4IFYA

Hiv-1 reverse transcriptase with bound fragment at the knuckles site
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
total genus 165
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ifyA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ifyA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ifyA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ifyA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ifyA05
1HNVA 2RPIA 1SV5A 2UUTA 2ASDA 4NLWA 3V9UA 4KKOB 1KVCA 4B9TA 3P5JA 4IRKA 4ZVGA 1BI4A 4E7KA 4AILC 4FM0A 3VQ8A 1T3NA 3HPGA 4Y34A 3B6PA 1WSHA 1IG9A 3QZ7A 1LWFB 4O3QA 4CHYA 5F9NA 1RDBA 3MR3A 2IDOA 3SPYA 1GOBA 2RN2A 1K6YA 4DG1B 1U4BA 3T5LA 4OKKA 4NCGA 4FJGA 1U04A 2ILZA 4HTUA 1LWCB 3AVNA 1SUQB 3LAKA 3DLGA 4TXSA 3LALA 3IG1B 5DMRA 4M95A 5DQHA 4QWEA 4DSLA 4Y1DA 4IG0A 5KFSA 4EO6A 4ED7A 4YFUA 1U45A 5E41A 2W9AA 3KMSA 1RTIA 4FYDA 4RW4B 3D45A 4FVMA 4WFYA 5J2QA 2IC3A 4I9QA 4FCYA 3IS9A 4OLBA 3LP2A 2YNGA 4CJ5A 3IRXB 1S9EA 3TI0A 3RR8A 3KLIA 4DLEA 1C1AA 2Z1IA 1S4FA 1UWBB 5D3GB 4DFKA 3AVCA 2B4JA 3V6DA 3MF5A 2B43A 4DTNA 4Q8EA 2RF2A 4IFYB 2AWZA 3M8QB 4DL4A 4R5PA 3C95A 3KTQA 1SH0A 1HQUA 1JL2A 5KT5A 4IDKA 1JLEB 3I0RB 1LWEB 2R8JA 3GILA 4NLXA 4URQU 1KHVA 3L8BA 3LP0B 4RNOA 2R2RA 5C25B 5KRTA 1ZBIA 4FS1A 4ECVA 1QS4A 1QSSA 3LP2B 4TSXA 5KGWA 1S1TA 1TK8A 2UVUA 4EP4A 4NLDA 4ELUA 3HVRA 3H5SA 1IH7A 2B6AA 2HWHA 3VQ6A 4FZYA 2ITGA 4Z4CA 4IG3B 1DLOA 5KFKA 4U6PA 2DPJA 3ZSWA 3ZSRA 3QZ8A 2ATLA 3CJ0A 4BE1A 4JV1A 4IR9A 2OPRB 2YNGB 4J9KA 3FQKA 4CF8A 4CESA 3KLGB 4ZTJA 4NLVA 4DTSA 3HM9A 3V6HA 4DQQA 3OYIA 2JC1A 3CDWA 1JIHA 2XY7A 4C8OA 1HYSB 4KPYA 4TY8B 4PA1A 4J2BA 3QGHA 4IQXA 1NOZA 1I6JA 2E9RX 5FROA 4PQUB 2P51A 4HCCA 1MMLA 1TP7A 4K4VA 1N6QB 4NCGB 5KFNA 1WNSA 4FK4A 2GV9A 3D0PA 3ASMA 5KFHA 3IAYA 3SNNA 3DMJB 5DG9A 1R0AA 4E1MA 3DMJA 1VSKA 3H98A 1A5WA 4CJUA 3AVFA 4CK2A 3RWUA 4DTJA 3KLVA 5JS1A 1NHUA 3QEVA 4NRTA 3RMAA 3L2QA 3G0ZA 3Q8QB 3TAEA 4RU9A 3Q8SB 1S1VB 2IJFA 4M3RA 3AV9A 4ZP6A 4DQRA 1TKTA 3DM2A 3KLFA 3FFIB 1TVRB 4BDYA 3DI6B 1T03B 2XCAA 5HLFB 5CYMA 4RNHA 3SI8A 4NYZA 4F2SA 5KFBA 3NAEA 2JLEA 2UVRA 4ELVA 1SH2A 1QQCA 3BSOA 2AGPA 3QEIA 1IKXB 3QIDA 2V4QA 1WSFA 3KNAA 2VWKA 4FJKA 4PY5A 3FSIA 2BQUA 5HROB 4IKFA 4RW7A 2X78A 4DTRA 1NJXA 2HHTA 4CJTA 1C0UA 1JLEA 1C6VA 3DRRA 4IDKB 3SUPA 1RT5A 1W0HA 4Y2AA 2WRMA 2W9CA 1BHLA 2BR0A 3M9NB 4ZHRB 2BE2A 4DL3A 1C1CA 3TANA 1S6QB 5C25A 4H4MA 1NK6A 1REVB 4KO0B 2XC9A 3KLHB 3N6NA 2KFZA 3HVTA 4WYLA 4MFBA 4FJXA 4WXOA 1WAFA 1RTJA 1RBUA 4ECTA 4HUFA 5DLFA 3GIMA 1T8EA 3KLIB 2C2DA 5KT6A 3MECB 1RTDB 2Z1HA 2XRIA 5F8HA 3IS9B 4ECUA 3ZT4A 1EX4A 4IFYA 4Z4EA 4FBTA 2C22A 4RNNA 3ZT1A 2ZE2B 4DTXA 2A1RA 1RT6B 4QW8A 3VQ5A 4JRPA 4KTWA 1BIUA 3AVGA 3KHRA 3RAXA 1RTJB 4MK9A 4O4RA 1D8YA 4KV8B 3OYJA 4CF0A 1KVAA 4IKAA 4EYIB 1LWCA 1S1WA 4N5SA 4N76A 4OGEA 2HNYA 3RBDA 2QE5A 3KIOA 1KLMB 4KBIA 4B9SA 4RW4A 2IGIA 1N48A 4ZVFA 3KJVA 2I5JA 2ILYA 4DF4A 3P1GA 4LH5A 1F21A 3OY9A 2DFFA 2FVPA 4DL2A 1T94A 3VQSA 4LH4A 2FVRA 1ZBFA 4CIGA 2YNHB 4URSA 4G1QA 3OYBA 4I7FB 4DWIA 2WOMB 5KG4A 1QE1B 4LSNA 4FK0A 4CHPA 1RBRA 2IAJB 2YV0X 3H4BA 3DOLB 3UIQA 4AHUA 2ZQBA 3PW2A 3VQ9A 4M94A 1W25A 1RT1A 3DOKA 2FJVA 1HARA 1RAJA 3VQCA 3NKYA 1IKYA 4CEDA 3EZ5A 1JXEA 2YHBA 3LP1B 1EETA 4HVJA 1YTUA 3AO3A 3QGGA 3V9XA 4EZ9A 3NGDA 2VG6A 2IS3A 1NKCA 3KJVB 3FFIA 3PR4A 3H08A 2JEGA 2FBTA 5KRSA 4CJ3A 1VSLA 3SUNA 4CF9A 2FVSA 4DU4A 2IM1A 3BGRB 3KLEA 3KK3B 2VG6B 1JX4A 1RT4B 1JXLA 4CGDA 4KTQA 4KHQA 4IFVA 1I3AA 3OHAA 4DF8A 3OLAA 4OKEA 3NFAA 2P5OA 1NK5A 4NLUA 4M41A 3IGVA 3WNFA 2IOCA 1BGXT 2FJWA 3AVHA 1IKWB 3HKWA 4CF2A 1FKOA 3M8SA 4HYKA 3PY8A 1S5JA 1S1UA 3PJWA 3FDSA 4EEYA 3SZ2A 3L2RA 3RMCA 3NH2A 1L3UA 4M3ZA 3I8DA 2B5JA 1RBTA 1S1WB 4FLVA 1ZBLA 4CGGA 4KAIA 3O3GA 4O0IA 4TYBA 5L1IA 1NKBA 2PYLA 1XI1A 3HSTB 4J9OA 1RT2B 3E51A 4I9LA 3SV3A 3MECA 1RTDA 4FLYA 5CZ2A 3DLHA 2YNFA 2RDJA 4CEBA 4RNMA 4G3IA 3MR2A 4O3PA 3KLEB 1MU2B 1TVRA 3TAGA 2RKIA 1IO2A 1TKTB 1SKWA 3CDEA 2HHXA 4LY7A 1S1XB 3AVIA 2R2SA 4HKQA 5JS2A 1S48A 4DL5A 3KOAA 3WNHA 3EZUA 1C0TA 4DL6A 4ICLB 3UPFA 4FM1A 1X9WA 5J2MA 4NLOA 4RNFA 2G8WA 5KFWA 3MFIA 4DS4A 2E6MA 4NCBA 4ZMMA 3T5JA 5F8GA 2YHAA 4R8UA 5JXSA 3AO5A 3H5YA 2HHVA 4TYAA 5KFDA 3KHGA 4DEZA 1SL2A 2DTUA 1TKXB 5CYQA 3K5MA 1A5VA 1Q8IA 1ZYQA 5F9LA 5L1JA 3RMDA 3QEXA 2LSNA 3AVJA 3HK2A 4O44A 5F8LA 3UR0A 3AO1A 5I3UA 5K14B 3QIOA 4LQ9A 4AHSA 4CF1A 2BGGA 1KFSA 2IA6A 3DLKB 4Z0UA 2FBXA 1IKVB 4KI6A 2W8LA 3OLBA 4IG3A 3MXIA 3L3UA 3AA2A 2G8UA 1S0OA 5KFVA 2F8TA 2Y1IA 1CLQA 3ZT0A 4AHCA 4XPCA 3NH0A 3KK2A 3H5XA 1L5UA 4KHYA 2HW3A 1WNEA 4ZVEA 1XR5A 4J9LA 1TV6A 4KHUA 4QWAA 3E01B 3V81B 4QWDA 3V9ZA 4Q45A 4F3TA 4WFZA 2OYQA 1EP4B 5EU7A 2ZD1A 3NH1A 3KLHA 3QESA 4GC6A 4Q8FA 4ECXA 2AGQA 1GOAA 4E7IA 2F8EX 1NK8A 4O4GB 4JS4A 1HQUB 5KFCA 2J6TA 3KLGA 2YNFB 2OZSA 5FDLB 3NF6A 2HHQA 2XGQA 4R5PB 1XC9A 4CFBA 2DFEA 4X2BA 1S1XA 5KFEA 5KFPA 2FVQA 1RT2A 4YR2A 1ASVA 4IH5A 4MIAA 3CFRA 5KG6A 3HPHA 4GMJB 4W5TA 3PX6A 1TL3B 1VSMA 1UOCA 1NKEA 1KSPA 3DLBA 3Q8PB 4EP5A 3KHLA 5HLFA 3C6UA 2X6SA 3DI6A 3QO9A 2XCPA 3K5OA 4B8AB 2W42A 3QETA 3SI6A 3LWLA 