4IGXA

Crystal structure of kirola (act d 11) - triclinic form
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
146
structure length
146
Chain Sequence
b'SGKMVKQVEILSDGIVFYEIFRYRLYLISEMSPVNIQGVDLLEGNWGTVGSVIFFKYTIDGKEKTAKDIVEAIDEETKSVTFKIVEGDLMELYKTFIIIVQVDTKGEHNSVTWTFHYEKLKEDVEEPNTLMNFCIEITKDIETYHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kirola
publication title Structural and bioinformatic analysis of the kiwifruit allergen Act d 11, a member of the family of ripening-related proteins.
pubmed doi rcsb
molecule tags Allergen
total genus 45
structure length 146
sequence length 146
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00407 Bet_v_1 Pathogenesis-related protein Bet v I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 4igxA00
3W9KA 2E3NA 3RT0C 3UJLA 2LAKA 2QPVA 3F08A 3QN1A 1X53A 4XRTA 3NMVA 2A1LA 2L8OA 3K90A 4M9WA 1JSSA 3KDHA 2Q3QA 4Z3LA 1H2OA 3TVRA 3KB3A 3CNWA 1IFVA 2LPXA 4A84A 2LF2A 5E4MA 2LDKA 3KDIA 1VJHA 5AMWA 1XN5A 3KAYA 4MA6A 4REJA 2KCZA 5C9YA 2RERA 2RESA 4FPWA 1LN1A 3NEFA 4Q0KA 4A88A 1XFSA 3FO5A 4DSCA 4REHA 4REIA 4A81A 1EM2A 5I9JA 1LLTA 2E3OA 4JHIA 5BRLA 2E3QA 3TVQA 3P51A 4JHGA 3H3QA 4IH2A 4LG5A 3TFZA 3NS2A 3E85A 4IGYA 2N4AA 3H3TA 3IE5A 1TXCA 3R6PA 2WQLA 1T27A 4BTZA 4B9RA 4IHRA 4LA7A 3QSZA 4LGAA 1XDFA 4JHHA 3NMTA 3OQUA 4BKCA 4N3EA 3Q63A 1FSKA 2LIOA 4Y31A 4A8GA 2Z9ZA 4MAPA 2K5GA 3KAZA 3RT2A 1BV1A 2LEQA 3UIDA 2FFSA 4IGVA 2E3SA 2NN5A 2GKDA 3H3RA 4XRWA 4A85A 4BK6A 1B6FA 3RD6A 2N4BA 2KTEA 3KB0A 2K7HA 2L9PA 3OH8A 4IGWA 4A8UA 1ICXA 4M9BA 3P9VA 3NI8A 4C9CA 2LCGA 1LN2A 1ZXFA 2LUZA 3ELIA 4C9IA 1KCMA 2FLHA 2M89A 2KF2A 4N0GC 2EJXA 2E3MA 3PUTA 1T17A 2L65A 5E4BA 1UW5A 2BK0A 2D4RA 3W9RA 5JO1A 4WVOA 3ZVUA 3KL1A 3NMPA 2REZA 3P0LA 4IH0A 3C0VA 4A83A 1FM4A 3NEGA 2QIMA 4BK7A 4BKDA 3KLXA 2I9YA 1TW0A 1XN6A 3OTLA 1XUVA 4JDAA 5I8FA 3NMNA 2VNEA 1LN3A 4GY9A 4QIPA 2Z9YA 5JO2A 2E3PA 4RYVA 4C94A 1E09A 2E3RA 1Z94A 3PU2A 3WG8A 3Q6AA 2NS9A 3NMHA 3NR4A 3OJIA 2KEWA 4OICA 2IL5A 3JRSA 3KDJA 4LGBA 4MNSA 2PCSA 5E4DA 4A86A 2MOUA 4PSBA 3TL1A 2LE1A 4JDLA 3H3SA 4A87A 3UQHA 3NJOA 4DS8A 5E46A 3NJ1A 2M47A 2PSOA 3JRQB 4IGXA 3K3KA 2LGHA 2VQ5A 1QMRA 3NJ0A 5JNNA 2R55A 3IJTA 1BTVA 4A8VA 3Q64A 4A80A 4DSBA 3GGNA 4R7KA
