4IH1A

Crystal structure of karrikin insensitive 2 (kai2) from arabidopsis thaliana
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
268
structure length
268
Chain Sequence
MGVVEEAHNVKVIGSGEATIVLGHGFGTDQSVWKHLVPHLVDDYRVVLYDNMGAGTTNPDYFDFDRYSNLEGYSFDLIAILEDLKIESCIFVGHSVSAMIGVLASLNRPDLFSKIVMISASPRYVNDVDYQGGFEQEDLNQLFEAIRSNYKAWCLGFAPLAVGGDMDSIAVQEFSRTLFNMRPDIALSVGQTIFQSDMRQILPFVTVPCHILQSVKDLAVPVVVSEYLHANLGCESVVEVIPSDGHLPQLSSPDSVIPVILRHIRNDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of two phytohormone signal-transducing alpha / beta hydrolases: karrikin-signaling KAI2 and strigolactone-signaling DWARF14.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords Hydrolase, alpha/beta fold family protein
total genus 91
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2012-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ih1A00
4BVLA 5BWBA 3HI4A 2G4LA 1ISPA 2ROQA 3EQ9A 3D4LA 4Y9SA 1JI3A 3DLTA 2I03A 5DTIA 3K6KA 2JF0A 3QMMA 2QR5A 3W9UA 4B7ZA 5C7YA 2PPLA 3HJUA 1CUYA 2DR0A 1UK7A 2XMQA 4X71A 1P0MA 3W05A 1VZ2A 1EINA 3IURA 4DMCA 4X90A 1DT5A 3VDXA 4Y2UA 3GA7A 2H7CA 3WLAA 1CEXA 1WB6A 2GZRA 2WFZA 4CCYA 3GELA 1QFMA 2ZYHA 1AX9A 1VXRA 4AO6A 3E0XA 4LIPD 5ISMA 3M3DA 5JAOA 2OG1A 4UHEA 4CI9A 2V96A 3A2NA 3IDAA 1HLGA 2XUHA 1XZJA 4L9AA 3QMVA 1UOOA 3R3UA 5IVDA 5ALJA 4AMYA 1CUCA 4C87A 1THGA 2WKWA 1XRPA 3GROA 4ZV7A 2W6CX 1MX5A 3WK6A 2HADA 1YSCA 1MO2A 5AM3A 3OPMA 4J03A 3O4JA 4UBJA 5ALDA 1VXOA 4CCYB 2RGUA 4IO0A 1LPAB 3V1NA 4J0IA 3G7NA 4HAIA 1DX6A 4J0KA 5FPQA 3X3HA 2OCLA 3R0VA 4X7BA 5AKKA 1FFCA 4KRYA 1O6FA 5EHXA 1ZI9A 3VKFA 1XQVA 5CT8A 3OM8A 3ZWQA 1DU4A 1F8UA 4FLEA 2XMBA 3KD2A 4DM7A 1E8DA 4ZREA 1CUZA 2HL6A 2QM0A 1K5PA 1EI9A 1GXSA 4H7EA 4A5SA 4CG2A 2R8BA 4C4YA 3D7RA 2JGJA 5LLSA 1U4NA 4BYMA 4XX1A 1FFAA 4DGQA 2QVBA 2XQKA 4RNCA 3LLCA 5AH0A 5CBKA 2C0QA 3EBLA 3O0DA 4GECA 1J06A 1XZBA 4J0HA 3IIIA 1UK8A 3OG9A 1FFEA 1O6GA 2FUKA 2H9YA 3FYUB 4FBMA 5JZBA 4B83A 4WJLA 1LGYA 3FNBA 1IVYA 4G4IA 5AM0A 3E3AA 3WQHA 4L0CA 1VJ5A 3U1TA 5T4HA 4NZZA 3O4HA 2Z5GA 1YAJA 2WIJA 1CUUA 3K2IA 5AI6A 4UBNA 1CUSA 4UBMA 3BIWA 4KRXA 5E4JA 4C4ZA 3SK0A 1QO7A 1AGYA 1WM1A 1LBSA 2HU8A 3WK4A 5JYCA 4AB1A 1Q0ZA 4FOLA 1CUWA 2AJLI 4MQLA 3ILSA 4J0CA 3ZLUA 1TK3A 2XE4A 2WUFA 3S2ZA 5HF5A 5D3KA 1IUOA 1CUAA 4I3FA 2AJDA 3ZLTA 2AJCA 1GQSA 4H35A 5AI5A 4J0JA 1AQLA 4B9EA 3SX4A 5LYYA 3N0TA 2XMRA 3A2LA 1E89A 1HPLA 3QH4A 4U2BA 1GKKA 3NUZA 3QZUA 4EB0A 1VOTA 5ALHA 5J3JA 2PSFA 1DX4A 3FWHA 4DSZA 3AZQA 2VT6A 3W2TA 2HRQA 2CUTA 4HXEB 2PKYX 3LP5A 4E15A 1XKTA 4W1SA 2ECFA 1B41A 4G4JA 5JIBA 2JGEA 3QYJA 4P9NA 5ALMA 1UFOA 2HA5A 5AKIA 3C6BA 2C7BA 1UKCA 5AK4A 2FJPA 4QWMA 3NGMA 1R9NA 3WKEA 1ZD5A 2QUAA 1GPLA 5AKZA 2NW6A 5ALIA 4LYEA 2RHTA 1N5RA 4UHHA 1SCQA 1I6WA 2WQZA 3LS2A 5HFAA 2PSJA 3D2AA 6YASA 3BJRA 1PV1A 5HF6A 3C45A 1CIJA 5ALVA 4EZIA 2XUIA 2HA3A 4UHBA 1EHYA 3LCRA 3WL8A 4BATA 1UXOA 1RP1A 2XDWA 4U2DA 2Z3ZA 5A7HA 5I9IA 4QLOA 4ZRDA 3G02A 2JGKA 1JMYA 1H2XA 4KYVA 2XB6A 4F5ZA 2C0PA 4QDXA 1K4YA 4E11A 2R11A 1XRRA 2WTNA 2FJ0A 5ALWA 5AK5A 3G8YA 4PSDA 4BAGA 1UK6A 3VXKA 4GXNA 3FCXA 5EGNA 5T4FA 2HFJA 4NVRA 3NOXA 4HRXA 3F67A 2Y1KA 5ALZA 3H1BA 4Q3KA 1AZWA 4MQMA 2HRRA 4Y2JA 1HKHA 3UMJA 4J3JA 1G5FA 2ZJ7A 4UUQA 3RM3A 1W4LA 2GYUA 4LHEA 5A71A 1PFQA 2V97A 5AKGA 3UUEA 3V1MA 2VJBA 4IH9A 3E1GA 3ZLVA 5DNWA 3AJAA 4IHAA 1A8UA 4U2FA 3C5VA 4BAZA 1QONA 2OGTA 1DQYA 3C6XA 4MYDA 4QDOA 1JJFA 2GBFA 1R3DA 3IBTA 4PSUA 5EIHA 4W9RA 1KEZA 5EI5A 3BIXA 5FP0A 3F97A 1TRHA 4N8DA 4OYYA 1JT2A 4OU5A 1XZDA 3BXPA 5DJ5A 3B12A 3WZLA 3C5WP 5JAPA 1UK9A 4BCBA 3G0BA 4HTAA 1QFSA 3H04A 5AI0A 1MNAA 1CUBA 1WCYA 1DWPA 5AK3A 4G4GA 1XRMA 3WA7A 3FAKA 3V1LA 3DKKA 1E8MA 1IZ8A 2QJWA 2LIPA 3BJMA 3CCCA 1CR6A 1WB5A 1CPYA 3EQ8A 4ROTA 3R3ZA 3SWWA 1VLQA 2VATA 5JADA 4J7AA 5LKRA 3R3WA 4Y2VA 4B0OA 5C8VA 4H7DA 1XRLA 2XMSA 2DHEA 3A6ZA 5YASA 4UBKA 4WY8A 3AINA 5ALEA 1FFBA 2ZJ6A 2XUJA 2XUAA 1DWOA 3A2MA 1BN6A 1IUPA 4LKOA 4H7KA 4BCDA 3JW8A 4DYHA 5E4TA 2JEZA 1GPKA 4OB7A 3FLBA 4BVJA 1QLWA 1Z68A 2BAGA 3R3VA 3VVMA 1J2EA 2VJAA 4FBLA 2VT7A 4PW0A 1BEZA 4G8CA 4GLBA 1XZIA 3AZPA 2HA0A 4M0EA 1YR2A 4ZV9A 4K6KA 3WWDA 4YK7A 1ZJ5A 1ZD4A 2JIDA 4WFJA 1K63A 4F21A 2OQVA 2J4CA 1DQZA 1ODTC 3M82A 1EK2A 1ZI6A 1ACLA 1XLWA 3H2HA 4X6UA 5AM2A 2B61A 3DJYA 4V2IA 3QPDA 3DOIA 1QZ3A 5AKYA 1ZGBA 4HXGA 3PUHA 1TIBA 2CZQA 1CUIA 1QGED 3W06A 3EF3A 2C4HA 3WKAA 1B6GA 1L7QA 1GGVA 1LPOA 5D3ZA 2HM7A 1BCRA 4H7HA 5AKLA 5AOCA 3HC7A 5AKXA 3BDVA 3DL7A 3IUQA 2OAEA 2WFLA 2PUHA 4CG3A 4YPVA 2QRUA 4KR0A 4XJVA 3BL8A 5JANA 1A8QA 1EB8A 2BGRA 2I78A 2O7RA 2HIHA 5AOAA 1BN7A 4MWTA 4LXGA 1EVQA 3WKCA 3EIOA 2UZ0A 3I6MA 4P93A 3WL7A 2ES4A 4QE3A 3Q0TA 3HXKA 2XLBA 1HBJA 2WUEA 1VA4A 5KWIA 4AO8A 2XUOA 3ANTA 1XZGA 3WI7A 4FNMA 4BDTA 2PSHA 3ICWA 5DYWA 2WJ4A 1A7UA 3DNMA 