4IFYA

Hiv-1 reverse transcriptase with bound fragment at the knuckles site
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
total genus 165
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ifyA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ifyA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ifyA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ifyA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ifyA05
3AVKA 1TGOA 4RW7A 5F8GA 4DS5A 4KFBB 1S4FA 1REVB 3G6VA 4KFBA 2P5GA 3LWLA 1SL2A 4KHMA 1REVA 3QNOA 1NKEA 1RYRA 4F4XA 5KFBA 1C0TB 4J2BA 4TY8B 1C0TA 2BQUA 2J6UA 4NLTA 4B8CA 4TY8A 3MXIA 3N6MA 1ZYQA 3CM5A 3HP9A 1GX6A 2E9RX 4CEAA 3ZSWA 3SJJA 1LWEB 4KRFA 4AHSA 1BQNB 3OYIA 4JS4A 3PW0A 3VQPA 3TWHA 4RNOA 3MR2A 4DF4A 4KPYA 3U3GA 1BQNA 4O3NA 4ZTJA 1O1WA 4WE1B 3ZSVA 3N6LA 4DG1A 3TR8A 1D9DA 2HHXA 4QW8A 3UDLA 1VSMA 1HARA 2O5DA 1S6PA 2JEGA 1IG9A 1RBVA 3V81A 1ZBIA 2WTFA 2UUWA 5HP1B 2FBVA 3MR5A 4FLYA 4M3XA 5F8HA 2D0CA 1S1UB 2XRIA 2J6TA 1TQLA 1WSJA 4IKAA 3KLFB 3PY8A 1TKZA 1QQCA 4TY9A 4NYNA 4ED0A 4M3YA 4MIBA 1VSJA 4PUOA 4NLPA 4M3ZA 3KLFA 2R2RA 4CHZA 4NRUA 3IGVA 5KFPA 4GW6A 3OJUA 1RT1A 3QNNA 3VQ4A 4F50A 1KVBA 3AO2A 1N4LA 3QYYA 1SH2A 4CK2A 3OS0A 3KD1E 3K58A 4QCLA 4WYLA 2OH2A 4ZVFA 4O5BA 3QIPA 3OSPA 2FC0A 3M8SA 4E7HA 3D28A 1JKHB 4KKOB 3VQAA 4DSJA 3V1RA 4MKBA 3KTQA 2OA8A 4CEOA 3TAQA 3H5SA 2ILYA 4CJVA 2HHWA 2V4RA 3DOKA 2IOCA 4OLAA 2O4GA 3IRXB 1S6QB 4JS5A 1N6QB 3MR6A 1IKWA 4CHYA 4Y1DA 4FJJA 1S10A 4CFCA 3TAEA 4B9SA 2IM1A 4YR2A 1S6QA 1N6QA 1S1WB 1BQMB 4RUAA 1DLOA 4CEZA 3OJSA 1JL2A 1S1WA 1BQMA 1QS4A 2ASLA 2DPIA 1YT3A 2GIRA 2E6LA 3CQ8A 4CJLA 1LW2B 3LP0B 2WB4A 1VRUB 3V6DA 4ECRA 4FM1A 2BE2B 1HPZA 3V4IB 3SQ4A 1A5XA 1VRUA 5KG6A 4E7JA 3M8PB 4MH8A 3V4IA 4O3QA 4EBEA 3H59A 1C2PA 4IDKB 2UUTA 3AA4A 3OYFA 4DU3A 3NF9A 3M8PA 3I5AA 4IDKA 2YNFA 1WAFA 1R0AA 5FRNA 3KHLA 1S0OA 4E7LA 2F8EX 5KRSA 2ZD1B 2JEIA 4O44B 3QEPA 4LSNB 4TLRA 3G6YA 3AVLA 4E3SA 2ZD1A 2I5JB 1QAIA 3V9WA 5FDLB 1RBTA 1NHVA 2G8KA 3QEXA 1RBUA 2I5JA 3OYEA 1WSIA 3F73A 3T5KA 4FK2A 2G8FA 3ZSZA 4ZMMA 2R2TA 4FJ5A 3H08A 1RA7A 3P5JA 4Q45A 2HAIA 2XI3A 4FK0A 1DTTB 1L3SA 1KSPA 3VQQA 3HO1A 3WNHA 2WK4A 2BQRA 2DTUA 4WZQA 1DTTA 2YNHB 4EP4A 3ZT2A 3MEEB 3G6XA 4IKFA 1JLAB 4K4XA 2YNHA 4QWCA 4W5OA 2ITGA 1JLAA 4CGHA 3UQSA 4ECSA 2KQ2A 2FVSA 4NLGA 5I42B 3FDSA 4FLWA 1XC9A 4FJ7A 4FYDA 2D3UA 4ZP9A 5I42A 4WFYA 1LWCA 2WOMB 4J2AA 1IO2A 1ZTTA 2WOMA 2BR0A 1C1CB 3L8BA 3JSMB 4ZHRB 2UVVA 2ETJA 3VQ9A 2IGIA 4J9MA 2G8VA 1C1CA 3EPGA 1HNVB 3JSMA 4WXWA 4KSEB 4FJXA 2WCXA 1S9GA 3G86A 2AU0A 1WNSA 2E9ZA 2OPQB 3MAQA 4F4KA 4QWBA 2OPQA 3TQ1A 2F96A 4RNNA 4J9SA 4ED6A 1U48A 2HHVA 4CJTA 2XGQA 4NYZA 1BHLA 4NLYA 4U6PA 3V9UA 4XIUA 5FROA 3O4NA 3OL9A 3C95A 1NK8A 2VG6B 1TK5A 4LY7A 4X2BA 4AHCA 1HYVA 3T5LA 3ZT4A 2FVPA 1S9EB 4LQ3A 3PZPA 4JUZA 2UVWA 1S9EA 3SPZA 2OZMA 1XR7A 4ECQA 4Z4EA 4ZPAA 2RF2A 1UA1A 3B6OA 5DLGA 1BISA 3OYNA 2RKIB 3HSTB 5KG3A 1TKDA 3S9HA 1ZBHA 2KZMA 3WNGA 4RNMA 4Q5VA 3CFRA 4Q43A 3N6NA 2PYLA 2Z1GA 4M42A 2IAJA 4F4WA 3TANA 3K2PA 3V9ZA 5KT6A 4MQ3A 4J9NA 4NZ0A 3GV8B 3SFUA 1QHTA 4JV0A 3AVAA 3TABA 1RDAA 3KJVB 1RYSA 2AJQA 1QTMA 3PR5B 2JEFA 2FVQA 3H4BA 1T03A 3GILA 3KJVA 1XWLA 3GIKA 1DTQB 1JLGB 4H54A 1ZETA 1Z25A 1VSFA 1X1PA 5CYQB 1JLCB 1DTQA 3C6UB 1JLGA 3CDUA 1TV6B 1MU2A 3KLGB 5J2NB 5HLFB 4CJRA 5CYQA 1IKYB 3IS9B 4CGIA 1JLCA 3KLGA 2IJFA 4N47A 3SQ0A 5HLFA 3AVFA 5JXSA 2JC0A 3MFHA 2X6SA 4NRTA 3M9MB 5EWGA 3TVKA 3OS1A 4CEEA 1EKEA 4ZVEA 2GIQA 3MEDA 4DL7A 4DL4A 4DSIA 3AA2A 3H98A 4DQPA 4DU1A 4NLXA 3QGHA 2GC8A 4IH5A 3RAQA 2AX1A 4BE0A 3AVCA 4ICLB 3ZSOA 2R8IA 4C8NA 4H4MB 4ICLA 2I1RA 5EDWA 4HCCA 3DLRA 3PVXA 1EP4B 2O4IA 2F8TA 4IFVB 3CM6A 4H4MA 4I2QB 5CZ1A 1YVUA 1B9FA 2FJVA 2QKBA 4E1MA 2HB5A 4I2QA 1RTJB 4O4RA 3VQSA 3ZT0A 4C8OA 3DRSA 2BANB 1ZBFA 3KKSA 3NGIA 1YVFA 1RTJA 2GUIA 4DWIA 3SUQA 4TYBA 3V9SA 2BANA 4K4ZA 3O3HA 3QIOA 4ED8A 3ZT1A 3NKYA 3OHAA 1BIUA 4NCBA 1S49A 3MXJA 5JS1A 5KI6A 1ASWA 4KHNA 1U47A 5HRSA 5KG4A 2R8KA 4ED7A 4FJLA 4K4UA 2FLPA 1KTQA 3JYTB 4JRPA 4NLRA 1KCFA 4I9LA 1WAJA 3SV4A 4F8RA 4DQQA 4M94A 4ECZA 3K57A 3ZCMA 5KGWA 4J9QA 3E01B 3KMSA 3M8RA 4KO0B 1U4BA 4FJGA 3I0RB 3OYBA 4R8UB 1QSYA 3BDPA 1ZTWA 2XY7A 4CGJA 1N5YA 1VSDA 1NK5A 3ISND 4R8UA 4ZPCA 3S3NA 3NL0A 4CK3A 2KFNA 4G1QB 1LW0B 4CJFA 4KHWA 4M95A 3SFGA 4IG3B 4I7FA 1LW0A 3GIIA 3PW7A 4ZVGA 4DFKA 2WONB 2DY4A 2A1SA 3NAEA 3KIOA 3ITHB 3NH2A 4KB0A 4ZP7A 3ITHA 4FXDA 3VQ8A 2KTQA 4I9QA 1J54A 1J53A 3DMJA 2KZZA 1HQUA 3GIMA 1NJZA 3HL8A 4BDYA 3CJ2A 3BQ2A 1BI4A 3ALYA 5HRRA 3RMDA 4CF0A 3KOAA 4F4ZA 2IS3A 3AVNA 4FLTA 4DTSA 3RTVA 3ZSYA 4DEZA 3G0ZA 1TL3A 3NAHA 2YKMB 5KT4A 5KGXA 4DS4A 4NLVA 4TN2A 3HT3A 3PUFA 2YKMA 3MECB 4IRKA 4IG0B 3NHGA 4DQRA 3MECA 1SUQA 4IG0A 1S0MA 3K5OA 1TK0A 3V6JA 4HHTA 4W5NA 1RA6A 2R2SA 2BRLA 3VQDA 3Q8RB 4NLQA 4WZMA 4B9TA 4KB1A 3NF8A 4J9LA 2YV0X 4K4VA 3L2QA 4CFAA 4KREA 2IC3B 1NOZA 1WN7A 3MTKA 4C8KA 2E9TA 5EUHA 2IC3A 5F8IA 1A5VA 2XC9A 3CJ5A 1NJWA 2RN2A 4IR9A 3TAMB 2QE5A 2C22A 3KD5E 4DFMA 2OZSA 1RNHA 3TAMA 4EBDA 1RILA 4DG1B 3FRZA 3IG1A 2P51A 1RT6B 2AQ4A 4IOBA 4YQWA 4CIFA 