4IFYA

Hiv-1 reverse transcriptase with bound fragment at the knuckles site
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
total genus 165
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ifyA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ifyA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ifyA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ifyA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ifyA05
4Z4IA 1S48A 2Z1IA 1NK6A 1SKRA 5L9XA 2EC0A 4NCGA 4ECSA 3SPYA 3DLRA 3ZSXA 4CJTA 3NF7A 1S1VA 2J6SA 4ZP8A 5KFZA 5FDLB 5F9NA 4Z4GA 1JLGA 4EP4A 2AGOA 1CZBA 2YKMB 4DL7A 1HMVA 4GC6A 3VQQA 3HVTB 1XR6A 4BWJA 3OYNA 5K14A 3T1AA 4URSA 1BISA 4URGA 2W8LA 3KK1B 3OYMA 1BI4A 1SUQB 1HYVA 3DOKA 1U4BA 1IKXB 3KLVA 1IKVB 4NCBA 2AGQA 3MR5A 3PR4A 2JEIA 4KHUA 1BHLA 5HROB 4AHVA 2GV9A 4W5OA 4RW4B 1EXQA 1RILA 4CESA 3NDKA 1EETB 1WSIA 3IAYA 1RTJB 2IOCA 3DMJB 3AVMA 1TP7A 3EPIA 1HPZA 4URQU 2G8HA 3OLAA 4BE1A 1KVCA 4G3IA 3RBDA 4DMNA 4NRTA 2W8KA 2WOMB 4TYBA 3SJJA 3MEDB 4IFVA 4ZPCA 4DTUA 3M8RA 4NLXA 4K8XA 1J9AA 4L8RB 4E3SA 5HLFB 5EWEA 3NGDA 2KW4A 1JXBA 5EUHA 4BE2A 4ICLB 4FLUA 1GX6A 1CZ9A 4H4MB 3NCIA 1S97A 3O4QA 1BQNB 3NGZA 1RT4A 5KFOA 1C1BB 1WNEA 3TR8A 5J2NB 2X78A 4FJ9A 3IGVA 2XI3A 4O3QA 3G86A 2BRLA 5KFWA 4EYHB 5KFNA 2WTFA 1JLBA 2RN2A 3VQCA 3PX4A 4W5TA 1KVAA 4CEZA 2KTQA 3LP0A 5F8IA 4O3OA 1VSLA 4E1NA 2DPJA 2HWIA 4IG3A 3OL6A 5L1KA 1HJRA 3KLHA 1HMVB 4CIEA 5JS1A 2XCPA 1RA6A 3CFPA 1JLAA 2BR0A 1KVBA 1ASWA 2ALZA 5KI6A 3ZT3A 3OYLA 5I3UA 1VSJA 3NGIA 4ZVFA 1C0MA 4B9VA 2JEJA 4F8RA 1U49A 4O4GA 1S6QA 1QHTA 3EZUA 3NE6A 3IS9B 2XY5A 4BDPA 3VQ6A 3ASMA 3L3UA 2VG5B 1QSLA 2BANA 1DLOA 2HW3A 5KT6A 1GOAA 3CWJA 1A5WA 3QIDA 1RDDA 3PX0A 5KFXA 3OYHA 4J9NA 2XY6A 4FJ5A 3I0SA 4CHOA 3L2UA 3U3YA 1TK8A 5J2MB 3MFHA 3U3GA 1UWBB 1RTIA 4CIFA 2WB4A 3PJXA 3FQKA 5D3GA 2JEFA 4EYIB 4PA1A 4OL8A 3NAHA 3VQAA 4DL5A 2QKBA 4QW8A 4E89A 1B92A 2QE5A 2DPIA 4CE9A 3PV8A 3JYTA 1HQUA 4CEOA 4JV2A 4NLYA 1SH0A 4FJJA 3DDKA 2GUIA 4JV0A 4RUAA 5L1LA 3AVGA 5T14A 2WONB 3QEIA 2DY4A 5DG8A 2BQRA 2YV0X 2W9CB 4B8AB 4TQSA 3B6PA 1RYRA 3FFIB 4ICLA 2C2RA 4GC7A 2HNYB 4KKOA 4B9TA 1S0NA 2E9RX 3IS9A 3OHBA 4DTPA 4HCCA 4AHTA 4Q44A 2VWJA 3EYZA 4CJ3A 4DL4A 2ATQA 3V6DA 3QYYA 4O0IA 3NH1A 2HHVA 3D5MA 4NLTA 1J5OB 1JIHA 1JL1A 3CJ0A 3MEEB 4CK2A 4FJ7A 3OL8A 1JLEB 1BGXT 5DG9A 3H08A 2V0NA 4GW6A 4M3YA 4DFPA 4DS4A 1BCMA 2UUTA 1N6QB 3HJFA 2C2EA 4J9MA 1UA0A 2FLLA 4KV8A 4K8ZA 2FVPA 1FKPA 2AWZA 2IGIA 1C1BA 4YNQA 4Z4EA 3QLHB 3RR7A 4CK1A 1KRPA 4DG1A 2IC3A 1K6YA 4ZTJA 1U47A 2D0CA 5T7BA 5L1IA 1NOZA 1MMLA 1HYZA 3BGRA 4WZQA 5J1EB 4M3ZA 2RF2B 4IG0B 1LWCA 2OPRA 4B3OA 3V9XA 2FJXA 4AHSA 5KG5A 1HNIA 3DLKB 3JSMB 4K4YA 3FQLA 4IQXA 3C6TA 4DTSA 4CEFA 2XO7A 5KRTA 3AVLA 5C5JA 1N56A 5DLFA 3S3MA 2IM0A 4DQQA 3PUFA 3NH2A 3I5CA 2W9BA 3PW4A 4E7HA 3NAIA 2ITGA 4CIGA 2XC9A 1TV6A 4ED6A 4FJMA 3FDSA 4R0EA 4AH9A 3BR9A 4FM1A 2G8FA 3AVFA 4CEQA 1WSEA 4K4UA 2X74A 3KK2B 3KTQA 4Q8FA 1S1VB 3MAQA 2IAJB 2VG5A 1DLOB 1XHXA 2KZZA 4PUOA 2Z1GA 1UOCA 3SZ2A 2G8WA 4Y1CA 3AVKA 3KKSA 2B6AB 2IBKA 3OL7A 5DLGA 4IH5A 1JL2A 4DU3A 5CZ2A 3BQ2A 3SQ1A 2CKWA 1MU2A 4O4RA 3DOKB 1C0TA 1ZTTA 1T94A 4RNFA 1S49A 2RKIA 3Q8SB 1C2PA 4J9RA 4JRQA 3NBPA 2I5JB 3LPTA 4IH6A 4AHUA 4CGHA 1TK0A 1SL0A 1JLFA 4KB1A 4QOZB 3DMJA 3P5JA 1VSIA 4DL6A 3O4NA 4CEEA 3OYJA 2P1JA 1NK7A 4FM0A 2LSNA 4MIBA 1T03B 4DU1A 1S1TA 1RT3B 3U6FA 1JXEA 2R2RA 3KLEA 1HYSB 2JGUA 1LWCB 1WSGA 1D5AA 2OPRB 3OVNA 1KFDA 4H54A 3QEVA 3HHKA 2F96A 4KHYA 4F4XA 2ASLA 3AA3A 2G8KA 4Q8EA 4Z0UA 4DTOA 1NKEA 1WSHA 1VSFA 3AV9A 3B6OA 3T5JA 4OGEA 1OS5A 2Y1JA 3AVCA 4IKAA 2XHBA 3DRSA 2B5JB 3MR3A 3O3GA 2P5OA 4CHZA 4Q5VA 1JLBB 3DM2A 4DFMA 5KFQA 3LP0B 4H4OA 1KSPA 3OSPA 1TAQA 2I1RA 2AU0A 1IKWB 1TKXB 2GBZA 5KFRA 4CERA 3GV5B 3GIJA 2HHWA 5HRSA 2HB5A 3DLGA 4IDKB 4M94A 5KT3A 3QO9B 3CJ4A 2V4RA 5J2PB 3LP3A 1JLQB 3DRRB 4NLUA 4R5PA 3NH0A 4NLDA 4ZMMA 4CJ4A 4M95A 4LSNB 3PVXA 1HYSA 3LAMA 4M45A 3QGHA 1VSKA 3D0PA 4OLBA 2F8TA 1BQMA 1LWEA 3C95A 3AVIA 3TABA 4KHWA 5KFJA 4CK3A 3TI0A 4K4XA 1VRTB 3SI6A 2BRKA 3GYNA 3AA5X 3HP6A 1VSDA 4JV1A 3KLIA 1D0EA 3TAEA 3SNNA 4CJPA 3HSTB 3NBPB 4CF8A 3ISNC 1C0UA 3RAXA 3ITHB 4F4YA 2KFNA 2XGPA 3LWLA 3K5LA 4FLXA 4DSJA 2HHXA 2E6MA 5KTQA 5EU7A 3SFUA 3H5XA 5F8LA 4O3PA 4FJLA 4QWEA 3JSMA 4JS5A 4Q43A 2C22A 4ECRA 1S9EB 4Q0BA 1S0OA 4CF2A 3E51A 3BSCA 4NZ0A 4ID5A 1ITGA 3DLGB 1RDCA 2ETJA 3VQSA 4KHMA 3DYAA 4PY5A 5J2QA 1C1AA 1S5JA 3RR8A 2F8SA 4DEZA 1L3UA 2FBXA 3VA3A 3TAMA 3KOAA 1JLGB 5HRPA 4DTMA 1EX4A 3EY1A 3SUPA 1K1SA 4IBNA 1L3TA 1W9HA 1RAJA 3CFRA 4YMEA 4FW1A 1XR5A 2B4JA 1B9DA 4WFZA 3MECB 2IJFA 3UDLA 2D7SA 4K4ZA 4FZXC 3OJUA 4ED2A 4DWIA 4ELTA 4CJRA 3V9WA 1J5OA 3MXMA 2R7YA 3S3OA 1SKWA 2QK9A 3VQDA 5J2PA 5CYQB 1JLQA 3RAQA 2HHSA 4J9LA 1NNDA 3IG1B 3IGNA 4XPEA 3V4IB 2G8UA 1HNVB 2IDOA 1LAVA 1HQEA 1ZTWA 2PYLA 4IDKA 2RDJA 4CHNA 2HHQA 3QIOA 1TKZB 4FXDA 2YKNB 1FKOA 3CJ3A 5KRSA 1HPZB 4ZP7A 4CFDA 4MH8A 4FLVA 2XY7A 1BI4B 4DTJA 2YNGB 4FJKA 4B08A 5I3UB 4KHSA 3KLFA 3DI6B 4E7JA 2Z1JA 4GVMA 3MXIA 3ZSZA 1UA1A 3LP1A 4QPXA 2WHOA 1U45A 4FZZA 1QAJA 3Q8PB 1TVRA 1CXUA 