DI6B 3FJ2A 2QFJA 1UEKA 4OJ1A 1TTHB 4DF4A 1OQ3A 2FLLA 4RW7A 3PYDA 1NAQA 1JIHA 2BJDA 4LFBF 2KXFA 3DLEB 1VIOA 2IM1A 3L7UA 4NZ7A 3G82A 1R31A 2B4VA 3W60A 4RU9A 4IOCQ 1OY9A 3VGUA 5IC4B 2XC9A 2KI2A 2MZRA 2Y1JA 1SIZA 4V19X 3AJ1A 1SV5B 2BANB 1WEXA 5IT9Y 3I9V9 5HJXA 1IKXA 4YQWA 5EHHA 5KFDA 3DLHA 2MQQA 3W9HA 1X8DA 5GADI 2J6UA 2ZD1A 2CG4A 2YQ0A 4K4VA 3R1LA 2JEFA 5HO4A 3LP0B 3FCWA 4FYYB 4GKKJ 1EKSA 4F67A 5HMZA 3DDIA 4YR3A 2QV6A 3DRSA 1RWXB 1VBKA 5EUHA 4N41A 4MYTA 3R5AA 4EO6A 3TANA 2W8LA 4GVLA 4PXCA 4RKUC 2R7OA 4YB5A 2DNHA 3NWGA 4ZP6A 1NK6A 2AJFE 4X4UA 3OVSA 1O0PA 3VALA 1O6XA 4ECZA 3CCQS 3M9MB 4IH6A 1RB0A 1RT7B 2E1AA 3PR4A 3R5BA 4LT6A 2VOPA 1NDLA 4KBIA 2AJ2A 2BQ3A 3D6MB 1HQEA 1U1PA 3LAMA 4LBHA 1M5HA 1EETB 2LVWA 2YWGA 5C42B 2Y9HA 5ETTA 2L41A 3QT6A 3RRHA 4EBDA 2P6SA 4MYUA 4ETZA 1NB2A 4K2JA 3T5JA 4JI0J 4J9SA 2VIHA 1P8GA 3PJ9A 3CJ4A 3QGIA 4J9OA 1LK7A 2XBPA 2G1DA 4WKRA 3AB4B 4WPAA 2HHUA 4PQUA 4TY8B 1RKIA 3JSMB 1UP1A 1X5PA 2GIRA 3G8TA 8ATCB 4HT7A 2CAJA 3OTCA 4O0IA 2RQCA 1FRLA 4EFAC 1NK8A 1BQMB 5K14A 2J8AA 1K1QA 2GC8A 1HWKA 2JFKA 3FSIA 2L48A 1FDAA 5RUBA 2YNGB 3J7AN 3NKYA 4PR6A 2ALYB 2RJZA 1J5OB 3Q2TC 3H20A 2A2CA 1EQ0A 1RYSA 2E9RX 4MFBB 2OAUA 2QA1A 2UUTA 3OL9A 2FQQB 2J0QD 4OZ5A 1RT5B 1ACMB 3PXGa 2A6OA 5F8IA 2E1PA 3CD6S 4EO8A 2L9WA 4ERDA 2VA2A 3E01B 2WB4A 5K8PA 2DO0A 4NA2A 5KOXA 1KEKA 3MPWA 4NYPA 5H9FK 5IV4A 1SIWB 3OFGA 3QNWB 1NMEB 4LF5J 1FFSB 2CKWA 2NXUA 1DTQA 2HFOA 3QRQA 3RW7A 4BC7A 3BM7A 3C6UB 4NA1A 3ICLA 3QT7A 4JI5J 3HM9A 1FD8A 3KLIA 1F3VA 3PYGA 2PFDA 2OKQA 5B0GA 4DR4F 1ZAWA 5KT5A 4OFZA 4RUHA 2QYCA 1B0PA 1OIAA 2W2QP 1HBNA 3CJSA 3DGPB 3GLJA 2C22A 2R8GA 1S97A 1F0XA 2DISA 3FRZA 1HQ2A 4FPIA 2JX2A 3OR2B 1X4DA 4WU2A 1HBNB 