3MUOA 5JAUA 4Q05A 4AN0A 3I2KA 4PSCA 4B0PA 3G0CA 4RGYA 4GHWA 1FJ2A 5AO9A 3LIPA 3C6YA 2WHPA 3FYUC 3WZMA 4QA9A 7YASA 4W1PA 1K6EA 2WU4A 5K3AA 3WK9A 5T4BA 2J3DA 5DNVA 1CUHA 3GFFA 1R88A 3FCYA 5EHNA 4BP8A 5JD6A 4MYSA 1GQRA 3H18A 3O9MA 1ORWA 3FOBA 3D2CA 3HACA 3HZOA 1CV2A 2EEPA 3WK7A 1KU0A 4K2AA 1SOMA 3DYIA 5D7BA 3AFIA 3STWA 1OILA 1VZ3A 3MUNA 4LXHA 4FHZA 4B80A 2H1IA 1KU6A 2YH2A 5E2IA 5ALUA 3HYSA 4OCZA 1XFDA 1CQWA 5AIBA 2DQZA 4FTWA 1UKAA 3HLKA 4QEKA 5T4EA 2OCKA 4K6HA 3VISA 3A70A 4M0FA 2G5TA 3KWJA 5C8ZA 1YASA 3K9BA 2HHAA 2HU7A 4RE5A 2B4KA 4UHCA 4DMFA 4OYLA 2PBLA 4JYPA 3S8YA 1X2EA 1QIMA 4A16A 1Q0RA 1AUOA 5AKJA 1U8EA 3I1IA 5A7GA 4Y2RA 5AI8A 4PQEA 4M0MA 2OCIA 2HDWA 5ALFA 5LZ2A 1OXMA 5ALRA 5FDFA 4X97A 2P8SA 4QWWA 3ESBA 1ETHA 3EQ7A 1BEEA 2WUDA 2QS9A 5A2GA 4PF1A 1BCSA 4I4CA 1H2WA 3F9CA 5HZGA 5I7UA 4N5HX 4HS9A 1WPRA 1IUNA 1H22A 5DLPA 2PL5A 1BRTA 5CW2A 3U0VA 1IMJA 1Y7IA 2D0DA 4J0DA 3ESAA 4X6XA 5C81A 2OPHA 2GYVA 4GWLA 2ZYSA 2BCEA 3TJMA 1UWCA 3STTA 3CN9A 1MN6A 2AXEA 4UFPA 5AK6A 3R3XA 5K5EA 4BC0A 2VJDA 3E4DA 4ETWA 4MWSA 1C7JA 2Q0XA 1TCCA 4PV7A 5AIAA 1F6WA 2CEKA 5ALGA 1AMNA 4F60A 5AI9A 3C6ZA 1WHTA 2WUGA 4FLMA 4UBOA 4JUIA 4FLFA 3STXA 3DEAA 4N8SA 5H3HA 4G8BA 3H19A 2BUCA 4BP9A 1ZICA 1VA5A 2RAUA 4W1QA 2VJCA 2XQIA 2DSNA 1P0QA 1ODSA 2JGFA 2V9ZA 4GEGA 4DNOA 2OGSA 2PX6A 2WIGA 4BVKA 1T4MA 1UOQA 4G5XA 1E5TA 2XUGA 2VAXA 2QUBA 1R50A 3P2MA 4KE7A 5HQ3A 4ITVA 2QMQA 1Q83A 1Y7HA 4H7IA 3QMWA 2BUAA 1AC5A 3TEJA 2GBIA 5AOBA 3H2IA 1XZCA 3QM1A 5KWJA 4GBGA 1SC9A 3QBJA 4UFNA 1XZMA 3B5EA 3FYTA 1BU8A 5KBYA 3DD5A 5K3CA 2C58A 4HRYA 1L7RA 3Q8WA 2QOEA 2XI4A 2GZSA 1MJ5A 1YCDA 4EY7A 2X5XA 4QDZA 3WKDA 5ALNA 2J3QA 2PSEA 1R1DA 5K3BA 4AX4A 1NX9A 2G5PA 1E66A 3IUNA 2I3DA 5IKXA 2CMFA 2XMCA 3WYDA 1DT3A 4G9EA 1MNQA 2WG0A 5DNUA 2PM8A 3WJ2A 2JGMA 4U2EA 4X92A 1JJIA 5KREA 2YXPX 1W75A 1CUDA 3BE8A 3BDIA 2Y2UA 5EHQA 1CUXA 2WHRA 4TGLA 2IX9A 2BUBA 1VE6A 4C88A 1CQZA 3W9BA 4Q34A 4N8EA 5E4YA 2JGLA 2Z3WA 5ALYA 5CT4A 3WJ1A 2XT0A 4OB6A 2RI6A 5LZ5A 4FWBA 2HU5A 2G63A 4QDUA 4BE4A 1LPNA 3V1KA 1QIFA 1EVEA 4ZWNA 4TPKA 2WJ3A 5IVKA 2XUFA 2OLEA 1NU6A 3R40A 1G4HA 2QXTA 3DKRA 3YASA 2J4FA 1GPNA 5JATA 5JALA 1LZKA 4JH0A 5C8XA 3IUJA 5CXXA 1XROA 3O4GA 1JFRA 4AZ3A 1CUFA 3STYA 1N5MA 3I2FA 1XQWA 3WMRA 1HDEA 5AICA 2WJ6A 1H2ZA 1QIIA 4OB8A 4CIAA 4OD0A 4KE8A 1XLUA 2WG2A 3C43A 1YA8A 3PUIA 3ZV7A 1QTIA 4EA6A 4BB0A 2RIPA 2GBCA 4DLNA 2JBWA 3VJKA 3PFCA 1S8OA 4ARAA 3JYHA 4GI1A 4YASA 1XZHA 3T52A 2Z8XA 1ZOIA 2VSQA 3IULA 1F0PA 1YAHA 4OPMA 3G9ZA 3AIOA 3HEAA 3IA2A 4WDRA 4KAFA 2WTMA 4AMZA 3KSRA 1MAAA 4INZA 4MEAA 3DS8A 4FNGA 4BCCA 4OU4A 5A6VA 2O2GA 1LNSA 2AJ8A 1WPXA 1ZIYA 5CH3A 1R9MA 4KE6A 4OSEA 1XZAA 4WY5A 1XKLA 4DNQA 5BV7A 2EDCA 1Q84A 2QT9A 2WFMA 2PVSA 1SCKA 2QJRA 4Y2TA 4TVKA 5HKAA 1QIJA 1ZD3A 1JU4A 5K3DA 1YS2X 3AUKA 1THTA 4U2GA 3I2JA 1G42A 1N8SA 1MTZA 2FX5A 1P0PA 2JGIA 1EX9A 5AM5A 3DYVA 2ACEA 2ZSIA 2Y6UA 2ZYIA 4KJXA 4QZVA 3C8HA 5ALOA 5FV4A 1XRNA 3M81A 2XQFA 1RWQA 4C6HA 4KE9A 5AKHA 1WB4A 1EDDA 1MT3A 1ZIXA 2ZVDA 3QITA 4PO3X 2CJPA 5AM4A 1XZEA 3I28A 4LXIA 4B82A 5LIPA 4S0XA 1UKBA 5ALKA 2CB9A 4Y2XA 3I6YA 4W1RA 1YA4A 2BFNA 5K3FA 4C89A 1EDEA 1CUEA 3IVMA 3ESCA 3WL6A 2IIVA 4UFOA 1J1IA 5CH5A 3AIKA 1TKRA 1ORVA 3ED1A 4QLAA 4Q3LA 3VJLA 4DMHA 4E14A 5F4ZA 4KAJA 3FVTA 4J0GA 4X00A 4K6GA 3SC2A 4BBZA 2OAGA 5D6OA 5BWCA 3H2KA 1BS9A 3RKSA 1TCBA 2WFLB 4DNFA 2PUJA 1EH5A 4KEAA 3D0KA 2OQIA 2YASA 5CXUA 1H23A 2BJHA 4X94A 2PU5A 3O4IA 3L1JA 3F8SA 4BTLA 4L3WA 2VAVA 4MXDA 3AZOA 5I8PA 1EK1A 2HA6A 2X76A 1XZLA 4UPDA 2O2IA 4UBIA 3DCNA 1W76A 3W04A 5EHZA 5JD5A 4JNCA 4JYMA 1ZGCA 4K5QA 5HCUA 4IH4A 3B3QA 1CLEA 4GW3A 3WWEA 2C5FA 4Q3OA 3I6ZA 3WL5A 5IH7A 1GZ7A 1BE0A 3TRDA 2ONCA 5SYMA 3PICA 4A23A 1DWQA 1FFDA 1J07A 1R4ZA 5LZ9A 3FSGA 3WWOA 3STUA 4BAUA 3WKBA 5CH8A 1X70A 4ZGBA 1USWA 4EY8A 1DTEA 4QDTA 3V9AA 3QVMA 2PU7A 5AHXA 5FKJA 4C01A 1LPBB 3F98A 3FLEA 4BZWA 2HFKA 2HA4A 1YB7A 1UOPA 3FSGD 1E3QA 4WCVA 4X95A 4IH1A 4E46A 2ZSHA 1EA5A 3IUMA 1MX1A 2XUDA 4Y2QA 4BE9A 3PDCA 4D9JA 2WIKA 3ESDA 1CUVA 2E3JA 4X93A 4U2CA 4XWGA 3MGAA 3ANSA 4CIBA 5CT5A 3R3YA 1H2YA 3BWXA 4EY6A 4WDQA 5ALLA 3DDUA 3CCBA 3LIIA 2VQ6A 1QIGA 2PSDA 3O9VA 2XUQA 4DTCA 3OOSA 3WWPA 4FFVA 1EXWA 2D5LA 5EFZA 5EIEA 1ZJ4A 1CUJA 4N5IX 1XQYA 1U65A 4CG1A 1CUGA 4Z49A 2H7XA 1E8NA 2GBGA 2VA9A 4H77A 4KACA 1JJBA 1LPPA 3G9XA 2Z8ZA 3D5EA 4EHBA 4GDMA 1EDBA 1Y37A 1XLVA 2WHPB 2XMGA 2WM2A 4FFWA 4O08A 3WIBA 4FDMA 5CTAA 4X85A 3C87A 3I2HA 3R41A 3WA6A 4DMKA 1LPSA 3H1AA 2OCGA 1QIKA 4Y2SA 2XUPA 4WFKA 3FVRA 2DFPA 2IITA 3HRHA 4I19A 2XQGA 2QZPA 1T2NA 5ALTA 3PE6A 5DYYA 2WIDA 2VEOA 3NWOA 4EY4A 1VE7A 4FMPA 5IVIA 5HK8A 2CKMA 4MEBA 3IB3A 1TAHA 3GUUA 3I1YA 1YS1X 1HL7A 2XMDA 1U2EA 5CMLA 1IZ7A 5AKEA 4YX9A 2O7VA 3TGLA 5A62A 3QPAA 3M83A 3D3NA 3PF9A 5FPPA 5AI4A 5AJHA 1AURA 