2ZD1B 4OGCA 3VQ8A 4FS2A 2OZMA 3VQ7A 2FLPA 3KHGA 1RTJA 4KI4A 1NOYA 2BANB 1IKYB 1X9SA 4JS4A 3OYAA 3QEWA 3KD1E 2UUWA 3TWHA 4RUCA 3V81B 3WNFA 4O0JA 3F73A 3ZT2A 3BQ0A 1VSEA 3AO4A 5SWMA 2VG7B 4MKBA 4DSKA 1REVB 5CYQA 3CO9A 4FJNA 4ECXA 3HXMA 4Y3CA 1GOCA 1SUQA 4B9LA 4E19A 3M8QB 3M9OB 4TY8A 4CJWA 5KT7A 4XO0A 4K4WA 2AX0A 2Q3SA 3VQ4A 5KG0A 4DL3A 3K5OA 3DRPA 4WE1B 2ZKUA 1Z25A 1RYSA 2OA8A 1ZBIA 1S9GA 3AVBA 1HQUB 4ED3A 1Z26A 4ECZA 3HKWA 3HPHA 1EETA 4OLAA 3G6YA 2QXFA 3SI8A 1ZBFA 4KTQA 4W5RA 4M3XA 3T5KA 1S0MA 2HAIA 3F9KA 4CEAA 4DF8A 4MKAA 5L1JA 4WYWA 1UWBA 2JC0A 1R0AA 5DQGA 4O3SA 3V6HA 3L2WA 1RT5B 1RBTA 4KTZA 4B9UA 2D41A 2D3UA 2AJQA 2HNYA 4KKOB 4CGJA 5C24B 1U09A 1IKVA 5FRMA 2JLEA 5HP1A 2AGPA 4I2QB 3TANA 4QAGA 4I7FB 4HUGA 3TAPA 3PW7A 1TAUA 4CF0A 3N6LA 2BGGA 4BDZA 4CFAA 5C42B 4GMJB 4CJUA 4DSIA 4FK2A 3H98A 4RW6B 1HQEB 5E41A 2HNZB 3QEXA 4TN2A 4H4OB 1TL1B 3AVAA 4ELVA 3LZIA 4IH7A 3OYFA 4LQ9A 2PYJA 3RMBA 2R2SA 2B43A 1GX5A 3DRPB 4WXOA 4Y2AA 4OPKA 1WLJA 3KLFB 2R8JA 4IG3B 2GC8A 1S9GB 1T3NA 5J2MA 4ECTA 2IM2A 4WYLA 4RG8A 3OYCA 1KFSA 4YFUA 3H4DA 3WNGA 3DYAB 3C6UB 2FBVA 2QV6A 2RF2A 3E01B 3MR2A 4FM2A 4ZPBA 4TQRA 1RTDA 3TAFA 4HYKA 3ZSVA 3NKYA 3AA2A 2HNDB 4AILC 5C24A 1TK5A 2BDPA 1TKDA 2FVCA 2YHAA 4I9LA 3K57A 3A2FA 2D5RA 2PZSA 1BQNA 3CJ5A 3KLGB 4PWDB 4CJLA 3PW5A 2J6TA 3OYIA 4BDYA 2IC3B 4MFBB 1RT7B 4R8UB 2FJWA 3ITHA 3MEDA 2X6NA 4G1QA 3ZSOA 2AX1A 3CFOA 4Z4CA 2UVUA 1CXQA 4RZRA 1D8YA 4B3OB 3VQ5A 3NAEA 3P83D 2V9WA 4DSFA 3MF5A 3IRXA 3OL9A 4EP5A 3SUQA 4KAZA 4DQIA 5D3GB 1CLQA 4ZVGA 4O3NA 4Z4FA 1EP4A 1T05A 3OLBA 1NK9A 1EKEA 2ASDA 4HUEA 2E4LA 3S9HA 1JKHB 1ZBHA 3M8PA 1NK4A 5HP1B 4DSEA 4FYDA 1FKOB 4CHPA 4B9NA 3NGYA 5JS2A 3HVAA 4CJFA 3RB6A 2YNFB 4XPCA 5KFFA 1S6QB 3CDEA 4IR9A 4K4TA 4E0DA 4RW9B 1KLNA 5KFDA 2PY5A 5JUMA 4KPYA 2W9CA 4ELUA 4K4VA 1LW2A 2J6UA 1NJWA 4ZHRB 3KHHA 1TL3B 3EZ5A 5CYMB 5EDWA 3L8BA 1F21A 1KLMB 4JUZA 5KFVA 2ZQBA 1Q9YA 4RU9A 1QUVA 1RT1B 3KKRA 3SUNA 4ECWA 3QGIA 1XC9A 1S1XA 2RKIB 4B8CA 5C25A 1IH7A 1LAWA 1NJYA 1QE1A 3KK3B 4KB7A 5KFKA 3PW2A 1S9FA 2R8GA 3RB0A 3GIKA 3V6KA 1SH2A 4J2DA 3HVRA 2OPPB 5KFEA 2FBYA 5DQHA 3SQ4A 1G15A 4KSEB 2W7OA 1Y97A 2Y1IA 1Z4UA 3V4IA 2HVIA 3ZSWA 2DFEA 2KFZA 1WN7A 3DLEA 2HNDA 4FCYA 5HBMB 4ED1A 3CG7A 1DTQA 2O5DA 3LZJA 4ECUA 1UAXA 1YVFA 4IRDA 1S6PB 4ECQA 4MFBA 1XHZA 3NF8A 2ILZA 3V1QA 2P5GA 1K1QA 3NL0A 1RCHA 4KB0A 4KFBA 4ED8A 1IM4A 4KTWA 3SUOA 3OS0A 1LV5A 2HMIB 3LP1B 2WOMA 2GIQA 4B9SA 3GV7B 2VA2A 4O3RA 2FLNA 3NF6A 4TXSA 3ZCMA 1LWFB 3FFIA 2NUBA 4DTXA 4ED7A 1IKXA 4NLSA 2ILYA 4KE5A 4QWAA 3KHLA 4DQPA 1RA7A 1SV5B 5HLFA 4IRKA 4FK4A 1T7PA 4U7CA 3MR6A 1LWEB 3C94A 4DU4A 3HVWA 3HK2A 2EX3A 4H4MA 4OKEA 2E9ZA 1RT3A 3VQBA 4KHRA 5J1EA 5DGAA 1RT4B 2E9TA 1U04A 2BQ3A 2GIRA 4ECYA 1XR7A 1N48A 4NRUA 1EP4B 3KJVA 1W0HA 3L2QA 3BREA 4M41A 4WE1A 4Y34A 2DFFA 5KT4A 2W9BB 4BE0A 1BQMB 2UVRA 4DLGA 4CFCA 1LW0B 2YNIB 3ICLA 3IN5A 3V9UA 1KCFA 3BGRB 2OPPA 4NLOA 3QERA 3KLGA 4PWDA 2HNZA 3V1RA 3KK2A 3SQ2A 1HARA 1R0AB 3L2VA 1C0UB 4AHCA 4ZTFA 3RBEA 1J53A 3GILA 3KLEB 3K5MA 3P1GA 4FBTA 2XRIA 4PUOB 3THVA 4IKFA 2W42A 1RTDB 5JXSA 5FDLA 4BWMA 5DG7A 1SH3A 1NJZA 3AVJA 5KFTA 3O3FA 3LANA 4J9SA 1YTUA 3PZPA 4QWDA 3T5HA 1C6VA 3DLEB 1BL3A 4CJQA 1NK5A 4OKKA 1SKSA 4WFYA 1B9FA 3DOLA 4C8KA 1QE1B 3KK3A 3UPFA 2I5JA 3SQ0A 1ZETA 3RB3A 1NK0A 3AA4A 1N4LA 1D1UA 4O44A 3QNOA 1S6PA 1IO2A 4KO0A 5KFMA 3H5YA 4MK9A 4E7LA 2FVRA 4IRCA 2YKNA 3RRHA 2ASJA 4NYNA 2FVSA 4N56A 2EHGA 3VN5A 4HUFA 5KFHA 4CCHA 4RNMA 2XY8A 4N41A 2YNGA 3M8SA 4DTRA 2QKKA 1Q9XA 5KG1A 4CEDA 3BQ1A 1A5XA 1TKTA 2R8HA 2D3ZA 1S1WB 4F3OA 2P51A 4CJSA 4DSLA 5EWFA 3EPGA 5KFLA 4ZPDA 5KG6A 4RNOA 5CY4A 3ZT1A 3ZSYA 2W7PA 1TVRB 1RBVA 1JLFB 3KJVB 5F8MA 1L3SA 1A5VA 4F4ZA 1IKWA 1TKXA 3K5NA 3V9ZA 3I0SB 1NHUA 3WNHA 1LW2B 4FK0A 1RTHB 2HWHA 1Q8IA 4K4SA 5KG4A 3JYTB 1RTIB 5SZTA 3DRSB 2R8KA 1RT7A 4CFBA 3FRZA 1RDRA 4EEYA 3NMAA 4K50A 1O1WA 3HPGA 2OPQB 2VG7A 2O4IA 5KG7A 3CJ2A 2R2UA 5J2NA 4FJHA 1I6JA 3NFAA 4F2RA 3KMSA 3G6VA 4LSNA 2HHUA 3RRGA 5KFSA 4TY8B 3OY9A 3T5LA 4ZHRA 3RWUA 3LALA 1JKHA 5HRRA 4FVMA 4Y2CA 3ALYA 4E1MA 1N5YB 3UR0A 4LY7A 3VQPA 4WXWA 3DRRA 4EO6A 3NHGA 4FLWA 3QZ8A 2FC0A 4FJ8A 2V4QA 2AQ4A 3OYGA 4IFVB 3V1OA 4LQ3A 2WK4A 2ZD1A 3ZT0A 4CJEA 3HM9A 3RMAA 1YTAA 1ZYQA 4FZYA 5KFIA 4HTUA 4ZPAA 4ED0A 4WZMA 3HPOA 4F3TA 3ZT4A 3V6DB 4O44B 1LW0A 5HBMA 1S10A 3ZSRA 4M3TA 4M3RA 4TYAA 4CECA 5KFBA 3PW0A 2CJQA 2W9AA 3PHEA 4LSLA 4ID1A 4YP3A 3MFIA 1DTTB 3RMDA 1WAFA 4CJKA 4QCLA 2JC1A 2G8IA 4O55A 4DFJA 3AO2A 1TGOA 4CHQA 4KRFA 2HHTA 1NKBA 5KFAA 5F8JA 3AVNA 3QIPB 4KV8B 4XIUA 3K58A 3TAMB 1X9MA 2IAJA 1HNIB 4W5QA 1IKYA 2UVWA 3VQEA 4OJRA 3PO5A 3BSOA 4HVJA 5DK5A 4W5NA 3G10A 2X6SA 4CGIA 3CIZA 5CZ1A 1JLEA 5EWGA 4NYZA 1RTHA 3H2LA 4KBIA 2OZSA 4FJIA 4QW9A 1RT6B 4OVLA 3V6JA 4PQUB 3C6TB 3DI6A 2VA3A 3QINA 3RMCA 3MXJA 4I9QA 4MIAA 3AO1A 2BQUA 2WRMA 1QQCA 3V9SA 3HO1A 3KNAA 3HP9A 3RTVA 4M3UA 1L5UA 1DTQB 3L3VA 4LD0A 2A1SA 3VA0A 4DG1B 4NLWA 4KI6A 5C42A 3AVHA 4J2BA 5DGBA 3BJYA 4NYFA 4N5SA 4RW6A 4EBDA 3S3NA 1TKTB 2B6AA 1DTTA 4FLTA 2HMIA 2VG6A 1TL1A 4YQWA 1SL2A 4HCBA 2OYQA 1S1TB 1J54A 