chains in the Genus database with same CATH superfamily
3W9KA 2E3NA 3RT0C 4QCKA 3UJLA 2LAKA 2QPVA 3F08A 3QN1A 1X53A 4XRTA 3NMVA 2A1LA 2L8OA 3K90A 4M9WA 1JSSA 3KDHA 2Q3QA 4Z3LA 1H2OA 3TVRA 3KB3A 3CNWA 1IFVA 2LPXA 4A84A 2LF2A 5E4MA 2LDKA 3KDIA 1VJHA 5AMWA 1XN5A 3KAYA 4MA6A 4REJA 2KCZA 5C9YA 2RERA 2RESA 4E6FA 4DSCA 4KPYA 4FPWA 3GB4A 1LN1A 3GL0A 3NEFA 3NQNA 1XFSA 3FO5A 4Q0KA 4A88A 4REHA 4REIA 3GOBA 4A81A 1EM2A 5I9JA 4NCBA 1LLTA 2E3OA 4JHIA 5BRLA 2E3QA 3TVQA 4JHYA 3P51A 4JHGA 4N47A 3H3QA 4IH2A 4LG5A 3TFZA 4NCAA 3NS2A 3E85A 4IGYA 2N4AA 3H3TA 3IE5A 1TXCA 3R6PA 2WQLA 1T27A 4BTZA 2YH6A 4B9RA 4IHRA 4LA7A 4QDCA 3QSZA 4LGAA 1XDFA 4JHHA 3NMTA 3OQUA 4BKCA 4N3EA 3Q63A 1FSKA 2LIOA 4Y31A 4A8GA 2Z9ZA 4MAPA 2K5GA 3KAZA 3RT2A 1BV1A 2LEQA 3UIDA 3HO1A 3GL2A 2FFSA 4IGVA 2E3SA 2NN5A 2GKDA 3H3RA 3TGOC 3HM9A 3DLBA 4XRWA 4A85A 4BK6A 4N41A 3HVRA 1B6FA 3RD6A 2N4BA 2KTEA 3KB0A 2K7HA 2L9PA 3OH8A 4IGWA 4A8UA 1ICXA 4M9BA 4QDFA 3HK2A 3P9VA 3NI8A 4C9CA 2LCGA 1LN2A 1ZXFA 2LUZA 3ELIA 4C9IA 1KCMA 2FLHA 2M89A 2KF2A 4N0GC 2EJXA 2E3MA 2ZYLA 3PUTA 2LAFA 3GTSA 1T17A 2L65A 5E4BA 1UW5A 2BK0A 2D4RA 3W9RA 5JO1A 4WVOA 3ZVUA 3DLHA 3KL1A 3NMPA 2REZA 3P0LA 4IH0A 3C0VA 4A83A 1FM4A 3GKEA 3NEGA 2QIMA 4BK7A 4BKDA 3KLXA 2I9YA 1TW0A 1XN6A 3OTLA 1XUVA 4JDAA 5I8FA 3NMNA 2VNEA 1LN3A 4GY9A 4QIPA 2Z9YA 3HJFA 3GTEA 5JO2A 2E3PA 4RYVA 4C94A 1E09A 2E3RA 1Z94A 3PU2A 3WG8A 3Q6AA 2NS9A 3NMHA 4QDFB 3NR4A 4N76A 3OJIA 5EKQC 2KEWA 4OICA 2IL5A 3JRSA 3KDJA 4LGBA 4MNSA 3F73A 4QDDA 2PCSA 5E4DA 4A86A 2MOUA 4PSBA 3TL1A 2LE1A 4JDLA 3H3SA 4A87A 3UQHA 3NJOA 4DS8A 5E46A 3NJ1A 2M47A 2PSOA 3JRQB 4IGXA 3K3KA 3HXMA 2LGHA 2VQ5A 1QMRA 3NJ0A 5JNNA 2R55A 3IJTA 1BTVA 4A8VA 3Q64A 4A80A 4DSBA 3GGNA 4R7KA
chains in the Genus database with same CATH topology
3W9KA 2E3NA 3RT0C 4QCKA 3UJLA 2LAKA 2QPVA 3F08A 3QN1A 1X53A 4XRTA 3NMVA 2A1LA 2L8OA 3K90A 4M9WA 1JSSA 3KDHA 2Q3QA 4Z3LA 1H2OA 3TVRA 3KB3A 3CNWA 1IFVA 2LPXA 4A84A 2LF2A 5E4MA 2LDKA 3KDIA 1VJHA 5AMWA 1XN5A 3KAYA 4MA6A 4REJA 2KCZA 5C9YA 2RERA 2RESA 4E6FA 4DSCA 4KPYA 4FPWA 3GB4A 1LN1A 3GL0A 3NEFA 3NQNA 1XFSA 3FO5A 