1XQXA 1CFJA 1QIDA 3MVEA 4DSAA 3ICVA 3G0DA 2HA2A 2WG1A 1MAHA 1JKMA 5HF8A 2XMZA 1L7AA 5ALPA 3HSSA 4ZXFA 2VF2A 1QO9A 5A7FA 1LPMA 3F96A 1AKNA 4AO7A 1CVLA 3WIOA 4C4XA 4EY5A 4HXFB 3RK4A 3WWCA 3PF8A 3D2BA 4H18A 4EBBA 3H2GA 3AILA 3GZJA 4UBLA 1PJAA 3KDAA 1X2BA 1QE3A 3HABA 4OUKX 4XVCA 2W22A 4H7FA 3QPCA 4LYDA 5EIAA 5JZ9A 3G0IA 1TCAA 3OURA 4W63A 5CT9A 5JARA 2QKYA 5LZ4A 1N1MA 3WK8A 2O2HA 3BF8A 5HQ3B 1WOMA 2V98A 3JWEA 4BZZA 1A88A 4FKBA 2WHQA 1ACJA 5HF9A 3WK5A 5HK9A 2XUKA 3FLAA 1TQHA 5DTJA 3DOHA 2DCMA 4L72A 1QOZA 1EB9A 5ALSA 2H7YA 5CURA 3VVLA 3G0GA 1MPXA 4G1FA 3PFBA 4X3CA 3RARA 2Y2VA 3OC0A 1GKLA 1W52X 5K3FB 1QTRA 1LLFA 4HZGA 2RONA 2BKLA 1HQDA 2WILA 4Y2YA 1XZKA 1WHSA 4Y7DA 3VJMA 1D07A 5ESRA 3FYUA 4QNNA 3G9UA 2XQJA 4KAAA 1ZI8A 1JMKC 1SCIA 3I2IA 1YB6A 1XRQA 3RLIA 3BF7A 5CRIA 1JU3A 4MJ3A 2DHDA 3I2GA 1QJ4A 4F0JA 5FRDA 2RHWA 3DQZA 1C4XA 4P08A 4ARBA 4AZ0A 4IQ4A 3C8DA 4HVTA 3KOOA 2OXEA 2ZJFA 1FSSA 2CBGA 5LKAA 4AQDA 2BGNA 3GBSA 2ORYA 4BRZA 3ZI7A 2X8BA 4AXBA 1LZLA 4B9AA 1SFRA 5JZSA 3CN7A 2EDAA 4NS4A 4P92A 3KWFA 1MX9A 1OCEA 3OTQA 4H7JA 1W1IA 2DHCA 4Q1VA 4BRSA 4EUSA 4G9GA 5DYTA 1F0NA 2B20A 1XZFA 5CT6A 4WFIA 3STVA 5LZ8A 4G8DA 2GYWA 4NMWA 3CXUA 3V48A 5JAHA 3G9TA 5BOVA 1QIHA 2I3ZA 4UHDA 4PNZA 3L1IA 3PI6A 5HFNA 1C7IA 3H0CA 5AM1A 4RE6A 1UT6A 2C5GA 1RYYA 1M33A 3D59A 4JEIA 2ACKA 3UUFA 2WU3A 1K8QA 3O95A 1CRLA 3DL4A 3T4UA 5JASA 2WLSA 2JEYA 1ODCA 2Y6VA 2AJBA 4DNPA 3AIMA 1ZD2P 2HA7A 2WIFA 3FBWA 4Y2PA 5FLKA 5ALXA 3H2JA 5FOQA 4Q82A 4UHFA 5FUMA 1MU0A 3H17A 1DINA 2YYSA 4BDSA 4B6GA 5DWDA 3ZPXA 2QTBA 2B9VA 2OGZA 1W6RA 1QIEA 5FXMA 4B85A 4B84A 5AP9A 1GT6A 5HKBA 2ZYRA 4B81A 4CFSA 4BC1A 3L1HA 4RPCA 5K3EA 5LZ7A 3C70A 3N2ZB 5LP1A 4AN1A 1LBTA 1A8SA 5IVHA 5ALQA 4X91A 2K2QB 1UZAA 4XIIA 4DIUA 1G66A 4BTVA 4H0CA 1P0IA 4ZI5A 2VTVA 2XLCA 2QXUA 4CCWA 2DQYA 3WYNA 1NU8A 4X6YA 5SYNA 1BROA 2WSLA 5JD4A 3KXPA 1VKHA
chains in the Genus database with same CATH superfamily
3JASA 4HOYA 5ITWA 2G4LA 3PWTA 5FBRB 1XNRB 2OZLA 1RAIA 4YMUA 2COKA 5M29A 2WKRA 3WBJA 1O0CA 3B20A 2XYPA 4MW6A 4LW8A 1T6YA 1LU9A 3DMTC 4WXMA 2AXNA 3MGBA 2WZCA 1YKGA 3ZIAD 3FTDA 2Q4TA 3T35A 2UYCA 4GD3Q 3CH4B 5AVJA 3O21A 3RVOA 4D9NA 2WFAA 3A1FA 2A4MA 2JF0A 4QSHA 5EERA 3QMMA 3L4EA 3MQ2A 4UE3S 3EVBA 4CF6A 4RPJA 5BW5A 4RBNA 1PFGA 4NBTA 1QVVA 1AY0A 3MJHA 3PS9A 4BLQA 2JG3A 3U3XA 4B7ZA 1DEXA 4MUGA 1CUYA 1UK7A 3F7MA 4Q03A 4D0GA 4BUJA 1SCBA 2XMQA 4XCQA 2Z8YM 1WDKA 4X71A 3L7MA 3D8NA 4M0DA 4IJQA 1TB4A 4DILA 2I67A 3PQ8A 4MICA 4DUGA 4LMAA 3K0SA 1GJRA 3I61A 1AN9A 1FXUA 1EINA 1FU7A 1V16A 3DB1A 3IURA 1AD2A 4M76B 4NCNA 5CUQA 2NPOA 3R76A 1KZ9A 3ZD9A 5BN4A 1JIIA 2FEKA 3KHUA 3L7KA 4Y2UA 5TMPA 2QDKA 2Q9CA 1TLTA 2P6RA 4BQSA 1EUCA 4J2HA 1W5BA 4Y0VA 4A7PA 3JYQA 3VU0A 1WB6A 3P9NA 1MQSA 3PLNA 1U2DC 4S24A 1BHQ1 3VYUB 1JKFA 4MH0R 4YLGA 4XB6B 4EKIA 5LUAA 3V80A 4TXLA 2H8GA 1YMQA 1GPAA 4BB6A 1OWLA 5DM4A 3HB0A 4EMBA 5K05A 4JR2A 4D1YA 3SF0A 4Z4CA 2KS6A 5ISMA 3AY3A 3M3DA 1KEEB 2AQKA 2OG1A 3TL3A 4CI9A 1FMCA 1F60A 1YCGA 1JPUA 3IFSA 3RS2A 2REXB 4L4RA 2F8MA 4XI9A 5BVGA 4G0MA 3BD8A 2O2DA 3KJGA 4BQNA 4HD8A 1TZKA 1LC3A 2E4WA 4CMEC 4CODB 3ZJTA 3NC4A 4YIKA 3OOJA 4NI5A 1N3YA 1H1LB 2D3WA 1VDMA 3EIEA 3HBAA 1GZ3A 2C4MA 3WYAA 4L22A 4QXOA 3UB2A 4BLVA 4R5MA 3BIOA 4ZTBA 4J0FA 2QYSA 2XYGA 4U7TB 1M6YA 5EXPA 3Q11A 4CM4A 4HVLA 4S12A 1JHPA 3Q8XB 2A1UB 1DRKA 4DDWA 7REQA 1VL8A 2JIZD 4X84A 3ZWWA 1ADGA 2A9FA 3LDHA 2Q3CA 2D2IA 5T6BA 2NSYA 5J2UA 1UZNA 2AW3A 3F7TA 2W6CX 3C41J 5AWFC 3A3KA 2ZS8A 3F7NA 4MRVA 1K7FB 3SG0A 2OHGA 3RAJA 1MP0A 2AFHB 1YSCA 5CK5A 3GCXA 5KYYB 1R6XA 3N9IA 4PPYA 2XWBF 1E3WA 3I4CA 4WZ6A 4F91B 2WJIA 3HCCA 5HJ5A 3F46A 3OHMA 1D4AA 2QAJA 1FFXA 3A58B 3R0IA 2AFIA 3LQ1A 5E6RB 2HMTA 2Z9BA 3SVTA 4L76A 2P6NA 4EFNA 2WAMA 3EEFA 1PJQA 1DO2A 1GKUB 3O8OA 2Z09A 3N2KB 2AG0A 3VPCA 4CQLB 4OLAA 3B8HA 2PX2A 4MQ6A 3N8DA 1LBQA 1NVUQ 5JY6A 4Z4IA 1RZUA 1C8KA 2X0RA 3HR4A 4NP6A 5FL3A 2Y99A 1MC1A 4J03A 2O8DA 3IQEA 3O4JA 2F62A 4N0DA 3RUPA 3T06B 3W8NA 5B6JA 3C6KA 3Q7PA 5C1IA 1WWKA 4UBJA 1ECPA 3RYCA 5DXJA 3SX0A 4BXOA 4TWJA 1RABA 3IAHA 3LDAA 3MJDA 1I10A 1J8VA 3VZPA 4GGMX 1D2CA 4JGBA 1LPAB 1YRWA 2GO7A 3V1NA 1IG0A 1UQUA 2V8BA 4ZDKA 5KNBH 4HG2A 4P3KA 3O0TA 4LYYA 1NBOA 2YYYA 3RADC 2PUGA 3DDHA 3PDIA 5EUQB 1E1DA 1V9CA 1DTSA 3DO6A 2HXSA 1P1JA 5EQFA 3SPXA 4AWBA 2XH8A 1RKQA 4OL0A 1TQ6A 2GZ1A 1NUHA 2O3SA 3ER8A 2PNJA 3B1XA 3RDPA 3F5DA 2VDLB 2FG5A 4UZSA 2ASVA 3HY6A 3K5WA 1X80B 1OXBB 4NYJR 3RS8A 4UTVA 2E49A 3UNXA 1EESA 1I4OA 3ZU6A 1NJGA 1F8UA 3QKRB 2XMBA 2W58A 4QGGA 1Y9ZA 3UXYA 5FUQA 2I4MA 3QY0A 3I37X 3PEFA 3M6AA 1EKXA 4ZEVA 2C8JA 4R1OA 3U4HA 2YUIA 1V2HE 3I52A 3IVCA 1K5PA 5AUNB 1IN6A 4N41A 5BN5B 1DJPA 3B1JA 4O59O 2FR0A 2EG5A 1AS0A 5B37A 4KN8A 4EFDA 4QG3A 2W8BA 3CONA 2WWIA 3P26A 3OQVA 5BSGA 1NBEA 2Y1EA 3EXFB 4NJEA 2A0YA 