3NF9A 1HNVA 3SCXA 3E01A 4NLRA 4JLHA 3CM5A 3ULDA 2KZMA 4EBCA 4C8OA 5KGWA 3FSIA 3CDUA 3I0RA 2YNHA 4I7FA 3VQ9A 3LPUA 4RW8B 1N6QA 2XWYA 4O5BA 2YNIA 3Q8QB 1WSFA 3DLBA 4FS1A 3QETA 2RPIA 4J9OA 3MEGA 4RNHA 1NHVA 4TY9A 4ECVA 1ZBLA 2BE2B 4DL2A 3T3FA 3HYFA 4F4KA 4WFXA 3BDPA 3CDWA 3MEEA 1RBUA 4FW2A 4NCAA 3DOLB 4M3WA 3AO5A 1NK8A 3K2PA 4RW9A 2XI2A 4Y1DA 4OKJA 3LDSA 1RT5A 1JLCA 4HKQA 5KGXA 4UQGA 4C8NA 1FXXA 3GV8B 4MK8A 1BIUA 4CF9A 2OH2A 3V81A 1I39A 1RNHA 3CYMA 4ZP9A 1T03A 3CVKA 1MU2B 2FBTA 4DQRA 3CQ8A 4I2QA 3QESA 3C6UA 4J2EA 3QLHA 2KQ2A 1KHVA 2WONA 1TV6B 2B5JA 2YHBA 3DLHA 4MK7A 3O3HA 3TAQA 4EZ9A 3N6MA 3QGGA 1RT6A 2D0AA 1T05B 4KO0B 5KT2A 3ISND 3PY8A 3L2RA 1VRUA 4I2PB 4N76A 3UIQA 5KFYA 4MQ3A 2YNHB 3HT3A 4CHYA 4RW7A 2IM1A 1RDBA 1TQLA 4DFKA 2DFHA 1ZBUA 4J9QA 4E7KA 5HRNA 1NKCA 3WNEA 4G1QB 4FLZA 4IG0A 4PQUA 4NLVA 1X1PA 1D9DA 3BSNA 5FROA 4QWBA 1BCOA 5DQIA 1S1WA 2ZE2A 2VWKA 4M42A 4IFYB 1C1CB 1W25A 1QS4A 1X9WA 3BSAA 4X2BA 3LAKA 3QZ7A 3M8QA 4YR0A 4KHNA 4EO8A 1S1XB 3MTKA 4RW4A 4YR3A 3KD5E 3UQSA 2R2TA 2JEGA 2C28A 1QAIA 4ZP6A 1FKPB 4IR1A 3GIMA 1JLCB 4RNNA 3I5AA 2C2DA 3PX6A 4DF4A 4TSXA 4TLRA 2VG6B 1GOBA 3QEPA 3H59A 1JLAB 3OYEA 3CM6A 4LSLB 2OPQA 4KFBB 3DM2B 5C25B 3TARA 3SPZA 5FRNA 3KLIB 1S4FA 4EZ6A 2FVQA 5KT5A 3OSNA 4NLPA 4J9PA 1RBSA 1HRHA 3T19A 4R8UA 3PJWA 3DLKA 5DMRA 1KHWA 3AO3A 3M9NB 3SYZA 3KIOA 1T8EA 5F9LA 2UVVA 4B9MA 3N6NA 4H8KA 4CJVA 1SV5A 2XGQA 4C8LA 4FJXA 1N5YA 3I8DA 1S9EA 4Q0BB 1RT2A 4Q45A 1I3AA 4R5PB 3OS2A 4J2AA 1WAJA 3M8PB 2IM3A 5K14B 3LP2B 1CSJA 3QNNA 3OYKA 1S1UB 4LH5A 1YVUA 2YNFA 1FK9B 4IFYA 2RDIA 4U6PA 3OYBA 3G6XA 3QIPA 4HHTA 2R8IA 3D45A 1VRTA 5I42A 4CEBA 3MEGB 1WSJA 1XI1A 4CGGA 2OPSA 4RW7B 1L3VA 1NJXA 3I5BA 3H5UA 2YKMA 1JXLA 3TQ1A 4J9KA 3H40A 1TL3A 4CJ5A 1D9FA 1ASUA 4CGDA 5CYMA 1VSHA 5F8NA 1KLMA 1C0TB 4KREA 1VK0A 4E7IA 4NCGB 5F8GA 4LH4A 4DQSA 3KHRA 4CF1A 3OJSA 3SV3A 1RDAA 4KHQA 4FLYA 4BACA 3TVKA 2XCAA 1SL1A 1BIZA 4Z4HA 1QSYA 3HVTA 1TKZA 1WNSA 4FJGA 2IJNA 2Z1HA 3M9MB 5J2QB 2DTUA 3LWMA 1VSMA 4DTNA 3OYDA 1YT3A 2ZE2B 3KK1A 4F2SA 3IG1A 3GQCA 1KTQA 1LWFA 2A1RA 3LP2A 2IA6A 3GIIA 2E6LA 2ATLA 4ZVHA 4ZVEA 4DS5A 3ZSQA 3D28A 1VRUB 4I2PA 3IRXB 4KAIA 4CGFA 3HL8A 1QTMA 2D0BA 3G0ZA 5HROA 4AHRA 1QSSA 2O4GA 3PR5B 5KG2A 4JRPA 5F8HA 5I42B 3I0RB 3RB4A 3H4BA 2OPSB 3K59A 4RW8A 4N47A 1RT1A 4OPJA 4QWCA 2G8VA 4F50A 1U48A 5KG3A 3Q8RB 1C1CA 3H5SA 3SFGA 2F8EX 4NLGA 3OS1A 4C8MA 1S1UA 1ASVA 1FK9A 4YR2A 3PO4A 2HVHA 4O4GB 2WCXA 1IG9A 4F4WA 2IMWP 5KFPA 1RT2B 4DLEA 4FBUA 2FJVA 5KFCA 4NLQA 4EBEA 3QO9A 1XWLA 5KFGA 5KFUA 3TAGA 1JX4A 4IOBA 1RBRA 1REVA 3MECA 3KLHB 2BE2A 2IS3A 3OHAA 4ID5B 3SV4A 3KMQA
chains in the Genus database with same CATH superfamily
1BWFO 1HBNB 4PXEA 4DUTA 3M7VA 2Z1IA 2QEXS 4RKUC 2G0IA 1PO6A 4ECSA 2XNQA 2UUAJ 3ZSXA 4HVZA 3KFWX 3D0HE 3LGMA 2J6SA 5EX5A 1CC8A 2KG1A 2V4JA 1JLGA 1XIQA 2CQ4A 4Z4GA 4EP4A 2AGOA 2CAJA 1CZBA 5JJBA 1T3VA 2Z2ZA 1U25A 3VEWA 2W2NP 3T1AA 1BISA 2CNKB 2BH1A 3OYMA 2OUGA 1SUQB 1IJFB 5KOWA 1RI7A 2E1CA 2AGQA 3PR4A 2JEIA 4FWKA 2W40A 3MCOA 2DH9A 4OX6A 3MCPA 1BHLA 3UKRA 3A8EA 4RW4B 3NDKA 1SAZA 3SQOP 1EETB 3GMGA 2ZJPQ 4DV6J 1X4HA 3NCQA 5CQGA 3MCNA 3EPIA 5M1OA 4CZJA 4P74A 4NRTA 4MMOA 2WOMB 1EQMA 2W8KA 1KS2A 5AE1A 4IFVA 4BS2A 2MQPA 4JKBA 1HX1A 2VASA 3G2XA 3IM8A 4E3SA 5HLFB 1U6ZA 4D3HA 5EUHA 3OXLA 4TKTA 2O67A 3THWB 3O4QA 3PEJA 5KFOA 3ATVA 1ATRA 2YVSA 4CI6A 4BY9C 4WKYA 2XI3A 3G86A 5KFNA 1VS3A 5AQPA 2RN2A 3PX4A 3MOJB 3UO0A 2PT0A 1GMWD 1G6BA 2CZ9A 2DPJA 4IG3A 2MZJA 3KLHA 2QFIA 2ZKTA 1HMVB 3CFPA 1KVBA 2BR0A 5B09A 2O8DB 3NGUA 3T9ZA 3OYLA 4KR0B 4ZVFA 1C0MA 2XYPB 1NB7A 2JEJA 1RAGB 5IT9O 3CDAA 1VBYA 1T9XA 2OAUA 1S6QA 3C16A 1UP1A 2OTJS 3IWNC 2WAQD 2VG5B 4P9SA 1PSDA 3B8AX 1DLOA 2XWXA 2HW3A 5BR8K 2D3O1 4PKDB 5IXUA 2ATCB 3QIDA 2HSEB 1VQ5N 4YOEA 4CZCA 4IWVA 1VQKS 1J2VA 3U3YA 4JI1J 1HNZJ 3MFHA 3W64A 4RWXA 2XNRA 4BC4A 1BG3A 4PA1A 3S8SA 3VQAA 4DCHA 3MN6A 2BV3A 2KT5A 2XZTB 4P6QA 4JI3J 2OMLA 1FRKA 4DR6J 2RJZA 4X62J 1U26A 2QE5A 2EXUA 4JV2A 4FJJA 1UZDA 1G1XA 1QDUB 1VAZA 4XTTA 4RUAA 3AVGA 3THXB 3R7NB 2BQRA 2YV0X 4B8AB 1PKUA 4PWUA 1U8WA 3NS7B 2RRBA 4KKOA 2LYVA 3CCMS 3PXGa 2MXYA 1N33K 4Q44A 1SJ3P 3E9OA 1S4EA 1OMSA 1F9EB 4M63C 2ATQA 3EE8A 4O0IA 4P72A 1HBOB 2D4WA 1BWVA 2HF4A 3NCRA 1K0VA 4DS4A 3MCMA 2UUTA 1N6QB 3HJFA 5M1NA 3BF1A 4IZ9A 3TEHB 2IGIA 4YNQA 1TUGB 2QI2A 2VIHA 5CCMA 1Q18A 1GAOA 4CK1A 4QU6A 2GJFA 4B1WB 2WFBA 2HURA 4DR6K 2OD6A 1NOZA 1MMLA 4B3RF 4C97A 3OFEA 2BOPA 1LWCA 3WEEA 1UFWA 2OPRA 1UKUA 2CQGA 3I55S 4AHSA 5KG5A 1RBLA 2Q79A 3JSMB 4LRAA 3FQLA 2KN4A 2QWMA 5KRTA 4CZLA 5C5JA 1N56A 5B0BA 4DQQA 2NZ4A 3KXDA 2BTFA 2ZJRL 2F4VK 2DHHA 5GAEI 3BR9A 2RVJA 2KVQE 1F2GA 1FERA 2W6KA 5KPRA 4K4UA 2X74A 3KTQA 3MAQA 1S1VB 2ACMA 1ZS6A 1VK8A 2KZZA 2OMOA 1LFPA 2Z1GA 3QDKA 2G8WA 3IFRA 4CH0S 2GV1A 1B64A 2A2DA 3KKSA 3TJ8A 3A8IA 2J4RA 2IBKA 3OL7A 5DLGA 4IH5A 5LSRA 3HT0A 1JL2A 3A0IX 2MJUA 2CKWA 1YJ9N 1R8BA 3DOKB 1IR2A 3KJQB 1S49A 3M05A 4BG8A 3TRGA 2P5VA 4HHUA 2UV8G 2CPIA 1E4FT 3LPTA 4KGKA 2YTCA 4AHUA 3IM9A 9ATCB 2IYGA 4USVA 2ZFHA 2B7CB 3DMJA 1VSIA 3CD6S 3O4NA 4DR1J 1FTCA 