4JV2A 1S6PB 5DK5A 3OYLA 4ED2A 1RT6A 3V81B 3NCIA 4HCBA 1MMLA 1UWBA 2BRKA 3H5XA 3I5CA 5J2PB 2IM0A 4FJNA 2VG5B 3V6KA 5D3GA 3LANA 3D0PA 1TKZB 5J2PA 3OLAA 2VG5A 1JLQA 4URSA 3GV5B 4FZXC 3KK2A 1CSJA 4PUOB 4IH6A 4O3OA 1HJRA 4DTPA 3PO5A 4FJKA 3V1QA 5HRPA 1IKXB 1Q9XA 5KFYA 1J5OA 2ZE2A 1Z26A 4B3OB 1RT1B 3SQ2A 1IKXA 1S48A 3CVKA 4Q8FA 4CEQA 4B3OA 1TAQA 3HK2A 2RDJA 3EZUA 3QERA 1T7PA 3OSNA 4M41A 2AWZA 2W8LA 1KFSA 4FBTA 1NKBA 4ECVA 3QIPB 4RW4B 3UR0A 4FJ8A 1KLNA 4CGGA 2X6NA 3SNNA 3NAIA 4RW4A 4O4GB 4UQGA 1XR5A 1S1TB 4QWDA 4O4GA 1D5AA 5KFEA 3DOKB 1S1TA 4IQXA 3RR8A 5KFJA 1CXQA 1UA0A 5KFHA 2HWHA 4PWDB 1IKWB 2RPIA 2D5RA 4ECYA 1HNIB 2HW3A 2C2DA 2FLLA 3LPUA 4O55A 1T05A 4PWDA 3HPGA 1HNIA 4LH4A 1DLOB 1RDCA 4J9OA 3DRPB 5J2MB 4R0EA 2HNDA 5HROB 1JL1A 1RTDB 1XR6A 4PY5A 1SKWA 3DRPA 5J2MA 2IM2A 3HVTB 5HROA 3PHEA 1RTDA 2Y1JA 3HVTA 4Z0UA 3OY9A 4RW9B 3V6DB 4URGA 1HPZB 4CJ5A 4Z4FA 4RW9A 4CE9A 4N76A 4Y1CA 1TKTA 3QIDA 2VWJA 4DTJA 2YNFB 1R0AB 5C42A 3THVA 4GC6A 4WXOA 3PW5A 5KFXA 5FRMA 3D45A 1FKPB 1K6YA 3EPIA 3NMAA 2XY5A 1FKPA 3VA3A 3AVBA 3RMCA 1C1BA 3HPOA 2B43A 1Q8IA 4K8XA 1BCMA 3AVGA 3TAGA 5EWEA 1TAUA 4OKEA 3SYZA 5KFTA 3LAMA 1SKRA 4Y34A 5KT3A 1SH3A 5DQIA 3VQ7A 4DSEA 1Z4UA 1VSIA 2ATQA 2XCAA 4ID5B 4NLUA 1TK8A 1FKOB 4CFDA 1IH7A 5CY4A 4ID5A 4EZ9A 1FKOA 4ZVHA 3V1OA 4CHQA 3NDKA 4FJIA 3SV3A 2AGQA 4E89A 4CGDA 2W9CB 2X74A 3AO5A 3K5NA 4ZP8A 3L2UA 2W9CA 5J1EB 3SUNA 4OVLA 3H40A 4M45A 3IAYA 1RDRA 1RCHA 1HYZA 4IH7A 5J1EA 3GV7B 1YTUA 4FLXA 1LWCB 3T3FA 2Z1JA 2W7PA 1IKVB 5KFQA 2R2UA 3BSNA 1WSEA 1C1AA 3ASMA 4IRDA 1IKVA 4EO6A 4KTZA 3CJ0A 3U6FA 4FJ9A 3OYJA 4K4WA 5CZ2A 3DRRA 1S9GB 1C0UB 3DI6B 2C28A 1X9MA 1SV5B 1C0UA 1JLFB 3DI6A 3HPHA 2FJXA 1SV5A 4M3RA 1JLFA 4C8LA 3TI0A 1WNEA 4ZPBA 3BSOA 3PV8A 1QSLA 2B5JB 4DL2A 3P1GA 3KLVA 2B5JA 4E19A 4J2DA 3I5BA 4K50A 4KHYA 3RB3A 4ED3A 4OGEA 4DL6A 5KG2A 5JS2A 3SI6A 2OPRB 4WFZA 3H5UA 3OYKA 3RBEA 3HVWA 2OPRA 3DDKA 1NNDA 2RF2B 4FS1A 4QOZB 2Z1HA 4DLGA 2IMWP 3AVHA 2HVHA 2OPPB 4J9KA 4Q0BB 3NBPB 1QUVA 2OPPA 4NCGA 3I0SA 4Q0BA 3NBPA 4Y2CA 4FLVA 4K8ZA 1TKXB 5DG7A 4B9UA 4YP3A 2IAJB 1U09A 3GIJA 4CEBA 4PQUB 1TKXA 4PQUA 3AO4A 3G10A 3AVMA 1SL1A 1EETB 1K1SA 4HTUA 3PW4A 3NF6A 4CJWA 2YHAA 2XY6A 3DYAB 3H5YA 2ILZA 1T03B 1EETA 4DQIA 3DYAA 4WYWA 1ASUA 4QPXA 3LP3A 3RWUA 4CFBA 1W9HA 4DMNA 3HVRA 4Y3CA 1MU2B 1Y97A 1NK9A 1CXUA 3C94A 5DLFA 4CIGA 2P1JA 3E51A 2QV6A 2YNIA 1U04A 3DOLA 3IGNA 3MEDB 3KK1B 3RAXA 1SL0A 1HMVA 3VQ5A 4EBCA 4CHPA 3KK1A 4CECA 4Z4HA 4CCHA 5L1KA 3ZSRA 1QAJA 1T94A 3DLGB 5K14B 4GMJB 1GX5A 2BDPA 4JV1A 1L5UA 3PJWA 1C0MA 4O3SA 3DLGA 2ASDA 5K14A 2FVCA 1A5WA 4Y2AA 2IDOA 5J2QA 1WSGA 3DRSB 3KK3A 1JXLA 1S1XB 2ALZA 4F4YA 4FCYA 1XHXA 4NLOA 4YR0A 5KG0A 1S1XA 5KT2A 3HP6A 4OLBA 4ECUA 3KLEB 2ZQBA 3RB0A 3PJXA 4R5PA 3O3FA 3MEGA 1UOCA 4DSLA 3KLEA 3K5MA 4Z4IA 1B92A 3UPFA 5KFRA 3VQ6A 5DQHA 1KRPA 3PR4A 2UVRA 2XHBA 4RUCA 1Q9YA 1D0EA 5E41A 4TSXA 3OL6A 3DLBA 5DQGA 3TAFA 1EXQA 4CHOA 3VA0A 2RDIA 1SKSA 2KW4A 3BJYA 4DL3A 2FBTA 2EC0A 1S1VA 4LH5A 4BACA 2ATLA 4BE2A 1N5YB 4DTMA 4WFXA 3C6TA 3L3VA 4IFYB 3SUPA 4QW9A 1D8YA 4PA1A 2YHBA 1VSEA 4IFYA 2PZSA 1SH0A 4KHSA 2W9BB 4B9NA 5L9XA 1KLMB 4I7FB 3EYZA 4CJ3A 4RNHA 1QSSA 2IJNA 2GV9A 2W9BA 3CG7A 3AO1A 4OKJA 4CJQA 4QAGA 1ZBLA 1KLMA 4O3RA 3OYCA 4FS2A 3M8QA 4ZTFA 2JEJA 2HVIA 4DTRA 4AHVA 5F9LA 2LSNA 1GOCA 2R7YA 2XO7A 3LZIA 3AA5X 3DMJB 1RT4A 3HXMA 1HQUB 2D7SA 4Z4CA 2HWIA 2B4JA 1RBRA 1LWFB 1TVRB 5DG9A 4XPEA 1BI4B 3KMQA 3H2LA 1JX4A 4E0DA 1LWFA 3MFIA 1TVRA 1T3NA 4E7KA 1HYSB 4CIEA 4KAIA 4CGFA 4L8RB 1TL3B 1HYSA 4CF9A 4DTOA 1W25A 4QWEA 3LPTA 4M3WA 2HMIA 3GQCA 2J6SA 1S5JA 3AO3A 1JLBB 4TYAA 3O4QA 1XI1A 4ELUA 5HRNA 2HHUA 2IBKA 2VA3A 1SUQB 1JLBA 5EU7A 5C25A 2R8HA 3NH1A 3MXMA 2GBZA 1L3VA 1JXBA 3SUOA 5KFLA 4E1NA 3U3YA 4AHTA 4CJKA 1ASVA 3CWJA 4JLHA 3O3GA 3RRHA 3NE6A 1BL3A 4CHNA 1X9SA 3DLHA 4DFPA 3QZ7A 4CK1A 4KHRA 2W42A 3QO9A 1RT5B 4FZZA 3T5JA 3AVJA 2DFFA 3BSAA 4MK7A 2R8GA 3ZSQA 1RT5A 3TAPA 3Q8PB 4CJSA 3PX0A 3RMAA 4IRCA 5C5JA 4HVJA 4B9LA 4LD0A 4HUFA 1GOBA 3F9KA 1RT7B 3EZ5A 2D3ZA 1L3UA 4B9MA 4CJUA 3IG1B 3L2VA 4F2SA 3ZSXA 3OS2A 4IR1A 1RT7A 4DQSA 4XO0A 4NLWA 5KFNA 4KI6A 3HKWA 2YNGB 2W8KA 1NJXA 1UWBB 3RB4A 2YNGA 1JIHA 3NGDA 1NK0A 4AHUA 5D3GB 4CF8A 1D1UA 1JLQB 3ZT3A 3KK2B 3M9OB 3NF7A 3FSIA 1LWEA 3LALA 2Y1IA 4G3IA 3L2WA 1J5OB 2ZE2B 5KFIA 2ASJA 2CJQA 2FLNA 3RMBA 4Q8EA 4OKKA 2E4LA 3VQEA 4WE1A 4EP5A 3V6HA 1NOYA 2JC1A 4O3PA 1G15A 3BR9A 4CJPA 2HHTA 5KRTA 1RBSA 4W5QA 3VN5A 2CKWA 5HP1A 2A1RA 3OHBA 2D41A 3IN5A 2EX3A 1S1UA 2P5OA 5F8MA 4BWMA 1W0HA 1N56A 4CEFA 4EO8A 3M9NB 2XY8A 2VG7B 1L3TA 2BGGA 3CIZA 4HKQA 3AA3A 2VG7A 1NKCA 1EX4A 4RG8A 3SPYA 1LV5A 2V9WA 1RDDA 5KG7A 2IM3A 5KT7A 3PX6A 1VRTB 1K1QA 1T05B 3A2FA 1BGXT 1VRTA 2HNDB 3KHHA 1KHWA 5F8NA 3KKRA 1JKHA 4KKOA 2AX0A 4YR3A 3HJFA 3RBDA 4ELTA 1KVCA 5KFMA 3CFOA 3KHGA 3B6PA 1IM4A 3IRXA 1RTIB 2OPSB 3CYMA 5JUMA 3PO4A 5KFFA 1TKTB 3KLIB 1RTIA 2OPSA 1HRHA 3KLIA 5C42B 3L3UA 4IBNA 2XGPA 3FQKA 1I3AA 3OVNA 1FK9B 3VQBA 1FK9A 1C1BB 4FZYA 1LW2A 3LP0A 4ECXA 4MK9A 2BE2A 1KFDA 3SI8A 4CF1A 4OJRA 4URQU 3QLHB 1F21A 4YFUA 4BDPA 3QLHA 