4CEOA 4E0DA 1TKDA 2J6SA 1QUVA 5C5JA 3CM6A 1L3TA 2X6NA 3V4IB 1KTQA 4FLZA 5I42A 4FZXC 1XR7A 3M8QA 3BQ2A 3DRSA 3ITHB 4O4GA 3MEGA 4ED2A 2V0NA 1BQMA 4KHNA 3WNGA 3H5UA 3ZT3A 4F8RA 4B8CA 4FXDA 2D0BA 1R0AB 3KK1B 1Q9XA 2HMIA 2X74A 3I0SB 3E01A 3V81A 4FLUA 3RB3A 4KFBA 3NE6A 4IOBA 1VSEA 4FJHA 3IRXA 3GIJA 3BGRA 3KK3A 1S49A 4ECZA 3MAQA 3S3NA 5J2PA 4KE5A 3SFUA 3SJJA 4O55A 4IH6A 5J1EB 1Y97A 4EBDA 4MH8A 3CJ2A 2AU0A 3LP1A 3CQ8A 4FJLA 4MKBA 3LDSA 2UVVA 5KFAA 4FJMA 3MR6A 3QIPB 1Z25A 1Z26A 3BR9A 3CFOA 5I3UB 3ZSZA 4CHQA 4M3TA 4LQ3A 2XY8A 1D9DA 4QCLA 2EC0A 4E89A 2JEJA 1QHTA 3C94A 2GUIA 4G1QB 4IRCA 5J2MB 4IR1A 5DG8A 4I2QB 1NK7A 5EUHA 2DFHA 1BCOA 2YKNA 1Z4UA 4AH9A 3NBPB 4KAZA 2KW4A 3AVLA 1NNDA 3OL9A 2RDIA 5FRMA 2I1RA 3VQ7A 1WSJA 2Q3SA 3SQ0A 4KKOA 5HP1A 1XR6A 1JLCA 4CGIA 3QNOA 1S6PA 4F4WA 3I0RA 4I7FA 1HNVB 2HHSA 4E19A 4DTPA 4KV8A 4DFJA 3MFHA 2BANA 3ZSQA 4ED0A 3S9HA 3MXJA 3B6OA 4ID5B 1EKEA 5J2NB 4CGFA 4URGA 2JEIA 1KCFA 4MQ3A 1A5XA 1KLMA 3HT3A 4DS5A 2G8KA 4WE1B 4CK3A 5T7BA 3ZSXA 2G8FA 3AO2A 3OYNA 4NLRA 1S0NA 1WN7A 3AO4A 4H8KA 2CJQA 2YKMA 4M42A 3KD1E 3K58A 4J9RA 4WE1A 4NRUA 5KFGA 2XWYA 5KFJA 1RILA 3A2FA 3ITHA 4CJSA 3S3MA 4Z4IA 1B9FA 2VG5B 4WYWA 1C1BB 1RYRA 4HCBA 4XO0A 3SCXA 3SQ1A 1ITGA 2B5JB 2W9BB 4KO0A 1HJRA 4HUEA 1JLAB 4ZP9A 4H4MB 4Q43A 1C1CB 3PW7A 4J2EA 2YKNB 2BRLA 4Q0BA 1TL3A 2CKWA 1JLBA 2WONA 3EPGA 4O5BA 3OYEA 4MIBA 2OPSB 1QSLA 3HVWA 2QK9A 4Y1CA 3MTKA 3JSMB 4FJIA 4CERA 4CJ4A 2XGPA 5KFFA 3GQCA 3DRPA 3NF8A 4K4TA 4OPJA 1JLFA 1O1WA 1YVFA 3RTVA 4CJLA 1CZ9A 5T14A 2OPPA 4JS5A 5HRNA 4L8RB 3SPZA 3DM2B 1JLCB 3KD5E 4M3WA 3DOLA 3L2WA 1BIZA 3JSMA 1VSHA 1K1SA 2BQ3A 3AA5X 4BE0A 1TK5A 2F96A 2WOMA 2YNHA 3PW5A 2FBVA 1KLNA 1WSGA 1SH3A 4FS2A 3OL8A 1BQMB 1BQNB 1TKZB 4R0EA 3O3HA 2P5GA 3HXMA 3OSNA 5C24B 4CHZA 3G6YA 3L3VA 4KI4A 4E3SA 3AA3A 4OKJA 4JRQA 2EHGA 1ZBUA 2VG5A 4Y3CA 2HVIA 5DLGA 1N4LA 3PR5B 3BREA 4ECQA 3THVA 2HNYB 3DLEB 1DTTB 3EPIA 2ETJA 4FBUA 2KTQA 5FRNA 5KFXA 3CYMA 2HHWA 3NL0A 1HMVB 4CJEA 2HVHA 4F3OA 4PUOA 1TAUA 3BSAA 3U3GA 3PO4A 3RRHA 2IM3A 4MFBB 1B92A 2C28A 1RTHA 4RUAA 2XY6A 5DGBA 2G8HA 4QAGA 3PJXA 5CZ1A 2C2EA 4ID5A 4CJRA 3TAMA 3G86A 1YT3A 4RG8A 4ZHRA 3LP0A 2ZKUA 3VN5A 4IH7A 1CXQA 1T05A 2ZD1B 1C2PA 3NGZA 3F9KA 5HP1B 4EYHB 1LAVA 3OYLA 4FW1A 4MK7A 5KFUA 4PUOB 3KKRA 2R2TA 3O4NA 4NLTA 4O3SA 1W9HA 4O3OA 2HB5A 3Q8RB 4DSEA 4RW6B 1S0MA 4CJPA 3AVAA 5KI6A 4KHMA 3SUQA 1SKRA 4QW9A 3LPTA 2RF2B 4MKAA 4DTOA 5CYMB 4CEQA 2FC0A 4CEEA 3KLFB 2ASLA 3H4DA 1S1VA 1HMVA 4J9SA 4FW2A 1X1PA 1J54A 2KZMA 2QKBA 1UA1A 4H4OB 1LW0B 1C0MA 1IKVA 3TAFA 1S9EB 4FJ7A 5KFMA 4CJVA 2PYJA 3IGNA 3T3FA 2FVCA 3KKSA 4QWBA 3OJSA 2GC8A 1RTIB 3N6LA 3OYGA 1D9FA 5KFYA 1RBVA 1L3VA 1J5OB 3HJFA 3OYDA 2W8KA 3CWJA 2OH2A 4Z4GA 3DLGB 3EY1A 5J2PB 4CJKA 2KZZA 4C8LA 1WAJA 2YNIA 4FZZA 4TY8A 1S97A 3V9SA 1HYSA 3CVKA 3VQQA 1J5OA 1EXQA 4KREA 3HYFA 3PW4A 3JYTB 4B3OA 2HWIA 2VWJA 3DLRA 3M9MB 4BWMA 5I42B 3U3YA 4PWDA 2FJXA 3MEDB 2WHOA 3CG7A 3RRGA 4DQIA 4H4OA 5DQIA 1HRHA 3OYFA 2P1JA 4YR0A 1RA7A 1XHXA 4F4ZA 3C6UB 3L2UA 2IMWP 4DL7A 4B08A 1RNHA 4QWCA 1NK4A 3S3OA 2WONB 4RW9B 4ELTA 2OA8A 4ZP7A 4CECA 3K59A 4K4SA 2WB4A 2D3UA 2J6UA 4WZMA 2R7YA 3BJYA 3H2LA 1JLAA 1DLOB 4LSNB 2W9BA 4RW8B 1U09A 5KT3A 1HYZA 4F50A 1RDDA 2A1SA 4Q0BB 3ZSYA 1S1TB 2O4IA 4MK8A 5C42B 4KHWA 2HNDB 3PZPA 3PX0A 3CJ4A 4YNQA 3IN5A 4JV2A 4B9UA 1VSDA 1K1QA 1QTMA 1S1UB 1HYVA 3OS2A 4J9NA 4M3XA 3G6VA 4RZRA 2OPQB 4AHTA 2UUWA 1UWBA 2FLPA 4FJNA 1G15A 1FK9B 2FLNA 1LV5A 4DMNA 1NOYA 1S9GA 4DTUA 1NJYA 3LPUA 2ASJA 4NLYA 5L1LA 4EBEA 4E7LA 5D3GA 2EX3A 2QXFA 4DFMA 3HP9A 5KT2A 4DSKA 3FQLA 2V9WA 1TGOA 4F4XA 1DTTA 4CE9A 3DLKA 3HVTB 1JLQB 2IM2A 3QLHA 3WNEA 5J2QB 4F4KA 2PZSA 3CDUA 5DG7A 1NK9A 2BANB 1KHWA 3V6KA 1WSEA 1SL0A 3K2PA 1NJWA 1RT1B 1JLGB 4H54A 3NCIA 4CIEA 3GV8B 1ASWA 3QINA 3NF9A 1JLGA 3H40A 4ZPAA 5SWMA 3TAPA 3CIZA 2OPPB 2AX1A 4KRFA 2R8IA 3K57A 3CJ5A 4ED6A 4E1NA 5JUMA 1FKPB 4YMEA 3OVNA 4KSEB 2D0CA 2R8GA 4FJ5A 3DRPB 4K4WA 2VA2A 4DSFA 1GOCA 4BWJA 3VQPA 3QLHB 5DQGA 1U49A 3SQ4A 3OS1A 4TN2A 2RKIB 2NUBA 4K4XA 1SV5B 3C6TB 4PWDB 3HPOA 4OL8A 1FKPA 4AHVA 4IRDA 3OL6A 4WFXA 5DGAA 2HMIB 2WTFA 1KFDA 3MEEB 4BE2A 3JYTA 3DOKB 1RDAA 1WSIA 3RB6A 4ED3A 4YP3A 4OJRA 4LSLA 3M9OB 1TQLA 1N5YA 4J9MA 3PX4A 1N6QA 4ID1A 1B9DA 2R8HA 2XO7A 1QE1A 4K4YA 1OS5A 2OPSA 3QEPA 4EO8A 4JUZA 1DTQB 2XI2A 3VA0A 3I0SA 3LANA 3KK1A 4GW6A 3DDKA 5HRRA 2I5JB 3QO9B 1VRUA 2VG7A 2W7PA 3NAIA 2GBZA 3ICLA 4DU3A 1QAIA 1VRUB 2VG7B 5C42A 5EWGA 4CGHA 4W5NA 4UQGA 2D0AA 1XHZA 4QPXA 3RMBA 1RT5B 5HBMA 2YKMB 1C1BA 4ZTFA 1JKHA 4W5RA 1YVUA 4DU1A 4CFAA 4YR3A 2XHBA 1ZTTA 3NDKA 4TY9A 2JEFA 1ZBHA 5CY4A 4LSLB 4NCAA 2KQ2A 3ZSVA 1TK0A 1L3SA 5F8IA 5J2NA 4OLAA 1S9GB 3QEWA 3GIKA 1ZETA 2G8VA 4U7CA 4RW9A 3UDLA 5F8JA 1VRTB 3LZIA 3OS0A 3OJUA 3ZT2A 3C6TA 4WXWA 1HNIA 3RAQA 2WCXA 3OL7A 4F2RA 5KFLA 2AQ4A 4ED1A 1S6QA 2D7SA 4O3NA 5KG0A 2BE2B 3SQ2A 3T5KA 3OYAA 4ECSA 5L1KA 5FDLA 3VQEA 4WZQA 4BDZA 4NLGA 3KK2B 2HNZA 3M8PB 4K4ZA 1C0UB 1S6PB 4KHRA 3V6JA 4B9VA 4FJ9A 3GV5B 1EP4A 3SUOA 1QSYA 3BQ1A 4CJWA 4HUGA 3G10A 1J9AA 3QIPA 2YNIB 4N56A 4PQUA 2IJNA 3NGIA 