4Q0KA 4A88A 4REHA 4REIA 3GOBA 4A81A 1EM2A 5I9JA 4NCBA 1LLTA 2E3OA 4JHIA 5BRLA 2E3QA 3TVQA 4JHYA 3P51A 4JHGA 4N47A 3H3QA 4IH2A 4LG5A 3TFZA 4NCAA 3NS2A 3E85A 4IGYA 2N4AA 3H3TA 3IE5A 1TXCA 3R6PA 2WQLA 1T27A 4BTZA 2YH6A 4B9RA 4IHRA 4LA7A 4QDCA 3QSZA 4LGAA 1XDFA 4JHHA 3NMTA 3OQUA 4BKCA 4N3EA 3Q63A 1FSKA 2LIOA 4Y31A 4A8GA 2Z9ZA 4MAPA 2K5GA 3KAZA 3RT2A 1BV1A 2LEQA 3UIDA 3HO1A 3GL2A 2FFSA 4IGVA 2E3SA 2NN5A 2GKDA 3H3RA 3TGOC 3HM9A 3DLBA 4XRWA 4A85A 4BK6A 4N41A 3HVRA 1B6FA 3RD6A 2N4BA 2KTEA 3KB0A 2K7HA 2L9PA 3OH8A 4IGWA 4A8UA 1ICXA 4M9BA 4QDFA 3HK2A 3P9VA 3NI8A 4C9CA 2LCGA 1LN2A 1ZXFA 2LUZA 3ELIA 4C9IA 1KCMA 2FLHA 2M89A 2KF2A 4N0GC 2EJXA 2E3MA 2ZYLA 3PUTA 2LAFA 3GTSA 1T17A 2L65A 5E4BA 1UW5A 2BK0A 2D4RA 3W9RA 5JO1A 4WVOA 3ZVUA 3DLHA 3KL1A 3NMPA 2REZA 3P0LA 4IH0A 3C0VA 4A83A 1FM4A 3GKEA 3NEGA 2QIMA 4BK7A 4BKDA 3KLXA 2I9YA 1TW0A 1XN6A 3OTLA 1XUVA 4JDAA 5I8FA 3NMNA 2VNEA 1LN3A 4GY9A 4QIPA 2Z9YA 3HJFA 3GTEA 5JO2A 2E3PA 4RYVA 4C94A 1E09A 2E3RA 1Z94A 3PU2A 3WG8A 3Q6AA 2NS9A 3NMHA 4QDFB 3NR4A 4N76A 3OJIA 5EKQC 2KEWA 4OICA 2IL5A 3JRSA 3KDJA 4LGBA 4MNSA 3F73A 4QDDA 2PCSA 5E4DA 4A86A 2MOUA 4PSBA 3TL1A 2LE1A 4JDLA 3H3SA 4A87A 3UQHA 3NJOA 4DS8A 5E46A 3NJ1A 2M47A 2PSOA 3JRQB 4IGXA 3K3KA 3HXMA 2LGHA 2VQ5A 1QMRA 3NJ0A 5JNNA 2R55A 3IJTA 1BTVA 4A8VA 3Q64A 4A80A 4DSBA 3GGNA 4R7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W9K A;  2E3N A;  3RT0 C;  3UJL A;  2LAK A;  2QPV A;  3F08 A;  3QN1 A;  1X53 A;  4XRT A;  3NMV A;  2A1L A;  2L8O A;  3K90 A;  4M9W A;  1JSS A;  3KDH A;  2Q3Q A;  4Z3L A;  1H2O A;  3TVR A;  3KB3 A;  3CNW A;  1IFV A;  2LPX A;  4A84 A;  2LF2 A;  5E4M A;  2LDK A;  3KDI A;  1VJH A;  5AMW A;  1XN5 A;  3KAY A;  4MA6 A;  4REJ A;  2KCZ A;  5C9Y A;  2RER A;  2RES A;  4FPW A;  1LN1 A;  3NEF A;  4Q0K A;  4A88 A;  1XFS A;  3FO5 A;  4DSC A;  4REH A;  4REI A;  4A81 A;  1EM2 A;  5I9J A;  1LLT A;  2E3O A;  4JHI A;  5BRL A;  2E3Q A;  3TVQ A;  3P51 A;  4JHG A;  3H3Q A;  4IH2 A;  4LG5 A;  3TFZ A;  3NS2 A;  3E85 A;  4IGY A;  2N4A A;  3H3T A;  3IE5 A;  1TXC A;  3R6P A;  2WQL A;  1T27 A;  4BTZ A;  4B9R A;  4IHR A;  4LA7 A;  3QSZ A;  4LGA A;  1XDF A;  4JHH A;  3NMT