3DGPA 4ECSA 2J0SD 1OY8A 1WF2A 3NOCA 4J9QA 4GO7X 3CCES 3KG1A 2JL9A 3RB3A 4EK2A 1OO0B 4ICLA 2VC1A 4LRAA 5IWAF 5E3CA 3N6MA 1OQ6A 5LM7E 4ZVGA 3ENAA 5DS7A 4PCQA 3TYTA 4ZLPA 1J5EJ 1W25A 1JLEB 3PDNA 4YB7A 1JLGA 1KTQA 3V5RA 2XZTB 2YWKA 2XS5A 4QIEA 4LJMA 4LIWA 1WC0A 2RS8A 2XG8A 1NHVA 3P5TL 4J90A 1NSKL 2MQOA 4AXJA 5A2QY 3LPEA 3I56S 1HBUA 1C4AA 3KUGA 3MMBA 3DLGA 1QD1A 4CDIA 1TFYA 3BR8A 1QM9A 4RW4B 5HP1B 5IC6B 4LBPA 3QZ8A 4NPOA 2IM2A 1UVKA 2MKJA 3PHTA 4LRBA 3J81U 4ECUA 2XYPB 1RHQB 5J2MA 2OD4A 4CQ1A 3V6DB 2J7KA 2A18A 5GAGI 1EX8A 3R2CJ 1D09B 1IJEB 1Y5LB 2JC1A 2VUGA 2ZBQA 4KJIA 1IR2A 2JWNA 2MXYA 1PAUB 2QFIA 1K9MT 1RT1B 3I0SB 1Q5YA 4RWWA 4RZRA 1CJVB 2ZKTA 4DX8H 2D74B 3D66A 2ASLA 3BKTA 2CPJA 1VRUA 2ZC3A 4R8UB 1O51A 1WF0A 3SCJE 4DS4A 3PW4A 2EC0A 4DLEA 5I3PA 3E8OA 1FJGF 1I3OB 2J0WA 4IKAA 4FF3A 3EMTA 2FHOB 1ZM4A 1MWYA 4ZN1A 3PEHA 4ZPDA 6FD1A 2AX1A 5DQGA 4UY85 3KLEA 1HKAA 2YH0A 3AA8A 3HSZA 5FD1A 1RAHB 2GHPA 2K3KA 2XTJP 1UAWA 1C0UA 2CNNB 4QOTA 3WQPA 5F3TA 4CLUA 3Q2SC 2EBEA 4PWWA 1SQGA 4AE5A 4PXBA 2B6AA 4JI5F 2KDOA 1WC1A 3ZFVA 2DIVA 3C66A 3PACA 1EKRA 1N5SA 1IR0A 1KLNA 5THWA 2ZH3A 5M2PA 4KKOB 5KFKA 3A3PB 2VB6A 4DR1F 2DRAA 3LANA 2G1HA 5KFXA 1XEZA 3G2XA 1JNRB 1HLWA 2DNMA 3KXDA 4FNIA 2OTJS 1JXVA 4O4GB 1M1GA 5KFAA 1N5QA 1BQXA 1YJ7A 1T03A 3THPA 3CCVS 5DO2A 3WIUA 2CQ3A 2Q79A 2Z2YB 2JVOA 2CZVC 3AAWB 2MSSA 3FNNA 5A0YA 5KG4A 1Q53A 1FRKA 3Q23A 2LKZA 2QL7B 5AXKA 1AB8A 2FZGB 4RBUA 5CYMB 5ETRA 2P5VA 3TUPA 2DR6A 3G8QA 1SJRA 4JB8B 4FS2A 2PFFB 4QBUA 4G1QB 1Y10A 2DGWA 5KT6A 3MEEB 3MM9B 4NLRA 5IT0A 3W64A 2QLBB 4EZ9A 2YKAA 4H4KA 5BYSA 2IY5B 1B7YB 3QIDA 3PW2A 3M8QB 4CO0A 4C8MA 4KB7A 1NH8A 2I5JB 3OL7A 1S72S 1WTFA 1BQNA 4IFVB 3M2UA 3W7BA 