2BQ3A 4DTNA 5CYMB 4DTUA 5EWFA 5CYMA 4RU9A 4JRQA 4KI4A 4O44A 4J2EA 3SQ1A 2PYJA 4LSNA 4YMEA 5KFZA 4BWJA 5FDLA 4NLDA 3CJ3A 4FLZA 4K4TA 4B8AB 5KFAA 2F8SA 4I2PB 5DGBA 3WNFA 4EEYA 1CLQA 2WRMA 1VSHA 2FBXA 4I2PA 1CZ9A 4ED1A 4CESA 4ELVA 3T5HA 2HHSA 3MF5A 2KFZA 3PX4A 3ICLA 2HNYB 4FM0A 1GOAA 3QGIA 4C8MA 4J9PA 4FJMA 4F3TA 2HNYA 2OYQA 1I39A 3BSCA 4ZP6A 4FW1A 3CO9A 3BREA 1RT2B 3MEEA 5KG1A 3QESA 3HVAA 2V0NA 1RT2A 3DRRB 3K59A 3P83D 3OL8A 3T1AA 4EYIB 3S3MA 2G8IA 4ID1A 3TARA 2XCPA 5L1JA 3CFPA 2NUBA 1KHVA 3H4DA 4BE1A 2V4QA 3QEWA 3EY1A 4O0IA 1YTAA 5SZTA 4NCAA 4ZHRA 4HUGA 1HNVA 4KTWA 2JLEA 2C2RA 3LAKA 3D5MA 1NJYA 4NLSA 4KHUA 4RNFA 4KAZA 1XHZA 1CZBA 1S97A 2XI2A 4KBIA 4OGCA 4KHQA 1ITGA 3BQ0A 3QZ8A 4KV8B 3LZJA 4NCGB 3I0SB 4GC7A 4RW6B 3NFAA 4KV8A 2VG6A 4K4SA 4CERA 4RW6A 1I6JA 4LSLB 4DLEA 5HBMB 1TP7A 3ISNC 3WNEA 2Q3SA 4H8KA 1WLJA 2JGUA 5T14A 4KE5A 3RR7A 5KFCA 4LSLA 5HBMA 1LAVA 4F2RA 3KNAA 3HYFA 5KFDA 4OPJA 2HHQA 4TQRA 2RKIA 4HYKA 4DSKA 2VA2A 4Q44A 5DMRA 4KB7A 3T19A 2B6AB 1VSKA 4AILC 1HQEB 4CEDA 3HM9A 4KTQA 4N56A 3OLBA 3KHRA 3BQ1A 3QETA 2ZKUA 2B6AA 4K4YA 1HQEA 4Z4GA 4FLUA 3LWMA 2QXFA 2YNIB 1FXXA 3NGZA 1WSFA 4TXSA 3DOLB 3OL7A 3OYAA 4EYHB 5KFWA 1HMVB 3Q8QB 3OYHA 4B08A 4XPCA 2G8UA 2IA6A 3NH0A 3VQCA 1QE1B 5F8JA 3DLEB 3QEVA 2Z1IA 2VWKA 4NYFA 4M3TA 3SZ2A 3FFIB 2D0BA 1QE1A 1RTHB 3DLEA 3C6UA 1TV6A 3KLHB 4M3UA 3DM2B 1BIZA 4FW2A 5J2NA 1TL1B 5KG5A 3FFIA 1RTHA 1IKYA 3IS9A 4W5TA 3CJ4A 5L1IA 3KLHA 1S0NA 3DM2A 5J2QB 1RDBA 5F9NA 3PW2A 1TL1A 1BCOA 3LDSA 3BGRB 3KK3B 1D9FA 3S3OA 3GYNA 5KT5A 3BGRA 4FBUA 1LAWA 2W7OA 5KFOA 3MR3A 2G8WA 1JLEB 4MFBB 1C6VA 4R5PB 1X9WA 4YNQA 3MEGB 3LP1B 4J9RA 1JLEA 4MFBA 3UIQA 2HNZB 3SCXA 3LP1A 4QWAA 2FJWA 4GVMA 4DFJA 1VSLA 1EP4A 4MKAA 3Q8SB 2HNZA 5KFUA 4B9VA 2EHGA 4IFVA 2W9AA 5KFSA 5KFVA 4FK4A 1U45A 4FM2A 4MK8A 4EZ6A 2AGPA 4H4OB 2WHOA 3DLKB 4ECWA 4AHRA 4H4OA 1S1VB 4DL5A 4N5SA 3DLKA 1S9FA 4DF8A 4DTXA 3C6TB 3OYGA 1U49A 5F8LA 3LP2B 3RRGA 4O0JA 3K5LA 4DSFA 4BDZA 3LP2A 2FVRA 3AV9A 3L2RA 4AH9A 4FVMA 3JYTA 2DFHA 3M8QB 4FJHA 4HUEA 2G8HA 4CJ4A 1J9AA 1N48A 3QINA 3E01A 4RZRA 1NHUA 4OPKA 5KTQA 3OYDA 4KO0A 3I0RA 4F3OA 1RT4B 4U7CA 3HHKA 2FBYA 5KFKA 2QK9A 5T7BA 2D0AA 4MIAA 1WSHA 5DG8A 2UVUA 2YKNB 4G1QA 2R8JA 2QKKA 1NK6A 5DGAA 3CDWA 1T8EA 4IG3A 4OL8A 2YKNA 3RB6A 2DFEA 1RT3B 4E7IA 2HMIB 1OS5A 1VK0A 2PY5A 2WONA 4ZPDA 2DPJA 1RT3A 2AGOA 3ULDA 3QEIA 3V9XA 4DU4A 5C24B 3QGGA 5L1LA 5C25B 4RW8B 3FQLA 5C24A 1B9DA 2X78A 4CF2A 2C2EA 5KFGA 4RW8A 3CDEA 2XWYA 3OYMA 4TQSA 4N41A 4ECTA 1JXEA 5I3UB 4LQ9A 1ZBUA 4CJEA 1RAJA 3QO9B 1KVAA 5SWMA 5I3UA 1UAXA 3I8DA 1NK4A 3NGYA 2E6MA 4RW7B 4W5RA 3AVIA 1NK7A
chains in the Genus database with same CATH superfamily
3AVKA 3MTJA 1S4FA 5M2PA 1P6TA 1U1NA 2WVCA 2P5GA 3I31A 4KHMA 3VF6A 5E3PA 3CMAS 3G6EN 3QNOA 2XBPA 4F4XA 1U8SA 2V2KA 1C0TB 4P2SA 2EFPA 4J2BA 3QGPA 2E7VA 3ADAC 4TY8B 3GG4A 4O5FA 4O8KA 1C0TA 4JI7K 1BD6A 3T6BA 1FJCA 4NLTA 4B8CA 4TY8A 1RU2A 2HBRB 1ZYQA 3KWGA 1CJVA 3TUIC 2E9RX 5M1NA 4CEAA 4DV5K 3ZSWA 3IO1A 2XLJA 3SJJA 1LWEB 5EGYA 4AHSA 3FCHA 4JS4A 5HMYA 4RNOA 1SJ1A 3R3TA 4KPYA 4O3NA 1VQNS 4DG1A 1HWIA 3CULA 4QW8A 2AV5A 3BPSP 4DUYJ 2NREA 4LF4K 2JEGA 3H2VE 2CYYA 4OHZA 1EB0A 2FBVA 4B3TJ 4KH4A 1VQPS 5F8HA 2XRIA 1TQLA 2IPOB 1VRQC 1WSJA 1WHXA 4IKAA 3PY8A 3JB9k 4M3YA 1ZOTA 1VSJA 2YHWA 4UUXA 2YQ3A 2HRYA 3GOIA 3J80Y 3U4LA 3WDOA 4DV3F 4GW6A 3GLJA 3QNNA 5KPTA 3MM9B 4CZHA 3K9JA 2CPDA 1N4LA 3QYYA 1YUWA 1SH2A 4WFNQ 3ZTPA 4QCLA 3N4QA 4JKFA 5EX5A 4WYLA 5HO4A 2FXUA 4O5BA 1HNZK 3QIPA 4AL5A 3AAQA 4PABA 3V1RA 1Q82T 2DGXA 3KTQA 2OA8A 2MZRA 3TOQA 1W2BR 4ES1A 2YWGA 4X64F 3IM8A 2XZDB 1SKUB 1TZ0A 1JJCB 4DU8A 2J9DA 4NOHA 1S6QB 2V2VA 4BRPA 1S10A 2F7VA 4YR2A 1S6QA 1M5VC 1S1WB 1S72N 1S1WA 4X4OA 2UUBK 2QWMA 2LA6A 1ITPA 1YT3A 3EVMA 4PWWA 4ECRA 1HPZA 1SJFA 5KG6A 3RU0A 2CGJA 4ISEA 1XC3A 4MH8A 1FRJA 1YZ7A 5AE2A 4O3QA 4EBEA 5CD4A 2UUTA 1SC6A 3NF9A 2BKOA 3MPDA 3FBFA 3GE1A 3MGJA 2YNFA 3KHLA 1S0OA 1R31A 4CYUB 4G9ZA 1G6BA 1O0PA 5KRSA 3OTOK 1YSJA 4ZK7M 4CYUA 1VQ4N 4GV6A 3ZTOA 1QAIA 3SMPA 3V9WA 5LJ3Y 4K7QA 3M6UA 1RBUA 1DQ8A 3NS7B 2ZUAA 4YY3K 3A3PB 4DR6J 1ZAWA 1Z2ZA 1WEYA 4PRFA 4ZMMA 2R2TA 2ZGYA 3HD1A 1SAZA 2UU9K 3DLJA 5IWAJ 1GMWA 2DGTA 4NA2A 2ACMA 4HI2A 2B9YA 1L3SA 3VQQA 5B0FA 2CNOB 1F9HA 2DTUA 4EP4A 3G6XA 3M1VB 3NGUA 4FYVB 1K73T 1T3VA 3M1VA 1T44A 3MPWA 1UVMA 2V6AA 4QPTA 1UFWA 2B4VA 1N34K 3EE9A 4NLGA 1SCJB 3FDSA 4IJNA 4FLWA 2OJ3A 4FYDA 5D0RA 2BBEA 4ZP9A 4KGZB 2CQGA 3QRQA 2QL9B 3CJKB 2DHSA 3AA9A 4F04B 1QQOA 4ANEA 1FT8A 2QWOA 3CMAN 1WD6A 3HI9A 2G8VA 4WXWA 4FJXA 3IR6B 2M8HA 3DNCA 2CADA 4CLKA 1SC1B 1HNXF 1X4GA 5E26A 2HLTA 4DR3J 3MM8B 1OYDA 3S8SA 2BJ9A 1HPMA 2FJBB 2HS4A 4UQTA 4CJTA 1REGX 2VQFK 1IBKK 1XJWB 4NLYA 4U6PA 1PILA 3AJ1A 1S59A 2HFZA 3MHYA 2DEJA 3O9QA 4LY7A 1HYVA 2SXLA 3HX9A 4FOEA 3D0GE 1SPBP 1VQNN 4CLTA 2F9DA 4WK1A 4CLSA 2RF2A 3B6OA 2B9EA 1RAGB 1VQPN 3OYNA 2RS2A 4A8OA 1IWAA 3S9HA 4KH6A 2F65A 3CFRA 4LIWA 4F4WA 3K2PA 1DHMA 5ETNA 1ZXOA 4J9NA 1UCNA 4IOCL 1QHTA 4DXLA 4OYZA 4JV0A 3BGUA 2W7AA 4YB7A 2AJQA 3PR5B 1T03A 2AMCB 3SSQA 1Z25A 1VSFA 1X1PA 2MKHA 1JLCB 