2WJVA 4RFLA 2D0PB 4BYMA 2R8EA 2Y71A 4XX1A 1F1BA 2ODQA 1G59A 4HPXB 3NWJA 1XLTC 4ALNA 4B32A 4DGQA 1DBRA 1N77A 4RNCA 3G13A 4JYBA 1TUBB 4GMXA 3U5ZB 4UUNA 4NFHA 4HRAA 1RWOA 3TD9A 5CNKA 1L4HA 3DLIA 3O0DA 1ADJA 3AF1A 1RXYA 4RCVA 4KITB 3DW1X 2XMPA 1XZBA 2IDZA 3LNCA 3HBLA 1UMBB 3FMGA 4MV6A 5IJXA 4C0JA 4EK9A 2G0AA 2I6FA 4KUHA 2FZ4A 1XMVA 5IKMA 1X0XA 2H0AA 4OQMA 2X2PA 1P2BA 1KA9H 1T35A 3FNEA 4ZZ1A 1O6GA 5J4LA 2EU8A 4CM5A 4JLVA 2K2WA 3OFVA 1FTYA 1HT3A 1TTHA 1X9GA 3Q7QA 1W4RA 1ZCAA 5JZBA 4B83A 4J16A 3RC2A 1LGYA 4WJLA 1S9DA 2Z4RA 2OGWA 5FWYA 2AFIE 4E88A 2CNLA 3EZ2A 2O8BA 4TKVB 2XUZA 1EBFA 1Z6ZA 2OZVA 2Q7OE 2EW1A 4CT0A 3KEFA 1YZGA 4WOJA 3G49A 4AP6A 4E5MA 3F8TA 1PSZA 1IH8A 5AESA 2I1WA 2BFOA 5BY2A 5JS2A 5EGSA 1XYGA 2RGGA 4WAUA 2UYGA 5FJIA 4RZSA 5CFLA 4P6VF 2NTVA 2HJGA 1WU8A 3VU9B 1KZGB 2Z2KA 4JI5B 1SUDA 1YZHA 3BIWA 4MO9A 5BNWA 5JSHA 1XPUA 1DG3A 3FPAA 4O0LA 5DCLA 2LDBA 5E4JA 4N18A 4WKOA 4Y0NA 2BV3A 3SK0A 4C4ZA 1HTBA 1HUQA 1NQOA 4R1PA 1AGYA 4BGEA 1LBSA 1WM1A 3Q1LA 9ABPA 1RPTA 1T2CA 2HU8A 4IDCA 4QEZA 1PR3A 2D5BA 2BMFA 2CNDA 3GIDA 1MVNA 2HDHA 3FRJA 4AY4A 4LNHA 3DB2A 4MQLA 5JPIA 3CLRC 2QD4A 5D3MB 3GNSA 3EPHA 2ZTVA 4BB5A 2FP4A 5GM1A 5D3KA 4Z0NA 1IUOA 1RI4A 1CUAA 3TRKA 5I6DA 3S55A 3KUUA 3W3AA 1ZHFA 1ZN7A 4PAOA 3NDRA 4FDVA 3SSNA 2IH4A 3SYTA 2V7VA 1ZM9A 4H6XA 3EIQA 1K4MA 3ZLTA 2H57A 1JIQA 5AI5A 4I50B 2VS1A 3A3OA 3NS7A 4WJZA 2MSLA 4LFCB 4ENWA 1P0FA 2C3MA 2AFIB 1AKMA 1G3IA 4B9EA 2B1RA 4P32A 1PGQA 2WRZA 2X9NA 3ZX4A 5IT5A 1BHSA 3MXTA 2JD0A 3N0TA 2XMRA 5DHSA 3SMVA 1IEVA 4ZHQB 3W7AA 3A2LA 3F9IA 4KVGA 1CFZA 2E55A 2C2OA 4RGQA 4F1JA 1I5RA 2XIQA 3DTTA 4U2BA 4UOQA 4YYZA 1GKKA 4PTZA 5I48A 2GAAA 2BW0A 3QZUA 2BGIA 2QV7A 3NEYA 4RV5A 1KMNA 2BZ1A 4ZCQA 3ZHOA 4EB8A 4Z1OA 5B1EA 3PQDA 3R7WA 4AIIA 3AXSA 1I2CA 3C7TA 4TLAA 4RD3A 3FWHA 4M1OA 2QMEA 1WW2A 4NOJA 2I3BA 3I62A 3O93A 1V1RB 3D1JA 5F76A 5CDTA 1SHLA 3B3AA 5EJEA 3UMYA 5EWJA 4OGFA 1K92A 4MK4A 4P8RA 1GZHB 2DH6A 1DOAA 1Y98A 3BMQB 2YZ2A 1ZIDA 2PX3A 2WJYA 2EJCA 1C80A 1EGAA 4YRQA 5ALMA 1SKUA 3O91A 5C8YB 3Q8MA 4M36A 1RTTA 3MUEA 4NV3A 4IKOA 4CLDA 4S1OA 3X1MA 2HA5A 3PHBE 3FUWA 1CQIB 1L5YA 3AHFA 2JJMA 3LKDA 3CX3A 3P9ZA 4INJA 2QAIA 5CEFA 4ZO9A 2Z43A 2C83A 2C7BA 5HKKD 4JX8A 2D00A 2YWCA 1W34A 2X9QA 5AK4A 4CL0A 4RHYA 1M74A 2ZVJA 4QWMA 3V34A 1WUKS 2PUBA 1BXKA 2QW0X 1XJCA 4KYIB 5KVQA 1NV9A 1ZA1A 3EZ6A 4UM8B 1LX7A 1ZD5A 2F1KA 4LWOA 4C7OA 2WIBA 1Z83A 1NVWQ 1XA4A 5A9SA 1IWBB 4JEHA 1KAEA 5AKZA 3MMNA 1DV2A 2LE0A 1NFRA 2NW6A 5JVDB 4EBFA 1JE1A 3FHLA 2QL5A 5PNTA 3ZCSA 4CFYA 4CXMA 1U3VA 4R8SA 3K73O 2JI4A 3HN7A 1GAQA 4CMBA 1SCQA 1G9XA 2CN1A 4HP8A 1M9NA 3LS2A 5EN4A 5KX5A 4ENRA 5AHOA 3X44A 5LDGA 4MHOA 5BYKA 3D2AA 1N6OA 3B6ZA 6YASA 5SZIA 2OILA 4ZAZA 5BMVF 2B7LA 3IE2A 4QFDA 4RD4A 1Z2AA 2JFYA 3GLHE 2ZS7A 1BOFA 3ETDA 4L8YA 4CIXA 1F0KA 1IXZA 2PMCA 2IW1A 3L7YA 3KQMA 5FIUA 2AG6A 4DA6A 4JLOA 4MVJP 1EHYA 2OGUA 3JQPA 1EUCB 1RQNA 4FFMA 1DEOA 1JDPA 1T8TA 3IVRA 3LCRA 1Z5PA 4XKJA 1V6AA 3HCOA 2AN4A 3HXMA 1DC4A 3ROZA 1WJGA 3VMFA 4C08A 1N6LA 3LOUA 4DCNA 2NYAA 3HB1A 5JMOA 4HZIA 5A7HA 1E0KA 3CZ9A 4LGVA 2JEOA 5CHYA 1OLSA 5D6NA 1QFXA 4PRZA 3SKVA 5B3AA 3CNBA 4NU5A 4AF6A 1H2XA 2ZDGA 4AP5A 4IR7A 4CIDA 2V65A 1N25A 2XB6A 2NU8B 2YV4A 2EL9A 5KDLA 1DCKA 4Q9KA 4KLCA 2FRDA 1PJRA 3JAWA 1RMYA 4GOLD 2WTNA 1W94A 4K0KB 1YJ5A 3RW9A 1GQOA 2DR2A 2O7NA 3HU2A 2PUVA 2ZWAA 3KLPX 3ORYA 3QLVA 4S1PA 1N6IA 2P2NA 4FCCA 4WINA 4R7GA 4D02A 2BGGA 1SXIA 3TSWA 4J4TA 4WUVA 1EEXB 2Q27A 1LRKA 1UJCA 3TMYA 4C0WA 5BUSA 1KJNA 5ALZA 3ROMA 1B00A 1YS7A 2VIIA 5DSTA 2QAGB 4QGBA 4MQMA 1EFRD 1NKSA 1PG5A 3B70A 3BHNA 2C2ZA 4KFTA 4X41A 4M0CA 4Y2JA 3M6MD 1V3UA 2MMCA 3DHWC 4Y1EA 1MMFB 1JEJA 1Z26A 1JQJC 2XRMA 3BFXA 4J3JA 5BWNA 1G5FA 4JBNA 3SQLA 2ZJZA 2BFFB 5JVDF 4CF4A 2WWHA 1GT91 3OD1A 5FHQA 1MG5A 1L4KA 3M1IA 1FTSA 2V97A 1HSZA 2XTNA 2Z1MA 4ZVSA 2VJBA 2DT8A 4IH9A 3VPGA 2NVUB 4D4IA 1NBMA 2ENUA 2QTZA 1Q1NA 1Y5RA 2QB5A 3PDIB 4G85A 1OFUX 4EJMA 2QMUA 4MR7B 5IXJA 2A14A 5LSAA 3AYZB 3AR3A 5DNWA 1I0ZA 4JB2A 2OVFA 5TPZA 4HB3A 4U2FA 2Y1XA 3C0KA 3DONA 4PC7A 4P4NA 3K94A 4BAZA 5BNIA 3G1UA 4YNBA 3ADOA 1JFVA 1TJ5A 4MYDA 1ZHOA 3DEYX 1JHAA 3ORFA 3QEJA 5DTMA 2QTNA 4J91A 4MPJA 3U31A 5MN6A 1SQSA 2L17A 1ABFA 1SUAA 3N0WA 5FX2A 5KEIA 3KT6A 1DSSG 5H9WA 3FF1A 2AXQA 1TU3A 2ZIVB 5TS3A 3GAZA 3IBTA 3UK2A 1FDWA 5T8KC 2Z83A 1G3MA 1E20A 1ONOA 4MGKR 5EI5A 1I6LA 4LF6B 1YV9A 1X7XB 2ZCUA 2MT9A 1SVMA 3CNNA 3F97A 4N8DA 5TPWB 4Q4HB 2EJWA 1FEZA 3JQQA 4OYYA 2YV1A 5HFJA 5TGZA 2QF7A 4DZZA 4P5EA 4Y2GA 4PFSA 3HKDB 1KTVA 4NZOA 4DR2B 1C8VB 3QG5A 5ECWA 1E99A 2AVDA 2A0KA 2X8JA 4C76A 3WZLA 4FI3F 4D3FA 4D42A 3E2PA 5HWSA 5JAPA 1FCJA 5DU2A 1NVBA 1POWA 1KSGA 3X1JA 4AZ0B 4CFZA 4QOHA 5CDSA 3WYGA 3TZKA 1K9VF 1QCZA 4D9CA 5C7OO 3H04A 3MW8A 1W4ZA 2JL1A 3NDIA 5SYAA 3NXKA 1CUBA 4MRRA 