A;  3OQU A;  4BKC A;  4N3E A;  3Q63 A;  1FSK A;  2LIO A;  4Y31 A;  4A8G A;  2Z9Z A;  4MAP A;  2K5G A;  3KAZ A;  3RT2 A;  1BV1 A;  2LEQ A;  3UID A;  2FFS A;  4IGV A;  2E3S A;  2NN5 A;  2GKD A;  3H3R A;  4XRW A;  4A85 A;  4BK6 A;  1B6F A;  3RD6 A;  2N4B A;  2KTE A;  3KB0 A;  2K7H A;  2L9P A;  3OH8 A;  4IGW A;  4A8U A;  1ICX A;  4M9B A;  3P9V A;  3NI8 A;  4C9C A;  2LCG A;  1LN2 A;  1ZXF A;  2LUZ A;  3ELI A;  4C9I A;  1KCM A;  2FLH A;  2M89 A;  2KF2 A;  4N0G C;  2EJX A;  2E3M A;  3PUT A;  1T17 A;  2L65 A;  5E4B A;  1UW5 A;  2BK0 A;  2D4R A;  3W9R A;  5JO1 A;  4WVO A;  3ZVU A;  3KL1 A;  3NMP A;  2REZ A;  3P0L A;  4IH0 A;  3C0V A;  4A83 A;  1FM4 A;  3NEG A;  2QIM A;  4BK7 A;  4BKD A;  3KLX A;  2I9Y A;  1TW0 A;  1XN6 A;  3OTL A;  1XUV A;  4JDA A;  5I8F A;  3NMN A;  2VNE A;  1LN3 A;  4GY9 A;  4QIP A;  2Z9Y A;  5JO2 A;  2E3P A;  4RYV A;  4C94 A;  1E09 A;  2E3R A;  1Z94 A;  3PU2 A;  3WG8 A;  3Q6A A;  2NS9 A;  3NMH A;  3NR4 A;  3OJI A;  2KEW A;  4OIC A;  2IL5 A;  3JRS A;  3KDJ A;  4LGB A;  4MNS A;  2PCS A;  5E4D A;  4A86 A;  2MOU A;  4PSB A;  3TL1 A;  2LE1 A;  4JDL A;  3H3S A;  4A87 A;  3UQH A;  3NJO A;  4DS8 A;  5E46 A;  3NJ1 A;  2M47 A;  2PSO A;  3JRQ B;  4IGX A;  3K3K A;  2LGH A;  2VQ5 A;  1QMR A;  3NJ0 A;  5JNN A;  2R55 A;  3IJT A;  1BTV A;  4A8V A;  3Q64 A;  4A80 A;  4DSB A;  3GGN A;  4R7K A; 
#chains in the Genus database with same CATH topology
 3W9K A;  2E3N A;  3RT0 C;  4QCK A;  3UJL A;  2LAK A;  2QPV A;  3F08 A;  3QN1 A;  1X53 A;  4XRT A;  3NMV A;  2A1L A;  2L8O A;  3K90 A;  4M9W A;  1JSS A;  3KDH A;  2Q3Q A;  4Z3L A;  1H2O A;  3TVR A;  3KB3 A;  3CNW A;  1IFV A;  2LPX A;  4A84 A;  2LF2 A;  5E4M A;  2LDK A;  3KDI A;  1VJH A;  5AMW A;  1XN5 A;  3KAY A;  4MA6 A;  4REJ A;  2KCZ A;  5C9Y A;  2RER A;  2RES A;  4E6F A;  4DSC A;  4KPY A;  4FPW A;  3GB4 A;  1LN1 A;  3GL0 A;  3NEF A;  3NQN A;  1XFS A;  3FO5 A;  4Q0K A;  4A88 A;  4REH A;  4REI A;  3GOB A;  4A81 A;  1EM2 A;  5I9J A;  4NCB A;  1LLT A;  2E3O A;  4JHI A;  5BRL A;  2E3Q A;  3TVQ A;  4JHY A;  3P51 A;  4JHG A;  4N47 A;  3H3Q A;  4IH2 A;  4LG5 A;  3TFZ A;  4NCA A;  3NS2 A;  3E85 A;  4IGY A;  