2JGUA 3DLEA 4OVLA 4K50A 2XY5A 3TQ1A 2IC3B 1VSIA 2GIRA 5K14A 1RT3A 4I2PB 2V4RA 1U47A 3LAMA 3ISND 1NK0A 4B9NA 3K5LA 1ASUA 4O0JA 4AHRA 4CHOA 2JC0A 3V1QA 4ZPCA 3SYZA 3I5BA 3I5AA 2ATQA 3AVKA 1ZTWA 4J9QA 4YQWA 2Z1GA 5KG1A 4R8UB 1WLJA 1TL1B 1RT6A 4B3OB 2UVWA 2ZE2A 3TWHA 4Q5VA 1BISA 1VK0A 4CEFA 4Z4HA 3BSCA 2QKKA 5KFRA 4FM2A 1RCHA 3PVXA 2Z1JA 1KVBA 2E9ZA 5CYQB 3DRSB 4CEZA 3HHKA 4ICLA 3EYZA 2BRKA 3TAQA 4DFPA 3V4IA 3CM5A 1BI4B 1CXUA 1RDCA 3I5CA 3T19A 4EBCA 5L9XA 3RB0A 5HRPA 1LWEA 1MU2A 3M8PA 4QOZB 1REVA 4ZPBA 3UQSA 4EZ6A 2HNZB 5KFIA 1D1UA 1JLFB 4DQSA 1LW2B 4ECWA 3RB4A 3DYAA 4DSJA 1J53A 4FLTA 1C0TB 3HP6A 1QAJA 2OPRA 4NLQA 1JL1A 3LWMA 3HO1A 3K5NA 1X9SA 1I39A 4XIUA 2F8SA 4RW8A 1RTHB 5KGXA 3V1RA 2C2RA 4RW7B 3O4QA 1BCMA 5HROA 2O5DA 2B6AB 1CSJA 3P83D 4B9MA 1JKHB 4ZVHA 2FLLA 4NYFA 5HBMB 4ED8A 4LD0A 1N56A 4RW6A 1FXXA 4DSIA 3CJ3A 4FLXA 5F8NA 4GC7A 3BQ0A 3NAHA 4CJFA 1T03A 2VA3A 5KFOA 4M3YA 1XWLA 3QGIA 3CO9A 3MXMA 3QNNA 1DTQA 3TABA 1TV6B 1SUQA 4DLGA 3MEDA 3ZSOA 3TAMB 5KG3A 3OSPA 3DYAB 5C24A 4N41A 5KFZA 4CEAA 1NJZA 1N5YB 2BQRA 4CHNA 3N6MA 4RUCA 2GIQA 4IFVB 4FJ8A 4ECYA 1UAXA 5DK5A 2DY4A 3FRZA 4B9LA 3VQAA 4BACA 1RT7B 3MR5A 4Q44A 3RBEA 4HHTA 1RBSA 4CIFA 1SL1A 2AX0A 2QV6A 3PO5A 4O44B 1U48A 1SKSA 4W5QA 3OYMA 3V1OA 4IG0B 4GVMA 5KTQA 1RT3B 4I2PA 3AA4A 1TL1A 4TQRA 3F73A 3VQ4A 1RT4A 1S10A 3IG1A 3GV7B 3BDPA 3HVAA 3NGYA 3PW0A 4Z4FA 3ZCMA 4J2AA 3HL8A 1LW0A 4ZPDA 4K4UA 2Y1JA 4FK2A 1IM4A 4BDPA 2OZMA 2IAJA 4J2DA 4DG1A 3U6FA 2HHUA 3ALYA 3NF7A 1VSJA 5KG7A 1HPZA 3TR8A 2O4GA 1T7PA 1LWFA 1UA0A 1EETB 3D28A 1JLBB 3NHGA 1IKYB 1TKXA 1RA6A 1D5AA 3QYYA 1Q9YA 3L2VA 2D3ZA 3VA3A 2AJQA 4C8NA 1HPZB 2D5RA 2BDPA 4CCHA 1S9FA 1T05B 3H59A 5KFQA 2DPIA 3VQBA 3QERA 4KTZA 3TVKA 3M8RA 4XPEA 5HRSA 1GX6A 5J1EA 5KT4A 3KMQA 3GIIA 2IBKA 2E6LA 5KFTA 1BL3A 4FJJA 1NHVA 5KT7A 2KFNA 3AVMA 1JLQA 3PHEA 1HNIB 4OPKA 4IBNA 1YTAA 1RT7A 3V6DB 1FK9A 4CFDA 4JLHA 4E7JA 4M3UA 4KFBB 4CFCA 3D5MA 3CFPA 1VRTA 4JV0A 1CZBA 2FBYA 4ECRA 3T5HA 3SFGA 5SZTA 3BSNA 3PUFA 3VQDA 4ZP8A 5F8MA 1VSFA 2D41A 3MEGB 4W5OA 4NZ0A 4DTMA 2HNDA 4NLPA 4NLSA 3KHHA 3TARA 1RYSA 3G6XA 4Y2CA 2R2UA 1JXBA 3T1AA 4K8ZA 3OYKA 2AGOA 4E7HA 4O3RA 4N47A 2W7OA 1IKWA 2WK4A 4DQPA 2OPQA 4OGCA 3SV4A 2IM0A 2HAIA 5EDWA 1KRPA 3OYHA 3AVBA 3RR7A 4K8XA 2E4LA 1LAWA 4J9PA 4CK1A 1RDRA 3LP3A 1TKZA 3PV8A 4C8MA 1BQNA 3NBPA 4TQSA 4FLWA 2PY5A 3GYNA 3OYCA 2ALZA 2W9CB 1D0EA 4I2QA 1FKOB 5EWEA 3OHBA 3DRRB 3O3FA 4TLRA 2XI3A 4NYNA 4KB0A 4KHSA 4M45A 3ULDA 4KB1A 2R8KA 3NMAA 1TAQA 5KG2A 5EWFA 2G8IA 4F4YA 1IKXA 3V9WA 5KG5A 3MEEA 1X9MA 3ISNC 3LZJA 1GX5A 4CGJA 1HQEA 4C8KA 1LW2A 1HQEB 2E9TA 4CJQA 4KB7A
chains in the Genus database with same CATH superfamily
3VEWA 2ASOA 2K3IA 1F6TA 2ASDA 2CA9A 3P5JA 3ZX2A 3UKRB 1BI4A 4FZVA 1D3WA 4RPFA 4IWVA 1S57A 3HHEA 3NCQA 1VR6A 2MQMA 3UCZP 3NGSA 2XZDB 5IT0A 1RDBA 3MR3A 2CWKA 2R3VA 4HWIA 3T5LA 4NCGA 3MUTP 1LXNA 3ZETB 1U04A 2RQKA 2YPYA 3R3TA 3DLLL 4CD3A 5LM7E 1SUQB 4JKEA 3DLGA 4OZ5A 2K7KA 2Z30B 5LSRA 1IBKF 2UXDJ 1CS4A 1RFQA 4DSLA 4DUYJ 1P9YA 1ZM4A 4X4SA 4CZFA 4RW4B 4PXDA 3D45A 4P2FA 4LF9F 1XMQK 4C2MA 4BC5A 4CWBA 1PYSB 3IRXB 4J7CA 2DCLA 1XNRK 4DLEA 2Z1IA 1OY6A 3Q89A 1S4FA 2PI5A 1Y10A 3MF5A 4J90A 4JI5F 4DBQA 4G9ZA 2PN6A 3HFZB 5CR4A 4R5PA 3C95A 1EZZB 2NZCA 3M6UA 4USJC 5KT5A 1JLEB 4IUFA 4U96A 3L8BA 1MN7A 2CNLB 4QR2A 4ECVA 2W6KA 1FDBA 2KJVA 1NJIO 5U47A 4DR7J 4NLDA 1R0BG 4EP4A 3HVRA 1F5BA 4X4NA 2N82B 4C8ZA 2ITGA 4Z4CA 4IG3B 1DLOA 2GHPA 1FRIA 5ETTA 4BE1A 2C2ZB 2OPRB 1IQZA 2O8DA 4J9KA 1FA0A 4CF8A 4CESA 1XMQJ 4JI6K 4NLVA 2EFPA 4WCEL 4DQQA 3V6HA 3OYIA 5IWAK 4ZVTB 2DRDA 2XY7A 1SIWB 2YXLA 4KPYA 3K0SA 4DN9A 1IBLK 1N36F 4QIGA 2E9RX 4HCCA 1Z1ZA 1TP7A 1T9WA 5FPEA 3R2CJ 1LCUA 2XG8A 5D15A 3N28A 5KFHA 4PZVA 4OI6A 1KXPA 1EWRA 3THXB 2EK1A 4ZVSB 4DTJA 2QA4S 1NUEA 2V8GA 1XMOF 3N9UC 1FCAA 3Q8QB 3BKFA 2H4YB 4USWA 3DM2A 2AYGA 2XCAA 5HLFB 4PG6A 5CYMA 3VZHA 2B51A 2XYPB 4ELVA 2FDNA 4MAKA 3I31A 3KJFB 1WSFA 3J80U 4AL5A 5GAEI 1NLKL 4PY5A 3CDBA 3TPQA 1NJXA 4DTRA 3DRRA 1RT5A 3HOTA 4Z37A 2D69A 1FT8A 5J1PA 4DL3A 2O01C 1C1CA 4NYOA 2MZ1A 2RQ4A 3CJ7A 3FJ2A 2XYHB 1VLYA 2LXFA 1F1BB 4KO0B 2XC9A 2WZ1A 1UEVA 4MFBA 1YRUA 2E7VA 2OD4A 2YKAA 3KWIA 4GY2B 4JI3K 3ZEUA 3TA0A 4HUFA 3GIMA 2A6AA 3VEZA 3KLIB 2OUGA 3SXLA 3TUIC 2ZGZA 3IS9B 5CZVA 3IAM9 1EX4A 3TUPA 4FBTA 1YSJA 3B54A 3KJQB 3OTOK 3ZT1A 1DQ8A 2ZE2B 5AZJB 3VQ5A 3AVGA 2Z4PA 2VPYB 2WBRA 2OEJA 4MK9A 3BKTA 4O4RA 5IQQA 4CF0A 4EYIB 2ZVIA 4N5SA 2OO4A 3RBDA 1HHTP 3GMGA 2DXDA 2C2KB 2I5JA 3JTPA 2FSNA 4LH5A 3OY9A 4M63A 4DL2A 4J9UE 2FVRA 4Y2KA 3DJCA 1QUPA 3OYBA 4G1QA 4JHDA 2WOMB 3DGPA 3C16A 5KG4A 3QRPA 2GEMA 1FI4A 3CD6S 5BPNA 4FVCA 1FE4A 2A42A 3UIQA 2ZJQQ 3FBCA 4CLLA 4X64J 3PW2A 1RHRB 2O66A 3TEGA 1RTZA 4LF5J 2MJNA 3GDQA 4X84A 3EZ5A 1JXEA 1TELA 1HLUA 2CPXA 2AT1B 2IS3A 3KJVB 4U67Q 3H08A 4OJHA 2FBTA 5HOOA 4LF8J 3MN9A 2FVSA 1FXRA 3E66A 1E6YB 2IM1A 4IO9Q 1QVGM 1Q82T 4JN4A 4BR7A 1OYEA 1WC4A 4IFVA 1I3AA 1NDLA 2B56A 3W7BA 2P5OA 4FO0A 5LXRA 3PM9A 3PSIA 2OIHA 1CQMA 2HFVA 2IOCA 1BGXT 2PMHA 2IYGA 4HHUA 4CO4A 4ZKAA 2CUYA 3HKWA 1OWXA 3WXJA 3M8SA 