1MMLA 1Z2ZA 4USHA 5KFNA 4CRJA 2HFSA 3ENVA 2GZOA 2I5JA 2RIJA 4RUCA 2W9CB 1JJ2R 2AU0A 4FVMA 4UTGA 1S1XA 3KDNA 1A7GE 3W2WB 4K4UA 1SJFA 1WG4A 3MPDA 2HHVA 4Q2MA 4X4PA 1H3DA 5L38A 4EZ6A 3BO3A 1QAIA 4IFYB 1JNZB 1T0TV 2HS0A 2XGPA 4ED5A 3OQ2A 2RUSA 1XJWB 4PAAA 3W61A 2FY1A 3TX0A 1WC5A 5ETLA 2W7PA 2MKHA 9ATCB 2XMVA 3CCRS 2GA7A 4PG7A 1Q79A 3Q8QB 1NUEA 2HNYA 5DDPC 3C16B 4NL5A 2CQ4A 3B82A 4ZA1A 4W4MA 5L1LA 1XQIA 3DU5A 4U7CA 4IRCA 1SC3B 3H2VE 2ZH9A 3OJSA 4ZP9A 2B7BB 2G2YA 2VA3A 2UVUA 4N76A 1D8ZA 5JJBA 3DYAA 3VTIA 1N88A 4E8UA 1G2EA 2VPYB 3DC2A 5HL7Q 3QFWA 3EZUA 1B64A 3GP9A 3GPAA 4JBCA 1M5OC 3N6LA 2B6AB 5K8MA 2E44A 3D9BA 3BBCA 4DMZA 3J7YU 2MB0B 4U8YA 2PE8A 1IR1A 2ZDPA 3QRPA 5A8KA 1UFLA 2ASYA 4QYZK 1IWAA 1CJUA 5ETSA 3SFUA 2R2UA 2VG7A 2H54B 4IH5A 3G71S 1HBUB 2IPOB 4DI6A 1NPKA 4NLXA 4Q45A 2CZ9A 3FCHA 4NWBA 3SFGA 3VAGA 3I5BA 4LMZA 4NOHA 1QTNB 2BE2B 2Q1LA 2WZ1A 4NLVA 4CTAA 4U6PA 2KU7A 1RTJB 3H5UA 4FNHA 3R5DA 4AUKA 1OPZA 4TYAA 2VD3A 2XWYA 3DM2B 5C2CA 4XDDA 4JV1A 1HWUA 1FCAA 4JI7F 2IC3A 2GVDA 3FFIB 1CPZA 2NXEA 3SZ2A 2BDPA 4IOAQ 3VAHA 2C2DA 2OPQA 1SH2A 3RRGA 2XZDB 1FVQA 1HBMB 1HWJA 3D67A 3W8GA 4C6AA 2H9ZA 1RHUB 2O66A 2XMKA 4OX6A 4CLYA 3PYFA 4OX7A 1PIEA 2RKIA 4D3GA 4I1TA 2DGVA 5J1EA 2R9LA 3I4HX 4OHVA 4OYOA 2X1FA 2YNFA 2FVPA 3A3NB 3R7SB 1NHUA 3MR5A 2YQ3A 1G3OA 3QSYB 4F8RA 4ILMA 2QN6B 4C8LA 5C7PA 4DSFA 1HYSA 3QLHA 5LSLA 1DZ5A 2L08A 5LXYA 1AFIA 2OTLS 2OD6A 2M9KA 4BWMA 3QT5A 2R7VA 4DUYJ 1H38A 2RILA 3GSDA 3AY0A 5CAAA 3CJTA 2V8GA 5DG8A 2K06A 4D3HA 1T8EA 2N82B 1Q7LB 2CIMA 2HNDA 3EZ5A 5DQIA 4J91A 4I6YA 2RHQB 2AIRB 3MMAA 5CCLA 3I0RA 3CCSS 2D9PA 2XHWA 4OYPA 2LDIA 3JTPA 2XLIA 3CCLS 2DNYA 1GEHA 3CCMS 4USIA 1U4BA 1PGZA 2GFFA 2X1BA 4PPZA 