2HS3A 2VJUA 4R79A 1OH5A 1NMDA 1T03B 2HHPA 1JJHA 1RT3B 4FF3A 2V8GA 3HZEA 4W90B 3OVNA 2E20A 1OY9A 1RACB 1CBKA 1UEVA 3QEVA 3C66A 4FDFA 1PBUA 2LP4A 2ASLA 3HHNB 4H5RA 4Q8EA 2G1HA 4CBUA 1WSHA 1C0GA 4EU0A 3ZTSA 2DJWA 1IUJA 4XK8C 4OGEA 3AVCA 4IKAA 2B5JB 2RNEA 3VENA 3O3GA 1U1OA 4CHZA 4Q5VA 2ZZTA 1GLFO 4B1UB 4ZVOB 2QWRA 3DM2A 1GXUA 2Z4PA 1KC8T 5E0OA 2QMWA 1JB0C 4DFMA 2W1BA 4OO1J 3OUYA 2GBZA 1K47A 2EC2A 2APOA 4MDAA 1MROB 5A8RA 1EKSA 4UF4A 1R3NA 4FSVA 1WG4A 4IDKB 3BKFA 4HDHA 3QO9B 2GELA 3I96A 3JS9A 3CJ4A 2P9LA 2V6AA 2DGVA 1JLQB 2C3MA 3DXSX 4R5PA 3NH0A 1RBAA 1DY3A 3SBTA 2LA4A 2MMYA 4OJ1A 4M45A 3BGOP 2AJFE 2Q6BA 2FHJD 1VSKA 4YDUC 3PFEA 3AB4B 3U27A 3TABA 5KFJA 3QICA 2QO3A 3SI6A 4CDIA 4IUFA 3TOQA 1KTVA 4JV1A 1MNEA 1WDDA 4S0MA 2O8EA 4CJPA 1TL7B 4DB3A 2F3JA 2KFNA 4WK3A 4OX9J 3NWRA 2ASOA 2HHXA 2E6MA 5KTQA 1RLCL 4HDGA 4WFAL 1H6KX 4FPAA 1VQLS 4JS5A 1S9EB 3WT0A 4CF2A 1MN7A 2GFFA 4U9RA 2MYFA 4M5LA 1G7CB 4NEYA 3G4SS 1IR1A 2AD9A 1HQ2A 4FWLA 4DX8H 4PY5A 1S5JA 1XTZA 2PFDA 1FI4A 1DURA 1L3UA 2FBXA 3VA3A 3TAMA 3MM8B 1JLGB 1ZBSA 1R8AA 4G6VB 5CXTA 1L3TA 1VQ8S 3CC4S 2JWNA 3I33A 2AV5A 4K5SA 3AGKA 2MZQA 3JAMY 3M8YA 4CJRA 3V9WA 1WB9A 5IT4A 1XMOK 5J2PA 5CYQB 1FDNA 3TUZC 5IWAK 2CGJA 2CIMA 4BGAA 4Y0WA 3R6GB 2KM8C 1N5TA 3N9UC 3GE9A 2CJ9A 4C0HA 4Q2MA 1FX2A 2COLA 4C2MA 2M8DB 2YKNB 1FKOA 1SI9A 2XY7A 3SXLA 3AT1B 4DUZF 4X66J 4JI7K 3QNWB 4GVMA 1W2BM 1FTRA 3GJSB 1QAJA 3HF5A 1RAOA 3Q8PB 2YKOA 4CBXA 2ZD1B 3Q24A 4OGCA 2ITMA 2NRRA 1FX4A 3D2WA 5M1QA 3GPAA 3C46A 1Q5VA 2VZ9A 4OI3A 1NOYA 2HBRB 4DR7K 3OYAA 3R9LA 2UUWA 1NRKA 1FA0A 3W3SA 3BQ0A 3EDRB 3AJ1A 3AO4A 5EX0A 2ZF5O 2OP5A 2VG7B 3H1VX 5CYQA 3NGSA 1HWIA 4ZKAA 1P8GA 4ECXA 4RR5A 1GOCA 4CO4A 1JJ2M 1W2BR 4FF4A 5CHCB 4LF4J 5IWAJ 2AX0A 3O8WA 3UE5A 1DBDA 3K5OA 3PTWA 2XLJA 1Z25A 4EAHD 1RYSA 5IQ6A 2J0QD 3QT6A 1QVGR 4ECZA 4ES3A 4CZEA 3HPHA 3R1LA 4CEAA 1WORA 3DHWC 5C10A 3ET6A 3L2WA 1RBTA 4KTZA 4P75A 2YWFA 2HNYA 5C24B 3TW0A 4FPRA 4WFNQ 3CCJS 5HP1A 3SMZA 3TANA 4QAGA 4USJC 4X4QA 5EVZA 1TAUA 3J81O 4DV3F 5GMEA 4BDZA 5HVHA 4CFAA 4ATNA 3FGUA 1I94K 3ILJA 3CCUN 1HQEB 5E41A 4YOVA 3QEXA 4R25A 5ETLA 2P9EA 3BGUA 1OYEA 2KH9A 3QPIA 4ELVA 5KQ8A 3LZIA 5K8OA 1RGIA 2WW8A 3TWZA 2PYJA 3RMBA 2FUG9 1V5VA 2R2SA 1ZM4A 1DKGD 2HIYA 5AZIB 1P6TA 3OVAA 4JOUA 1WC3A 3FZBA 4JI2K 1P9YA 3UDVA 5J2MA 4B9QA 4WYLA 4WIIA 5AQTA 1KFSA 1AUSL 3SQGB 4DR1F 4Y00A 4ZPBA 2HHHF 4DV1F 3QAEA 1RTDA 1NZAA 4NLBA 3NKYA 2QL7B 4HHHA 4AILC 5C24A 1TK5A 2BDPA 3C3LA 2OELA 4I9LA 3OW2R 2PZSA 2EBEA 2EFVA 4BC9A 3OYIA 1WELA 3P39A 2DEJA 3I6PA 3SSRA 1CJKB 3Q2SC 4R8UB 2FJWA 3ITHA 1ATNA 4AT1B 2CNLB 3O9SA 3DU5A 2UVUA 1NDLA 2VKZG 1D8YA 3VQ5A 5D6GA 1U2VA 3SUQA 3MF5A 1CLQA 4J9VA 2FY1A 1WBDA 1LFWA 1EP4A 1EKEA 2D1CA 4HUEA 2E4LA 3CCZA 4KIAA 1ZBHA 1RE1B 3ZXWA 5E3RA 4FYDA 1AW0A 2Q2RA 4R0JA 2P6SA 1PYTA 2YX1A 3LOUA 5KFFA 3CDEA 1BLUA 2J9DE 4BRQA 1NB2A 3P31A 3JAMO 4TU9A 3CD5A 3A4TA 2UUCJ 2ZBPA 1G4CA 1SB6A 2G2ZA 4OFZA 5GADI 2B7BB 2VF3A 5ITHA 3L8BA 1F21A 4FYYB 2ZNYA 2DGTA 1HD1A 1XQIA 1Q9YA 4I56A 2RSQA 4F4AA 1KOHA 5C7PA 1I1GA 1GMUA 2KU7A 3LUYA 4KB7A 3PW2A 2DBBA 1UW9A 3V6KA 2UXBK 2HGLA 5E26A 4USKA 2OPPB 1YTYA 1VQNS 2M52A 2ZOGA 4UQTA 2ZH8A 3SQ4A 1G15A 1Y97A 2Y1IA 1R31A 1Z4UA 3V4IA 2L9NA 1NSAA 2KFZA 3HI9A 1ZM3A 2HNDA 4ED1A 4BVPA 3CG7A 5FD1A 4UY85 4QJVA 6FDRA 1FRIA 1TR0A 5DDOC 3LZJA 3LGHA 2GQQA 1IBMJ 4ILHA 4JB8B 5K8MA 1MWQA 1RCHA 1VQ9N 4KTWA 4IDHA 2HLTA 1HW8A 3SCLE 1CEZA 2VA2A 3NF6A 2FLNA 4EMDA 4TXSA 1LWFB 1KQKA 4DTXA 3M6VA 2V8PA 4KE5A 5LMUF 2CJBA 4DQPA 4M7YA 1RA7A 1UVIA 1T7PA 2Y8YA 3US5A 2B4VA 4DU4A 4NOHA 3HVWA 2CPHA 3HK2A 4ILRA 5LJ5Y 4H4MA 3VQBA 3BY5A 1VQPS 1Y9OA 5F0XA 1ICEB 4Y6IA 2EK1A 1U04A 4ECYA 2B9EA 2DR9A 4OYWA 1KONA 3ZZPA 1KR4A 1K9MO 4NRUA 5D0HA 3FVYA 4H5WA 1ILYA 1Q8KA 1Y5IB 4WP3A 1W0HA 4IO9Q 4WE1A 4C3MA 2GHWA 5KT4A 4O23A 1WUAA 4CFCA 1HWUA 2LDYA 1FE4A 1KCFA 3VAJA 1FDAA 5BRDA 4JKFA 3KLGA 4PWDA 2HNZA 1Q7YT 2MY7A 1HARA 3CJSA 4RO0A 1C0UB 1N5VA 1Y10A 3J7Z5 4Z2XA 2E8AA 3GP9A 3RBEA 1J53A 3KLEB 3THVA 3H7HB 3JXOA 4IKFA 3RW6A 2MKJA 1N5QA 4ILLA 2PBDA 3DCAA 5L9NA 4WU3A 1HNWK 3C7NB 4GKJK 2EKYA 1RHJB 3PZPA 4V19S 1C6VA 1NK5A 4OQJA 1X0PA 2DXFA 4Q7AA 4F04B 1QE1B 4JI2F 4X4VA 2E1YA 3POTB 3SQ0A 2GWJA 1NK0A 1D1UA 2BUNA 3PG9A 3T6JA 3QNOA 1IO2A 4A2AA 1WACA 5E3QA 4M5MA 3D7SB 2DEIA 5D0GA 4IRCA 3RRHA 2EHGA 5KFHA 3E2EA 5AQIA 4K8RA 4DBQA 4N41A 2YNGA 3M8SA 2BKPA 4CVNE 1GXLA 3OR2B 3BQ1A 4LF1A 2HF3A 3CIPA 4JI6K 1XMOJ 3VGVA 2SXLA 3BYPA 4CJSA 3EPGA 1UVKA 1JXVA 3THTA 5JVHL 1RBVA 1JLFB 5F8MA 3M1VB 4F4ZA 3K5NA 2JFDA 5T7LA 3MX5A 2NR0A 4D3GA 4K4SA 5KG4A 4K7QA 3KG1A 2F9JA 4BLGA 1NAQA 4CFBA 3FRZA 4ZCKA 1O1WA 1TYQB 4FWOA 2P9LB 3CJ2A 3H2UB 2GO9A 4CLLA 4FJHA 3BYRA 1IBKF 4F2RA 1TUUA 3R5DA 2R9LA 1HHSA 2WBMA 3IBWA 3MM9A 4J9UE 3RRGA 2UXCF 4ZIVA 1SQKA 3T5LA 4ZHRA 2LEAA 1YWXA 3KG0A 1Q81T 2JOQA 2L3MA 4UZCA 3KJNB 3ALYA 4JV5K 1N5YB 3VQPA 1WC6A 4EO6A 3ILOA 1KD1T 3RVCA 5BR8F 2E5LJ 4ZVSB 2AQ4A 4QIFA 4ETZA 2ZD1A 3ZT0A 2O8EB 2MHEA 2FLOA 1YRUA 4FZYA 1NJIO 2N4DA 1SZ2A 1YXQA 3ZT4A 4OJHA 1LW0A 2ZITA 3ZSRA 3BH7B 4M3TA 4M3RA 3M1VA 3IUCA 4MKYA 3CQXA 2W9AA 