1GLAG 3D2FA 3OTOJ 3SCKE 2K3KA 4EEYA 2QWPA 3R5GA 2ZJPQ 4C6AA 2VB6A 3NH2A 1QM9A 2GVDA 5ITHA 3I8DA 4CDIA 3CD7A 4W98A 1S1WB 2DNHA 1QTNB 3VEVA 1ZBLA 4CGGA 3N0VA 3MPYA 4DV7K 2UXCK 4DJBA 1NKBA 3D6RA 1R31A 4LFBJ 2GQCA 1VBZA 2OMOA 2W25A 4X65K 4FLYA 2LDYA 4JI6J 2HBYB 1RAHB 2YNFA 2RDJA 4RNMA 4G3IA 2M8HA 2DR6A 3MR2A 1NSKL 2MSTA 1AZSA 1MU2B 2W4CA 2CG8A 4LY7A 1VQMS 1BMQB 3HOSA 1R59O 2DTJA 3KOAA 5H9EK 3Q8YA 2XMAA 3QNWB 4FM1A 3NP5A 1VQKN 5J2MA 1G99A 4B1WB 1NMEB 1HHQA 4WQ4A 3FE1A 1U0HA 3S6EA 5F8GA 2YHAA 1VHFA 3K8WA 3VAGA 3KHGA 2BM0A 1DQ9A 1ZH5A 3EUNA 3ID6A 3QEXA 5DETA 5F8LA 3UR0A 2QA2A 3AO1A 4QU6A 4DV6F 4LFBF 1D8ZA 3UN5A 1KFSA 2IA6A 4NYPA 2KDOA 2FBXA 1A9NB 4DR7F 1RWPB 4KI6A 2ZBRA 2XULA 2DNNA 4NX9A 3DHXA 1FJEB 3AA2A 2G8UA 4UUWA 3W64A 1T6DA 4DR1K 2QWQA 2VQFK 2ZUGA 2LEPA 3H5XA 1L5UA 3GJRB 1MG7A 3FK4A 2CPJA 3R7NB 4QWAA 3V81B 4DCHA 4QWDA 3WZ0A 4PYAA 2DR7A 4CH7A 3DWLA 2G0JA 2ZD1A 3NH1A 4GC6A 2AGQA 1OVQA 3SQOP 3GIRA 5E3RA 5KFCA 3AAQA 5FDLB 3GYGA 1UVNA 3NF6A 2GJFA 3Q23A 2Z56B 1C4CA 4CFBA 2DFEA 2MKJA 5K8OA 5KFPA 4YR2A 4LBPA 4LRAA 3UFCX 1ASVA 2AJ1A 2A6OA 4B1UB 2ZHBA 4KH0B 1FJ7A 1VSMA 2C3PA 1UOCA 1R6YA 2RUGA 3Q8PB 2GZOA 3E3XA 2EC2A 1T9YA 3C6UA 4A8YA 4ZCKA 3QETA 4RO0A 2Y8WA 3J7ZO 4FWSA 4M8LA 3EDQB 3LWLA 1TKDA 2J7UA 5C5JA 3CM6A 3V4IB 4ES1A 3D1HA 5I42A 4FZXC 2A3JA 3ITHB 4O4GA 2KI2A 4ED2A 1BQMA 3OV7A 1EKRA 3H5UA 4F8RA 2HBLA 4B8CA 1LQ9A 2H48B 3KK1B 3R97A 1KNZA 1RAEB 2PFUA 3B78A 2YWKA 2PAVA 2DGUA 2HMIA 1ZZFA 2FZKB 3TVZA 4JI7J 4WP9A 5BREA 3MCMA 4X62K 4YHHK 4KE5A 2UUCJ 3SFUA 3SJJA 2O1PA 4CIOA 3FBEA 2QL7B 5KPRA 4ZS6A 3PFEA 1HWUA 1Q82O 1Y97A 1QZ5A 4JI2K 4OJGA 4UY8T 2EFNA 4MH8A 3D6HB 2AU0A 2UUAF 3CQ8A 4FJLA 5E3QA 4JI0J 2UVVA 5JVHL 2W2OP 3MR6A 5I3UB 4M3TA 3T1HK 4BR4A 1WUAA 3QPIA 3LGMA 4QCLA 3CMAN 2CFXA 4E89A 3HHLC 3G87A 4AM6A 4OYAA 1X3MA 3JAMU 2OSQA 1BCOA 2YKNA 3NCRA 3NBPB 2B9EA 2WVFA 2VGNA 1C0FA 2GMJA 5HP1A 1R8CA 4CBXA 3CCJS 4JI5K 4DTPA 3TUJC 3GJQB 2CZVC 2BANA 5GAEU 5A8WA 3ZSQA 4YORA 4NXNJ 3S9HA 2MQNA 5J2NB 1KCFA 3JXOA 2O3DA 2XSJB 3FMWA 4DN0A 1DEJA 4G6VB 4WE1B 3ZSXA 3LDQA 2RS8A 4DV2J 2DRAA 1FNOA 4ATNA 5B0AA 4NLRA 1WN7A 4M42A 1GFWB 4F36A 4MDBA 5IT9U 4GKJF 1U6FA 4OIXA 4OQJA 3QQCD 3A2FA 2QW9A 2OFGX 3ITHA 4CJSA 2I7NA 2KG0A 4WYWA 1C1BB 4KHPJ 3SAGA 1RYRA 3C3LA 5GAHP 5IFMA 3D7EO 4HCBA 4XO0A 2FPHX 3E2EA 2B5JB 4JKDA 3I96A 4FF1A 1JLAB 2LVWA 4OZ3A 4Q43A 3PRBA 4J2EA 4QYRA 2YKNB 2R42A 3ETOA 2BRLA 4OJ1A 4Q0BA 2WONA 3Q7BA 4HHJA 4A47A 1S12A 3P96A 1APSA 2FHJA 2IVOA 4ZCIA 2FQQB 3GG4A 4CERA 1P9QC 5IZHA 3NF8A 2YHYA 2Q2RA 2X3GA 4A48A 3UD5A 4K0KJ 3UVJB 4OPJA 3SMPA 1CZ9A 4DV5J 2GGPA 5AJ3F 3QJJA 3DM2B 1NPKA 4RLEA 3CJRA 4ID8A 3DOLA 2BTFA 2BQ3A 4Y2IA 3BYRA 4NMXA 1X4FA 4X4QA 4ILLA 1BO5O 2WVEA 3LDPA 3D6MB 1H72C 5EVZA 1M5HA 4C1NI 1U1LA 4FS2A 3OL8A 1CJVA 1BQMB 4P71A 1BQNB 3RGIA 4OI4A 1TKZB 4R0EA 2P5GA 3HXMA 1HWJA 3WIVA 5EX5A 3EE9A 4CHZA 3L3VA 4WWSA 2KU7A 4E3SA 2N4CA 2EHGA 4X66K 1JXVA 3ENQA 2FGCA 3NY0A 3I33A 1VIXA 5A8RB 3CCSS 2VG5A 4WF9L 3W2WB 4ZJOA 2RB7A 5CXTA 1FWPA 4ECQA 2JFDA 1VQON 3THVA 2C3OA 1G1XA 3W5YA 1VAZA 3AGRA 4WK3A 3W60A 1U1PA 4DR3F 3D3BJ 2WUSA 2MGZB 2W7AA 3CCVS 1X4CA 2ZH8A 2HHWA 4DV4K 2HVHA 4F3OA 5AQRA 3BSAA 4J5OA 3SLCA 3JSBA 5JLHA 2G8HA 4ID5A 1YIJS 4CH0S 4RG8A 3PIPL 5GAGU 2OMLA 1ATRA 2VDIA 2ZKUA 1O8BA 3GOIA 1YJUA 4C11B 3P8BB 3CCLN 5B0GA 2ZD1B 1SS6A 3NGZA 3F9KA 4OYWA 4EYHB 4IO9L 1GMWD 2YPZA 3FVYA 2RSQA 2W2NP 4DSEA 1VQNS 5KI6A 3SUQA 4QW9A 2UP1A 1N54B 2NZTA 4LUBA 4UZBA 4CEQA 3LW5C 4L3QA 3R27A 3KLFB 3Q24A 4OX6A 1MN9A 5ETVA 4J9SA 1UPPA 1Y3KA 1KVIA 1X1PA 2QKBA 1NHKL 3KFWX 1SJ1A 2NRVA 1IKVA 1S9EB 5KFMA 4C98A 3KHYA 3IGNA 1K8AT 1RTIB 4HT5A 4DV1J 3UDCA 1L3VA 2RH3A 3HJFA 1AT1B 2LFVA 2W8KA 3U02A 1ZM9A 1WEXA 4R79A 3DLGB 3EY1A 5J2PB 5AXKA 4CJKA 1CEZA 4C8LA 2YCHA 3OBYA 4TY8A 3RSEB 2ZJRL 4DV5K 1ILYA 3O3LA 4WP8A 2CNKB 4B3OA 1QQNA 1SQKA 1W2BR 3ZZ0A 2NREA 2KKHA 4YOXA 4LF5K 3G8SA 3M9MB 3Q8UA 3O8MA 3DDNA 3U3YA 4UY8O 2FJXA 4H4OA 4HI2A 5DQIA 4CZHA 3HLUA 4YR0A 4LIWA 4UOFA 1VQ8N 3D1OA 4OV1A 3L0QA 1JJ4A 4MO5A 3L2UA 5CD4H 4B08A 2CJKA 1URRA 4UUXA 2OEMA 2I9SA 4C0HA 1K9MT 4K4SA 1IWAA 3EZWA 1RE1B 2D3UA 4FWMA 3BJYA 3H2LA 2IBOA 2Q43A 1SZ2A 2M7SA 1U09A 1PCAA 3GWCA 3J7ZT 4Q0BB 3ZSYA 1S1TB 4P9SA 4DPWA 3M05A 5H9FK 4OI1A 3LDOA 2RU3A 4AQYK 1QTMA 1S1UB 3OA9A 2HQIA 4J9NA 4M3XA 3G6VA 4MO4A 3VGSA 4AHTA 1F2GA 2HKEA 1KC8O 4DV2K 2MLYA 2QWLA 4OX9K 2MGZA 3VEXA 3TOQA 4GKJK 1T11A 1AROP 3CC2N 2GHWA 5D3GA 3MR7A 4FPIA 2EX3A 3WEEB 4C3LA 2NXEA 2DXEA 2CPZA 1DTTA 3DLKA 3HVTB 2VOPA 2EI5A 1B3TA 3O44A 2BKOA 2HG4A 3WNEA 3G4SN 3CDUA 6AT1B 1NK9A 2BANB 2QRRA 3A8EA 1WSEA 1NJWA 3HHLA 4PKHA 4F67A 3Q7CA 3DRYA 4F3MA 4HL9A 1RT1B 2E1PA 3JXUA 2DNRA 4H54A 4QR1A 1UVJA 1ASWA 4ZPAA 4K8RA 3ISZA 2FC8A 3E8OA 2CPEA 4KRFA 3QAUA 2B8PA 4ED6A 4E1NA 4KR0B 5A6WA 2XO6A 1EWQA 5K9FA 1FKPB 4YMEA 3OVNA 2BJ8A 4YB7A 2DIVA 2JOQA 4O8UA 4GVEA 5LSOA 3QLHB 3SQ4A 5GADU 4FOEA 3H2UB 5A8KA 3CJSA 4QPTA 3OL6A 2D9PA 2WTFA 3QFUA 1NH8A 1RDAA 3RB6A 4ED3A 3US5A 4YP3A 4LSLA 5D6GA 2H5EA 1N6QA 2WFBA 2BMBA 2Y1LB 3CCQS 4DXLA 1OS5A 1WTFA 2XI2A 1WHWA 4LT6A 4LF8K 2YX6A 