2N4A A;  3H3T A;  3IE5 A;  1TXC A;  3R6P A;  2WQL A;  1T27 A;  4BTZ A;  2YH6 A;  4B9R A;  4IHR A;  4LA7 A;  4QDC A;  3QSZ A;  4LGA A;  1XDF A;  4JHH A;  3NMT A;  3OQU A;  4BKC A;  4N3E A;  3Q63 A;  1FSK A;  2LIO A;  4Y31 A;  4A8G A;  2Z9Z A;  4MAP A;  2K5G A;  3KAZ A;  3RT2 A;  1BV1 A;  2LEQ A;  3UID A;  3HO1 A;  3GL2 A;  2FFS A;  4IGV A;  2E3S A;  2NN5 A;  2GKD A;  3H3R A;  3TGO C;  3HM9 A;  3DLB A;  4XRW A;  4A85 A;  4BK6 A;  4N41 A;  3HVR A;  1B6F A;  3RD6 A;  2N4B A;  2KTE A;  3KB0 A;  2K7H A;  2L9P A;  3OH8 A;  4IGW A;  4A8U A;  1ICX A;  4M9B A;  4QDF A;  3HK2 A;  3P9V A;  3NI8 A;  4C9C A;  2LCG A;  1LN2 A;  1ZXF A;  2LUZ A;  3ELI A;  4C9I A;  1KCM A;  2FLH A;  2M89 A;  2KF2 A;  4N0G C;  2EJX A;  2E3M A;  2ZYL A;  3PUT A;  2LAF A;  3GTS A;  1T17 A;  2L65 A;  5E4B A;  1UW5 A;  2BK0 A;  2D4R A;  3W9R A;  5JO1 A;  4WVO A;  3ZVU A;  3DLH A;  3KL1 A;  3NMP A;  2REZ A;  3P0L A;  4IH0 A;  3C0V A;  4A83 A;  1FM4 A;  3GKE A;  3NEG A;  2QIM A;  4BK7 A;  4BKD A;  3KLX A;  2I9Y A;  1TW0 A;  1XN6 A;  3OTL A;  1XUV A;  4JDA A;  5I8F A;  3NMN A;  2VNE A;  1LN3 A;  4GY9 A;  4QIP A;  2Z9Y A;  3HJF A;  3GTE A;  5JO2 A;  2E3P A;  4RYV A;  4C94 A;  1E09 A;  2E3R A;  1Z94 A;  3PU2 A;  3WG8 A;  3Q6A A;  2NS9 A;  3NMH A;  4QDF B;  3NR4 A;  4N76 A;  3OJI A;  5EKQ C;  2KEW A;  4OIC A;  2IL5 A;  3JRS A;  3KDJ A;  4LGB A;  4MNS A;  3F73 A;  4QDD A;  2PCS A;  5E4D A;  4A86 A;  2MOU A;  4PSB A;  3TL1 A;  2LE1 A;  4JDL A;  3H3S A;  4A87 A;  3UQH A;  3NJO A;  4DS8 A;  5E46 A;  3NJ1 A;  2M47 A;  2PSO A;  3JRQ B;  4IGX A;  3K3K A;  3HXM A;  2LGH A;  2VQ5 A;  1QMR A;  3NJ0 A;  5JNN A;  2R55 A;  3IJT A;  1BTV A;  4A8V A;  3Q64 A;  4A80 A;  4DSB A;  3GGN A;  4R7K A; 
#chains in the Genus database with same CATH homology
 3W9K A;  2E3N A;  3RT0 C;  4QCK A;  3UJL A;  2LAK A;  2QPV A;  3F08 A;  3QN1 A;  1X53 A;  4XRT A;  3NMV A;  2A1L A;  2L8O A;  3K90 A;  4M9W A;  1JSS A;  3KDH A;  2Q3Q A;  4Z3L A;  1H2O A;  3TVR A;  3KB3 A;  3CNW A;  1IFV A;  2LPX A;  4A84 A;  2LF2 A;  5E4M A;  2LDK A;  3KDI A;  1VJH A;  5AMW A;  1XN5 A;  3KAY A;  4MA6 A;  4REJ A;  2KCZ A;  5C9Y A;  