3TB6A 4P53A 2EFEB 3CIFA 3VR4A 3ZTWA 1S0UA 1UBSB 4BLPA 3UFXA 3HMKA 4DEVA 3AJDA 1Q3TA 1PUJA 3LC0A 4WY2A 1BO6A 1KO8A 4NEQA 4ZDWA 1WDTA 4Z7QB 3BQ9A 3T1TA 4BFVA 4HWRA 2ZRIA 2G9UA 4V0RA 3I64A 3IODA 5FTJA 4AS3A 5JJCA 4KPUA 3WA7A 1EPUA 2GASA 3FAKA 3LK7A 4DT1B 2P5YA 2VP5A 4PZZA 2PQMA 3LPAA 3M6UA 1M0WA 3AW8A 2GZ3A 2X77A 3DAOA 1PWEA 3DKKA 1N9ZA 3MILA 4F9EA 1SCUA 1JDNA 1DC8A 1UODA 3PC2A 1G4AE 2PCLA 4FT2A 1UQRA 4FE3A 2FPLA 5DLYA 1GGKA 4AZVA 4M0KA 3CH5A 3TK1A 2HB6A 3M89A 5FJJA 3CCCA 2EX4A 1WB5A 2QL9A 2YTZA 2KM1A 3ENWA 3GLUA 2ONZA 4UAVA 5DXFA 4TLCA 3AF4A 3SHQA 1VJDA 2VH2A 2DLNA 3LY7A 1BWSA 1O77A 2GK7A 4ROTA 4K9LA 3DFIA 1I5OA 4M8KA 1N33B 4RH0A 5BSTA 4KC0A 4P7KA 2IZZA 2R2GA 3Q3JB 5IH3A 2EEZA 5AT1A 1WZNA 1ZW6A 3I05A 5EZYF 2H1HA 4ZMSA 3QW2A 2R87A 5THQA 3UAVA 4DCTA 1DIHA 4B0OA 4O1IA 5C8VA 2J0VA 4XH9B 2C8LA 2Z5LA 2AC7A 3RVKA 1XRLA 1H3FA 4KODA 3G5LA 3WG9A 5JY1A 2GK3A 5A0FA 3RQSA 2YBEA 3KQHA 3JQBC 3H2SA 4N3AA 2ALJA 2JFXA 2JIQA 2PUWA 3ZE7A 5CBPA 3WNZA 3PQ6A 2NSJA 3U26A 1GADO 4XVHA 3NORA 2IS4A 4PAWA 5YASA 5FR2A 4KVAA 3KOZA 2L19A 4ND6A 4WY8A 3BA6A 2P90A 1Q19A 1UIRA 3JQEA 4E94A 5B7PA 3L41A 1T3SA 4D57A 2W83A 4OYRA 3A2MA 3T95A 4YRNA 1E7YA 5DSXA 4EW3A 1YI1A 3KHTA 4NIMA 1P5HA 4HN9A 1PP4A 3OBBA 3G79A 4IHJB 4OIFA 3JW8A 4BCDA 1TEXA 1OZFA 2ZTMA 1KJZA 3GJQA 4WKGA 3TTTA 3NZEA 1VI2A 2ZRCA 4FEYA 1RWMA 1SK9A 2GERA 2GK6A 5C8YF 2R6HA 1F3LA 4Q6BA 4NCBA 4OGLA 3ZUGA 1Z88A 3GEIA 1QLWA 4X61A 1USIA 5IAJA 4BVJA 4EI9A 4HUQA 1GPUA 4BO5A 2A30A 4LYGA 2BAGA 4MR9B 3DUFB 5C5EA 3Q5EA 1AMUA 4MV5A 2VQDA 3CUSA 3LGXA 1J2EA 2VJAA 1LRLA 4BEJA 2EATA 2C7RA 3TOSA 4LSMA 2VT7A 1TVEA 5C0OE 3W6PA 1NNEA 2VA8A 4JDPA 4FVTA 4GLBA 1XZIA 1SQ6A 2HZ7A 2G1UA 2RI1A 1Y6GA 4KKXB 3AESA 4HJRA 2GILA 3QE2A 5I3CA 4Z53A 4MKHA 4K6KA 1QX4A 3RTCA 1VJRA 3QLUC 1M6EX 3Q0EA 4LHXA 1N32B 2EF1A 2VWQA 3B89A 1XTQA 1ZJ5A 4XPIB 2JIDA 1E7SA 1X1SA 3DZBA 1KMQA 2W6PA 5C8YA 1XK7A 3HB4X 4O2AF 3LPCA 3AC0A 1G1MA 2PT7A 1RJ9B 5K9ZA 3ICOA 2ASEA 4CHTA 1KR2A 2V5VA 1IHOA 3RS7A 3ITKA 1RJDA 2FN9A 2PA0A 3IP1A 3AKCA 1RRPA 1QM5A 1ZI6A 1V5GA 2HK7A 3B7PA 3F9RA 4JJFA 3VQTA 2V3WA 3QPUA 3R0QA 4GI5A 3H2HA 5EKDA 3RHFA 1GZSA 2ZRNA 2V5UA 2AN3A 2YQ5A 1N3IA 3PE3A 4YEDA 2IU3A 1V5FA 4TVOA 3S1AA 2BFAA 4BE7B 3RAEC 3SHWA 4D8TA 4C4OA 2K7FA 3DJYA 4V2IA 4Y6QA 2WYOA 4GG1A 3FPEA 3PGLA 1EFVB 5B55A 2J0QA 3TBFA 2PYIA 4HFMA 4IWNA 2L82A 2GPBA 3FA2A 2IUFA 5AKYA 3O2SB 4MWGA 4Q4HA 4MYUA 3VNAA 2JFUA 1ZGBA 1KSFX 2ECKA 2CGEA 3NHFA 3OM9A 4UASA 1TIBA 4CV3A 2F3SA 4QTYA 4KQIA 1CUIA 4BMYA 1QGED 2NWQA 2EVWX 1Z4JA 2PL9A 3QWIA 3W06A 4EVRA 4FGJA 5KNCH 2ZRQA 1WSWA 3TW6A 2OZPA 3L6CA 2QQ0A 3U80A 3KELA 5FBZA 2X2EA 3UG6A 3VX3A 5BNFA 3ST7A 1L7QA 1ZRNA 3WFJA 2WNSA 3QU9A 1N6PA 3TD2A 1JXAA 4OFWA 5KTYA 4C04A 2POQX 4O33A 1TM4E 1JKJA 2RAPA 3AEKB 4QSMA 3QU2A 4ND2A 2A35A 3C3XA 2HM7A 4MAAA 5D3ZA 4F9GA 3HDTA 1J25A 3N58A 2BTQA 1CVRA 2BOVA 1DI0A 2UVPA 3SY8A 2BCJQ 3UAZA 4F9TA 3UBTA 2KW5A 2EP5A 3CF4G 4QT4A 1SC6A 2YZMA 3H75A 4UHJA 2NG1A 5AKLA 1VLJA 3AEQB 2Q5JA 4RZXA 4KOAA 3K72B 5HIMA 1ND5A 3X43A 2XYVA 1NULA 3DWIA 1WR8A 1Q91A 2QRVA 5HIJA 3MCWA 4WLNA 4UUMA 4B3HA 4KV9A 3V8QA 4N54A 1NBIA 4I99A 1W1WA 3L0OA 2AZTA 4YPVA 2BY4A 3WL4A 4A0QA 1IE3A 4ISCA 3CUUA 4UARA 2JZCA 4KR0A 3PXAA 4XJVA 5JJKA 1Q7EA 5JANA 1QG2A 1A8QA 2J6IA 3DKPA 2Y67A 4XJTA 1TW3A 2BGRA 2J3LA 3WDLA 1L5FA 4L5JA 2W6NA 4B7XA 3CZCA 1FLVA 3P9SA 4BFUA 3TQRA 1E1YA 1ODLA 2XNDA 4I9HA 4RWEA 3UB3A 1IPHA 3WKCA 1K2VN 1F3OA 2D2XA 2IDJA 3TS1A 1EBBA 3UY4A 2WVJA 3EIOA 3ZZMA 4N76A 1TYBE 1XP8A 1NXTA 2FSUA 1AXGA 1QMGA 2VAMA 2ES4A 2IA5A 2VJOA 3DF9A 3OJ0A 4B8WA 3RC1A 1TEZA 3D0OA 3HXKA 3JAWB 4KDRA 1O95C 3BHMA 2XLBA 5D87A 4URVR 2HRZA 2WUEA 3AEUB 3OCZA 3RC8A 5KWIA 1Q1GA 2AL7A 3PHCA 4J7UA 4Y1RB 3KVRA 4YCBA 3D02A 5I5EA 3VX4A 1VHQA 1EFUA 1RJWA 2DM6A 3KOYA 1MA3A 2OKGA 3X2SA 5JNTA 3GLRA 5E9AA 3AO0B 1A7UA 4HBZA 1FMTA 1JYSA 1L4NA 3DNMA 3FR8A 5BYAA 1YOVB 2KBEA 4ZI7A 3GJ6A 2OFXA 1EE1A 1TM3E 2FMUA 4M99A 2E2WA 1E94E 4MV3A 2J0EA 3ZXIA 3UJ7A 2RHDA 3Q3CA 1NURA 4RGYA 1K0UA 2C7QA 4N40A 4GHWA 3ABIA 4YQFA 3S7TA 3MT7A 5AO9A 4B45A 4BLRA 2XGOA 5GIPE 3GRAA 4NZYA 2WHPA 2CJYA 4DLAA 2B94A 1OU0A 1E9SA 2JCBA 3LZDA 4XDHA 1C9DB 4QA9A 1H5UA 2BSQA 4ENSA 1B4DA 2JFPA 2RGCA 3WK9A 1B8PA 3OSUA 4YAWA 2NQTA 4IG9A 4MLPA 1KE2A 1DTWB 5K4HA 4N1AA 1KBOA 3F47A 4DDUA 4Y8VA 2J3DA 4LEIA 1YE5A 1G98A 1CY6A 3GFFA 1R88A 3FCYA 5F5NA 3HM9A 1Z6AA 2EWVA 4NV1A 3QQ5A 4O2BB 2J5BA 4UXHA 3E4CA 3G2MA 3J81k 1NI3A 2HJVA 4RHXA 1ISMA 1SZDA 3OIDA 4NE9A 2GUGA 5EMLA 4KO8A 2D13A 2VHUA 3CG4A 3G2PA 2JASA 3MYYA 3UT6A 3D64A 5GJVC 4L6IA 5ECYA 4FBGA 3VPFA 2Y77A 4JJ6A 5REQB 4UPEA 1C7EA 1DBSA 4M86A 3UWDA 1RRFA 2Q9UA 3EJWA 1OWOA 1E2GA 2NXWA 4KDFA 1T4CB 3TKLA 2F3PA 3FOBA 3OFNA 1U8AA 4DMRA 2QMZA 1USVA 2NZXA 3E61A 3LBYA 4NBKA 4PCAA 4WXPA 4YCSA 4OOEA 3WMFA 3DYIA 