5HL7L 3DC2A 1YRUA 5I4MA 5J2NB 4CJRA 4NEYA 3IS9B 4CGIA 1JLCA 3OV7A 4YDUC 3TNVA 1NO8A 2IJFA 1IR0A 2POKA 3CDAA 3SQ0A 3AVFA 1C4AA 4OJHA 2JC0A 3MFHA 3DHXA 3KJNB 3M9MB 4S0MA 4QS8A 2GIQA 2GX9A 4DL4A 3H98A 4DQPA 1Z05A 3QGHA 2AX1A 4OX6A 4BE0A 3IDHA 1QVGM 5EDWA 4EFAC 4HCCA 3DLRA 2O4IA 2C1EB 5CZ1A 3VAGA 1BG3A 4E1MA 1MWKA 2X1GA 2HB5A 1CC7A 1SC3B 1RTJB 4O4RA 4B3TK 3IAS9 2BANB 1X9JA 1RTJA 3UKRB 2BANA 4K4ZA 3O3HA 3UKRA 4DN0A 3ZT1A 5F0WA 1JCGA 4NCBA 3MXJA 5CQGA 2CA9A 3QRPA 3TSQA 4LF9F 4RKUC 5KG4A 2R8KA 5AXLA 3J7ZO 1YDLA 3PJ9A 1DARA 1OMSA 2FLPA 3S41A 3Q2TC 3JYTB 3L3CA 4KC5A 3A1YG 3VGUA 3KNGA 4GRSA 1HI0P 3K57A 4J9QA 4P9SA 2ZBQA 3OYBA 1RHQB 1QSYA 3BZCA 1PYTA 2XY7A 2VONA 1VSDA 2ZBIA 3C0BA 3S3NA 1U02A 1V3SA 3I96A 2W25A 2MZJA 4B1XB 4CJFA 4KHWA 1U26A 4CD3A 3D54A 4I7FA 3Q8UA 4X66F 1B0TA 4RUHA 4CM2A 3R3LA 4ZVGA 5BREA 4HT7A 1B7FA 3LQVA 2MJNA 4ZPTR 3ITHB 3ZXWA 2HBLA 3WT0A 2YKOA 3M30B 3VERA 4IUFA 3ITHA 4I9QA 3QWPA 3R9LA 1HQUA 2UXDF 3GIMA 5AR0A 2DR7A 4Y6IA 1BI4A 3ALYA 9RUBA 5HRRA 2HBYB 4CF0A 5E33A 4FLTA 2LXFA 1ZH5A 2DIVA 3ZSYA 4I1TA 2YKMB 1UVLA 2GJIA 3HT3A 3PUFA 2YKMA 2FLOA 4IG0B 1YAGA 3NHGA 1CJUB 2MJUA 1V3RA 4BQLA 4IG0A 4OZ2A 2JLGA 1CJUA 1PBUA 1TK0A 4HHTA 2WTUA 2FZCB 4W5NA 3T1YJ 3OR1B 4DR5J 2GMLA 2M4MA 3FNNA 4ZLPA 1K47A 4LRBA 1CJTB 4DR6K 3HFVA 4O0NA 2FF3B 2OGUA 1N32J 1CJTA 4K43A 4UY8O 3MTKA 2E9TA 5EUHA 4DI6A 5IWAK 1FVQA 4IO1A 4P2MA 1RHUB 3OUYA 3LGHA 2RN2A 2VKZG 3HSZA 3TAMB 2C22A 3SCJE 3R5AA 1GEHA 3FBCA 3TAMA 1NAQA 2P51A 3IG1A 1I1GA 3CUNA 4IOBA 4YQWA 2JWNA 2NRRA 1S6PB 1WKJA 4C7QA 4B02A 4HCBA 4JI1J 1T6CA 3K17A 3H5XA 1TMJA 2CRLA 1JXVA 5ADZA 1TKZB 5AXKA 4W98A 1JLQA 1D3WA 5HAOA 1HJRA 3ZZTA 1Q81O 1OVQA 3OW2R 1NZ8A 3IFEA 3CJRA 4RLEA 1X5SA 5HRPA 1MG7A 1IKXB 2ZE2A 2J0QD 1IKXA 4Q8FA 4CEQA 4PWUA 2P8IA 3HK2A 2RDJA 3O2IA 1KXPA 3SK3A 3W3DA 1WHYA 3AB2B 4WFAQ 4FBTA 1NKBA 4ECVA 4DR3K 3ZTRA 5KPRA 4RW4B 3UR0A 2O8CA 4CLFA 2H3GX 4ILJA 4RW4A 4UQGA 2ZM6J 2Z8QA 4QWDA 5E5NA 3L0QA 4IQXA 5KFJA 1UA0A 3SQGB 3JAMU 1R43A 3SQGA 3VR1A 1NHKL 3LPUA 1R8CA 3PYDA 1WEZA 4J9OA 3DRPB 1TMMA 2CQ0A 5LY3A 3P96A 3DRPA 2IM2A 4JI7F 3ZNUA 4BC3A 3FR0A 4EI2A 4RW9B 3V6DB 1MROA 4K41A 2AYGA 4Z4FA 4RW9A 4N76A 2E5JA 2ACYA 2FJAB 1TKTA 3QIDA 2VWJA 4DV0J 4OYAA 2FD2A 1R0AB 4X84A 5F41A 4YOUA 4GC6A 4WXOA 1FKPB 3CT9A 2XY5A 1VHIA 1FKPA 3VA3A 3PYFA 3BYPA 2IVFB 1OQ6A 3PEJA 3J7ZT 5EWEA 1Q95G 4GVEA 1S22A 1JWWA 4WIIA 2MSTA 4CBWA 4QR1A 1W26A 4BC5A 2F5GA 1SKRA 3DU5A 1SH3A 4HLBA 2IDLA 2F63A 2H48B 3A5LC 4ID5B 4ZJLA 1FKOB 2LU1A 4IO9Q 4CFDA 3ILJA 5AQOA 4ID5A 4LREA 1FKOA 5B0BA 2YWWA 4LJMA 4TU9A 1EO1A 2K7JA 1FNOA 2HWTA 2P9PB 3VGVA 3ZO7A 2R4FA 4CGDA 4I0WA 3MXHP 2DITA 2WBMA 3IC1A 2P9PA 3K5NA 3G4SS 1M5HA 4CNYA 2E1ZA 5J1EB 3SUNA 4X4SA 5A8KB 2BH1A 4M45A 1RCHA 2YWHA 5J1EA 3F9MA 4OJ1A 4CVNE 3PEHA 1WSEA 4JI5J 4IRDA 3JTNA 1FI4A 4JKCA 2KXFA 4NXNJ 4P73A 4UF4A 4KTZA 2O67A 1QVFM 3CSKA 3CQXA 2UUBF 1S9GB 1HA1A 2C28A 1SQGA 1X9MA 1RZMA 2XULA 1D8ZA 2VGNA 2FJXA 1WELA 1N36F 4ZPBA 4BR4A 1QSLA 1RADB 2FHKA 2CJBA 3L4BC 1Z1ZA 1GLBG 4I6MB 4E19A 4M63A 2NLXA 4KHYA 1N5VA 4PKHA 4U7BA 2Q0UA 2BXJA 5ITHA 4I6MA 3BF4A 3OTOF 5C15A 4HWIA 2XQCA 4WFZA 3OYKA 3M3ZA 4YHHJ 4C11B 1NNDA 3R7BB 4FS1A 2DGWA 4NLBA 3T6JA 1EWRA 4C11A 3P31A 3AVHA 3GJSB 1FDBA 1UZHA 4X65J 4LFBJ 4EHUA 3NBPB 3J7AN 5AXNA 2J4RA 3CIPA 3A3OB 1WG1A 3NBPA 4Y2CA 2IFXA 3D6MB 3EWGA 2HLUA 2FZKB 3TUJC 3U1MA 3HSGA 2QO3A 1KONA 2QA1A 1ICEB 1K9MO 1SQEA 1E4FT 4ZVRB 3MAAA 3QBXA 4L76A 4JI4J 2EVZA 1SL1A 3PW4A 2I9SA 3BBCA 2L9DA 2M70A 3KHYA 2O1PA 3ZETB 1ASUA 3CIMA 3LP3A 3T1YK 2WC9A 3I87A 1HKBA 2C42A 3C16B 4DR5K 3ENAA 1MU2B 1X5OA 2IHR1 1CXUA 4FF4A 1IBLF 3C94A 5DLFA 4CIGA 2P1JA 2PEHA 1YF5L 5D0GA 5GAHU 4I67A 1U04A 1RAAB 3VQ5A 4BY9C 4A2BA 2O3DA 1N88A 2FJEB 3ILIA 2KYZA 2VWBA 5BPLA 2DR5A 3QNWB 2VDHA 2WSCC 2BDPA 1L5UA 1AZSA 5IT9Y 1C0MA 4O3SA 2FVCA 1A5WA 4JI1K 4ZJQA 5L46A 4JV5J 3UN2A 3ZTQA 4CI0B 2Y8WA 2MSSA 1JXLA 3OVBA 4LF2A 2ALZA 2LMIA 1EKSA 3W0LA 4BR7A 3HHDA 1M1KO 1WUAA 2E2OA 2YPYA 3PJXA 3NWGA 4DSLA 5HK4A 3UPFA 4C97A 5KFRA 3POTB 3HJVA 5DQHA 1D0EA 3POTA 5E41A 2OANA 4TSXA 3OL6A 2BKPA 2VFVA 3QJPA 2V8HA 3A5NC 3TAFA 3FVYA 4U95A 2VZ9A 3O4WA 3VENA 2DY1A 1IQTA 3WXJA 3BJYA 3N01A 1PIEA 2EC0A 4BACA 2RIJA 1BLUA 2ZM6K 3U7JA 1RCOB 1N5YB 4PAAA 4PA1A 4C1NK 2GMHA 2W9BB 4B9NA 3LDQA 3EYZA 5HN0A 3TQEA 4RNHA 1QSSA 2W9BA 3CG7A 3AO1A 4OKJA 1ZBLA 3G4SN 4FS2A 3M8QA 2W4CA 2QLFB 3TEGA 2HVIA 2R7QA 4DZ6A 1GOCA 3AB4B 3PLAA 5HANA 1TUVA 4AE5A 2N4CA 3DMJB 1HKGA 3EO3A 2D7SA 4Z4CA 3I56S 3IAM9 4CLWA 3WQPA 2DGSA 4ATNA 2B4JA 5ETKA 4PEOA 1JX4A 3MCPA 3MFIA 4E7KA 4AL6A 2A42A 4CIEA 4KAIA 3NNCA 2J8AA 2BYCA 4DJBA 1BO5O 2Z0GA 4DV0K 1W25A 1VLOA 4DV6J 2HMIA 2J6SA 4IFEA 4FPBA 5HRNA 2DXFA 1AUDA 2IBKA 1S57A 3KUEA 5GMEA 4KGVB 3MXMA 5ETMA 3SUOA 5AQQA 5KFLA 4LR7A 1ZC6A 4E1NA 4AHTA 3RRHA 1WORA 4CHNA 3DLHA 4DFPA 2JOQA 5GMDA 2XMAA 3OBWA 3VVUA 3PYEA 3PX0A 1WWHA 4H0PA 3RMAA 2ZH6A 4HVJA 3FBEA 3GDQA 4U67L 4B9LA 4DUZJ 3OXLA 3UD3P 3F9KA 1RT7B 4B9MA 5AQJA 2RNEA 2MQNA 3SSSA 1S76D 1RT7A 3D6FB 3TSPA 2AD9A 4NPOA 2W8KA 3VCDA 1VC5A 4YUDA 2ADCA 1ZZNA 1JIHA 3ENVA 4K5SA 