2RER A;  2RES A;  4E6F A;  4DSC A;  4KPY A;  4FPW A;  3GB4 A;  1LN1 A;  3GL0 A;  3NEF A;  3NQN A;  1XFS A;  3FO5 A;  4Q0K A;  4A88 A;  4REH A;  4REI A;  3GOB A;  4A81 A;  1EM2 A;  5I9J A;  4NCB A;  1LLT A;  2E3O A;  4JHI A;  5BRL A;  2E3Q A;  3TVQ A;  4JHY A;  3P51 A;  4JHG A;  4N47 A;  3H3Q A;  4IH2 A;  4LG5 A;  3TFZ A;  4NCA A;  3NS2 A;  3E85 A;  4IGY A;  2N4A A;  3H3T A;  3IE5 A;  1TXC A;  3R6P A;  2WQL A;  1T27 A;  4BTZ A;  2YH6 A;  4B9R A;  4IHR A;  4LA7 A;  4QDC A;  3QSZ A;  4LGA A;  1XDF A;  4JHH A;  3NMT A;  3OQU A;  4BKC A;  4N3E A;  3Q63 A;  1FSK A;  2LIO A;  4Y31 A;  4A8G A;  2Z9Z A;  4MAP A;  2K5G A;  3KAZ A;  3RT2 A;  1BV1 A;  2LEQ A;  3UID A;  3HO1 A;  3GL2 A;  2FFS A;  4IGV A;  2E3S A;  2NN5 A;  2GKD A;  3H3R A;  3TGO C;  3HM9 A;  3DLB A;  4XRW A;  4A85 A;  4BK6 A;  4N41 A;  3HVR A;  1B6F A;  3RD6 A;  2N4B A;  2KTE A;  3KB0 A;  2K7H A;  2L9P A;  3OH8 A;  4IGW A;  4A8U A;  1ICX A;  4M9B A;  4QDF A;  3HK2 A;  3P9V A;  3NI8 A;  4C9C A;  2LCG A;  1LN2 A;  1ZXF A;  2LUZ A;  3ELI A;  4C9I A;  1KCM A;  2FLH A;  2M89 A;  2KF2 A;  4N0G C;  2EJX A;  2E3M A;  2ZYL A;  3PUT A;  2LAF A;  3GTS A;  1T17 A;  2L65 A;  5E4B A;  1UW5 A;  2BK0 A;  2D4R A;  3W9R A;  5JO1 A;  4WVO A;  3ZVU A;  3DLH A;  3KL1 A;  3NMP A;  2REZ A;  3P0L A;  4IH0 A;  3C0V A;  4A83 A;  1FM4 A;  3GKE A;  3NEG A;  2QIM A;  4BK7 A;  4BKD A;  3KLX A;  2I9Y A;  1TW0 A;  1XN6 A;  3OTL A;  1XUV A;  4JDA A;  5I8F A;  3NMN A;  2VNE A;  1LN3 A;  4GY9 A;  4QIP A;  2Z9Y A;  3HJF A;  3GTE A;  5JO2 A;  2E3P A;  4RYV A;  4C94 A;  1E09 A;  2E3R A;  1Z94 A;  3PU2 A;  3WG8 A;  3Q6A A;  2NS9 A;  3NMH A;  4QDF B;  3NR4 A;  4N76 A;  3OJI A;  5EKQ C;  2KEW A;  4OIC A;  2IL5 A;  3JRS A;  3KDJ A;  4LGB A;  4MNS A;  3F73 A;  4QDD A;  2PCS A;  5E4D A;  4A86 A;  2MOU A;  4PSB A;  3TL1 A;  2LE1 A;  4JDL A;  3H3S A;  4A87 A;  3UQH A;  3NJO A;  4DS8 A;  5E46 A;  3NJ1 A;  2M47 A;  2PSO A;  3JRQ B;  4IGX A;  3K3K A;  3HXM A;  2LGH A;  2VQ5 A;  1QMR A;  3NJ0 A;  5JNN A;  2R55 A;  3IJT A;  1BTV A;  4A8V A;  3Q64 A;  4A80 A;  4DSB A;  3GGN A;  4R7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...