1JHRA 1SZCA 3DXZA 1F8YA 1RT9A 4D8UA 3GF4A 2A58A 4FSXA 3A4YA 1F17A 3RYHA 4CEJA 1YB2A 3MERA 4FWIB 1SCUB 1OILA 1MG0A 1VZ3A 4LXHA 5GADl 4QL3A 3THXB 3I23A 2HRCA 1BXGB 3ZDDA 1W19A 3IAEA 2XGGA 3RSGA 3PPIA 1U2QA 1YB1A 1ZJZA 3H65A 4I5FA 2P2LA 3UO8B 1Z5UA 4IKEA 1R0CA 4J49A 2QGZA 3BGIA 4C7JA 5JXGA 2PGNA 4ZMRA 4RK4A 2C7OA 2DQZA 4A1OA 4FKZA 3IRVA 1B0PA 3KT3A 1GPYA 4ETNA 3MINB 2AZXA 2GRAA 2I55A 3GT7A 1KBZA 5F64A 5CVJA 5IF3A 1A77A 3L0ZA 2YBDA 1NQTA 3ENQA 4RJTA 5I7OA 2FQ1A 4R0VA 4UM9B 1RFLA 4W7HA 1E32A 2Z30A 1RD4A 3QTTA 4DLUA 1KVSA 1OFIA 2V7TA 3BXZA 5JQWA 2YC4C 3UW1A 3A70A 4F4JA 2ORVA 3U3ZA 1XDSA 1E61A 3GMIA 2J5XA 2JCGA 4E5SA 1NN5A 5CR9A 1JEQA 1SA0B 1USKA 3KWJA 2AHRA 4RVDA 4RXMA 4G1BA 5CFQA 4QGSA 2H59A 1T9GR 2N3ZA 3E9RA 2G17A 1DRWA 3M4NA 3U4AA 2B4KA 4M83A 4JR0A 3ELDA 3HYTA 4ZYWA 3D7MA 3ETJA 3VNSA 1H66A 4W9MC 3TTVA 2HIMA 3L7AA 3P9RA 4YBZA 2ZI7A 5JQGA 3GFRA 2JVKA 1HT2E 1UC8A 4CM1A 3N3BC 2QYHA 1RXWA 4TYPA 5FLYA 4R1NA 2X22A 4F4HA 3TRFA 1NVDA 1ECJA 1CHDA 2EWWA 4RS3A 4BO6A 2R6R1 4ZI2A 3S8YA 4ZPJA 4Y3UA 2E87A 2C8VA 2XNSA 1DVRA 2IPLA 3JR3A 3OPYA 4HH3C 2GZAA 1N0IA 1T8UA 1YB4A 1AUOA 2G5CA 1GTMA 3BMOA 3IAS1 4FN5A 4O4JF 4ATNA 1PFYA 3ZWYA 4YR9A 1ZGJA 5D5PA 3SQXA 2V59A 2F1OA 1JP7A 5A7GA 4RD0A 1KF0A 3I53A 4MNTA 4PTYA 2QZSA 2I8CA 4AW9A 2CV0A 4V24A 3C8MA 3L9WA 1WMEA 5DX8A 5K0EA 3VKHA 4AROA 4HLUA 1Z5OA 1TGYA 4BNKA 4PZCA 5ALFA 1XNGA 4PYRA 2HF2A 4QECA 2YHAA 1H2RS 4NBVA 3AL3A 1C9KA 1DAKA 3ESZA 5ALRA 2P8SA 2BEUB 4XGRA 2C9CA 2PKXA 4QIHA 5IZCC 1D2AA 5D5HA 1OYYA 1R18A 4RQUA 3NBUA 4LJYA 1BEEA 1T13A 2WUDA 5A2GA 3COVA 4US0R 2UYOA 1EGVB 1WTAA 3KB8A 4I4CA 1H2WA 1FK8A 5EHIA 4XYLA 1N5JA 9LDTA 2AKEA 1RXVA 5HZGA 1PEKE 4Z4GA 4MVJF 1Y6RA 3D3WA 4N5HX 3NNSA 5EJ6A 3INGA 4ITUA 1WPRA 1IUNA 4L0MA 4ZT6A 4UXJA 3Q6MA 5DLPA 3QXGA 1QK4A 3DAHA 4OSPA 1C7ZA 1U0HC 5E7MA 1MR3F 4RJIA 4FCTA 2HW8A 4RIIA 4JR1A 5B1SA 3W4IA 3EY9A 2WF7A 1V35A 2C5AA 3ESAA 4GOND 4MPPA 4CKBA 4HAVA 1P7CA 4ZVVA 1P75A 2FW8A 3CLRD 3I9LA 3NGXA 3UEOA 2JHPA 1BTOA 1GYPA 1X1BA 2PWYA 2H5LA 4PG4A 1EFTA 1J23A 1LV7A 1EJ0A 1RC1A 2QYOA 3GY0A 4YB8A 3HNPA 1QVZA 2JIOA 1GITA 1XD2B 3TJMA 1BC5A 1UWCA 3F74A 2FW9A 4JX9A 3STTA 3NV9A 4Z54A 1I7QB 2EJVA 2LD4A 1PJ8A 4TQ9A 4U0JA 4WECA 4I46A 2O50A 4C5BA 3I9V6 1P7ZA 4UFPA 1M54A 5CW1A 3GFBA 1NXWA 3E4DA 4ETWA 3DKIA 2QN1A 1LDBA 1QZXA 5E1BA 1KKUA 1RZRA 2F8SA 1ZD1A 3MSCA 3O5AA 1I0LA 2EV9A 1R16A 3PFGA 5EZYA 3HWX1 3PTAA 3PT5A 1I94B 1RE0A 1XUOA 2BFMA 3C16C 1KIAA 3JQ6A 4EKNB 2COEA 2ERYA 2M1ZA 1GAEO 2QN2A 3LYUA 3H2ZA 4MVJE 4PS0A 2QLJA 1Y3DE 2PGXA 3LECA 4JL6A 2ZI6A 3VSDA 2B3DA 2P0AA 2XGSA 3VBEA 4F60A 4KREA 1WP9A 5AI9A 1P8JA 1AQJA 3PJGA 5EKSA 2XB4A 3H3FA 1WHTA 2WUGA 3K35A 4LJ4A 1FW6A 2X40A 4N0EA 3STXA 1C81A 2J32A 1ICIA 3P2IA 5GONA 1QTNA 2X3UA 1D4ZA 1G16A 4BP9A 1NBHA 1SG6A 3FCUB 1E3EA 3ZWMA 1NV8A 1R2QA 2IQ5A 2QI9F 2QWXA 4MHSA 4UEJA 5DNAA 4D43A 2JGFA 5HM8A 4WT7A 1Q17A 2BFCB 2ODEA 3SZMA 2EKBA 4I4LA 1H2FA 2XSZA 4I50F 1QNFA 3ADBA 2WIGA 3M9WA 3DR3A 1UOQA 3AB7A 3QLEA 3MIIA 3ZBQA 4WESB 4KQKA 2NVUA 1R50A 1U0FA 1UMDA 2QZZA 4FHFA 3GMTA 3ETEA 1QDLB 3VYWA 4H7IA 1AQIA 3GBVA 3LFHA 1U2GC 3TEJA 4UEOA 1IJEA 1RKBA 4GZLA 2CNOA 3BTSA 2UUCB 1WY7A 5ICSA 1QRUA 2CLEB 1G9TA 3QM1A 1KVTA 4MGYR 1ZNZA 1TVKA 1CKEA 4J94A 3L4JA 5TR9A 1P31A 1SC9A 1FMJA 2JAPA 3NT2A 4OQ4A 5JS6A 1KEKA 1ZLYA 8ABPA 4TQAA 2H18A 2C58A 1VMIA 3NIBA 1L7RA 1S2MA 1U8FO 3C48A 3UT5A 4MS3A 2GX6A 1JG3A 2C04A 2HTEA 3ZCRA 1H1TA 2O8FA 4QVGA 1N6KA 1OH6A 1NYRA 1SUFA 5LQDA 2F67A 2IPAB 4XM1A 5EWMB 3ZBPA 1BZYA 1TMOA 1ZSNA 2PH1A 1CIVA 4G3XA 4D3DA 5LJIA 4NFYA 5BOSB 5BRJA 13PKA 3DGEC 4UEWA 4BX0A 3WKDA 3QVOA 2ZB7A 3NM5A 5HEKA 2GN8A 3U39A 5HOEA 2PSEA 4BECA 1ECCA 2OHXA 1R1DA 1NF8A 2Y1DA 4H1HA 4WMLA 4NJMA 1UEIA 5K3BA 4AX4A 4U3JA 3AONB 1MFZA 2VUHB 5LOVB 3SSAA 3HXQA 2HRDA 1XXHB 3SVLA 1UC4B 1DMRA 3S1LA 4P58A 4NEGA 1E66A 1WHSB 3FNIA 1PIWA 3IUNA 4XA8A 3SZRA 1OH8A 2GK4A 1O87A 3T5MA 4XVQA 5FYQA 2XMCA 5IKEA 4QFBA 2A7XA 3MD9A 5IM5A 4DCUA 4M1EA 4YAKA 2I4RA 3LT0A 4OL9A 4IRUB 1VPEA 2FZLA 2PD4A 1PL7A 3DMGA 3WJ2A 2DFLA 4BU0A 1KEUA 2FNAA 3RVBA 3CGWA 3ZVLA 1T3LA 3FHJA 4HQOA 1U3CA 1Y9AA 4JJIA 1UBUS 4MB2A 4U2EA 4CWAA 3FTEA 3OKFA 4PLCA 2HLPA 2ID9A 2YXPX 1IQ0A 3E58A 2X1LA 2C31A 3NHRA 5FFFA 2VPYA 5KNCD 3CVYA 2VPQA 3OA0A 1BYIA 4AJ4A 2RGDA 5IT9A 3FE2A 2PGLA 5EHQA 5TQVA 3R7WB 3WLLA 1P2SA 2BN4A 2HSDA 1G64A 2IX9A 4DJEC 2JBAB 4HFJA 3QX3A 3IUYA 1DEHA 4YFYA 3HO6A 2YWDA 3EC1A 3W9BA 3L8CA 3OX4A 1QZUA 4N8EA 4RYLA 3A6DA 4EPWA 2Z3WA 2YZ7A 3NKFA 1M2GA 3MYRA 4L8FA 1MPTA 5ALYA 2IUUA 5KDOA 3PC6A 1T5TA 2IZ7A 4OB6A 3ROXA 3TVTA 3V7NA 4KYUA 3C3AA 3SN6A 3WB9A 1DJLA 5LZ5A 2WR8A 5DK6A 4FWBA 5F1OA 3W79A 1BXGA 3SZLA 2G63A 1KVQA 4QDUA 3H5NA 3B9PA 1JAZA 4LA4A 1P1KA 5D51S 1Z4OA 3AEZA 2FEWB 3V1KA 5BXYA 3T12A 1C3VA 2L69A 1EVEA 1SKAA 4ZWNA 4W5JA 