1WTFA 4YP3A 1DTTB 2AJ2A 1WAFA 3ISZA 4QYZK 2FY8A 4DFJA 1TGOA 1SQGA 4CHQA 1S7IA 1NKBA 2HVZA 2JVRA 1KN6A 3RRKA 3QIPB 4XIUA 3K58A 3QRRA 2P9UB 3H8YA 3SCJE 4HWIA 2EWHA 3TAMB 2XS5A 1BOTO 4XH4A 2X1BA 2H51B 1VJQA 3H25A 3AQPA 4OJRA 4HVJA 4CM2A 1IN0A 3B4MA 1VBKA 1YK9A 3CIZA 1YJNS 3CJQA 3DOMB 1WOSA 4RBVA 3WIVA 3CCTA 2PD1A 2LEPA 3EGNA 2I2YA 4FJIA 3MCAB 4QW9A 1DZ5A 3V6JA 2VA3A 3DI6A 2XS2A 3RMCA 4BRMA 3MXJA 4MIAA 3AO1A 4CYUA 3EUNA 3LDOA 2BQUA 2WRMA 1QQCA 3V9SA 4EHTA 2Y1RI 4DV0J 4M3UA 3RZAA 3LGNA 1H1VA 1HI8A 2DT9A 4L75A 4FP9A 5M2RA 2J7UA 2D69A 5DGBA 4NYFA 4BR9A 3G82A 4AL5A 3PM9A 4EBDA 2MY8A 3EKSA 1DTTA 4FLTA 1HUXA 1SL2A 2PFUA 4IEIA 1S1TB 4JI3F 2QRRA 4NLRA 4KPCA 1WSVA 2VDHA 2YWKA 3CDUA 2WC9A 3I0RA 4O8UA 1QQMA 1T02A 1T6CA 1H98A 2Q43A 3CCWA 4RW8B 4YHHJ 2IPOB 3Q2TC 1WSFA 3O5TB 2GNKA 5GAHU 2Y0SD 2QN6B 1FJ7A 2BJ1A 4ZA1A 3O1LA 1OPIA 4RNHA 3RBXA 1NHVA 1S59A 1SS6A 4DL2A 3T3FA 2QA1A 3JSBA 1GEHA 4YDXA 1RK8A 2NSCA 2DR6A 2JLGA 4WFXA 1R43A 3MEEA 3OPKA 3UI3A 2BXJA 2RT3A 2W4CA 4RW9A 1WHYA 4DCJB 1FDBA 3OBYA 4OHZA 4OKJA 2WVEA 4C8NA 2AJ4A 2L9WA 5HJXA 2F7TA 1H2TZ 3CYMA 1HW9A 1NCLA 3D66A 2O1PA 3L9ZA 4J2EA 1T0TV 1HKCA 3QLHA 4FXWA 1FXRA 1DHMA 2YWHA 4I6MA 3CD6N 2UYTA 2B5JA 5AXMA 2FXUA 3O3HA 3A1YG 2A41A 3QSIA 5DO2A 4KO0B 3L6QA 2EVZA 4N76A 3UIQA 4BQLA 5KFYA 2GQ2A 4DU7A 3M30B 3HT3A 4CHYA 4RW7A 3THPA 4BR4A 5LY3A 1RDBA 1X4CA 1VQ7S 1FFWB 4FWQA 2C3YA 3FLCO 1ZBUA 3GFZA 2KHCA 1HBNA 3WNEA 5HI7A 1UWAA 3QBCA 3CPEA 3BSNA 5FROA 1VQSA 2VWKA 4M42A 1Y5NB 3KG4A 5FLXO 1W25A 3M1FA 2KHOA 3LAKA 4KHNA 3IMQJ 4H0TB 2Y3YA 2RS2A 3KD5E 4RUHA 2C28A 5B0EA 4K42A 2QA4G 5AQUA 3CJRA 2WSCC 1IBLF 3PX6A 3EO3A 2VG6B 2W7AA 2V67A 3DGPA 1F3FA 5GAHP 2KKHA 3R5GA 2GVZB 3CM6A 4LSLB 2OPQA 4KFBB 3ULEA 3TARA 2FVQA 3VTHA 5KT5A 1RBSA 1K73O 3T19A 1R0BG 2OJ3A 2BM0A 1HWLA 5LT5A 5DMRA 4OHWA 3CIMA 4X62F 3FZ2A 3NOGA 2OANA 2UVVA 5IM0B 3N6NA 4C3LA 1O13A 4CJVA 1SV5A 3MMBB 2XGQA 4FJXA 3D2EB 2W24A 1R6YA 3I8DA 1S9EA 1I3AA 3WHIA 3OS2A 4HT5A 4DR2F 5ETTA 3M8PB 4QIWD 2YY3A 4H0OA 3QNNA 2PIIA 4P52A 4HTIA 2CPZA 4CRJA 3CMES 5A0YA 1RGVA 3CO0P 2BUPA 2RUSA 3AXKA 4ZN1A 1MMNA 4DV4J 2ZH4A 3N5FA 1VRTA 4JI5K 4CEBA 1WSJA 2GEMA 3H5UA 7AT1B 1N32K 1TL3A 2XSJA 5IS2A 2FC9A 4KREA 1VK0A 2E7VA 4NCGB 1Q81O 4CF1A 5HATA 4GKJF 1TELA 4A48A 3FRYA 3TVKA 1EQYA 1BIZA 1R59O 1B4SA 1WNSA 1EARA 2EFPA 4ETXA 3LWMA 1VSMA 4DTNA 5AXLA 2ZE2B 3KK1A 5A2QO 1KTQA 3GQCA 4DV5K 4A8FA 1E4GT 5HSPA 2YHYA 3CJ1A 4NZ6A 4KAIA 3HL8A 1YQHA 4DU8A 1QTMA 1D09B 2QM1A 3G0ZA 5LMNK 2CNNB 4ZK7M 1QSSA 3G6EN 3T1YJ 3WC2A 3E9PA 3H0PA 5BN8A 5LL6d 2ZH2A 1N36J 2HRYA 5KG3A 4ZLNA 4GV6A 4NLGA 3SSQA 1N32J 2E5LK 1S1UA 3NRBA 5IV3A 4HACA 2ZWHA 4C98A 3EM1A 1AB8A 4YR2A 3PO4A 3QRQA 3BB5A 2W2MP 4UTGA 4F4WA 5KFPA 4DLEA 4PHTX 4NLQA 1WEXA 4ISFA 3QO9A 4A8OA 3QFWA 2B3TB 3VESA 3TAGA 5BR9A 4ID5B 1Z1ZA 4FF1A 1S3XA 3BBBA 3BM7A 1CPZA 1S48A 3DAWA 1UW4A 4QYZJ 1SKRA 2CDQA 1OH8A 3SPYA 1YDLA 2J7WA 3C65A 1U6BA 2ZM6F 1FHTA 4DV5J 2NRZA 2DKOB 2CQ0A 2YKMB 2AYGA 1IQZA 2DCUB 3HVTB 4BWJA 3OYNA 3IP0A 2ZNZA 4URGA 1UJ4A 4B3MF 2AEMA 1T11A 2O8BA 1BI4A 1FXLA 4WWSA 1U4BA 3MM7B 1IKXB 5F3TA 2DD8S 3KLVA 1IKVB 1N36K 3MR5A 4DR7J 4HH1A 3CCUS 4W5OA 4AQYK 3HFKA 1RILA 2Z56B 2IOCA 1TP7A 3FKBA 1DQAA 3W65A 4URQU 2G8HA 4BE1A 1WKJA 4OZNA 3M2RA 3HD2A 2ZH1A 4DMNA 3SJJA 1I51B 3MM8A 2XTJP 2RU3A 4OMFG 1N33F 2BJ7A 2WBRA 1HA1A 3M8RA 4NLXA 3OHRA 4K8XA 1J9AA 4ZVTB 4MKVA 3HHEA 2QLJB 2IA0A 2KW4A 3VTIA 2ERRA 2CZVC 1GX6A 1W26A 3NCIA 2OFGX 2LXIA 4PXDA 3HSDA 1FRMA 3EICA 2GWKA 3AXMA 1WNEA 5J2NB 4NZ7A 1Q5YA 3THYA 3HI0A 4FJ9A 3IGVA 2FZCB 4G1IA 3A8KA 4BREA 3EKUA 1KVAA 4ANDA 3TZXA 1T9UA 4UW2A 1RDUA 1HJRA 3NXZA 5JS1A 1RA6A 3QFPA 2CH5A 5AJ3F 3ZT3A 2FGCA 1OYDA 4CNYA 2KT2A 3NGIA 1S57A 3LQVA 4B9VA 4F8RA 1KC8O 2P9SB 5AQXA 4O4GA 3FZFA 3VVTA 3OR2A 3L3CA 2I6WA 4P2SA 2MB0B 2LXFA 1VHIA 3NE6A 5D8HB 3CC2N 3MMJA 3ASMA 2J0XA 2W25A 5KT6A 3D6MB 3TEGA 2GVDB 2D3OR 1K73T 2NSBA 2AEJA 2BM1A 2DGQA 2CWXA 3PX0A 1HR0F 2VQFK 2GMJA 4CD1A 2XY6A 3W9JA 1B7YB 4A8KA 3CC7N 1TK8A 2Z57B 4DV1J 3TSPA 1UWBB 4CIFA 2ZBIA 3I82A 3PYEA 3FQKA 5GAEU 2DR7A 3A5OC 1OY6A 3JTNA 1YIJN 3D1OA 4UOHA 4NXNF 4LSZB 2QGFB 4OJGA 4WJBA 5KPZA 2VV5A 2A5XA 4QW8A 4Q2LA 2RE2A 4DR4K 4CE9A 3Q86A 4CEOA 3J7AP 2XMAA 1GQEA 2GIFA 5BN9A 3CE8A 3CJKA 3UD3P 1WI6A 1SJ4P 2NLXA 3EXCX 4LVOP 5HN0A 3QEIA 2GHPA 2DY4A 1R0CB 4TQSA 3B6PA 1KDNA 1FWLA 4ICLA 1RWMB 2C2RA 4GC7A 2HNYB 3PYDA 2E9RX 1RWNB 1YRTA 3OFHA 4DTPA 3T41A 5L38A 3EYZA 2Q66A 3GONA 4CJ3A 2HVDA 3VAGA 3FNNA 2VC1A 3NH1A 3D5MA 5LMUJ 4NLTA 1FRJA 3DXMB 3CJ0A 3MEEB 3HOTA 4CK2A 4FJ7A 1VQ9S 1J5EJ 3G4SN 3FMBA 5DG9A 3CJCA 3H08A 2ZHAA 3L7UA 4FOIA 2GZOA 3Q7CA 5E5NA 3CHWA 3CMQA 2E2OA 1MDUB 1JCEA 4Y2KA 4A61A 1VC5A 3P45B 3W8PA 4LFBF 1H74A 1QQOA 2Y0BB 1C1BA 4W4MA 1M5KC 3QLHB 3RR7A 1VQ8N 4H0VB 2IC3A 1K6YA 2P9IA 3VERA 4DPXA 3GWCA 4DR4J 3DFEA 3DOMA 1KQSM 4BROA 3BGRA 5G0RA 2G4BA 3O9RA 4ZPVR 3HZGA 1M5VC 2FHOB 3VV2B 2ZDOA 1MLAA 1HNIA 1Q8BA 2BW7A 4RJVA 4K4YA 4GVBA 4DR2K 2KXFA 4RPFA 2RE1A 4CEFA 3ZTPA 1YJWS 5T41A 4MO4A 3AVLA 3B82A 4CYUB 1MWYA 3MPYA 3RW7A 3S3MA 3PUFA 3NH2A 1CS4B 2XMJA 3AJ2A 2ITGA 