1QLNA 2VPWB 2E66A 1L3KA 5EWGA 3R5GA 5LJ5Y 2VKZG 3OHBA 2ZH7A 4PG5A 4J9RA 4LF5F 4KKOA 4F7VA 2ZHOA 4ID8A 4KIAA 1Q0NA 4CH1A 3MM5B 3PHEA 1UTAA 4XPEA 2OSQA 5H9EJ 3LW5C 3KFWX 2AT1B 3H0PA 2FC9A 3GV5B 1I94J 3M8PA 2A2DA 3CUNA 1RT5A 1M90T 2V8PA 4K4WA 2VDIA 2LEBA 5ETPA 3UD4P 4M5JA 2XY6A 4ED3A 1UPPA 4I56A 1LFPA 2MY8A 2F9DA 2HBYB 4OYBA 4IO9Q 1OMSA 1KC8T 3S1TA 2HAIA 1UJ4A 3X1LB 1N33F 2DNGA 1DY3A 1REVA 4K7QA 2IJNA 4Q43A 3GYGA 4DJBA 3HVTA 1F6TA 3NMAA 1I6JA 3GJRB 4TKTA 2XMJA 3MEGB 4Z7CA 1WHYA 2OEJA 3NMRA 3OR1B 1U2FA 3DOLA 3OLAA 4ZCIA 2KYZA 1UKUA 4R0JA 3UN2A 1K73T 3MUMP 2HS4A 4IRDA 3RBDA 2CVEA 1B3TA 4DQIA 1SL0A 1XMOJ 2YNHA 2RT3A 5JVGQ 3EYZA 1AT1B 3C46A 1PKUA 4IH7A 3DLKA 4KH1B 2RUGA 1U1LA 5GAHI 1XK8A 2OEKA 5K8OA 2DD8S 4KFBB 4Q44A 3MXHP 2I8EA 5A6PA 2BM1A 1VQOS 1QVFR 1SJQA 2J7UA 2XYHB 4CYUB 2WB1D 1R0AB 3TR5A 5IV3A 3CXCR 2HBRB 2HQFA 2P6TA 5KFLA 5GAEU 2JEIA 1NXIA 2MGZA 4P2MA 1IBLF 2VF3A 4MKBA 4F4ZA 3NBPA 1JKHB 3K57A 4HHHA 3PW7A 1ZA2B 1S6QA 1HYSB 3QSIA 4Z7YA 4DR5J 3T5KA 2LCWA 3FEZA 1HNWF 3TVYA 1ZTTA 3THTA 1S48A 1Y5IB 2IYGA 2IBOA 4CLWA 4HI2A 3SSRA 4ZLNA 5AT1B 5LSOA 1IXKA 2OP5A 3CIZA 3DXBA 2XSJA 4ED6A 3N9UC 4A8QA 4EWTA 3OTEA 4L74A 4ELVA 3OVAA 4U7UD 1KN6A 3HCXA 1HI1A 1WELA 2ZJPQ 4X4OA 4DFJA 2OELA 5DG9A 1FE0A 5IZHA 4LFBJ 5DZ6A 3JSRA 2U1AA 5CYMA 3BF4A 4E0DA 4X2BA 5B0FA 1S9GA 3SCIE 1NSAA 1FWKA 4LRFA 1LWEA 4DG1A 1F3FA 2KXNB 1RT2A 2QO3A 2EG2A 4LF4J 3HZGA 1J2VA 1F2HA 5B0BA 1LXJA 4CO4A 3KMQA 4GKKF 2DR7A 1CSJA 4P6QA 4QWEA 5F8NA
chains in the Genus database with same CATH topology