4RWWA 5HMXA 5D3GB 3EE8A 1U1OA 2M52A 1ZA1B 4L3KA 2R3VA 3M9OB 3NF7A 1WKKA 4JI5K 3L2WA 4NXNK 5KFIA 2ASJA 2A2CA 1V5VA 1NB7A 2VPZB 4F67A 3RMBA 3TPQA 1VQMS 2CPHA 3QPIA 2GVDB 4O3PA 3BR9A 2XNRA 4CJPA 1IR2A 2MPUA 2PT0A 1K9MT 1HQ2A 5HP1A 4BCAA 2GHPA 5E3QA 4K2JA 2WW8A 2D41A 2Z56B 3HSCA 4FPIA 2ZNZA 5SUHA 4EO8A 3NY0A 2OMLA 2VG7B 2VV5A 5M2RA 3ENHA 4ZPWR 3AA3A 2VG7A 2LDIA 3DXKB 4C1NI 5JVGL 3SPYA 1LV5A 5KG7A 3DXKA 2YXLA 3MR7A 1RGIA 2YX7A 4YHHK 1T05B 5B0EA 3U1LA 3BEXA 3VAJA 1KHWA 5F8NA 2CJAA 4LFBK 4YR3A 3HJFA 2CVEA 1YBTA 2PMZD 3R8YA 2MKIA 3W9HA 3D6TB 3CFOA 3P5BP 2QA4S 3LO3A 4FVUA 1NWKA 3MCNA 4B3MF 1B70B 3Q7BA 2K3IA 2ZWOA 4JI4K 4JKHA 3L3UA 3W5YA 2CG8A 2BOAA 1NGBA 1F5BA 1I3AA 3CD6S 2G0CA 4GVLA 2LA4A 2D0PA 1XMQJ 1LW2A 1UWAA 4MK9A 2CQBA 2JJ4D 2BE2A 2J76E 1DQ9A 4M5IA 4OJRA 1YKWA 2LP4A 1YJ7A 4N7TA 4ZCKA 4O23A 3ENWA 3HZEA 1CJKB 4KI4A 3BO3A 4J2EA 3SQ1A 1CJKA 4QZVB 5FDLA 3CJ3A 3I56N 3EGNA 4B8AB 5KFAA 1KBRA 2F8SA 4I2PB 5DGBA 3WNFA 2CQ4A 2Q66A 4I2PA 1CZ9A 4JV5K 1FKAF 1CS4B 1QQNA 3T5HA 4BGBA 5HJXA 1RXOB 1SIWB 1B4SA 4FM0A 4JK8A 3R1LA 3EJMA 3C6AA 2YWEA 1KNZA 2QC3A 1RKIA 3OD2A 4FW1A 4OMFG 2CQIA 1RDWX 2QLWA 1DZ5A 2B9WA 3CETA 2DEIA 3K59A 2D1KA 1XEZA 4ILRA 2ZC3A 3FEXB 4J9UE 3HOSA 3B4DA 5IOLA 3CFPA 1KHVA 3H4DA 3J8AA 3K2YA 4CD1A 3QFHA 1ZPVA 4JKEA 4NCAA 4Z7YA 1LEOA 4OX8A 7FD1A 1FRXA 4EAHD 1PKUA 4P74A 4RNFA 2CQ1A 4KAZA 2ZDPA 1F9EB 2E8AA 4ANCA 4GMKA 2CAJA 4H5WA 3J7YU 4CT8A 3C19A 1TR0A 1X8DA 4KV8B 2QX0A 3MN9A 4NCGB 3VZHA 3KDNA 1VIXA 4GC7A 1AT1B 4KV8A 3NP5A 1ATSA 2VG6A 1S79A 1DGKN 4K4SA 2KDOA 4MO4A 2Q43A 1RWVB 4H8KA 1VQMN 5KFCA 3R6LB 2IVMA 2Y0BB 4DV6K 3KNAA 2PFDA 2FC9A 4OPJA 2HHQA 3BGFA 4EHTA 2LU2A 1FF2A 1Q5YA 1W2BM 5KOWA 2J0SD 1J5EF 4DSKA 4FKYA 3T19A 2B6AB 1VSKA 4AILC 2EBGA 2C3YA 3HM9A 3BQ1A 3QETA 2B6AA 1CBKA 2VDIA 1NMNA 4K4YA 1R8PA 1LCUA 2D9PA 2RDDA 3CMES 3NGZA 1PJ6A 3M05A 3DOLB 3T69A 2AP6A 4EYHB 1U0SA 5KFWA 2A10A 4OYXA 1IM6A 2V52B 2M88A 2VOPA 4TU8A 2Z2YB 2LQJA 3O8WA 2WSEC 1QE1B 2E5IA 2VWKA 3K89A 4M3TA 3SZ2A 4YB6A 1QE1A 1RTHB 1E6YB 5MLCQ 5M1KA 1TV6A 3DM2B 2QA4N 1I3OB 5IS2A 3O3LA 5KG5A 4DR4J 1RTHA 4H5TA 5L1IA 3DM2A 3KDOA 1D9FA 3S3OA 3GYNA 3H25A 3L7UA 3VAIA 2CQ3A 2LQ9A 3MX2A 2RILA 3CD6N 4USVA 1C6VA 1P1LA 3MEGB 1KDNA 1GTHA 3UIQA 3SCXA 2U1AA 4QWAA 2FJWA 4GVMA 2YQ1A 3Q8SB 3GFZA 4B9VA 4H0VB 3G25A 4JI3K 3A5MC 5KFSA 1YJNS 2O8BB 2YKAA 3BF1A 2COLA 4LRDA 4DPXA 4QS9A 1UW9A 4LRCA 3QMLA 4AHRA 4ECWA 3GU0A 4QIFA 2L3MA 1S1VB 1S9FA 3J80O 3C6TB 3OYGA 2UUCF 2DR8A 1F0XA 3Q22A 4O0JA 5CR4A 4ZA1A 4BDZA 3AV9A 2Q0RA 1VYAA 2G0IA 4EK2A 3HI0A 1HWUA 4JYAF 3T1YF 3CC4S 3Q86A 3B8HA 4CJ4A 1DRZA 3QINA 2AA4A 4BREA 3E01A 1V5IB 4EFHA 3OYDA 3OT9A 1Z6RA 4KO0A 8AT1B 4DPOA 1JJ4A 2B56A 4F3OA 3E2EA 4CW7B 2FBYA 3O44A 2UVUA 4G1QA 1IVZA 4GVBB 4OL8A 4OYBA 4DV4J 2VFTA 4E7IA 1F2GA 2VOOA 2F4VF 1VK0A 2QT7A 3QQCD 2B51A 2DPJA 3ULDA 8RUCA 1IUJA 5L1LA 2P9GA 4DX8H 2FHJA 1PGZA 5C25B 3G8QA 4LF8J 5AQFA 2X78A 1Y3KA 3UCGA 1XMQK 1VMBA 1QAYA 4A62A 5GIOA 4HHHA 3BO4A 1PJ7A 1RP5A 4N41A 1JXEA 3QO9B 5SWMA 3T1HJ 2EKNA 4H0YB 4XH5A 3L9ZA 5HQLA 1VK8A 1X4CA 3G6VA 2ZJQL 3LWLA 1SL2A 4FYXB 1WTBA 4ZLLA 3HKZD 4ED4A 3WX4A 1NDLA 4RJVA 1IWGA 2V7ZA 3O9RA 3H8YA 2ZM6F 2V69A 2E20A 5LMUF 2R7VA 1NBEB 3N6MA 2PI5A 2A3JA 1XK8A 1JMTA 5F3ZA 1BWVA 2A3ZA 2ZC4A 2EFQA 1XUPO 5JVHL 1GT8A 4KRFA 1H2VZ 1BQNB 3UNGC 3OYIA 3UVJB 3VQPA 3TWHA 3AGKA 3MR2A 4DF4A 1BQNA 4ZTJA 3AQOA 3ZSVA 3N6LA 2Q6BA 3UDLA 2LDYA 1HARA 3NGSA 2WTFA 2BJ1A 3GTYX 3EVOA 3PYGA 4M3XA 3CMEN 2D0CA 3KLFB 4TY9A 4ED0A 4PUOA 4NLPA 4ZKAA 3KLFA 2R2RA 4WU2A 4NRUA 3GYXB 5CAAA 5KFPA 2W2OP 3OXGA 2EEYA 3F0NA 3MCOA 3P45B 3AO2A 1U1PA 3J7A1 4PCQA 3ZZZA 4AF1A 4CK2A 3KD1E 1KD1O 2OH2A 1Z2LA 3D28A 4KKOB 2HRUA 1H3DA 3TAQA 4CEOA 1P1TA 2E1YA 1HI1A 1MMNA 4CJVA 4AM6A 3DOKA 3HCXA 3CCES 4OLAA 1M0SA 1MWZA 2AW0A 2A18A 1UL3A 3MR6A 3O1BA 4CHYA 3CC2S 3TAEA 3JSBA 3THXB 1JCFA 1YJNN 4DUTA 1DLOA 4F9OA 1JL2A 1QS4A 4U67Q 3KYLA 2DPIA 3C3LA 1BXNA 3AXKA 2G4BA 2AJ4A 2E6LA 1GK8A 4CJLA 3LP0B 2WB4A 1VRUB 1HBNA 1PC4A 4FWLA 1Y4ZB 4LSZB 2H5JB 4A47A 3SQ4A 3CTRA 4PQAA 1VRUA 5A2QU 1EAYC 4E7JA 3GL1A 4XTTA 4MMOA 4NXNF 2FSKA 1C2PA 1YBUA 1ZAXA 3AA4A 3SCIE 4F0MA 4DV3J 2GUPA 3CC4N 5KAKA 1WDDA 1Y3JA 3CNQP 1WAFA 5FRNA 5H9FJ 2FYXA 2C2OB 2Q31A 2KKZA 5CABA 3D2FB 3NGTA 3H46O 5A76A 3QEPA 4TLRA 1HLUA 3D2FA 2X1AA 3NCQA 3LTOA 1NHVA 2G8KA 2EK6A 3OYEA 2ZUGA 3F73A 3LM2A 4DR4K 1B64A 1IG8A 4WTYA 4CO3A 1Q8BA 3UDCA 4BRKA 1VQLN 4X64J 1B7YB 1VCTA 2X7IA 1RA7A 1FRKA 2VGMA 3F44A 4Q45A 2XI3A 2OHDA 1KSPA 2DXEA 2ZKTA 4WZQA 5JVGQ 3MEEB 4QYRA 1WHWA 4QWCA 5DDOC 2OD6A 3NVKA 2ZJPQ 2Y1RI 2N7YA 2E1RA 2H9ZA 4WCEL 2B4OA 4YOWA 2D3UA 4D3HA 4WFYA 2WOMB 4J2AA 3J81U 1ZTTA 2WOMA 4XK8C 4L75A 3JSMB 1KTVA 3H3OB 5LJVA 1PAUB 1NRKA 3IXQA 1HNVB 3UKUB 3JSMA 1H6KX 3TP2A 4OZ1A 4WQ4A 2H65B 5BRHA 1S12A 1DEJA 1SJ4P 3UKUA 3DLLL 4CZEA 4HTJA 1ZM9A 3ZC4A 3TQ1A 2F96A 1LFPA 1LOTB 2LLZA 4PHTX 1U48A 2HHVA 4NYZA 3OW2M 1WB9A 6AT1B 4LT6A 3MAHA 4XIUA 2ZBPA 2KVIA 3PSIA 1WC4A 3MM7B 1WC3A 1RQ0A 1H7WA 3T5LA 1E3MA 5LSRA 4DV4K 1Q1KA 3SPZA 3OTCA 1KAZA 1YK9A 4LF7F 3ID8A 4HH0A 3X1LB 2KRRA 4P7TA 1HLWA 