4G1PA 3EGZA 1MDUB 2I5JB 3QO9B 1PC4A 2W7PA 3AY9A 2GBZA 3ICLA 4YB5A 1VRUB 3V2UC 3MZIA 2MPUA 3DU6A 3RMBA 2D0PA 3OD2A 4A4JA 1C1BA 4X4PA 3P39A 4IOAL 3J81j 4DX6A 2HBKA 2ZH2A 3IFRA 3F0NA 3AOBA 4NCAA 1MWQA 2HQFA 3UNGC 5FLXO 4OLAA 5D0EA 3QEWA 4DV0F 4TLQA 3GIKA 1XEZA 2G8VA 5J1NA 4RW9A 2RHSB 2UXBK 2IRXA 3LZIA 1E6VA 2MQLA 2OSRA 1PYTA 1RWMB 1TUGB 3OJUA 1XJWB 2RD5C 4WXWA 3ZTQA 4BVOA 1N33J 4CLUA 3NGTA 3OL7A 2XLJA 1SXLA 4RL1A 2D7SA 3TYTA 1YI2N 2QLBB 4DR3J 3QT6A 4LFCK 4DR2J 3K2YA 2LLZA 5HATA 2BE2B 3SQ2A 4PABA 4ECSA 3PNIA 5H1SQ 5FDLA 4WZQA 4ERDA 1RB0A 5B08A 2A41A 3CCZA 2K2PA 1C0UB 3V6JA 4HLBA 4LC9B 3M8YA 2GWJA 5LY3A 1QSYA 3BQ1A 1WEZA 3QIPA 3HD1A 2DHGA 4FKXA 1NB7A 3A13A 1SC6A 3GFXA 4L73A 1U47A 1V4TA 1SQEA 3A5LC 4ILGB 4O0JA 4I69A 3MCNA 3BBFA 4ZPCA 4M5DA 3VF2A 3SYZA 3I5BA 4BR9A 5CHIA 3IP0A 3CGIA 2DYAA 1WLJA 1TL1B 3KZBA 1RT6A 2HSTA 1YJ9S 2VFUA 4CEFA 3QGPA 3P6YC 1UWAA 3VALA 2Z1JA 2EPIA 5CYQB 3ELHA 1B7YB 1BOTO 2DIUA 1RXOB 2QI2A 3V4IA 4C4WA 3BDEA 2CH6A 1CXUA 4B3TJ 1RDCA 4ANCA 3T19A 2H65B 4EBCA 1NO8A 5CYJA 1ATNA 2XS2A 1X0FA 4KHPF 4EZ6A 1SIZA 3H0PA 1WF2A 3HI9A 1JLFB 3CEDA 3RB4A 2HHHF 1J53A 1LK5A 3HP6A 2P9KA 2PE8A 2R7RA 2VBXA 3L6QA 4HACB 3K5NA 4RW7B 1P8ZA 2O5DA 3CCSN 4BR0A 1DJ0A 3OW2M 4HR2A 3O9QA 1IBLJ 3G6EN 4NLBA 3MWBA 1WC5A 8AT1B 1OH6A 2BJ1A 3TNVA 3KVGA 1N56A 2L48A 3NOCA 2WSCC 4L74A 4N8OA 1KAZA 3GZ7A 5KFOA 2V5HG 3AD9C 4M3YA 3M6WA 5ETOA 1SUQA 2Q97A 3ZSOA 2MHEA 4N41A 5KFZA 4ENOA 4CEAA 2NSCA 1N5YB 3L4IA 4UY85 1SQGA 4LBHA 1UAXA 3RSEA 2ACMA 2L9NA 2FTRA 2HHHK 2X51A 1RT7B 3MR5A 2O8EB 1JB0C 5GAHI 3O6QA 4KHPK 1UL3A 3O8WA 1IJEB 2CPHA 2AX0A 1RAGB 3BP8A 3PIPQ 3UW1A 2IPOB 2V8HA 1RT3B 4I2PA 3ZNJ1 2V67A 4TQRA 3F73A 3IG1A 3GV7B 4DPYA 2PC6A 3PW0A 3R6MA 1Y64A 2ZH3A 3HL8A 4DV3K 4K4UA 2Y1JA 1K9MO 3C65A 4JYAF 3OPKA 1IM4A 1VFJA 2IAJA 5FD1A 3ALYA 3NF7A 4OO1J 2QTWA 1QAYA 1R0CB 2O4GA 3GSDA 3ZFVA 4USKA 3KG1A 1JLBB 1RA6A 1D5AA 3QYYA 2VOOA 5KOWA 3L2VA 4JKGB 1WTBA 3PKYA 1HPZB 2W24A 2IVMA 2LCWA 1S4EA 2NYIA 1Q16B 2GIFA 1S9FA 3DXKB 3U9DA 4DV1F 4LR7A 2R4FA 1VQPN 1YJTA 3TVKA 2C2OB 1KR4A 5EHHA 1LEOA 1RJJA 5KT4A 1X5TA 1U6BA 1NHVA 5AZIB 5BJRA 3PHEA 1WKJA 1EKSA 2HLTA 1HNIB 3V6DB 4K42A 4JI3J 5DDQC 1UJ6A 2LMIA 5C2DA 4CLPA 4BR5A 3RU0A 1CZBA 3CTRA 3BSNA 3VQDA 4ZP8A 2RMLA 4F26A 2D41A 4JYAK 3MEGB 2AEFA 4NZ0A 1JNZB 1OY8A 3KHHA 3G6XA 2E5LJ 5GAGI 1HW9A 3IM8A 1JXBA 5A8RA 3OYKA 4E7HA 3F9MA 3NRBA 4O3RA 4JKCA 3D54A 2AF6A 1YJ9N 3RW6A 3SV4A 3H20A 5E26A 5EDWA 1KRPA 3OYHA 3BH7B 1MNEA 5F0XA 4CK1A 1RDRA 1M0SA 1TKZA 2EEYA 3RBXA 4TQSA 3K8VA 4CRJA 1F60B 2Q6CA 3C6AA 5EWEA 3OHBA 2DVIA 3LL3A 1ZXOA 1FD8A 1T9UA 4MTPA 3O3FA 4DV6K 2CPIA 1UKUA 4ZJLA 2LEBA 1UZHA 5E33A 3DNCA 4KHSA 2Q0RA 2YTCA 5M1QA 3HJVA 2Z2MA 1X4AA 3W9IA 1VBKA 3Q8VA 4F4YA 4L76A 2IJRA 5LL6Z 3AB4B 3NNCA 3ISNC 1IG8A 3C6HA 1HQEA 4Y00A 1BUPA 1LW2A 4H0VB 3W5ZA 3P3DA 2RPIA 1GMWA 3AJ2A 2IYIA 2BJ7A 4NLWA 1SJQA 4IRKA 1OH7A 3AODA 2JJ4D 1SPBP 4E7KA 2HURA 3AGKA 4AILC 3NOGA 3VVUA 3VQ8A 1T3NA 2HIQA 3CXCR 1WSHA 4BRPA 3F44A 2NYHA 1LWFB 4O3QA 4PWWA 3C15A 1NMDA 4DG1B 1VQ6S 1HI0P 2M70A 2CQPA 4HTUA 2VC1A 2OFHX 2GO8A 1URNA 2ZITA 5DMRA 2H3GX 4JI6F 1R8PA 1YZ7A 4YFUA 4RBVA 2JVOA 1I94F 4FVMA 4KGVB 2WTUA 2IC3A 3L3CA 1WUUA 1GTHA 2Z0GA 3IS9A 4L75A 4P10A 3LP2A 2O8DB 3ENWA 2LKZA 5DS7A 3T9NA 1UWBB 3B8HA 5AQPA 3BEGB 1N32J 2C2MB 3QRRA 3R6GB 3ZTOA 4DR4K 3PSFA 4WFNQ 4DTNA 2EFGA 2L3MA 4DL0C 4IFYB 1NBEB 2KT2A 2AWZA 3SBMA 1EIYB 5MLCQ 3AFGA 3LDNA 1A7GE 3SQGA 2JFKA 1TYQB 3O2IA 2W1BA 4JKAA 1N32K 3CSKA 3UKUA 2YI1A 2V2QA 5BRFA 3MOJB 4XTTA 2Z8QA 4LF1A 4RNOA 2R2RA 1XK8A 5KRTA 3D2WA 4K2XA 1ZBIA 4FS1A 1QSSA 4TU9A 4ED5A 5KGWA 1YG0A 1TK8A 4PG7A 1KAXA 3EE8A 2DRBA 4XDCA 4ELUA 3H5SA 1KONA 2B6AA 2HWHA 3VQ6A 2GELA 3E9OA 4ISGA 4DUYF 1AFIA 5KFKA 3ZSRA 4ZK7M 3QZ8A 4IOCL 2LEAA 4IR9A 4LF6K 2HFUA 5CHCB 1NGDA 2FY8A 4LSZB 4DTSA 3VHQA 3UR3C 2IDLA 3UN2A 4J9VA 3CDWA 1JIHA 2FY1A 1GLJO 1KQFB 3R2DJ 1RISA 4CNZA 2HRTA 4KH5A 1VRQC 4IQXA 2ASMA 4PQUB 2YJFA 4JV5J 1MMLA 1N6QB 5KFNA 4FK4A 4OZ2A 3D0PA 2P9SA 3ASMA 1ICEB 3IAYA 3ZTSA 3DMJB 1A5WA 2XZTB 2XTJP 4USTA 4RWTA 3RWUA 2KYZA 3KLVA 3JQMA 2J0SD 4NRTA 4Y2MA 2FD2A 2ZDPA 3TRGA 1Q79A 3TAEA 3N79A 5F2RA 4M3RA 1TKTA 1HBOB 2QMUB 3FFIB 1TVRB 4BDYA 1T03B 1CJUB 3J7Z5 3BV8A 4LF4F 2DPNA 2V7ZA 3SI8A 4JP8A 1U8WA 4NYZA 4F2SA 5KFBA 4ZA1A 1D9AA 2UVRA 5F3ZA 2KO1A 1SH2A 3QEIA 4UOHA 2V4QA 2HFOA 4BROA 2PEBA 4EAHD 2VWKA 1MWMA 3CPWR 2BQUA 1OY9A 4CJTA 5GMKa 2E2OA 4DR5K 1JLEA 4GKKK 3NS6A 2HGMA 3FRYA 2WRMA 3SAFA 3M9NB 1K0TA 3D6TB 5C25A 4H4MA 1NK6A 3LA0A 4IEEA 4K59A 5E84A 2UU9F 1REVB 1FHTA 4EIAA 3HVTA 1DHMA 1HIYA 4WYLA 3IMXA 3JSYA 2P9PA 3C14A 3D0IE 1DRZA 5HSPA 4X65F 1S6UA 1H1VA 2Z1HA 2N3OA 1KS2A 3AQOA 4ECUA 4JKHA 2JLFA 3JTOA 4ISEA 3VEYA 1NPPA 3GJTB 4Z4EA 2YWEA 3VGKA 2QL5B 4LRFA 2C22A 2W01A 3CJAA 1YHQS 2A1RA 2OAUA 3KHRA 1HBMB 3RAXA 1RTJB 4KV8B 4KRWA 3TTFA 1WOPA 2XMMA 1J5EJ 3VR1A 3IWXA 3EXCX 2HNYA 5ADZA 4H03B 4B1VA 1FERA 4KBIA 3CXCM 4RW4A 2AEJA 1N48A 2ILYA 4XEIA 4OYPA 1OIAA 5E3CA 1F21A 4NA1A 2AD9A 3VQSA 3BO3A 1ZBFA 5FPNA 4URSA 4ZCMA 2UXDK 2J9EA 4H4KC 5BR9A 4CHPA 1RBRA 3X1LB 4DR6K 