4XB2A 5EXEA 1QG4A 4ECEA 2WJ3A 4JJKA 1PK9A 3LHSA 1P17A 2I4LA 3G8DA 2OLEA 1TA0A 3H16A 1U1GA 3SDSA 2CF5A 3CUWA 1EJBA 4Z5XA 1D6SA 5KJFA 2I29A 2NSLA 3FFAA 3R40A 1G4HA 3AF3A 1E4EA 3LBIA 1XYVA 4FINA 3D4PA 3G5MA 4FKMA 4TYQA 4COKA 4XUDA 3AU8A 3KWMA 1NX6A 3ZHVA 2GRJA 5B2EA 3F6BX 3VR2A 5BSRA 2DPMA 1PBTA 4XD7A 3MPOA 4GNKA 4JJ8A 4F1WA 3VZQA 5JALA 3HUEA 3DE2X 4ND1A 5HVNA 1Z39A 1LNZA 2QTGA 1NOJA 1XTUA 1KQFA 3STHA 4YJKA 2CDCA 2WM3A 5FWDA 4BLTA 3OH8A 1JEYB 2AD5A 3DE1X 3U7IA 3CZ4A 3LYAA 4F11A 4NMLA 1KC3A 1YBVA 1XMSA 1ZGZA 2WHXA 1CBUA 2VPXA 1BXRA 2ZEJA 1YQTA 2XVXA 3I2FA 1RBYA 4KV7A 5LYJB 2P5SA 2XF8A 4FHCA 5AICA 3K09C 5I7VA 2F9MA 2WJ6A 3A3NA 1QIIA 1CDEA 3QE0A 1FY2A 1UANA 2PT5A 4HDAA 5SV2A 2W6QA 4GC5A 4JROA 5E8RA 2XGMA 3WLJA 1ZNQO 4A0HA 5IJ9B 5I9SA 1ZUHA 1V4NA 5F1KA 1U94A 3PUIA 5HCNA 4JSTA 3SXUB 3IMCA 3DFMA 3GDHA 1HO3A 1ZRMA 2V6BA 1SGWA 2VOEA 2J5QA 2QXYA 4Z1MA 4DCMA 2OMKA 2VPTA 1CU1A 5D3MA 2GBCA 3GJ8A 3BREA 3K96A 3RC7A 4OXXA 4YHBA 3ND5A 4DHEA 1APBA 2B37A 3VJKA 3E9DA 2QPAA 3MJEA 1GAJA 5TJHA 4I1VA 3FOCA 3S44A 3LT2A 5KYUA 1FNMA 1S8OA 2QRMA 4DR3B 4GI1A 2ZRJA 1I4LD 2MSNA 1EUDA 2PWPA 3HXTA 4G0PA 1XZHA 4QUBA 4R1LA 2ZIZA 3RASA 2B6NA 1D2NA 1ZH8A 5T64A 3T52A 3GH3A 4JCCA 4RJ2A 2GTIA 4DIBA 1F0PA 4JIGA 3QE9Y 1ULSA 3OEHA 4IJUA 4UVIA 1NMXA 1O97C 1SQ0A 1PS8A 3AIOA 3G9ZA 1KZYC 1R8SA 3AHCA 2KQUA 3MTJA 4Z0TA 5ADUS 1L7PA 5B5SA 3K2EA 3TD6A 1R6BX 2FK7A 2O1WA 2SICE 4OHUA 2H31A 2G80A 2Q1YA 4RLQA 3U56A 1JIJA 2WPDA 3MCAA 4JQYA 4KAFA 3SHTA 4OI0A 3K53A 3DBRA 4GIBA 4JQZA 1SOAA 4E31A 4PG7A 1BHJA 1XEWX 5DP1A 2I6TA 2DKFA 3G59A 3TEMA 4DV2B 4GRAA 4BCCA 3EZYA 4QU5A 4RAQA 4OU4A 3V1UA 2D2VA 2O2GA 4BNGA 5COBA 2YJGA 3A1SA 3WBFA 5G0WA 2F17A 1ZIYA 4PXYA 3HFSA 4RZ2A 5CAEB 3DBLB 1R9MA 4H08A 3ULKA 4OFBA 4DQ0A 1RRVA 1IQUA 1II9A 2P11A 3GT4A 4N6GA 3WAKA 5DBEX 4MA0A 3H7AA 2PMKA 3U6BA 1KZ7B 2AFVA 4WY5A 1ULZA 3QVUA 3ZU4A 1YRYE 1ARZA 5AW3A 1QORA 2JJQA 4A6EA 1SUSA 3BSWA 1EP3B 1P60A 4EG1A 2Q3JA 3FNGA 2P1ZA 4DDKA 5JDIA 4DV5B 2BMVA 3CLVA 3V5NA 2IZ5A 3NHYA 5IBRA 4PINA 2OPBA 5KQLA 3IS3A 3UYKA 2FEXA 4ZYYA 5K8UA 3H9JA 4F12A 2P62A 3PX3A 4F71A 1ZD3A 3KDPA 3NHLA 3P45A 5K3DA 1FVHA 2Y1GA 1Y1PA 1K5DA 4C07A 2B5VA 4W7IA 3AEQA 1OZ0A 2A1IA 5GPBA 3ZNQA 3A6EA 2FSIA 2N75A 1BVHA 4Z7NB 4GR5A 3KOMA 5IC4A 1NJFA 3A8TA 2XVAA 3HXPA 5GVRA 3GD5A 4Z51A 4C0QC 1G42A 1N8SA 1TUEA 3RAGA 3L1UA 1S6YA 1ZAKA 2AOUA 1DBPA 4M1KA 4UVEA 5EJGA 3MA0A 3K5IA 4IICA 2Y1OA 1XO1A 4NZ9A 2ATXA 1PT8A 5DSZA 3TR0A 3UJCA 1BDIA 4JEUA 5TMDA 3ID6C 1EX9A 2WWRA 1P5FA 3EEQA 1Q92A 3IP6A 2CUZA 2C94A 4YXFA 4YDRA 3SSMA 1RRGA 5K6AA 1E2KA 1J39A 1ABEA 1HDXA 1QYWA 1UFQA 2BHRA 2I54A 2MSWA 3K31A 3QXXA 4QPPA 2HRBA 5H3CA 1KQPA 1X7ZB 3C8HA 5D8DA 2Q2NA 3Q6NA 2NZWA 3PL1A 4A6DA 1ONNA 3KQWA 3M34A 3QHPA 3QVWA 3QUSA 2N47A 3G7SA 3UFBA 3M81A 3JYNA 2X8LA 4X44A 4HDSB 4GWKA 4RVGA 5LQJA 2DETA 2H16A 3B5JA 4XGQA 3G2NA 1PAUA 4IZIA 4LXYA 3IXQA 5ESDA 1KWKA 1TL7C 3AK4A 3RRYA 1EDDA 3MAGA 3IQHX 5DRTA 5K0BA 2SECE 3ONEA 1O0SA 3A9CA 1WF6A 3TTSA 3FDXA 4ND3A 1ZIXA 4M8NE 2ZVDA 5U9CA 1XU4A 3RIGA 3QF4A 1XKXA 3RQIA 1SHKA 1N9GA 1WG8A 3R74A 4FYVA 2BM8A 3I28A 3JWHA 4DBLC 1ADYA 3WGNA 4ZI3A 4S0XA 3LOQA 1KMMA 4K1LA 2RARA 2O2XA 3IOBA 3AETA 4Y2XA 4FFRA 3U7JA 5GVSA 1Y82A 1CR4A 4RKWA 2J07A 4NZZA 1YA4A 1H4QA 2BFNA 3LDGA 4G09A 5K3FA 1E3JA 2CD9A 1XZQA 1WXQA 1FMFA 4L50A 1R12A 2Y76A 1Z2PX 3HJBA 5JPDA 3T38A 2JLWA 2R1ZA 4UFOA 4ZHQA 3IEVA 2QAGA 3RNOA 1PTJC 3QYFA 3IAXA 1ZN9A 1MB3A 1UUFA 2B34A 2OHJA 2H2HA 4LTMA 4PO9A 4P81A 1ONBA 1RACA 1RWBA 5CA0A 2RE8A 5CJPA 3L7BA 4F3TA 1J8MF 2IDKA 1U28C 1UXGA 1VGRA 2B5WA 2JIMA 3ET5A 4I5IA 3G5UA 4I50A 4CHGA 1KH1A 3A27A 1KI6B 3QKRA 4E14A 5C5IA 1WCIB 3PHJA 4BLSA 1JG7A 1YO6A 2RKBA 3ER9A 1J21A 2VJMB 4OQDA 1ECLA 2BSXA 4WK2B 5BSWA 1ULUA 4MDYA 4K6GA 1DADA 3JWJA 3SC2A 2IUSA 2Y1CA 5KIAA 2NYVA 2VLIA 3L6OO 5BWCA 5KMGB 3T9CA 2IHYA 3RKSA 1HDRA 3DMYA 4S0ZA 4TVSA 3G8CA 4JVNA 4IHJA 2XDQA 4IIGA 4KEAA 4P7JA 4CV0A 1ZCJA 5L51A 2YASA 4PLFA 1E2NA 3HJRA 4BL5A 3ISTA 3GRPA 1XTTA 3EISA 1UBRS 1YNOA 2ZBFA 3HRIA 1XD2A 2ECQA 4K1XA 2H2DA 4B2PA 3L1JA 2E4YA 2C96A 2E9SA 3BL6A 1MDBA 2WAAA 5C7IO 1FTQA 2PGDA 1H8EA 5DRYA 1VIYA 5KOHB 3VV3A 1CEEA 2VAVA 3CLKA 4JL8A 4JDUA 4MXDA 2X6TA 3AZOA 3PCRB 4B7UA 1OXTA 1PR4A 3QFRA 4CKBB 5F9FA 4U9IS 4INAA 3MOGA 1L8OA 1X8KA 5FNVB 3RVRA 3CUVA 4M7OA 4X0EA 3DFUA 3DHEA 2QZ4A 2RMKA 3HI6A 5CX1B 1EK1A 1A5ZA 5K0SA 2XCQA 3VSCA 2P9ZA 2O2IA 2RH9B 1A50B 2IYAA 1SC1A 1OR8A 1W76A 4FYPA 5F2KA 3W04A 2WA1A 2DLCX 2Y9PB 5JD5A 3DC2A 3GP5A 3LK6A 4JNCA 3SKYA 3U3MA 2BI4A 1FYWA 4JYMA 4U00A 5I5GA 5GM2A 5BMVA 5IASA 3ORSA 7ADHA 1WMAA 1ZN2A 1LJ8A 4GW3A 2BFDA 4EPRA 4MRAA 1YIOA 3WWEA 2HQRA 1V7PC 4COOA 1RPAA 4Q3OA 1RE1A 4QLBA 2FEPA 3LF1A 5EMJA 3T94A 1O7JA 4DY4A 3AW9A 3H9UA 3I6ZA 3SBDA 1SCDA 5KZMB 3WL5A 4JC8A 5DLEA 4BRWA 2GCOA 