2EWSA 3NMRA 2NXUA 4LF8K 4NB4A 4H5NA 1MWYA 3HSTB 4BGAA 1U1QA 5KG3A 3MM6B 1TKDA 3FZFA 3PM9A 5A0YA 4Q5VA 4BC7A 1RAEB 4Q43A 3T1HK 4M42A 2Z1GA 3TANA 4RR5A 4JAXA 5KT6A 2BE7D 2Y3YA 3RG6A 4NZ0A 4TU7A 2LKZA 2XSFA 2EG1A 2CJYB 1G3OA 2CQPA 1RDAA 4NXMF 1RYSA 4DOZA 1Y5NB 1QTMA 2JEFA 2ZDOA 1ZZFA 4HVZA 3TWZA 3GILA 3TZWA 1XWLA 1HNXJ 2DCLA 5LXRA 4A8SA 4K0KF 4DV7F 3VGMA 2E88A 5HLFB 3CCEN 4B1YB 5KPZA 2IA0A 4JKGB 5HLFA 5JXSA 1WC6A 4DZDA 2X6SA 4JKGA 2AP1A 4C2MA 5DM7L 1WSVA 3BM7A 3CC2N 4CTAB 4YOYA 2LYVA 2WVBA 4OPAA 4CTAA 2M8DB 4DSIA 1NH8A 2K8GA 4NLXA 4IH5A 2GC8A 3RAQA 4G65A 4FYYB 4PR6A 5BPMA 1Q53A 1EHWA 1OWXA 1EP4B 2AEFA 4IFVB 4I2QB 1PAEX 2HZAA 1YVUA 1R0BG 2QKBA 1R8HA 4I2QA 3W2WB 1NGDA 1P9YA 3BP8A 2ZVIA 3ZT0A 3DRSA 1SC4B 3H20A 3EN9A 1YVFA 1YITS 5HMZA 2BJ7A 3QIOA 1BWFO 1ZA2B 1YXQA 3OHAA 1BIUA 3PCOB 1S49A 1HJOA 5JS1A 1ASWA 3V2UC 2WFBA 1VJWA 1NDCA 1U47A 4KHNA 4J5OA 2YX1A 4FJLA 3A13A 3FMBA 5K9FA 1RAOA 1AXQA 4JI0F 2BUPA 1KTQA 4JRPA 3FK4A 1WAJA 4DQQA 4ECZA 2DO4A 3ZCMA 5KGWA 4PXBA 1U4BA 3I0RB 4FF1A 4R8UB 5IQ6A 3N4WA 3BDPA 2VPYB 2E1PA 1NK5A 1EARA 4R8UA 3W8PA 3DN9A 4CK3A 2KFNA 4IOAQ 1N8RO 1LW0B 2ZEJA 2P9LB 3TJ8A 3CJ1A 2E1MC 3M6GA 2X3GA 1LW0A 3GIIA 2P9LA 2CZ4A 4GO7X 2JSXA 2DY4A 3KIOA 1KQKA 3P6YC 3NH2A 2NRHA 3NG8A 4C0BA 5HATA 3CERA 5ADXH 5BYQA 1UEVA 1NJZA 3GONA 3BQ2A 3RMDA 1YVNA 3IP0A 4DEZA 3NAHA 4ILHA 4DV3K 1F1BB 4WFNL 5KGXA 1CLFA 4DR2F 2RHSB 2W2PP 4KGMA 4NLVA 4LF9J 5H9FK 4C48A 4R79A 1TYQA 1CPZA 4JI3F 2DT9A 5LSOA 2XZTB 2W01A 2ZH3A 2R2SA 4P2FA 1Y64A 3VQDA 4MKYA 3Q8RB 4WZMA 1YJVA 2IRUA 4B9TA 3NF8A 2J7WA 5AQYA 4MKVA 4CFAA 4KREA 4X64K 5L8RC 4JB8B 3TYTA 4C8KA 2VC1A 2HQIA 1EX8A 5CYJA 2D74B 3QT8A 1TTHB 2L08A 1A5VA 2NRWA 1RTZA 3TO8A 2HVDA 3IA0A 3DXBA 2OZSA 1RNHA 1TL4A 5LT5A 4EBDA 4EIAA 1RT6B 2OI2A 1RAFB 2YWKA 5DK5A 5B7WA 4L74A 3OYLA 1GLDG 4ED2A 1RT6A 3V81B 1UWBA 4DR1F 3IKMA 1C0GA 2UXDJ 2B4UA 2EFNA 2EKYA 3CJ8A 2BRKA 2VG5B 5D4LA 3V6KA 1RWMB 4CQ1A 3C15B 2VG5A 4URSA 3M2VB 3PO5A 3C15A 5DDPC 1K44A 4FJKA 2JWLA 3CF5Q 5KFYA 1Z26A 1YJUA 4B3OB 3NOGA 1RT1B 2W2NP 1RI7A 4B3OA 1V3ZA 4PL8A 1TAQA 1B99A 2G1DA 3EZUA 3BN4A 1FESA 3UO0A 2HF3A 3OSNA 2AWZA 3HHLB 4AT1B 4OLPA 2KLAA 4CGGA 5LOQA 3NAIA 2NXJA 1EQ0A 1XR5A 1FX4A 1S1TB 1HW8A 2ASOA 5KFEA 1S1TA 1D9AA 1UFLA 2JNJA 1VQ6S 2HWHA 4Q7AA 1IKWB 2MKYA 1UJ6A 2E2QA 3U9DA 3NCRA 2OAUA 1M5SA 1RDCA 5J2MB 4R0EA 3FKBA 2XS2A 2HNDA 3FZMA 2ZJQQ 4PY5A 2ATCB 3TTCA 2CPYA 1SKWA 4NI2B 5J2MA 2KFYA 1SJRA 3IR7B 3HVTB 1YITN 2DNHA 4NI2A 5DM6Q 2HZVA 4PXCA 3HVTA 5EN1A 2P9IB 4Z0UA 4URGA 3K0SA 4CJ5A 2P9IA 2D9OA 1GLAG 4OZJA 5GAEI 3Q7CA 1KKHA 3W5ZA 4DTJA 5C42A 3THVA 4C9DA 4H0TB 4I6YA 3LOUA 3NMAA 3SDEA 1HNXK 4ISFA 4BRHA 3AVBA 1C1BA 3HPOA 1Q8IA 1IJEB 1U7LA 3AVGA 3TAGA 3MN7A 1NSAA 4OKEA 4U7UD 4PG7A 5IV4A 1EQMA 4FVCA 1X60A 5ETPA 2DNKA 3LL3A 2Q3PA 3GBTA 5H1SQ 1PC5A 1I5OB 2M9KA 3ZZ0A 1QHAA 1HHQA 1MN9A 4OFZA 5B0DA 3H7HB 5FPEA 5IT9O 2AGQA 1N8RT 3BZQA 4OZ3A 2W9CB 3AO5A 4JI7J 2UXBK 2D3O1 3UB5A 4OHWA 2W9CA 1UJ4A 4OVLA 1RDRA 2OO4A 3OFGA 4OHVA 1PYOB 5T7LB 3GV7B 1LWCB 5C2CA 3T3FA 3HSDA 2W7PA 4OI0A 3TEHB 5T7LA 3GP9A 1C1AA 3C6HA 1X0FA 1V6HA 2W1BA 5ETOA 3CJ0A 3OYJA 5BN8A 1AFIA 5CZ2A 3BH7B 4H0XB 3DRRA 1ZS6A 4M63C 1C0UB 1T9TA 3DI6B 1X5PA 1VBXA 4CZMA 2DHHA 1SV5B 1C0UA 3DI6A 4X4VA 3Q8VA 1SV5A 4C8LA 1VQ7S 1WNEA 2CPEA 4P2XA 4Y2MA 2B5JB 3U27A 2JLFA 1X4AA 3P1GA 2B5JA 5IT9U 4DQ8A 4WIQA 3PRDA 1U1MA 3I5BA 5AQMA 4FF2A 4ED3A 4DL6A 5JS2A 2DR6A 3WIVA 2MLZA 2HG4A 1GAOA 4OV1A 3HVWA 5D15A 2Z1HA 1U1KA 1I94F 4DLGA 2IMWP 2Z30B 2PA3A 1QUVA 2K3KA 2CDQA 1FXRA 3SAGA 3BO2A 2XYGB 5M2UA 2YVSA 1TKXB 2KHCA 3KJFB 4CEBA 2IAJB 3GIJA 1TKXA 2MQ8A 4LF9K 3Q89A 3AVMA 1EETB 2E7WA 2XY6A 2UUBJ 5AQTA 1EETA 3RWUA 4GV3A 3VVTA 1W9HA 3HVRA 3FGVA 1N36J 1Y97A 2HKEA 3NXZA 3HHEA 5DRKA 3S01A 1VQ6N 1RBOB 2E66A 1J27A 2QSFA 4FXVA 2QV6A 1WF1A 3MEDB 3KK1B 1HMVA 2KRBA 3O1LA 3OTOJ 4EBCA 3ZEUA 3KK1A 1UVIA 5GAGP 4Z4HA 5L1KA 1XNQF 1QAJA 3M6VA 5JICA 1JNZB 5K14B 4GMJB 5KOXA 2WBRA 1RWNB 5K14A 2P2CB 1VLYA 4H5VA 2V34A 3PFOA 4CLZA 5J2QA 2UXDK 2GTDA 3KK3A 1P9QC 4WFBL 3OR2B 4CLUA 1HBOB 1XHXA 4ZCMA 3OR2A 5KG0A 3NGRA 5KT2A 3HP6A 4OLBA 3ISZA 4ECUA 1HBOA 3KLEB 4OYPA 3ET6B 3PNIA 3RB0A 2R7SA 2PBDA 1OY8A 3HHNB 3KLEA 2V7YA 3ET6A 3WUHA 1B92A 5CHCB 5E3CA 2QYGA 3VQ6A 1KRPA 3PR4A 1NMDA 3CCJN 2IRXA 4ANDA 3KJQB 2GQQA 2MLXA 4B3SF 3CJTA 5DQGA 2LQ8A 1EXQA 2DPNA 4CHOA 4HH1A 2DXDA 4M5LA 3T1HF 2CXEA 3A8KA 2M5YA 2FBTA 4YOTA 2OIHA 1IBLJ 2ATLA 4BE2A 2HBKA 3W60A 3SUPA 4QW9A 1WOQA 3THYB 3IM9A 2F40A 2DR9A 1T9UA 3UI3A 3IWXA 3ELHA 1KLMB 1S0VA 3ILLA 4CJ3A 2IJNA 4F3QA 4QAGA 1NSKL 1KLMA 3OYCA 4ZTFA 3FSXA 2UV8G 2ZITA 2LSNA 3LA0A 3QJLA 4USTA 2XO7A 3PSFA 4K8RA 4RPFA 2BM1A 4USJC 2BW7A 4RBTA 5GINA 2Q97A 4EU0A 1RT4A 4DHVA 1LWFB 1E6VB 2GVZA 5DG9A 4XPEA 3MWTA 3KMQA 3H2LA 5AQPA 3RVCA 4E0DA 1LWFA 3L6QA 5IXUA 3MURP 1UPMB 3VF0B 2A6MA 7AT1B 1VK3A 1TL3B 4JI6K 5I9EB 4QWEA 3LPTA 5AXMA 3AO3A 1JLBB 2W2MP 2P5VA 2VA3A 1SUQB 4XDDA 1JLBA 5AJ3F 5EU7A 1VQ7N 2CVIA 2GBZA 2WUSA 1QZ5A 1L3VA 1P8ZA 1WF0A 3O3GA 5CCMA 1X9SA 5IT0A 2YJEA 4OI2A 1CVJA 4E8UA 1RT5B 3T5JA 3LW5C 2B7CB 1NMEB 4MK7A 