1Q53A 3UKRA 4M94A 4CLTA 3P38A 2DD8S 2MEWA 2FJVA 1RAJA 3CJCA 4BQZA 3PTWA 2FJBB 3NKYA 4CEDA 2X7IA 3LP1B 4GVBB 3AO3A 3IBWA 2QLFB 4NL5A 1O5JA 2AZ1A 4EZ9A 1NKCA 2VG6A 3KJNB 4CJ3A 3P5BP 2LA6A 3SUNA 4CF9A 2E66A 2K06A 4L3NA 3KLEA 2HPUA 1HBUB 3TW0A 2VBYA 3F56A 4CGDA 3OHAA 3AARA 2J8AA 3K7RA 1KDNA 3OFGA 4HTIA 1U7LA 1TUWA 5AQZA 3HULA 4M41A 3IGVA 3FGVA 5CE3A 1T9TA 2KHCA 2Y8YA 3CCRN 3VETA 1ATSA 4CF2A 5FLXY 5HVFA 1YITS 4BRFA 1KD1T 3FDSA 5GADP 3SZ2A 2GVZA 3L2RA 3VAFA 3RMCA 3AAWB 5DZ7A 1V3ZA 4CZLA 3NS7B 4Y0FA 2R9LA 5IM0B 4LF5F 3O3GA 5F1XA 1S3XA 1RLCL 4FYWB 2YHXA 4X4OA 1OO0B 4QQBA 1P27B 5KOXA 3U1MA 1T9VA 2DXFA 3NS5A 3M2UA 1UMJA 2CGKA 2H5IB 3IM9A 3HSTB 4N7TA 4J9OA 1RT2B 1UP1A 2M2BA 3MECA 1RTDA 3ZZPA 2FHMA 2ZBCA 2P9UB 1X8DA 3TEHB 1N88A 1MMDA 1EHWA 3KLEB 2YWFA 1TVRA 3TAGA 2RKIA 4CZCA 3JS6A 1OQ6A 4DR1F 2HHXA 1A6LA 1ZS6A 4AYBD 4HKQA 4B17A 1U1NA 1HBNA 2KRRA 4DL5A 4DL6A 4QIWD 3UPFA 2NRHA 3CUNA 2G8WA 1BHNA 3CDAA 2XZWA 3CE8A 4K5SA 4RWXA 4DS4A 2DISA 3W3DA 3SMSA 1Q78A 1YITN 1ZC6A 5JXSA 4ETZA 2QGFB 3H5YA 4FF3A 2RJZA 1SL2A 1TKXB 5CYQA 5ADXH 4OHYA 1ZYQA 2DB1A 3FEZA 1B64A 2LSNA 5EX3A 2B9XA 4O44A 3DGVA 3ILJA 3QIOA 5DDOC 1Y0HA 3R9PA 3UDEA 4ZLNA 2A0FB 3X3UA 3R5CA 2CNOB 2W8LA 5AE3A 2DNGA 4USHA 1UPMB 1S0OA 4RU2A 3WBZA 4AHCA 2KM8C 3NH0A 3KK2A 1V5VA 4U9RA 1UW9A 4OZNA 4NZ7A 1XR5A 4J9LA 2J0WA 4CI0B 4KHUA 3EGNA 4UF4A 2GO9A 3E01B 3V9ZA 3THTA 4WFZA 2OYQA 1EP4B 3HZGA 3MK6A 2UXBJ 4ZPTR 4E7IA 4ZITA 4JS4A 3BZQA 1NGEA 3KLGA 3NVKA 3E9PA 1ZBTA 2W41A 4X2BA 5KFEA 1S7HA 2DR8A 3T1YJ 4MIAA 3PYEA 3PIOL 3CFRA 3MDQA 5THWA 1N5TA 4P72A 1DBDA 4C0BA 1AA1B 1WB9A 4LF4K 3FZHA 1Z05A 4GV3A 5A0YA 3PX6A 5LSLA 1KSPA 4EP5A 1KQKA 1M1KT 2Q6BA 2V8PA 5HLFA 2B8QA 2WBMA 4Q2MA 5L38A 3MDFA 2XCPA 5LT5A 4PR6A 1VQ6N 4PAAA 5LOQA 4QYZJ 3OR2A 1HR0J 1I3OB 2VFVA 3M8QA 4LBIA 4MKYA 1MSWD 4DR6F 4ES3A 2F7TA 1PILA 2VU5A 2V0NA 3GP9A 4KHNA 3WNGA 3ZT3A 1N32F 4FXDA 2D0BA 2BJDA 4ANDA 4S0MA 2IMOA 2VC0A 3RB3A 3O1WA 2HZAA 5LMUJ 1GXTA 3S3NA 5D8HB 2BBEA 2JNJA 4RBUA 5L46A 2UU9J 4NE9C 3S8SA 4NB4A 3J7AP 4IH6A 3BO4A 1YDLA 3R5JB 5J1EB 3VGLA 2EKYA 2P9LB 3EKSA 2X3DA 1BWFO 1IBKJ 2EXUA 2M52A 3MMBB 3CJ2A 2CJXB 5A8KB 3QRQA 4K5RA 4CJ7A 3NXZA 3M8WA 3G4SS 1FNMA 5KFAA 3QIPB 3BR9A 3CFOA 3L7UA 4I68A 4CHQA 4JI8K 3DRXA 4LQ3A 2EC0A 4XH4A 1V4SA 2ZNYA 3WUHA 5HQLA 2D1CA 2ZH9A 3NNAA 4AH9A 1Z4UA 2A10A 4LF6J 4U95A 1NNDA 5FRMA 2I1RA 3VQ7A 4JK7A 2JWLA 4JBCA 2Q3SA 3P31A 3SQ0A 3F2KA 4KKOA 1XR6A 2V51B 1S6PA 4F4WA 1YF5L 4I7FA 2HHSA 4E19A 2A2DA 2AYBA 1WACA 4ED0A 1NDKA 4XAKA 2NRRA 1EKEA 1REGX 2JEIA 3PJ9A 4BC2A 4MQ3A 1A5XA 1KLMA 1RWOB 3HT3A 4A8FA 2E44A 3MM9B 4CK3A 2N4DA 2G8FA 1H98A 2YH0A 3J7AN 2YKMA 3CNQP 1MLAA 2G1DA 4J9RA 2KL8A 4NRUA 5KFGA 5IT4A 2KN4A 4FYVB 2NLXA 2XWYA 1U26A 1ELOA 2VQEJ 4KQZA 2JL9A 1CG2A 2KT3A 3PYFA 1K73T 2DNYA 3PEHA 1CS4B 2EBGA 1NGFA 3SCXA 2NPIA 1ITGA 1RHKB 1HJRA 2CQ0A 4BRGA 3OR1A 1VBXA 1HA1A 5T41A 2VD3A 1WF0A 1TL3A 2CKWA 1JLBA 3EPGA 2Y1RI 4O5BA 4DPUA 3MAHA 3OYEA 1T95A 4MIBA 1ULRA 1S99A 5KQDA 1QSLA 3HVWA 2QK9A 1YGYA 3H1QA 3JSMB 2CQ4A 2NXNA 5KFFA 1EB0A 3ZZUA 1GK8A 4NI2A 3FGUA 4Y65A 3J81U 2NS1B 5C15A 1IBMK 2H3EB 1O1WA 4RUBA 4CJLA 5T14A 4JS5A 4L8RB 5AJ3K 3SPZA 3DKDA 1JLCB 2CG4A 2MZRA 2NUUG 3R9LA 1GXUA 4X4UA 1BIZA 3JSMA 3C7NB 1K1SA 2X1FA 2O8EA 2FGOA 4BE0A 3EEQA 2UUBJ 2AIRB 4FN5A 1OYDA 1FRKA 1SH3A 3HT0A 5BN8A 1WC0A 3PDNA 4H0XB 3MAAA 3TU5A 3OSNA 4AQYF 4CH1A 3MN6A 2P9GA 1HQ2A 3AA3A 3RAMA 2F65A 4JRQA 4IZ9A 3BM7A 2HVIA 4Y3CA 5ETQA 1N4LA 3PR5B 1Q8BA 3P4UB 2HNYB 5LL6d 2RIJA 1Y11A 1HWKA 1NGHA 3MMJA 4ZN3A 4FBUA 2KTQA 3ZZOA 5FRNA 2DR5A 4CJEA 1HMVB 2RQCA 3KWMA 2XM3A 3PO4A 1NGBA 5D4OA 3RRHA 5E0OA 3KK7A 2XY6A 2ZBQA 3UE5A 4CJRA 3TAMA 1B99A 1Q86O 6FDRA 3EN9A 1XNRF 1VQ4N 3LP0A 4IH7A 1BDGA 3U9ZA 1CXQA 1T05A 5BR8K 3OYLA 1NGAA 2R2TA 4NLTA 4O3OA 2WW8A 3QFWA 4IDHA 4AL7A 4PHTX 3FC9A 3DC2A 4JI2J 4USIA 3LPTA 2RF2B 3LQVA 2XBPA 4DTOA 5DDPC 2FC0A 3JQJA 4X4RA 4C3MA 5ETMA 3H4DA 3CETA 2GAHC 2KZMA 2FC9A 2QG9B 4H4OB 4DPTA 1C0MA 3D0HE 3TAFA 4CJVA 1NSAA 4FVUA 2L08A 2FVCA 2CJBA 1XUPO 4MDAA 2XHWA 1D9FA 4USMA 2HQCA 2A40A 1UVLA 4OX9J 2RAQA 3E1YA 4GV6A 2OD6A 2Z57B 4QJVA 1CBKA 2NPFA 1HNWK 3GJSB 3OFFA 4ZVOB 3V9SA 1HYSA 1VLOA 3VQQA 1J5OA 1GLCG 3A8JA 3FSXA 1EXQA 5H9FJ 4H0OA 3PW4A 3JYTB 3MPUB 2JWNA 3GLJA 3DLRA 3FKBA 3KG4A 4I6YA 4OJ3A 3MURP 2XNRA 5HVHA 3CG7A 4LRCA 2DNKA 2W2QP 4BGBA 3OYFA 2P1JA 3NMUA 1BWVA 1RA7A 5AFUH 4B3SJ 4F04B 4F4ZA 1HI8A 3O80A 4BRMA 2MB0B 1V3RA 2IMWP 1E6VB 4KH1B 4DL7A 3VMFB 2I8EA 3DFEA 1BLUA 4QBUA 2WONB 2EFQA 2RT3A 3K59A 2WB4A 2ZKTA 4WZMA 2G4BA 2YQ0A 1JLAA 2CQCA 2V68A 4GV9A 4RW8B 3DGPB 5ADXA 4C11A 3CJ9A 1M5VC 3CQYA 1RDDA 1CULB 2A1SA 4N8NA 4JI0F 2R7XA 4EFAC 1HKAA 5C42B 4YNQA 2NQPA 3CCJN 2Y9HA 4YOVA 5IV3A 3KUEA 4CZJA 1CC7A 2JHEA 1HYVA 3OS2A 3UKUB 2PIIA 4RZRA 2PDAA 2VFTA 1I94J 1UWBA 3B6BA 1TYQA 2FLPA 3A8IA 5D0GA 1H6KX 5EGYA 1HNZF 1NOYA 4NZ6A 3HHDA 4DTUA 3UI3A 4ISFA 1NJYA 1U2VB 4DZDA 1WG5A 3LPUA 3OUYB 3VEOA 3KDNA 3CC4N 4ZOSA 4KIAA 1L3KA 4JI4F 4JI5J 1S0VA 2UXBF 1TFYA 3EX7B 2QXFA 4DFMA 5KT2A 3HSJA 3R5DA 2V9WA 2BXJA 2E1RA 1TGOA 4CBWA 1JLQB 2IM2A 3QLHA 