3ZZUA 3LM9A 3SCKE 3M32A 5ETNA 2XC9A 4L73A 3FDSA 1AUDA 1NGIA 2KFYA 4AH9A 4FM1A 4BG9A 2G8FA 3W60A 4NO7A 1VJWA 2IVPA 1WSEA 2RAQA 1T9VA 5CCLA 4Q8FA 2IAJB 1X5OA 4B3MK 2BX6A 1NGEA 2FC8A 1NMEB 3DGPB 3SZ2A 5F0UA 3R3LA 5LMNJ 1WHVA 4Y1CA 1S12A 3PSIA 2FHMA 3AY9A 4YUDA 2CPYA 3THWA 3BGFA 2KM8B 5CZ2A 3BQ2A 1E6YB 3SQ1A 2F40A 3R7BB 3IBFB 4YY3F 4O4RA 1C0TA 1T94A 4RNFA 2WVBA 4JRQA 3NBPA 2B4OA 1HPMA 1X60A 3LH2S 2HBQB 3ZTRA 3GR0A 4OX8A 4LF9K 4LR8A 4DV4K 2W2QP 4PG6A 1TUVA 2HZAA 3P5JA 1SQFA 5A8KB 4QS7A 2ZHOA 2LSNA 4YB5A 4JK8A 2VPXB 5DETA 1JXEA 3D6HB 2JGUA 3KDNA 1Y5LB 4UOFA 4B1YB 4I6MB 4BBYA 1VQ4S 3C16B 1FW6A 2V2QA 1PC4A 5M1FA 4DTOA 1NKEA 2B9YA 3ZZRA 3AV9A 5B8HA 3AD9C 4GY2B 4DR3F 2VODA 2IRYA 2P5OA 1JLBB 3S41A 2QTWA 3QJPA 3LP0B 4H4OA 1KSPA 4I6YA 3K0JA 2AU0A 3W2VB 5D0EA 3QMLA 3OTCA 1LXJA 1BA1A 1RLDA 2GJIA 2E5HA 3EGVA 3DLGA 5KT3A 3R7SB 2H65B 1PYOB 4F0KA 2V68A 2XZWA 3LP3A 5RUBA 1AXQA 2Q36A 5A8KA 2MKKA 4JD2A 3CJBA 2DGXA 4LSNB 3DXKA 3PVXA 8ATCB 1GH8A 5H9FK 1H38A 4IFEA 3U1NA 3QGHA 1W2IA 1BQMA 4FPBA 1QAXA 3AVIA 2QLBB 4CK3A 1LK7A 3DU6A 4P7TA 2GQCA 4K4XA 3PDNA 1U1NA 2PE8A 4LF5F 2P9PB 1IXKA 3PRVA 1S79A 3HULA 3HP6A 4CWBA 1BA0A 2ZBRA 2K7JA 2KKZA 2H54B 4CT9A 4F4YA 1B0PA 3U9ZA 3LWLA 2E2PA 2LXUA 5TKYA 3SFUA 4M5HA 3GDQA 4A8QA 4Q0BA 2V7YA 3E51A 3D0GE 4NZ0A 4ID5A 3R2DJ 2XEXA 3DLGB 1RDCA 2ETJA 1VQ6N 1C1AA 1U2FA 4DEZA 2VCPA 1RQ0A 3MUTP 2E2NA 4DTMA 1K1SA 1W9HA 3T9NA 4FW1A 1RWKB 1SJQA 4WFZA 3MECB 2RB7A 2C2KB 3OQ2A 4K4ZA 2I8EA 3KUHA 4BR2A 4LBIA 4ELTA 3CNQP 1J5OA 1UVMA 2R7YA 5AJ3J 2E5LF 3PIPL 3VQDA 3W5XA 3CCVS 4M63A 1NSKL 4A46A 1XK8A 2R7RA 2XLKA 5ETMA 2UU9J 3I87A 1IR0A 3VAKA 1ZTWA 2EBGA 2RDJA 3QIOA 1TKZB 5KRSA 3OR1B 4FLVA 5E3CA 2YNGB 4B08A 4YOUA 4YB7A 2BEFA 4A8XA 2Z1JA 1Q7LB 4USIA 2EWSA 2JWKA 3ZSZA 3MXIA 2D9PA 5C15A 1UA1A 4JI7F 2JJ4D 4QPXA 1MSWD 3AB2B 1UVNA 1JQGA 2RQ4A 1ESVA 2NXEA 2YBVA 1DQ9A 2AIRB 1RTJA 1X4GA 1ZAVA 1IKYB 2IFXA 4JS4A 3CSKA 3VEZA 2VOOA 3KD1E 2N3OA 4O0JA 4CLTA 1TMMA 3F73A 4MT1A 3N5BA 3U02A 3O8MA 2XMMA 3CO9A 4DV0K 3Q23A 3AQOA 3HBTA 4WF9Q 3HXMA 2PEHA 3PCOB 5A2QY 1J5EK 3ZZYA 4E19A 4H03B 3M8QB 5GAHI 3NGKA 4K4WA 3Q89A 2Q3SA 2ZDPA 2VFSA 3DRPA 2ZKUA 4EGLA 2OA8A 2E66A 5HVFA 3AVBA 4IOAQ 2X1AA 2MEWA 5DDQC 1HQUB 2NREA 1S0VA 1FEEA 2MZTA 4RTFD 3SI8A 4W5RA 4B3SF 3HHLB 5L1JA 1FRLA 2HYIB 1R0AA 1RT5B 3D2FB 1P9QC 4ES1A 4FNHA 4C8ZA 3RSEB 2AJQA 3WX4A 1IKVA 3SIPB 4QBUA 4CIOA 2CPXA 2AGPA 4K5RA 4I2QB 2M7SA 4I7FB 2H3GX 3TAPA 2AMCB 4CF0A 3N6LA 2BGGA 3TJAA 5BPMA 2LU1A 3H98A 4RW6B 2QA2A 2A42A 3PLAA 4TN2A 5IT9Y 4HHJA 1TL1B 1R8PA 4F3QA 3H45C 2L48A 4HR2A 4LQ9A 2ABYA 3O9UA 5HQLA 3J7YI 3DRPB 4WXOA 1HNWF 2JWLA 4Y2AA 1WLJA 3KLFB 2DRBA 4CO5A 3OT9A 2GC8A 2QWLA 2VB6A 3OBWA 4ECTA 4RG8A 3WQTA 2ZH5A 2ZEJA 4X64J 3C6UB 1B0TA 2H4YB 2RF2A 3E01B 2QV6A 3MR2A 4FM2A 2P8IA 4CLUA 4TQRA 2GMLA 3ZSVA 3ONQA 5CA5A 1IG8A 1WF0A 2VU5A 1RU2A 3EVOA 4F9OA 4PL7A 2YHAA 2MQNA 3A2FA 4ZLJA 3KLGB 4PWDB 4CJLA 3PW5A 3CJ9A 3TVZA 3GZ7A 5B0GA 4MFBB 2A2CA 1NDPA 2HPUA 3LW5C 2O8CB 2F63A 1P8ZA 2X6NA 3MPUB 2AX1A 4Z4CA 2ADCA 3NAEA 3A3OB 3P83D 3GG4A 4ISGA 3IRXA 3OL9A 4DQIA 5D3GB 1T3OA 3KUGA 2KRRA 2QSFA 3CULA 2RQMA 2VHGA 1NK9A 2ZBCA 1XMQF 4H5VA 1JKHB 1NK4A 3O9TA 4CTAB 1DEJA 4MDBA 4B9NA 1FJGK 4BC2A 5JS2A 2YNFB 2NXUA 4XPCA 1QD1A 2M0GB 3BZKA 3D1HA 4RW9B 5IC6B 3SBMA 4JV5F 1NJIT 2Z0GA 4KPYA 2W9CA 4ELUA 1HI0P 2Q97A 4OZLA 5IT0A 3Q8VA 3M32B 2O8DA 5CYMB 4KJIA 3MK6A 3BP8A 1RU1A 4I0WA 5D0RA 5KFVA 5HANA 4RU9A 1QUVA 3C7NA 3T7ZA 2NUUG 3WXIA 1VCTA 3QGIA 4ECWA 4RBUA 2R4FA 3J80Y 3KDOA 1S1XA 4B8CA 5C25A 2D0PA 5H9EK 1LAWA 4WFBL 1QE1A 1M90T 5T7LB 4GO7X 5SUHA 3GCXP 1U24A 3AD8C 2OTLN 4DR5F 4LF9J 3D6RA 3HVRA 2UXBF 4U8YA 5HQ8A 5KFEA 4P73A 3PHTA 5DQHA 1X9JA 4AL7A 2MKIA 2VBXA 1XMBA 2DFEA 4YB1P 1WN7A 3DLEA 4BR0A 1KAZA 4B02A 2D0OA 5HBMB 4JN4A 2ZUGA 2H4WB 4U8VA 4IO9L 5BRFA 4DV6F 4YB6A 1DTQA 2O5DA 4UOGA 1UAXA 1XNQK 1YVFA 1S6PB 3KZBA 4A62A 1XHZA 1E6VB 3C15B 1BHNA 3R27A 3NL0A 2V5HG 1GK8A 5AXNA 4KFBA 4ED8A 3ULEB 3I55N 1IM4A 2V7ZA 2F65A 3CD0A 3IR5B 3LP1B 4BRCA 2GIQA 4O3RA 3ZCMA 3T1YK 4OHYA 1YJ7A 3MM7A 1N8RO 3CMAN 2AT1B 4ED7A 1SC4B 1IKXA 3UN5A 4CI0B 4NLSA 3UKUB 3QBWA 2JNJA 4QWAA 1FD2A 1SV5B 3MMBA 1IBLJ 3C94A 5I9EB 3ENBA 2R7QA 3BR8A 5LSLA 3RU0A 3NOCA 4M7XA 2BYCA 2EX3A 4K2XA 5J1EA 1G99A 1RT4B 3NCPA 2YJEA 3ELHA 1K9MT 3MPVA 3JSYA 4QU7A 6FD1A 4ZLPA 2FSNA 5CABA 5C2FA 2YJFA 2EKNA 1WHWA 4CH7A 2Z2LA 4DV7F 5LJWA 3HD1A 4QS9A 2W9BB 4ZIWA 4BE0A 3ZFVA 2UVRA 4F26A 5KPTA 3CT9A 1LW0B 2ZC4A 2YNIB 3S1TA 2X51A 3LTOA 3I4HX 3DXKB 4DPYA 1HI1A 1S7HA 4NLOA 3QERA 4CLPA 1KQSR 4BQZA 3C6HA 3V1RA 1U2CA 5E3AA 4C9DA 2QTDA 2XM3A 2GGPB 2ZVIA 1BUPA 4MLHA 3W2WB 2DRAA 4PUOB 4L6V3 1XBWA 1RTDB 4AL6A 5JXSA 1B70B 3M4XA 5DG7A 1XQSC 3FZLA 3TZZA 3O3FA 1KAXA 4ANCA 4QWDA 3IDHA 1FT8A 1G3OA 2DO4A 1R8CA 4YDDB 4OKKA 2YI1A 2PMWA 3DOLA 2AYBA 4C8KA 3KK3A 1CJKA 1ZAWA 2I5JA 2K3IA 5JVGQ 1URRA 3RB3A 1N4LA 2ROEA 4O44A 5KFMA 2PMHA 3C2PA 3H5YA 2QX0A 3CJ8A 2ASJA 1Q16B 4FYWB 3JS6A 5M2UA 2GAHC 3VEVA 1HNXF 4BC3A 2XMVA 3KUEA 3HHLD 4AFFA 4CEDA 4EFHA 2RH3A 2R8HA 3UVJA 1S1WB 5LXRA 4F3OA 3UW1A 2P51A 2IHR1 5EWFA 