1UEKA 3ZSQA 1RT5A 2GNKA 2QLXA 1U1LA 2HS0A 3B6BA 4FPAA 4IRCA 2DNMA 3D9BA 4LD0A 4HUFA 5FPNA 4CO5A 1HW9A 4N8OA 4DQSA 1RWXB 3BGOP 1GFWB 5D0HA 1PCAA 1NJXA 1OQ3A 1FE0A 3O5BA 2DNPA 1RHKB 2ZH1A 2XLKA 1DAXA 2YX4A 4HEA9 5GAEP 1D1UA 4J9VA 3ZT3A 3KK2B 3US5A 4ALZA 5GADI 3FSIA 1RB0A 4WU3A 3VEOA 1LWEA 3LALA 1J5OB 1GXUA 2CJQA 2E4LA 3WXIA 5DDRC 3V6HA 3ULHA 3NLCA 3WXLA 3JTOA 2J7KA 2VFRA 3CJSA 1GLEG 3SIPB 1RBSA 4FO0A 2O66A 3A3NB 5BN9A 2EWHA 3C8YA 2MY8A 2W24A 4WJBA 3LDNA 2P5OA 4HHJA 5F8MA 1KQSR 4IXCA 1UTAA 2W41A 2XY8A 4IO9L 2WW4A 5U47A 1L3TA 2BGGA 1T9XA 4UUWA 5CH7B 1RWPB 1NKCA 4RG8A 2VBWA 4QYZJ 3MM9A 3D7EO 2FPHX 4EUVA 3L4QA 3PX6A 1F5AA 1K1QA 1FXDA 3TUZC 1WBDA 3BV8A 2ZOMA 3IWNC 2PFUA 5D8HB 1WEXA 3KHHA 3KKRA 1XQSC 4M5NA 2YTCA 2XYHB 1NLVA 4YB1P 5AE3A 3Q24A 4C23A 1X0PA 3JS9A 1FRLA 3H1QA 3CXCR 4LVNP 3KHGA 3MMJA 2IJRA 1VHFA 3CJ7A 3ZZUA 2VU5A 2CZ9A 1HI8A 4LF6F 3FQKA 2ALYB 3JQMA 5HJYA 3OVNA 1FK9B 1UPPA 4NASA 1FK9A 2X3DA 3U8XA 1N36K 4BROA 5ETVA 2V50A 4NMLA 4USUA 4LF1A 4GY2B 4FXWA 4LFAJ 3SI8A 3PACA 3QLHB 2JVOA 4BDPA 1QY7A 2PA8D 3QLHA 2D0OA 3EUNA 4RWTA 2XSJB 4DCJB 5EWFA 3KVGA 2EI5A 2QMUB 3GG0A 3CPWR 4BRCA 3ZFVA 4NLDA 3ONQA 1FO1A 3X3UA 1UVJA 4A5BA 3PIPL 4EEYA 1CLQA 2XB2D 4DR7K 2FBXA 3KG1A 2LXUA 4ED1A 4ELVA 3D0IE 2HHSA 4NZ6A 3ZLJA 2AJ0A 2CPZA 2W2QP 3HHLD 3T9ZA 3PX4A 3JAMY 2DIUA 4B3MJ 3QGIA 3C2PA 3ZX3A 2L9NA 4C8MA 4J9PA 1DY3A 4F3TA 3QBWA 1GMVA 2OYQA 1Q4RA 2XS7A 1UETA 3BSCA 4ZP6A 2VF3A 1N0VC 3QESA 2EC2A 1PSDA 4V19X 3RBZA 3W1YC 2DY9A 4EYIB 1FCAA 4ID1A 3TARA 4FL9A 3UN5A 2AJ1A 3BKTA 2NUBA 4CH0S 1T3OA 4BE1A 1IBLK 3AY9A 1ATNA 5EX0A 5AT1B 3CJKA 2V4QA 4DV1F 3EY1A 2VD3A 5SZTA 4CH7A 2ZH5A 3OXFA 4HUGA 1VS3A 2CJXB 1SB6A 3UNYA 4KTWA 2JLEA 3LH2S 3LAKA 3SAHA 2QSWA 1R6YA 1NJYA 2IIHA 1A9NB 5AQIA 4NLSA 2HFOA 2KVQE 2R7WA 2P9UB 2F9WA 1CZBA 1HKAA 2HBMA 1YGYA 3MM8A 4OGCA 1ITGA 1NZAA 2GQ2A 2YPZA 4GKKJ 3B82A 3I0SB 3MN5A 4RW6B 2XS5A 4YOVA 4MYUA 4RW6A 1I6JA 2Q3SA 2AYBA 2JGUA 4KE5A 4PZVA 4A8MP 3A12A 2QRRA 2DNOA 5ADXA 3HM8A 5CXTA 2UXBF 2H5IB 1VI7A 1NLKL 4HYKA 4JI8F 1G7CB 2VA2A 1ILYA 5DMRA 2QN6B 4KTQA 1NGJA 4N56A 2DD8S 1S5ZA 2ZKUA 4F7VA 3ZX2A 4OI4A 2YNIB 1FXXA 1WSFA 1X3MA 3H90A 2DYAA 5FLXO 4JBCA 5D77A 3OYHA 4NZ7A 2O01C 4X4QA 4JK7A 4DB3A 2IA6A 2J9DE 5LMNF 3WQTA 3QEVA 4NLCA 1LKZA 2Z1IA 4NYFA 3DHWC 3FFIB 4CWBA 3ENQA 3J7AP 5J2NA 1FE4A 2GEMA 3FFIA 2HGMA 3IS9A 1S0NA 4W90B 3PW2A 4MT1A 3TZXA 3LDSA 4ZCIA 4G6VB 2ZGZA 2WSFC 5AZJB 4C6AA 4ERDA 2NXCA 2D69A 1LAWA 5D4NA 2W7OA 1O13A 2G8WA 1YZ6A 3M1FA 3DOMB 3E9PA 4R5PB 1X9WA 4J37A 3LP1B 4TNOA 2HNZB 3LP1A 5BR8J 1TUYA 3WBZA 2HNZA 2CIMA 4OO1J 4FPRA 4PKGA 5I3PA 3HBTA 2NSCA 4QR2A 5FLXU 1J5EJ 5KFVA 3R1XA 2WHOA 4G1IA 4RCHA 1MWQA 2ASYA 3QAUA 4MDBA 5JJBA 3OFFA 1S77D 4Z94A 3F5TA 5F0UA 1U2VB 5K8OA 5F8LA 1KS2A 2KN4A 1QJHA 3QT7A 1CQMA 3ZYYX 1FNXH 4QYZK 3K5LA 3IMXA 3C14B 3LM9A 2BA9A 3JYTA 2V9KA 3EMTA 2DFHA 3VEWA 3C14A 4HUEA 4NX9A 2DNZA 3ATVA 1RJJA 2G8HA 1J9AA 1MDUB 5KTQA 2JRSA 1TL7B 3LGMA 1NGAA 1HWJA 1TL7A 4USKA 2H4YB 4ILLA 2C3MA 5KFKA 2QK9A 5DETA 3I9ZA 4I68A 5GADP 3W63A 5DG8A 3VAKA 2YKNB 3NGKA 4HDGA 2QKKA 1T8EA 2MQMA 2YKNA 4A61A 3A8EA 2K2PA 5LL6Z 4UOFA 4ZPDA 3THWB 2N82B 3V9XA 3QGGA 3D67A 3THWA 1NU4A 5E3AA 3M30A 5IT4A 3GJTB 5AQNA 5IFMA 2DH9A 2C2EA 4I6WA 4JKBA 4A8XA 3B78A 2HOEA 4NO7A 5L38A 3G2XA 4BR2A 3AJ2A 1WSRA 4LFAK 4CJEA 1QLNA 4XDCA 1KVAA 5AE1A 4WFBQ 2UUCJ 4HDHA 2R9LA 5AQWA 1UFKA 2OD4A 3AVIA 3GCWP 2MZ1A 1FDDA 3AY0A 4AQYF 5F8GA 1TGOA 2QJ3A 4JYAJ 1OKJA 3FEZA 1ZBTA 3OR1A 1F3VA 2LFVA 3AA8A 5H9EJ 4L3NA 2P9KB 1HWKA 4AM7A 3SBGA 3LPYA 2P9KA 3CCRS 2BQUA 3B54A 3J81j 3G87A 3MXIA 1A0OB 3SSRA 4A8WA 5ELZA 3R2DJ 4B3MK 2O8FB 2EPIA 1VQYA 2N3OA 4CLYA 3PW0A 2F4VJ 3U3GA 1NCLA 4WE1B 1UMJA 2DJWA 1VSMA 4CBUA 1FXLA 2P6TA 1S6PA 1JK9B 1IG9A 3BBBA 2APOA 3O6WA 2ROEA 3B4MA 3EGWB 4WPAA 2KYXA 3MR5A 5F0XA 2DRBA 2ASMA 1S1UB 1HHSA 2ROPA 1S99A 1TKZA 4V19J 1QQCA 2YI1A 1B3TA 4M3ZA 4JI6F 2ZH9A 2HF4A 2VPXB 4P10A 1VC0A 3N4PA 2KG0A 5ETTA 4TLQA 2FY1A 3VQ4A 4F50A 1KVBA 4WP3A 4L3QA 1FFGB 2QWNA 2JFKA 1HR0F 1OY9A 3OSPA 3CGIA 3M8SA 2FC0A 1JKHB 2BMBA 3J7Z5 1KAYA 3VQAA 4GKKK 4DSJA 2QXLA 5LMUJ 4F02A 3H5SA 3R5GA 4CZJA 1M5KC 1Y00A 2HHWA 2V4RA 2IVNA 3ILOA 2ZH8A 2IOCA 1FA0A 3IRXB 3OPKA 2KB2A 1YRTA 2F9JA 3SMZA 2OELA 3P39A 2HEKA 3AODA 2YHXA 4JS5A 1N6QB 4Y1DA 4FJJA 4B9SA 3LDPA 2HHHK 3O6QA 1N6QA 1W97L 2BJ3A 4LIRA 3CHWA 3VEXA 1HWLA 4RUAA 4CEZA 2MMYA 3GZ7A 2DGVA 1SI9A 1LOUA 2ASLA 3M2UB 1VGYA 1R0CB 2C2NA 3VAHA 1OH7A 2J5AA 3CQ8A 3GSDA 3KUHA 3V6DA 2MQLA 2AT1B 2HYIB 4IZ9A 5A6WA 2CPIA 2ZH4A 2L41A 3H59A 1M5PC 4IDKB 1RWOB 3OYFA 4BR5A 3I5AA 5BJRA 4LMZA 1N54B 1KQFB 4DKWA 4IDKA 3FGUA 1IV0A 1R0AA 2F8EX 1TUWA 4O44B 3CC7S 3ULEB 2F1FA 4LSNB 1IQZA 2I5JB 4QIEA 1RLDA 4BRLA 2E5LJ 2W40A 3ULEA 1FRHA 3QEXA 2I5JA 1YBAA 3OQ2A 3CD0A 1WSIA 2MXYA 3T5KA 5ETQA 1JCEA 5B0AA 4LF5F 3H45C 4FJ5A 3H08A 2BUNA 3P5JA 3TA2A 2DHGA 4KPCA 3BEGB 1JJ2R 3NOCA 2R7TA 5JLFA 3HO1A 1KOOA 4P71A 4AXJA 2YNHB 2OFHX 1PBAA 3S1TA 3ZT2A 5C2DA 4IKFA 4UY85 5BR8K 1JLAB 2QLBB 1NM2A 4L6V3 2YNHA 3RW7A 4W5OA 2VQEF 3CCLS 1CZAN 2ITGA 1JLAA 2Z2ZA 3BKFA 1VISA 9ATCB 1J5EK 