1CPZA 4CM2A 5J2QB 1FJCA 2QSWA 2BJ9A 1NG9A 3I4HX 4CP5A 1QVFM 3V6KA 1RDUA 5B0CA 4K41A 2PMZD 4P74A 3EWGA 3AHPA 3GV8B 1AW0A 3DN9A 3H40A 4ETXA 3PHTA 2E5HA 3GR1A 3Q2TC 1JJ2M 2OPPB 2RUSA 2R8IA 2V63A 3MMBA 3N4QA 1IBMJ 5JUMA 4JD2B 2VV5A 2CGLA 2D0CA 2GQQA 2VA2A 2F9WA 1Z6RA 1JCFA 2GHVC 4XH1A 5DQGA 1OMSA 1QY7A 2HQGA 4DV4J 3AXKA 4K4XA 1SV5B 3SSSA 2YX7A 1RK8A 4AHVA 3VGVA 4IRDA 1PBUA 2AA4A 5BRDA 4JI4J 2HMIB 4K0KK 1KKHA 3R1HA 3JYTA 2M5YA 3DOKB 5SUHA 4WU3A 4OJRA 1R43A 3PX4A 4LFAK 4CZKA 2FYXA 4MJKA 2XO7A 1QE1A 1FDNA 5FPDA 4EO8A 4JUZA 1DTQB 2NRTA 3KK1A 1H3DA 5HRRA 3LM9A 1VRUA 4X66F 1JQGA 2KM8B 2KRBA 1HFEL 3U4LA 5C42A 1SCJB 2RU9A 2VPZB 2RNEA 3WC2A 1FD2A 4HHHA 5HBMA 3RG6A 4ZTFA 4W5RA 2HFSA 3C0BA 1ZPVA 4YR3A 3NDKA 2ALYB 1RAIB 3GYXB 1DARA 4C8YA 5CY4A 4LSLB 2IFXA 4H0PA 1TK0A 3MM7B 5J2NA 3M1FA 4U7CA 3UDLA 3IR6B 1T3OA 3TTCA 2LQJA 3ZT2A 4PXBA 3DXKA 1HNIA 2WCXA 2AQ4A 3T1YK 2AJFE 2ZH1A 1S6QA 1NSPA 2E8AA 2DGVA 1Y4ZB 3PYDA 5L1KA 1HW8A 3KNGA 1QHAA 3R1XA 4NLGA 3KK2B 2X1GA 1HI1A 3VTIA 4M7XA 3HBTA 3Q86A 3GV5B 4DZ6A 1DURA 3SUOA 1B0VA 2KXFA 3VGMA 1WDTA 3SEOA 4CQ1A 2QJ3A 1J9AA 2VQEF 1XNQF 4N56A 2IJNA 3DLEA 4K50A 4AE5A 3B4DA 3KUGA 1RLDA 2VQEK 1TL5A 1WDDA 3ISND 3BZKA 4HTLA 4B9NA 2H4WB 3PEJA 2R7SA 1EARA 1XIQA 1NAQA 2ATQA 3CJKB 4J9QA 2EG1A 4YQWA 1XERA 4OHXA 2Z1GA 4IQMA 2MQOA 4NXMF 1BUXA 1ZPWX 1UCNA 2UVWA 5G4DA 4Q5VA 2R7QA 1VK0A 1BISA 4JOUA 4K7QA 3BSCA 4D3HA 3W1YC 4Z4HA 3UNYA 2YWGA 4FM2A 3UD3P 1RCHA 2WW4A 1KVBA 1VYAA 4CEZA 1R89A 2EBEA 3EJMA 3TAQA 1Y9OA 4OYMA 5M1KA 1BI4B 3TJ9A 1RWWB 2MZQA 4F9OA 3I5CA 5L9XA 2XMJA 5A2QY 3RB0A 3M8PA 4QOZB 1REVA 4ZPBA 3LM2A 3UQSA 1F3VA 4DSJA 3QT5A 4WFBL 4NLQA 2MHNA 2VJUA 1Q81O 2FUG9 3HSDA 3HF5A 1VHXA 3TX0A 2ZEJA 3GG1A 3POTA 4B3MJ 3P83D 4ZVHA 3W65A 2C2NA 3VAJA 1D4XA 5HBMB 2MKSA 2J0QD 4WFNL 4ED8A 4LD0A 3GONA 2OHDA 3BBBA 2GVDB 2Q0UA 5F8NA 3BQ0A 1KWMA 3POTB 1T03A 2VA3A 1MROA 2UUCK 4FNIA 2E1MC 1DTQA 3TABA 1A0OB 4JI7K 1TV6B 4DV5F 5AJ3J 3TAMB 2R7OA 1RWVB 5IWAJ 1RGIA 4FWKA 2AYMA 5IS2A 4CI6A 2M88A 3TJ8A 4LMZA 4UZCA 4CHNA 4RUCA 2VQFF 3BN4A 2ZWOA 3FRZA 4B9LA 1U1MA 5D4NA 5ELZA 3WC0A 2Q1NA 1DQAA 5ETNA 2OI2A 2JWKA 3CJKA 4Q44A 2IRYA 4HHTA 3AB2B 1RBSA 4CIFA 5DM6L 3WIUA 3K0JA 4TU8A 4IO1A 4AT1B 4W5QA 3OYMA 3VQTA 1ZAVA 3THPA 1NB2A 4CTAA 1S10A 3ATUA 4E8UA 3NGYA 4Z4FA 2V4JA 4J2AA 4DU7A 2VDHA 2MKCA 4FK2A 2OZMA 4J2DA 2HHUA 3CCRS 4YY3J 5KG7A 4ILRA 3TR8A 3H90A 1KAYA 2I2YA 1UA0A 5E5NA 3D28A 3DAWA 1XC3A 1Q9YA 4C9DA 1NDCA 2HLUA 3M2VA 2KVIA 4G1IA 2D5RA 4I6WA 4WQ4C 1BE4A 1EX8A 5KFQA 1KVKA 3QERA 4KTZA 2G0IA 4XPEA 2NUHA 3G96A 2E6LA 4FJJA 3AVMA 2L9DA 3UDVA 4USUA 2LXUA 3A5OC 1ZZNA 3M5RA 3AD8C 4JLHA 4E7JA 3DXSX 1RP5A 4H5TA 1ZM2A 1U2RA 1LFWA 3A3PB 5C2CA 2FBYA 4ECRA 3T5HA 1LOUA 3SFGA 2RHQB 4WFAL 3OW2R 1VQ9N 5CQGA 1E4GT 4W5OA 2DHAA 2QEXS 4DTMA 4KH4A 4NLSA 3GCXP 4YY3F 1TTHB 2J76E 2BYCA 1CJKB 2AGOA 1Q0NA 3D67A 2JVRA 3MCPA 2BA9A 5DM7Q 2IA0A 4N47A 1T9XA 2CQHA 5GAGP 2W7OA 2ITMA 2NXUA 2IM0A 2E4LA 2BZ2A 1LAWA 4J9PA 3LP3A 1VMBA 1BQNA 5K5MA 2V6AA 1D0EA 1O0PA 1IN0A 3FZMA 4OX8A 3DRRB 1VC5A 1P8GA 1M5SA 2XI3A 4NYNA 4X66J 4KB0A 3VF4A 4M45A 3MM9A 3CCES 3CJTA 4KB1A 3BF3A 1NGCA 4CVNE 2EWHA 1IKXA 4YDUC 1PJ6A 5DZ6A 1VQ4S 3O9SA 1M5KC 5A8WB 3LZJA 4JD2A 1YWXA 3VPZA 4OX7A 5L39A 1YJNS 4KB7A 4CJQA 4PKIA 1SV5A 5JVHQ 3ET6A 4JI8J 2FHKA 2UUTA 4M5GA 4YY3K 3V9UA 4KKOB 5A2QO 1R7IA 2DBBA 1Q7LB 1VCTA 2HZVA 4WQ5A 2MLXA 4U7UK 4FM0A 1GMUA 2V8VA 3A5MC 2FF3B 1WELA 4GKKF 3HPGA 4Y34A 2O8BB 3QZ7A 4ZPWR 3HRGA 4C3KA 5F9NA 1H38A 3T69A 3D1QA 2ZC3A 1K8KB 1TMJA 2IDOA 5BRHA 2MY7A 1GOBA 3LUYA 1AFJA 1Q86T 4OKKA 4MKVA 4FJGA 1OSCA 1DGKN 1LWCB 3AVNA 4WQ5C 4TXSA 3TSPA 2JZ5A 4M95A 5DQHA 5F0WA 3EGWB 1CJKA 4IG0A 2E5GA 4DQ8A 4AF1A 4EO6A 1U45A 3MM6B 5E41A 2W9AA 4FYDA 4QIFA 5J2QA 1HR0F 5T7LB 4I9QA 2MKKA 3QSIA 4A61A 3NVMA 4OLBA 2HS4A 3B4MA 3TI0A 1ESVA 3KLIA 4RTFD 4UT4A 3QFPA 1C1AA 5LMNJ 5D3GB 4DFKA 2B4JA 3V6DA 2G2OA 2B43A 7FD1A 3MCOA 1TUUA 4Q8EA 3M8QB 4DKWA 4DL4A 4OI0A 2Z58B 3UO0A 2QMWA 3M30B 2ROPA 3GFYA 3J7YU 3SCLE 3JS9A 2D3OR 4NA3A 9RUBA 1HNWJ 5BYSA 5IOLA 1LWEB 1R6VA 2R8JA 2IIRA 1SC3B 4NLXA 3O6WA 4DV3J 3AH6A 1FTCA 1KHVA 2MY8A 3LP0B 4LVOP 4RWWA 2XMVA 3I6PA 1VQPS 4GMKA 4CBUA 3LP2B 4TSXA 3VERA 1S1TA 2DNZA 2DEJA 3PLAA 2BW2A 4K2JA 1FRLA 3VGTA 3I8BA 1IH7A 3WQTA 2OTJS 2RDDA 1OPZA 1FRXA 3AT1B 2HBJA 4PKGA 3ZSWA 3MI7X 2B9WA 3ATVA 5C0YA 1NGIA 3NWRA 3CJ0A 4JV1A 2IIHA 2EVZA 2YNGB 4QR0A 3FQKA 2OTJN 3KLGB 4XDDA 2C1EB 5HMYA 3HM9A 3C46A 1JCGA 1WI8A 2JC1A 3HTVA 3BF1A 3TP2A 2J9CA 4C8OA 3VCDA 1WHXA 1HYSB 4BGAA 2I38A 4TY8B 4PA1A 4J2BA 4NXNF 3QGHA 1NOZA 4EGLA 1WSVA 3ILLA 5FROA 2P51A 3G82B 3HHNB 3UB5A 5AQGA 4NCGB 1X4GA 1WNSA 1Z2LA 4JKBA 4YOYA 3OXLA 3SNNA 2QYGA 2G13A 1R0AA 2ZH6A 3OHRA 4PPZA 1VSKA 1IM6A 3DXMB 1VQLN 2BEFA 4CJUA 3VF0B 2PFDA 3AVFA 3U1LA 3PYGA 3H6EA 3I56N 5JS1A 3G0ZA 1NEEA 3H46O 4RU9A 1CQNA 2IJFA 1UVIA 2E88A 3KLFA 3MWTA 1MROB 2A1BA 2HF3A 4RUHA 3QAEA 4HTJA 3AA9A 1TUVA 3J81O 1YJWS 3OVBA 3NAEA 3BSOA 3WX8A 2AGPA 1AB8A 1CJTB 3KNAA 4FJKA 3ZTRA 1YHQN 4DV0J 3A0IX 2FZCB 2QA1A 1HKBA 3M3ZA 4IKFA 4RW7A 3D7SB 3SUPA 2BX6A 1VISA 3BR8A 2A2CA 