2R7TA 5KFLA 2Z2MA 4ZPDA 3VHQA 4FF2A 5CY4A 3ZT1A 3ZSYA 1TVRB 2MLZA 1ZH5A 3KJVB 3ZTQA 3SAHA 2WVDA 4KBOA 4G9ZA 3JAMU 1Z05A 3SAFA 3HHDA 3WNHA 1XMQK 5KQDA 4FK0A 2PI5A 3MXHP 3KVGA 3FEXB 3DRSB 5FIIA 2R8KA 1F6TA 1RT7A 4EEYA 3NMAA 1IV0A 3HPGA 4DR6F 1DJ0A 1H2VZ 3TNVA 2DNYA 5GINA 3KMSA 1VQMN 3CC7S 1H2UX 4ID8A 4JYAJ 4LSNA 2C42A 2HHUA 3EL2A 1OJ4A 4TY8B 3OY9A 3LALA 2HQGA 5HRRA 1RAHB 1UJ6A 1AT1B 2CZ4A 3BDEA 4DPOA 2D1KA 6AT1B 4E1MA 3ENHA 3DRRA 3W61A 3UN2A 1Y4ZB 4KC5A 1KWMA 4CO3A 3EJMA 2PAVA 3OYGA 1HBUB 2ZVSA 3V1OA 1QTNB 5B7WA 1YTAA 3L4IA 4ZPAA 1WC5A 1X31C 4OV1A 1S10A 3H42A 4F0HA 3CUNA 1ROFA 3BKUA 1KNZA 5KFBA 1NGGA 2ASMA 1UMJA 4LSLA 1VDHA 4ID1A 3FBEA 3MFIA 1RKJA 5F41A 3W62A 4CJKA 2JC1A 2ZOMA 2HBJA 1IJJA 2G8IA 4J37A 2KYZA 3AO2A 3AFGA 2BKNA 1FESA 4KRFA 3LO3A 2HHTA 1WEYA 3AVNA 5F8JA 3UDEA 1F5BA 2ZWOA 3T1HK 2E2QA 1HNIB 3HX9A 1OY8A 2UVWA 3PO5A 3BSOA 3G10A 3FFKB 2X6SA 3I9ZA 2P6TA 2IYIA 4U7BA 3G8QA 4JAXA 3KK7A 3BZQA 5CZ1A 2HFSA 1RTHA 3H2LA 2HFNA 4DHVA 2OZSA 2DIVA 1WC4A 3MD3A 2DVIA 5AFUH 3C6TB 4LF8F 4ILGB 1CG2A 3G71S 3H2VE 4QPTA 1L5UA 5BR8J 5ETQA 4LD0A 3GJRB 4JI8J 2A1SA 2BJ3A 4N8NA 2JFKA 1N52B 1UTAA 4E1JA 4OHXA 4IOCL 4LF4K 2DXEA 4N5SA 4RW6A 1HNZK 1TKTB 2A6MA 5AQKA 3MN9A 2HMIA 2CQ2A 1TL1A 3TTFA 4YQWA 4HCBA 4BRHA 2MTLA 2QL5B 2BE7D 2DGSA 2ZGZA 5A8WA 3I32A 4OI4A 3SCXA 3C8YA 3B4DA 4UUXA 4HH0A 3CM5A 2KZMA 1V5IB 1H0HB 4X62K 2F9TA 1CJUB 2YNHA 3GYGA 1VQ7N 3VQ9A 4DV7K 1N6QA 1Q95G 3CJ7A 2R7UA 3UCGA 3VEOA 3DLBA 3QETA 3N79A 3LPEA 4FXVA 3TX0A 4JEPA 1FRHA 1Y3KA 1H7XA 2DHSA 4F4KA 2B51A 3A12A 4OI2A 3CDWA 3QT5A 4FW2A 3K2PA 2XI2A 4OYAA 4Y1DA 1VBZA 4UQGA 2NZTA 2MQOA 4LBPA 4MK8A 3L95X 3V81A 1AZSB 2AEFA 3CVKA 2W4PA 4EUVA 3CQ8A 3QESA 2PMZD 4RWWA 3E3XA 3TR5A 1ZZFA 4JI8F 5DM6L 2P9NA 1UZHA 2KQ2A 4KRWA 3ZZZA 3MM5B 2Y1LB 1FJGJ 4LF7J 3DLHA 5CZXA 2OSRA 3POTA 4PXBA 3TAQA 1RT6A 4UY8O 2CXEA 2YNHB 3ZX0A 1MMDA 1UCNA 3D68A 2IM1A 3QAUA 2CQHA 2KXNB 1TQLA 3M2VB 2DFHA 3ZLJA 4E7KA 2V2KA 5I3QA 1NKCA 4G1QB 1OSDA 3DDIA 4FLZA 4IG0A 4JI1F 4PQUA 2J0WA 4ZDNA 4MO5A 5DQIA 4JI4K 1Y3JA 1LKZA 4IFYB 1QS4A 4X2BA 5B0AA 3QZ7A 3DXBA 4KQZA 3VR1A 2HQIA 2R2TA 1VLOA 4KH0B 3PJ9A 2JVOA 4BRLA 5E2QA 3UD5A 3MMAA 4RNNA 2VBWA 2QJ3A 2C2DA 3VOVA 2QLXA 4DF4A 4TSXA 2UUBJ 4J90A 4C6AA 2K06A 3OYEA 3FZMA 2ACYA 3C6AA 1HKAA 2Q1LA 3DM2B 1GLJO 5C25B 4JBCA 4J9PA 3IWXA 4ZLLA 1NGAA 3GG0A 3CXCR 1FEHA 1NGHA 3SYZA 3KIOA 2FHJA 1HWKA 1Z2LA 4OZ2A 4C8LA 4A8SA 1N5YA 4A4JA 2NNWA 4Q0BB 2MSTA 4R5PB 2YWWA 1CJTB 4KGXB 1NGBA 2IM3A 2MGZA 3ZZTA 3RAMA 5DDPC 2HOEA 1M90O 4LRFA 4OZ0A 1YVUA 2KT3A 3M3ZA 4IFYA 4PQAA 3BKTA 5CAAA 1KXPA 4H0PA 3QIPA 1SJ1A 5K8NA 5I42A 3OUYB 4BVOA 2W2OP 3MEGB 5IQQA 1XI1A 4CGGA 4OZ1A 2FD2A 1YKWA 1M1KT 3R9PA 1L3VA 1I94F 3I5BA 3LL3A 2IIRA 1GLLO 3ETOA 1HKGA 5H9FJ 1KLMA 1C0TB 3FZKA 3H90A 5F8GA 4LH4A 3GSIA 1VQ6S 3QQCD 3OJSA 4X66F 3SV3A 2QYGA 3IAM9 3TTCA 4NXMK 2RILA 2XCAA 2V8HA 1SL1A 1P90A 1QSYA 1TKZA 4FJGA 2DTUA 4WCEQ 3UKRB 2CFXA 3VGMA 1YT3A 2HZVA 2YKQA 2I7PA 4L76A 1MW7A 4ZCLA 3IG1A 1KBRA 4LRBA 3SK3A 3CDBA 1YHQS 2A1RA 2K7KA 2E6LA 4ZVHA 4DS5A 1NU4A 4I2PA 5B0CA 2DK2A 3HTVA 3CCVN 1O0PA 3PYFA 1NSPA 4CGFA 3PYGA 1H73A 3L7PA 3W63A 3JQJA 3P4UB 3MM6A 3BF3A 2O4GA 3PR5B 2OD4A 5KG2A 3R3TA 4JRPA 5I42B 3I0RB 3RB4A 1PG5B 2F8MA 4CLKA 1X4DA 2V34A 2W2PP 2C2OB 4RW8A 3B6BA 2PO4A 1RZMA 1U48A 2J5AA 3SFGA 1VYAA 1U02A 3JQKA 2HBMA 1E3MA 3CETA 3SLCA 1FK9A 2OCEA 4O4GB 4MLEA 2IMWP 1S72S 3W5YA 1RT2B 5J1PA 4IJNA 5AJ3K 2BABA 3CCSS 1G2EA 2FJVA 1UAWA 5KFCA 4EBEA 4CO1A 1XWLA 2XMWA 5KFGA 5B0FA 1RBRA 1REVA 3KLHB 2ZH7A 1OO0B 2IS3A 1D9AA 3SV4A 2ZZMA 1RP5A 2HQFA 2VFVA 5L9XA 5HQMA 3J7AN 5MAOA 3DLRA 2YHXA 2E5IA 1S1VA 4ZP8A 1YITS 5FDLB 2HHHK 1CC7A 3T1HJ 1P1LA 1ZA1B 3MM6B 3TQEA 1Q82O 4DL7A 1HMVA 3VQQA 2NRWA 2DNGA 4A2BA 2YX7A 1NM1A 1XN9A 2UXDF 4A5AA 1OVQA 3W66A 4NEZA 2LKZA 1J27A 2WTUA 1HNWJ 3K89A 3DOKA 1GNKA 3VQTA 4M5GA 4EI2A 4NCBA 4QR2A 3QJLA 4UZBA 3ENQA 3TPQA 2HK3A 4LF6J 3AARA 5HROB 4GMKA 1V3RA 3BV8A 3MPWA 4CESA 4LR7A 1WSIA 2NUHA 3IAYA 2HVEA 3DMJB 3AVMA 3VF2A 1HPZA 5F3ZA 1SIWB 5BYQA 4G3IA 3RBDA 4TYBA 3MWBA 3CMAS 3MEDB 4GVBB 3TUJC 4USUA 3F0NA 1CJVA 4HL9A 3G9CA 2CPFA 4EHUA 1WOOA 5BYRA 4DTUA 3B54A 3E66A 4L8RB 4MYUA 1JXBA 4BRNA 4BE2A 2I9SA 1M0SA 4FLUA 5EY4A 2O8FA 4DV2K 4H4MB 1S97A 3BF4A 3EGZA 4DPWA 1C1BB 2PA3A 3PIPQ 3KWGA 3SJHA 2CG8A 1RAAB 2X78A 3G8SA 4YY3J 3CQYA 3C19A 4EYHB 2BRLA 3OXGA 3ATUA 1YRXA 2WTFA 2UUCF 1UPMB 3VQCA 1XNRJ 2FJAB 1PJ7A 2KTQA 4XDCA 4O3OA 1VSLA 1CULA 4E1NA 2H3EB 5HAOA 5L1KA 2J76E 4U7UD 2D74B 3P49B 3WXLA 2A0FB 1VOMA 1RXOB 4CIEA 5B08A 2XCPA 1JLAA 1ASWA 1VSJA 3VAHA 4DDFA 5HL7Q 2LQ9A 1HLUA 2K2PA 4X65K 2AP1A 4JKGA 3GJQB 2AYEA 4JV5J 2XBPA 4USHA 1U49A 3TZWA 2KG0A 4BR5A 2O3DA 1QHTA 2CQDA 4L74A 3D3BJ 3HOSA 3VQ6A 4DCOB 2OHDA 3VMFB 3L3UA 4ZOSA 2LMIA 1QSLA 2AKWB 4IO8A 2ZM6K 2IIHA 2VQEF 2XMKA 3K7RA 3M2UA 4J9NA 1SBRA 1NGCA 5J2MB 3U3GA 2ZH9A 2WB4A 3W5ZA 1A9NB 1XERA 2JEFA 2QMXA 2DNKA 4EYIB 4OL8A 2WUSA 2ZHBA 2NS1B 1UL3A 2HGNA 4E89A 1VRQC 1BQXA 2VOPA 1B92A 3VGKA 2DPIA 4BCAA 3IR7B 3SDEA 1HQUA 3LF0A 1SH0A 4KH4A 2GUIA 4JV0A 1FNMA 5L1LA 2CRLA 3MPDA 5DM7Q 3EVMA 