5ETLA 4DU7A 4B1VA 1GNKA 1FNMA 5I42B 4WQ4C 3FUYA 5A8KA 4FJ7A 3THPA 3L09A 5I42A 2HQFA 4IWVA 3HRGA 1A7GE 4M5KA 5M1QA 4RX6A 3N28A 5EOYA 3Q83A 4O8UA 3L8BA 3EDRB 4ZHRB 2UVVA 2HK3A 3VQ9A 4J9MA 2F8HA 3ID6A 3EPGA 4USIA 2FSJA 2N7CA 3U9ZA 1S9GA 4A46A 2AU0A 2E9ZA 2LEAA 4Z37A 3CCRN 3CD5A 3VGTA 1XMBA 1FJ7A 4AYBD 3MOZA 2OTJS 4RNNA 2NRXA 4Y00A 5FPMA 4FNHA 3V9UA 3FC9A 1GLLO 2ZVSA 1LK5A 3EGZA 5HOOA 3QWUA 4HHUA 1NK8A 1TK5A 2K1RB 4AHCA 4DN9A 5D78A 2NSBA 1IXKA 1S9EB 2K1RA 4LQ3A 1GXTA 4JUZA 3CEDA 1S9EA 4UY8T 1FJEB 3W2VB 1XR7A 4Z4EA 4ZPAA 4CZKA 3W66A 2IIRA 1RISA 2RKIB 4DR7F 2VASA 1YWXA 3AD7C 4GKJK 1ZBHA 3PIPQ 2KZMA 3WNGA 2C3OA 1CULB 3N6NA 2RU9A 3V9ZA 2CZVC 4F36A 4MQ3A 2UUCK 1CULA 4RO0A 3SFUA 3S7RA 1NSPA 4X4NA 2VFSA 2KXHA 5E2QA 1UVKA 3KJVB 1Q81T 3NNAA 4JYAK 2FVQA 3H4BA 3ZETA 3KJVA 3CI5A 2BJEA 1JLGB 4H54A 5H9EK 3C16A 1U6FA 3C6UB 3T41A 1JLGA 1MU2A 4MAKA 2IVOA 1IKYB 1HNWF 2GQCA 3M6WA 2RQ4A 3BR8A 3SJHA 2V5HG 3OS1A 4CEEA 2FTRA 1YQHA 3E1YA 3M5RA 2MHEA 2F4VK 1WC1A 4ICLB 1IBMF 4LF7J 3AVCA 2R8IA 2FJDB 2B7BB 4H4MB 4BRNA 4ICLA 2LQ5A 3PVXA 2F8TA 3RJMB 3GCXP 2C3PA 3F2KA 3CM6A 4H4MA 2AYMA 1B9FA 2FJVA 1R8BA 1MSWD 2BE9B 5HQMA 4C8OA 3AAWB 3P8BB 3KKSA 3V5RA 4CM0A 4QS7A 2GUIA 5FJ4A 3SUQA 4TYBA 4C3KA 3C46A 5EY4A 1FFWB 4ED8A 2MDAA 4GO5X 3NKYA 2VPWB 2BM0A 2J7UA 1YLXA 3CC7N 1XNRJ 2VL1A 5HRSA 4OPHA 4TVAB 2OSQA 2QM1A 3SQOP 4ED7A 4K4UA 4NXMJ 1I51B 5CZVA 3E9LA 3CCSS 3AAPA 3FZKA 2FGOA 2I8EA 4I9LA 2E7XA 2VHGA 3SV4A 3FZHA 3IWLA 2OP5A 4OX9F 3LPEA 4K0KJ 4DV7J 3M8RA 2IY5B 5LMUK 1MNEA 4A8QA 4KYZA 3R27A 3I32A 1ZTWA 2G2YA 4Y0FA 4CGJA 1N5YA 3NMUA 4ZPCA 3NL0A 1VJQA 4PKIA 3O08A 3A5OC 2C3UA 4ZPVR 2PAVA 4H5RA 4IG3B 3KK7A 3BY5A 2MZTA 3HT0A 4C3MA 3CCLN 2OCEA 2WONB 2A1SA 1X4FA 3W65A 4KB0A 2BEFA 4FXDA 2KTQA 5JMNA 5DS7A 1J54A 1J53A 5DO2A 3DMJA 4ZLNA 3M32B 3HL8A 4BDYA 3M32A 4BLGA 2PDAA 2I38A 3KOAA 3AVNA 3MI7X 4DTSA 3RTVA 4BHQA 4DPUA 3U1NA 3G0ZA 4PG5A 4DS4A 2QG9B 4TN2A 3U02A 3MECB 4IRKA 2W6KA 3EX7B 2JH3A 4DQRA 2OTJN 3MECA 2X1FA 4JI0J 2GGPB 2GCFA 4XH1A 1U2RA 5JLHA 1B0PA 2E5LK 1UEUA 4P6QA 2BRLA 2GGPA 1OSCA 3E3XA 5TKWA 4KB1A 2E5HA 3QDKA 4WP8A 1V4TA 4K4VA 2MEWA 2CQDA 3L2QA 1BMQB 4BR9A 2FUG9 2IC3B 1NOZA 2IBOA 3CCQS 2V94A 3KXDA 1CJVB 2IC3A 2J9CA 2W6LA 5F8IA 4B3RF 2N3LA 1NJWA 3GSIA 4IR9A 1NSQA 3KD5E 4DFMA 4QBUA 1WOSA 2QL7B 1FX2A 4DG1B 3FRZA 1RILA 2AQ4A 4CZFA 2YKQA 5LJ5Y 5BYRA 5CA5A 4JV2A 2FZGB 2Z2MA 1NB2A 3NCIA 4QQBA 1SXLA 4FWQA 3MMCB 2WBNA 3I5CA 3Q23A 5D3GA 3MMCA 4UW2A 3LANA 2FC8A 3D0PA 3GV5B 1BA1A 4FZXC 1CSJA 4IH6A 4O3OA 3AQPA 4DTPA 2YCHA 3V1QA 3HHLC 4DR2J 2FHOB 1S48A 2GVDA 4JI3J 2OLWA 4BVOA 4A5AA 1T7PA 3QERA 2QFIA 2RVJA 1TUUA 3W5XA 4M41A 2W8LA 1KFSA 4AD6A 1OH5A 3QIPB 3EZOA 5DZ7A 5D6GA 4LFAF 3SNNA 2BJ8A 1X4EA 3BF3A 2MTLA 3KG4A 4E2FB 5A8RB 1VAZA 1KR4A 1VC6A 2PI4A 5A8RA 3RR8A 2Y1LB 4HTLA 2KM8B 1OY6A 1MA9B 3VESA 1ACMB 1YJ9S 2RPIA 4QR0A 1H38A 1HNIB 1EKRA 2GHWA 2C2DA 1KVJA 2ZJPL 2FLLA 2ZBCA 4LRFA 4O55A 1T05A 3JTPA 3HPGA 1HNIA 4MIWA 4C8YA 1RCXB 1XR6A 4WTOB 3AGRA 3PRBA 3PHEA 2CWXA 1SQFA 4OQJA 1SIZA 4DR1J 1OH6A 1SS6A 1FEHA 1LNQA 3OY9A 3I9V9 2HQCA 1XIQA 1HPZB 1M1HA 1BUPA 3H0PA 4Y1CA 3CCSN 1YG0A 4X4RA 2YNFB 4KGKA 3PXGa 2WVFA 1M1KT 5FRMA 1U6BA 2DHXA 5HQ8A 2YHYA 4BRGA 3MDQA 3BUZB 2B43A 3FZLA 3FCWA 4PG4A 4DX6A 1BCMA 2ZOGA 1URNA 4ZN1A 3SYZA 4A2AA 2RHQB 3LAMA 1OJ4A 3GR0A 2ZWHA 3GFHA 4DSEA 1Z4UA 1RHMB 1VSIA 2RQMA 2ATQA 3MEKA 2B8PA 5CY4A 3KFWX 4LF7K 3FCVA 4EZ9A 4ZVHA 3LF0A 4CHQA 4W92B 3G9CA 4FJIA 1UW4A 2RQKA 4GKKF 4E89A 5RUBA 1MMDA 3L2UA 2ZBRA 1CS4A 3H40A 2R7XA 3IAYA 4PPZA 1HYZA 4IH7A 1YTUA 4FLXA 4LVOP 2WAQD 4YOEA 2GO8A 2Z1JA 1XBWA 2GHVC 2CFXA 4G1PA 3BSNA 2HHHF 1XNRK 4KQZA 4WWSA 3EXYA 3IMQJ 4NXMK 3EEQA 4LFCJ 1WG4A 4K25A 1PG5B 4C0OC 4MLEA 1N5TA 3HSJA 2LCWA 2KJWA 4HT5A 4K0KK 5A2QY 4DV7K 2CQHA 4UOGA 2VIHA 3EKSA 3CCQN 2V63A 3EVWA 3ZTSA 3BSOA 4RBVA 4CH1A 3PV8A 2AHOB 2FSNA 3I6PA 2O8EB 5M1OA 3KLVA 3JQKA 1T11A 4KIAA 1AFJA 2XHCA 2O8EA 4OGEA 4M5HA 5KG2A 2VICA 2GO9A 4Q2LA 3SI6A 3CB4A 3WHIA 1A6LA 3RBEA 2P6SA 3DDKA 2G2OA 2RF2B 2Z4PA 4NE9C 1KQSM 4QOZB 2JVRA 4WQ5A 3MUVP 4QJVA 2HVHA 3BKUA 4Q0BB 4NCGA 3D7SB 4Q0BA 1IJJA 2DH7A 3HFZB 2HGLA 5ETRA 4OYWA 3DKDA 2JWKA 3CJAA 1KAXA 3M2RB 4K8ZA 2ZWPA 1U09A 3M2RA 4YB5A 2DO0A 1ESVA 3CD7A 4IQMA 3AO4A 3C7NB 5BR8F 3C7NA 3PIOL 4CJWA 2YHAA 4JI2F 4EGLA 4X62F 2E29A 4JI0K 2ILZA 1T03B 4WYWA 2R7RA 3W3SA 3CXCM 4OZ0A 5AQVA 1YJWS 4CFBA 4DMNA 3QFWA 4Y3CA 3UN3A 4IOAL 4RL1A 3W64A 2D1CA 2P9EA 3J81Y 4CT9A 3FLCO 1YJ9N 3BN7A 1NBWA 3DOLA 3IGNA 1DFDA 2VB6A 1FJGF 3MWPA 1T9VA 4CHPA 1GTEA 1OPZA 4CCHA 3DDNA 5K8PA 1U1RA 1RSCA 1I94J 3L4IA 4JV1A 1BUXA 3PJWA 1E6YA 2BV3A 1FEEA 2RMLA 2PMHA 3MD1A 3RRKA 4Y28C 2B9XA 4DUYK 2CNLB 2IDOA 1WDTA 5FIIA 2XO6A 1WSGA 2NXEA 1S1XB 4FCYA 4FP9A 4NLOA 4YR0A 1S1XA 1QTNB 2IYIA 2OFGX 3CPWM 4DR2K 4ZIWA 3IBFB 3O3FA 3MEGA 1UOCA 3K5MA 1DJ0A 2J9EA 2W4PA 4Z4IA 3M7VA 2YH0A 2DISA 1VBKA 3EICA 2XHBA 1Q9YA 2MLYA 3DLBA 2O8BA 4GKJF 5DDQC 3VA0A 2VJUA 2RDIA 1MW7A 1Q7YO 1SKSA 5AQLA 2FIUA 2KW4A 3GJRB 3UD5A 1AUSL 4DL3A 1S1VA 3MCSA 5IQQA 1T9YA 1T02A 2IDEA 4DTMA 4WFXA 3C6TA 3L3VA 1D8YA 4PYAA