3EDRB 2W9CA 4WF9Q 2BR0A 1N8RT 3ENVA 4X62F 3ENBA 3M6GA 1S6QB 2UUBK 1C4AA 2D74B 3KLHB 3N6NA 5AQNA 2DH9A 5EN1A 2P5VA 3GTYX 4A8KA 1Y7PA 5LMNK 2KVQE 4CLYA 4ECTA 3MCAB 1VC0A 2A5XA 2MZJA 1C0GA 3MECB 1RTDB 3TO8A 2P2CB 5F8HA 4CYUB 5HAOA 3D66A 5HVGA 4CYUA 4W4MA 2G1HA 1JJCB 4JRPA 1BIUA 3PKMA 1H7WA 2F9JA 3CCTA 3OYJA 3BGFA 2DCUB 4MT1A 1S1WA 4OGEA 3TJAA 2ZBPA 3KIOA 2FHJD 3H42A 1X4DA 4B9SA 2N7CA 3KJVA 4DF4A 3P1GA 2FVPA 3NNHA 1T94A 3H25A 2HF4A 4CIGA 2FHOB 4I7FB 3CMEN 5HJXA 3KKFA 1QE1B 4LSNA 4FK0A 2L9WA 2IAJB 2VJVA 3DOLB 1XQIA 3BPSP 5GMDA 2ZQBA 7AT1B 3AY0A 3SSRA 3VQCA 1WC1A 5K20B 4JHDB 1IKYA 4ILJA 1EETA 4MLEA 3ADAC 1YTUA 4OZ0A 1SJ4P 2CDRB 3TZWA 2CZ9A 3FFIA 1KOHA 4IEIA 2CNNB 2JEGA 5KRSA 5LXYA 3NGUA 1VSLA 3W61A 3VV2B 3BGRB 3KK3B 1AZSB 4DCJB 2VG6B 5FJ4A 1JX4A 1YJ7A 4F25A 1RT4B 4KHQA 4BC7A 1RDWX 1UFKA 5LJVA 4DF8A 4CNYA 3NFAA 1G2EA 5AQLA 4JI4K 2VONA 3VAHA 3WNFA 3MOZA 3AVHA 1FKOA 3L9ZA 2WSEC 4HYKA 3MMAB 2QMXA 3PY8A 4M5JA 2CQBA 4J8FA 3G9CA 1L3UA 4CLSA 3MN5A 1G6BA 1ZA1B 2VASA 2AW0A 2O8FA 4B3SF 1KVJA 3OR2B 2PGCA 4C48A 4C97A 4DU8A 1MMNA 1SKUB 1U24A 3JAMY 2K1RA 3ZC4A 2E5IA 3D0GE 5D0RA 4I56A 3E51A 4I9LA 3SV3A 2DGTA 1ACMB 3ZZZA 1W2BM 1DAXA 3CF5Q 5HO4A 4FPBA 5HANA 4O3PA 4MYTA 4RBTA 4DCPB 2AZ3A 1IO2A 1TKTB 4LF9J 4BRLA 1RZMA 4LF7F 2F4VF 2B3TB 1PYOB 4YN3B 5E3PA 1S1XB 3T9ZA 2R2SA 3AVIA 3SQGB 4FOIA 5AT1B 3QJLA 1S48A 3LO3A 3WNHA 3VTHA 3EZUA 1C0TA 4ICLB 3KYLA 1E3MA 2HHPA 1X9WA 1GQEA 4NLOA 3BGOP 1EQMA 4B3SK 4NCBA 2ASYA 3T5JA 3M2VB 4R8UA 2B7BB 1HUXA 2BUNA 2HHVA 4TYAA 1WG1A 3M4XA 4DEZA 2DTUA 1HNWF 1A5VA 1Q8IA 4PYDA 5F9LA 1YQHA 5L1JA 1XQSC 1CC8A 2ZWHA 3FZFA 1GAOA 1MW7A 3WXLA 3AVJA 4FNHA 4GNIA 2EK6A 2CJ9A 5I3UA 5K14B 4CF1A 4LQ9A 4AHSA 2BGGA 2VBWA 4X64K 2UUAK 3M1VA 4TU7A 4BRCA 4FYYB 2P9NA 1NZ8A 1WC6A 3GFHA 2AJ0A 3OLBA 1FJGJ 2Q79A 3C15B 3L3UA 4LRDA 2YVSA 2F8TA 2Y1IA 4JI3F 3W9JA 1CLQA 3ZT0A 1O51A 4XPCA 2HW3A 4KHYA 1RSCA 1WNEA 3MN7A 4ZVEA 2QA4G 2ERRA 4CZIA 5JMNA 4B1YB 2JRSA 1V3SA 3THWA 2ZH4A 4Q45A 3UCUP 4F3TA 1M1HA 4GVLA 2FSJA 3MX5A 1LNQA 1GOAA 1KBRA 3EKUA 2F8EX 1NK8A 4O4GB 5AQVA 2J6TA 2OZSA 4JV5F 2YX1A 2DNPA 1S1XA 5MAOA 3I56S 2FVQA 1RT2A 4H0TB 2Q36A 3M2UB 3DCAA 1FESA 2OGUA 1SC1B 3KG0A 3H7HB 1RBOB 1NZAA 2UUAJ 4GMJB 4W5TA 2NZ4A 4HI1A 4DV7F 2BH1A 2IRUA 2CIMA 3DLBA 3QATA 2B9YA 3BBCA 1XMOK 3CCMN 3MEKA 5KPTA 5JJBA 1LXJA 1XBWA 2X6SA 4WFBQ 4B02A 3QO9A 1MWZA 2UV8A 4BC9A 4GO7X 3K5OA 4B8AB 4CM0A 3SI6A 4E0DA 1WG4A 3QWPA 1RKIA 1S6OA 2L41A 5GAHU 1KTQA 3CD5A 1EO1A 4FLZA 4YOUA 4FDFA 4LR8A 3MEGA 1IR0A 2HEKA 1FX4A 1H74A 4P2SA 2JDJA 4QZVB 3MPVA 5KQ8A 3GE9A 1Q9XA 3E01A 4DMZA 1U0SA 1WORA 2NCKL 2FB0A 3NE6A 2DK2A 1YK9A 3IRXA 3MAQA 3BGRA 3KK3A 1S49A 4ECZA 3G6ES 3C7NA 5J2PA 3RBZA 3WXMB 2QT7A 3SBGA 2F8MA 4O55A 4B1ZA 1TL7A 1TUYA 3SCJE 4DCOB 2LQ8A 1PC5A 1VQYA 1QAXA 2DHXA 1YXQA 3W2VB 1WKKA 4EBDA 5CCMA 1VK3A 3LP1A 1DKGD 3AXMA 4NWBA 1UZDA 5C12A 4MKBA 2XMTA 4FJMA 1U2FA 2YQ3A 4DPOA 2XY8A 1Q95G 1D9DA 1HNXK 5HMWA 3GBTA 1QHTA 2GUIA 2DNOA 5LMNF 5J2MB 4IR1A 4EHUA 2BM1A 1YX2A 5EUHA 1S79A 2R7VA 2EW9A 2RE2A 3AVLA 3OL9A 1RU2A 1U0HB 1NU0A 1QQMA 1JLCA 4DUZK 4JI1J 4PL8A 1K0VA 2QWRA 3WQUA 3I0RA 2VCPA 4KV8A 1RCOB 3C8YA 1HBMA 1FDDA 1VQKS 2P9UA 3B6OA 4URGA 5JVGQ 4QS7A 1N5VA 2Z2YB 4H5NA 1P90A 4M1KA 4DS5A 5T7BA 3AO2A 3QSYB 3J8AA 3OYNA 4AFFA 4I6MA 2BUPA 2GS8A 2VPXB 5DM6Q 2CJQA 2H5JB 4H8KA 5A2QU 3KD1E 3TZYA 4I0WA 2LECA 2MMYA 5HMZA 4V19S 3THYA 4ZLPA 2HFNA 5KFJA 3ENHA 1XTZA 4V19J 3U8XA 2D3O1 2E2PA 2HMPA 4FXVA 4DUTA 5M2UA 3L4BC 1HPMA 2QC3A 2E2NA 3QWUA 3HCXA 2IVPA 4UQTA 4ALZA 1HNXF 1UEUA 4NLCA 4ZP9A 4H4MB 3B82A 3MAAB 3THYB 1MWKA 4LIRA 3TUZC 1XNQK 2VZ9A 1GLFO 3FR0A 2HBMA 2GX8A 2YKOA 3QMQA 1OJ4A 3C2PA 4W92B 3AJDA 4A8XA 1GLBG 2OPSB 2ASPA 1FXLA 5JICA 3L4QA 4FJIA 4CJ4A 4PL7A 2XGPA 3KUHA 3GQCA 4EWTA 3HKZD 3DRPA 4A8QA 3HZ6A 2AHOB 2RVJA 3TA2A 4K4TA 4GVBA 1RWUA 3RTVA 3HSCA 4KY3A 5HRNA 2O8CB 1UJ5A 1TL7B 4M3WA 5L9NA 4P2MA 2BVZA 4OYBA 1VSHA 3J7A1 4JKGA 1TK5A 2F96A 3NGKA 3GFZA 1FTRA 4Q7AA 3PW5A 3H1VX 1KLNA 1IBKK 1TL4A 3FEXB 3DXBA 1NBWA 2NXJA 4P7VA 1BG3A 2P9SB 3M32A 3BEXA 2DGWA 3G6YA 2P9NB 4ED4A 4KI4A 4NO7A 5LJWA 4OKJA 1ZBUA 2FLOA 2MLZA 4M63C 3ONQA 2ABYA 1OVYA 4A46A 3BREA 4BRKA 5C7PA 2EFOA 2H9ZA 3DLEB 2YJEA 3ETMA 2MQPA 1H2TZ 3EPIA 5KFXA 3A4TA 3BH6B 3NL0A 5FPMA 3IXQA 1RI7A 2ZHAA 1K73O 4K0KF 3U3GA 1G4CA 4MFBB 3G8TA 1RTHA 4ZLLA 4KC5A 1YBAA 2XMWA 2ZJPL 3PJXA 4LF8F 3RZAA 4A59A 2F1FA 1YT3A 2P9KB 1ITPA 4PG4A 4XK8C 3N4PA 1Z2ZA 4MYUA 2VWBA 1C2PA 2MKIA 1LAVA 5HP1B 3P4IA 2DO0A 5AXMA 4FW1A 5KFUA 2CADA 1VQ7N 5AE2A 2EG2A 1NWKA 1W9HA 2HB5A 3Q8RB 1U8SA 2BE9B 1Q7YT 3THWB 1LOTB 4RW6B 1S0MA 1BQXA 1SKRA 4MKAA 4X64F 4HH0A 5M2PA 3M7VA 1R8AA 3T41A 1RABB 2BE7D 1QZ6A 1UA1A 3GE1A 2AJ4A 4NPOA 4LFCF 3J7YP 4FJ7A 3BZCA 2O8FB 1G7CB 2PYJA 5DDRC 1I1GA 1FF2A 2NLWA 5I3QA 1WEYA 3T3FA 3KKSA 4QWBA 3OJSA 2GC8A 3N6LA 2ZUAA 2HVZA 4NOHA 4DR2K 3MMAA 3OYDA 2V7YA 3CWJA 2HK3A 3CCQN 4Z4GA 8ATCB 3BN7A 4EK2A 1RAAB 4IOAQ 3ZNUA 4Z94A 1YTYA 2YNIA 1QVFR 5G0RA 5M1PA 4YS2A 1S97A 2QYCA 1FKAF 3FZKA 3CVKA 3CCVN 3AQPA 2CH5A 3HYFA 1Q8LA 1Y00A 4F0HA 4OZ1A 2PBDA 1Q81T 2HWIA