1RYRA 3FFIB 3OFFA 4B9TA 2F4FA 4HCCA 1JK9B 4MJKA 2VWJA 2FJEB 4Z7CA 3TTDA 2LDIA 3BN7A 4DL4A 4YORA 1DT9A 4YHHF 2OGUA 2PI4A 2KJWA 1E6VA 3C15A 4QIEA 1YLXA 4HTLA 2DR5A 1JL1A 4DV2F 3TO8A 2FIUA 1JLEB 4JKDA 3A8JA 3ZETA 2Q6CA 4J8FA 5HO4A 4F7VA 4LF5J 1O51A 2V0NA 4GW6A 4KHPK 4DFPA 4C11A 4LIWA 3W1YC 3F56A 4OI6A 4LREA 4J9MA 2R7VA 1UA0A 5AE2A 2FLLA 4K8ZA 2QMUB 2K1RB 1YI2N 1RWWB 1KRPA 4DG1A 4CZFA 4JI3K 2YXLA 4ZTJA 3E9LA 5L1IA 1EQ0A 3NNHA 3VCDA 4W92B 3OTOF 4PZVA 5H9EJ 4WZQA 5J1EB 1TTHB 3MOZA 2RF2B 4ALZA 3M6UA 3CD7A 4B3OA 2HQ3A 2FJXA 3CCQN 3DLKB 2JSXA 1GLAG 3H3OB 5MLCQ 3C6TA 1JWWA 4C0OC 4DR1K 3OTEA 2F8HA 4NYOA 2VQEK 3I5CA 1NGDA 2ROPA 2W9BA 3PW4A 4E7HA 3NAIA 4ED6A 1TV6A 3G87A 4FPIA 2J9DA 3AVFA 4LFCJ 2YHWA 5FPEA 2EI5A 3MDFA 3MGJA 4JI6F 2F5GA 4X4SA 3R1XA 4BR7A 3MN7A 1XHXA 3G25A 3W2WA 4PUOA 4KHPJ 1UOCA 2QSWA 2VC0A 2UZAA 4AUKA 1EX8A 3FK4A 4GKKJ 3RG6A 4DU3A 1MU2A 3OW2M 1ZTTA 1REGX 4LR9A 2RKIA 3Q8SB 1C2PA 1F2HA 1FVSA 3BN4A 2I5JB 4PG8A 2H5EA 1NH7A 4CGHA 1TK0A 3MTJA 5AQOA 1SL0A 4ED5A 4C1NI 3J80O 1YJWN 4DL6A 4CEEA 2P1JA 4FM0A 4JHDA 3VEYA 1IBKJ 5L46A 3P6YC 4ZJOA 1AZSA 3EGWB 4NL5A 4Y2MA 4DU1A 1S1TA 2A3ZA 3KLEA 2KYXA 1LWCB 3WEEB 4TU7A 1D5AA 2OPRB 4FKXA 1KP6A 3I31A 4H54A 2IBOA 3HHKA 2F96A 1TU0B 4M1KA 1H7WA 1X5SA 1FO1A 3HZ6A 4PG4A 3ILLA 4Z0UA 5I4MA 1VSFA 3B6OA 5JVGL 4GNIA 2CH6A 1NO8A 1RAIB 4JK7A 3PRBA 1UVJA 2J9CA 4X4TA 4OX9K 4WF9L 4DOZA 3DRSA 4HLBA 3QWPA 2HFVA 4F3MA 1SC1B 1EWRA 4AF1A 1TAQA 2I1RA 2VGMA 2R7SA 3E1YA 3DC2A 3CCLN 5GAGP 3GV5B 2HHWA 5HRSA 1W7AA 4LF6K 4M94A 2QC3A 1K0TA 4H5TA 3HDSA 3MEKA 2V4RA 3FR0A 2POKA 5J2PB 2VUGA 3Q0AA 3DRRB 4DV6K 3FMWA 4NLUA 3J81U 4ZMMA 4CJ4A 3O1BA 4J5OA 4LFAF 1T95A 3CJKB 4EFAC 4IXCA 3LDLA 1ZOTA 4LFBJ 1U2VB 4OLBA 3QRPA 3C95A 1GLEG 5AQQA 3FEZA 1OSCA 3CCRS 1D3WA 1BMQB 4CZKA 3AA5X 1W7WA 3TAEA 3SNNA 3JTPA 2QYCA 4CF8A 3QGPA 4OPHA 4EIAA 2XGPA 2WZ1A 2A40A 4DSJA 4YY3K 1YHQN 2UUAK 2GAGC 5F8LA 1N8RT 4O3PA 4FJLA 4QWEA 4Q43A 2C22A 4CLWA 4CJ7A 4FWNA 4PG5A 3BSCA 1YVNA 4WFNL 4FKYA 1ITGA 2FB0A 3VQSA 2LQBA 4P2XA 3NS6A 1IVZA 5J2QA 3RR8A 4YOYA 2CJYB 3IBCB 4CD3A 4JYAK 4FYXB 3PNIA 5C2GA 2C2ZB 3KOAA 5HRPA 2IVFB 3EY1A 4GV3A 3SUPA 2V9KA 3ZZ0A 1NDKA 1ZBTA 1T6DA 1YX2A 1VLYA 4OLOA 2QFJA 1RAJA 2DNMA 2B4JA 2GS8A 1B9DA 5GAGU 3O5BA 1BY9A 2FTRA 2IJFA 3F44A 2D7SA 4FZXC 3MWPA 3OJUA 1NXIA 4ED2A 4DWIA 3MXMA 2HLUA 2RRNA 1SKWA 4OX9F 3D9BA 2QK9A 4M5JA 3QFUA 3DLJA 3IO1A 3BZCA 3JXUA 1X3MA 1JLQA 2VBZA 2HHSA 4C23A 1MN9A 4J9LA 3ZEUA 1NNDA 2FYXA 3IG1B 3DWLA 4XPEA 3V4IB 3X1LB 2IVYA 2ROGA 1HQEA 2PYLA 3QT7A 4IDKA 3VPZA 3WQUA 2CG4A 5FPMA 3HM8A 2R7WA 3CJ3A 3CCJN 1HPZB 1CLFA 4LMZA 4MH8A 2MQQA 2NLWA 4FJKA 3KWMA 4ZN3A 2H5IB 2V8DA 5I3UB 4KHSA 3DI6B 1M5HA 3U4LA 4WFBQ 1GTEA 3HSZA 2WHOA 2O8CA 1U45A 4UOCA 1TVRA 4YS2A 2YKPA 1CXUA 4ES2A 4PEOA 2VQFF 3VAIA 2AW0A 4FS2A 3VQ7A 2FLPA 4B3TK 3KHGA 4GKJJ 2BANB 1YSJA 3HSGA 1X9SA 2MSSA 5M1PA 1ZA2B 4OI1A 4AE5A 1Q7YO 3UCUP 3TWHA 4RUCA 3V81B 3HFZB 5GMDA 1R8HA 3O08A 2MQLA 4HT7A 3A13A 3B8HA 3QWUA 2MKCA 1REVB 4DSKA 2HGMA 3P3DA 4Y3CA 3ZEUB 2B0GA 4X65J 4DV0F 2HZCA 1EIYB 1SUQA 4TY8A 4CJWA 4B17A 3GOIA 5KT7A 1RWUA 4XO0A 1LNQA 3VQ4A 3NWGA 4DL3A 4PPZA 4WE1B 2F1FA 1X7VA 5AFUA 1S9GA 4NLCA 2MZSA 2ZM6J 1Z26A 3M2VA 1EETA 4KTQA 2DNNA 1FXDA 1ZBFA 2IVMA 4M3XA 3T5KA 1S0MA 2YQ0A 1HBUA 2NQPA 1DAXA 4WYWA 1UWBA 4DX6A 1EB0A 1ZM2A 5DM7L 3I9V9 5AQLA 2D41A 2DHGA 2D3UA 4MIWA 3C14A 2C3OA 5FRMA 2JLEA 3QBXA 4PXCA 5DZ6A 3TSQA 5DZ7A 3MR7A 4I4BA 4AM6A 4KH1B 2Y9HA 5AQVA 4B3TJ 4DUYF 2C1EB 4GMJB 3ENAA 4DV3K 4DUYK 1VFJA 3EZWA 3OTBA 2LFVA 1RCOB 4H4OB 4ZITA 4QZVB 4LFCK 1SJRA 3IFEA 3N0VA 1OQ6A 4I6AA 4OPKA 2YH1A 1N33J 4LF6F 4IG3B 4RBTA 1S9GB 1T3NA 3SMPA 2J7KA 3O1WA 2M5YA 1HBMA 2Q0UA 4GVEA 3CPWM 3DYAB 2FBVA 4ILMA 2RHKA 3EDQB 3OTDA 1OPZA 4DV1K 4HYKA 1SJFA 3I8BA 1WG1A 4NMLA 3ZNUA 3AA2A 2HNDB 4WYBA 2BJEA 1XNQF 1DRZA 4DR7F 1WJ9A 4LJMA 3K57A 4YOTA 2WSEC 1YJRA 1BQNA 3BS9A 3CJ5A 2J6TA 4BDYA 3ENWA 2IC3B 3H6EA 5B0DA 4RX6A 2QWPA 2PEBA 4V1Ak 3HMJG 2E1RA 5A6PA 3CFOA 1TUYA 4KH6A 2CGLA 4ZJLA 3MURP 2KB2A 4LBHA 4DUYJ 4DSFA 3KWIA 1EJ7L 4EP5A 4KAZA 4ZVGA 2N3LA 2EG1A 2UUBK 3X3UA 4BHQA 4Z4FA 4DXLA 4JI0F 1T05A 4C0BA 3NG8A 2ASDA 5MLCV 4OYMA 3TU5A 3S9HA 3M8PA 5HP1B 3NNCA 3R8YA 1U0HB 3R6MA 1QZ5A 3GFYA 3DRXA 2GJ2A 4G65A 3NGYA 3HVAA 4CJFA 3RB6A 4O0NA 1WHXA 4QR1A 2C2NA 4L3KA 4I6WA 4IR9A 3HSCA 2CDRB 4K4TA 2P9KA 1KLNA 3BH6B 1NG9A 2ZUAA 5KFDA 2PY5A 5JUMA 1WC0A 4LC9B 1LW2A 3W7BA 2HRUA 2QL9B 2B56A 1TL3B 2XSJB 1VQ4N 5EDWA 2CQBA 5E84A 4JUZA 4PKGA 2ASYA 5G4DA 2VDIA 3MM5A 4LF2A 2HWTA 2DNQA 2VPYB 3O4WA 2P9SA 3EWGA 3H20A 1FFGB 5FLXU 3C0BA 3KK3B 5KFKA 2BVZA 4MAKA 1S9FA 2R8GA 1NEEA 4DR5K 3RB0A 2VPZB 3EZOA 1S72N 1QUPA 4J2DA 3P96A 4UUWA 2DGUA 5ETKA 4DMZA 1O8BA 4WQ4C 2XULA 1KOOA 2YQ3A 4KSEB 2HQDA 3UNYA 2HVIA 3Q8UA 3T1HF 3E8OA 2VH7A 2A10A 1FVQA 3VGTA 2UP1A 3D3CJ 1GLDG 5K5MA 2RIJA 3RUBL 3J80U 5D4PA 1ULRA 5DJBA 2I7NA 4IRDA 4NPOA 1SKUB 2VJVA 4LT6A 4ANEA 1FF2A 2ILZA 3V1QA 3MAAA 1QM9A 1YJUA 2K8GA 4IOXA 1N34F 4OHVA 3SUOA 1LV5A 3K5PA 2E7WA 3VGSA 2WOMA 2PA8D 2NUBA 1R89A 2ILYA 3WC0A 3KHLA 2QZ8A 5HLFA 4IRKA 4FK4A 4U7CA