4U67Q 3QO9A 1X4HA 2Q43A 3MF5A 2F3JA 2W4CA 4CO3A 1YJNS 2DCUB 4ED2A 2DBBA 2NQPA 3HK2A 2YKOA 1SKWA 2RS2A 2E29A 1G7CB 4IUFA 2OPPB 2XI2A 1PILA 3DLJA 5KG1A 3Q8RB 1C0UB 1YI2S 1R0AA 4DV0F 4HDHA 1VBZA 5FIIA 1IKVB 3RW6A 4LIRA 2LECA 2BYCA 4BHQA 2VG6B 2UV8G 2B5JA 2FB0A 2Z8QA 1O8BA 5CCMA 4A8MP 2P9EA 3FSXA 1HNZF 3CC4S 5KFOA 4K4SA 2HNZA 2HS3A 1EETA 1FRHA 1R8CA 3DRYA 1YJ9S 4DR2F 1K1SA 2EPIA 4TN2A 4DL0C 1RTHB 2C2RA 1QVGR 1N5TA 1SJ4P 1C1CA 1ZYQA 3C2PA 2WOMB 2CPIA 5HP1A 4F3MA 1LWCA 2Q6BA 3QWUA 3BJYA 3T6BA 3F73A 4ED8A 1NKEA 1W2IA 3MM7B 4DUZF 2DR9A 2BJEA 1SBRA 5IFMA 2B0GA 4NLUA 3BEGB 3CTRA 3GZ7A 5J2QA 5HLFA 4L72B 1VFJA 1VK3A 2W9CA 2HG4A 3AB2B 3BN4A 1YHQS 3MD3A 4DL5A 1TFWA 3VQSA 4PG4A 2IVFB 4CT9A 4Q2LA 1S1TA 4OJ3A 1KLMA 5C25B 1ZZFA 1A6LA 4IDKA 4NZ6A 5K14B 5DQHA 2H5EA 4QWAA 1FNXH 2R2SA 3V4IB 3KJVA 2IA0A 3N0VA 1XMBA 1UWBA 3TW0A 2OPRB 4WYLA 5KFWA 5I4MA 3POTA 2R7RA 4AQYF 2AJQA 3I6PA 2NYIA 2IRXA 4ID5B 2ZC4A 2B5JB 3LP2A 1WTBA 1T95A 2QLXA 4DQRA 4QR1A 2W9BA 2VG5B 3F56A 5KAKA 1G6BA 1RWUA 3M6VA 1RTJA 1S9EB 5JUMA 5GAGU 2YH1A 1KQGB 4ZPTR 3E51A 3HP6A 1N56A 5KG0A 4LF8F 1HBOA 2UVRA 2XCAA 1JB0C 3A1YG 1RISA 4LQ3A 5KFRA 4BDPA 1CQMA 2ZKUA 1M5VC 5DJBA 2NS1B 5GAEI 1R6YA 5HROA 3PR5B 3LP0A 1OWXA 5FLXY 1X9WA 3G9CA 2DHXA 2KN4A 1TQLA 2BXJA 4HVZA 2N7CA 1WHWA 3HKWA 3IS9B 1N52B 4H4MB 5D6GA 4QIFA 3EPIA 3DMJB 4LSNA 5GVQA 4DV4F 2DPJA 2V4JA 1SJ1A 2LYVA 2AW0A 2ZITA 3K5OA 1UA0A 4WU3A 1SKSA 4QYZJ 3LP2B 1JLCA 1DTTB 1DRZA 1IUJA 1DLOB 3ISND 2I1RA 3HHDA 4DL4A 1UJ6A 3C6TB 1FERA 2CQIA 5C42A 1R7IA 2DNOA 4P7VA 2DGQA 4WKYA 5KFHA 2JC0A 2ZZNA 2Q66A 2BOPA 4CO1A 1IBKF 2WTFA 2QZ8A 2E9TA 2FLOA 1RA6A 2D41A 2PI5A 5M2UA 3MAQA 2AYGA 4MIBA 1FRJA 3N5BA 2ADBA 3NGDA 2FVQA 4L6V3 1KQKA 2CJKA 5LT5A 4LFAF 1S49A 3SDEB 2CZ4A 3CJ0A 3GIKA 4OZ1A 3RAXA 2V4JB 2HRYA 5KFQA 1W2BR 5KOWA 4WYWA 4KAIA 2HFNA 2BQUA 4GC7A 2VH7A 2GQCA 2JH3A 2EFOA