4MW7A 1Q0HA 1Z4NA 4B3CA 1QDEA 3PICA 3E3MA 4A23A 3JZDA 4IOJA 5JBIA 4QM6A 1R4ZA 1J07A 4LGMA 3KQSA 1NBMD 1MO5A 1O8BA 2Y93A 3FGNA 1KHTA 2FETA 3AI2A 4JJEA 3PCXA 2V1UA 3KZVA 4U5QA 3OCVA 4ZAVA 5LXTF 4BO8A 4JXXA 3FFXA 3SFTA 1QZZA 2B5OA 1JSLA 5CH8A 2A57A 3WKBA 4AUNA 4BXOB 4MZDA 1SVNA 2IOFK 1D5WA 3UGTA 5TIIA 3BIFA 4PO8A 1SXJE 3G23A 5KOJB 2Z2JA 3CRW1 4XWTA 1AKYA 2JJ8A 3GRYA 5D1NA 4I55F 1GQFA 5I7SA 3K16A 4E30A 4MUYA 4E7PA 3B60A 1E9BA 3H6HA 3UMVA 5LQMA 3WQRA 2XD9A 1H0SA 4UQOA 1L5GB 4IDBA 1VBKA 4YMVA 5G1NA 3RJMA 2OV2A 3B9QA 1I36A 3S7ZA 1CETA 3VSAA 4G0WA 1OBFO 2H4JA 2JGAA 3PYLA 2W9XA 4DCPA 2QSJA 3D8RA 3F98A 1SVOA 2QD2A 5LBIA 1Y3BE 4PIMA 3U3DA 1XJ5A 4FIDA 2BFFA 1IHPA 1VBMA 2VHEA 2NPIA 3N6RA 1KQNA 3TAXA 2VNAA 1F2UB 2DPLA 3O2JA 2Z57A 5IDVA 1OBCA 2G8NA 1B93A 4PHGA 3VR2D 4FFPA 3OESA 2PLAA 2DHRA 4XDYA 3WB0A 3CLUD 3X1DA 3C14C 3FPSA 1X42A 2JKYA 4M1YA 5F23A 5JEDA 2VDQB 4IH1A 2H2AA 5CITA 1FUUA 3OJEA 3M2TA 5JAIA 1E5VA 4Y0AA 1ISFA 4IJKA 1IPFA 3IEMA 2HPAA 3IUMA 4FXPA 4LY9A 1L5QA 4LDZA 2BVNA 5AW4A 2DFVA 3NPAA 5FBWB 1W0CA 1XDDA 3TQQA 3L02A 3CKKA 2NTYC 2XUDA 3D6HA 3H8JA 5EVJA 4BMCA 8OHMA 5JZVA 3LQFA 1RRMA 3DEZA 1SCAA 3R5XA 1PQPA 2CHGA 1MRNA 3V46A 4FGWA 2NACA 3HGTA 3OZRA 1H0HA 1WU7A 3ESDA 2NTEA 1LBHA 4M1QA 3IB6A 4W82A 3AG5A 2WTBA 3KB1A 4WCFC 4MGHA 1G7RA 4P3PA 4CEIB 4OLHA 3ANSA 1NONA 2RHGB 5L8VA 4DLBA 2HAEA 4BO2A 4C14A 5I51A 3FGOA 3ITEA 2B7CA 3T5PA 1UBNA 2HNKA 3DV9A 5CB0A 1H2YA 1IZZA 3LLMA 1DAEA 2GKGA 3BWXA 4LSGA 1HX7A 1HZJA 4EY6A 1HYEA 3ROEA 4WDQA 5ALLA 1HOXA 2EXXA 1LCIA 2OZKA 2GXUA 1JALA 2ESRA 4JLMA 3TFQA 3ESYA 5KC9A 4JVSB 5FI1B 4YGXB 2G83A 3I8XA 1C4KA 3K8YA 3NRCA 2FDXA 3CCBA 3PX2A 1YR1A 3IAUA 1M0EA 1QIGA 1ZBQA 3G2KA 3PJFA 3OE5A 3ETLA 5JD6A 1W2WB 2GSWA 2IUTA 2LR0A 2AUNA 3O9VA 2ECOA 1GZUA 3CGGA 4DTCA 3KQYA 3OOSA 4I5EA 4O02B 4FFVA 1EXWA 2D5LA 1C1DA 3LO8A 5EFZA 1HGXA 1S5PA 2R68A 4PQYA 3IHLA 3PVCA 3GCWA 3BSFA 3UYLA 2F8LA 2AN9A 2J33A 5BT8A 1TK9A 3MTEA 1KDZA 3ZK7A 1RC8A 2BBTA 3I5MA 1AE1A 5EMMA 5A1TA 4LFAB 3UGKA 1CUGA 5FYDA 2FSSA 2FMXA 2V6GA 4GF5A 4EKYA 4Z49A 2PT9A 3KV1A 3S8MA 1TZMA 3SKXA 1U8TA 3ECSA 3WXBA 3V4ZA 1ORTA 4KACA 4O25A 3BCRA 1DJQA 3IJ5A 2R7MA 2FXVA 1QP7A 2AH5A 3OCXA 3G9XA 4JLWA 4PSVA 4UDNA 5C5CA 2Z8ZA 2RHRA 2WMYA 3HVHA 4H0FA 4F3CA 5T7BA 5KQRA 3OIYA 3IIEA 3OX3A 2YS6A 4PYOA 1RAEA 3OJFA 1PHPA 1C9MA 1KY2A 1YH3A 1ZDMA 3NH9A 4O08A 4ZOEA 2GCGA 3R9IA 4B3JA 3CIOA 3PUKA 1OIVA 5DHFA 3I2HA 3D8HA 1UBGA 3IMEA 1UMDB 3WA6A 4XXHA 4Q7JB 1PR6A 3WNQA 4DMKA 1NMQA 2VR1A 3EZXA 4IIVA 5FAKA 4M88A 4RIHA 1LPSA 5B58T 4G67A 3UJ9A 2WMNB 3R23A 1F9EA 4QYIB 2Q29A 2EQBA 3GEMA 3N87A 2XUPA 4AJNA 2FHPA 2FI1A 4PCUA 2X0EA 4JOQA 4YV2A 1IN7A 3FVRA 2DFPA 4OQZA 5H81A 4RETA 1SVWA 1FPMA 3HRHA 4PR3A 1Y7TA 3M7IA 4OSOA 4QHSA 3IUBA 1R00A 1T8WA 3HE3A 5JJ5A 2NU9A 2J9YB 4Q4DA 1AH2A 3UOAB 2BH9A 1MTOA 4LVCA 3PE6A 1JF8A 1HNWB 3NCHA 4CF3A 4MUXA 4BFTA 2C5BA 5D86A 3TM5A 2XZPA 3WB2A 5KVCA 1Z34A 3U7EB 1Q1EA 2AUMA 3KXIA 4EY4A 1BOOA 5H02A 3REFA 1Y3CE 2D1RA 3M4XA 3USCS 1I32A 1KFJB 3K9CA 4LOIA 4OBXA 4NTZA 2CKMA 5HK8A 1CY8A 2YRWA 1HURA 1QGAA 5TQ2A 1VLVA 2O2SA 5EJ2A 2B1IA 3T1VA 1RZVA 2LDXA 5JXWA 1TAHA 3I1YA 2G06A 2PD3A 1CJUC 2YDXA 1HL7A 3DEFA 3IT0A 4J43A 3U9SA 3IR5A 1Y4ZA 2D06A 4HDNA 3VRHA 2COUA 5AKEA 5K0NA 2VDVE 1OKKA 1AKWA 1MEOA 2GNAA 2H5JA 2YMMA 5DXAA 5A62A 3TLKA 2O3UA 1R27A 1R4AA 5JCXA 3DDCA 1XE3A 5CJJA 1KDVA 1E1MA 1JR2A 5DHPA 3UV3A 3C7DB 1G6HA 4D97A 5IMBA 3RJ5A 4TYWA 2C2BA 1Q57A 5AJHA 5EIBC 1RHRA 5H0IA 1XQXA 1CFJA 1QIDA 3MVEA 4DSAA 5LQCA 4MDHA 3EUWA 4TL7A 4PX2A 2P0EA 3KQVA 4FYYA 4EGFA 5CFRA 3MS4A 1PDWA 1RXIA 3OU2A 1JLHA 1ABBA 1MAHA 1FS5A 5DFAA 1LX6A 4Q7KA 3E82A 4EDHA 1X7DA 3M6VA 1L7AA 3IIMA 3OCJA 4MQUA 2QRGA 3DUFA 1B23P 3IHTA 1ESCA 4OQLA 4I14A 4PHTA 1DAIA 1COWD 2WM8A 3M1AA 5TY0A 4HZUB 1QO9A 1P2UA 4IINA 5A7FA 2UXDB 2LP4Y 4ARCA 4TV8B 1NL3A 4Z9AA 3WMGA 1NWCA 3A3YA 1LS1A 3GDFA 1F2TA 3WWCA 3VTZA 3TUJC 2V55B 5I4KA 1C14A 4R2HA 2ZBDA 2OP1A 4KR2A 3HRKA 1CJKC 1J0DA 1QOPB 3D2BA 3EMDA 4QQKA 2GXAA 2WD7A 4EBBA 3BYZA 4RIGA 1Y81A 3AILA 5KQMA 3OFSA 1FTWA 3GZJA 4UBLA 3C39A 3H3JA 5BSFA 3L5OA 2ERCA 2ZYUX 2GM5A 1KDRA 1V3TA 4BGIA 3ZQUA 2Z6QA 1GY8A 3O8DA 2XNCA 1QE3A 4IMRA 5CTJA 1IXSB 2XPCA 3IR6A 4OQXA 2UZ4A 4KR3A 5ED0A 3R1IA 1P2VA 1T8PA 4MS1A 1JU9A 3WTBA 5JSFA 4JLUA 3TBHA 4Q9NA 5JOQA 2X4DA 3EPKA 4WKPA 1AK1A 3FMFA 1JQKA 1JA9A 2FMIA 3CRNA 4FIZA 1L5VA 4FOOA 3PXUA 4KPUB 2A7QA 3LX4A 1CY0A 1QAQA 1R8XA 1DV1A 1U2SA 3ZY3A 4EQ6A 4EZEA 4L4UA 2IYWA 1QQTA 1S4QA 3D1VA 4UMFA 1CQPA 3GFOA 3FZGA 2A1TR 3LXRA 5ULLA 2O23A 1OXUA 3AR4A 4P3XA 3TZHA 4AFNA 5DI3A 2CVOA 4KFUA 2R6CA 2NQ8A 2OAQ1 2VEDA 3K3PA 2CBXA 3A1WA 2RH8A 3JWEA 4OHWA 3W77A 3WLIA 1A88A 3A32A 5MF6A 4UNIA 1ZL2A 3BG5A 4MLZA 3CW8X 2UXCB 1J90A 1KSJA 2ODAA 2XWQA 3LSYA 1ESMA 1Z07A 3NW9A 1L1RA 2GF9A 4N0QA 1CNFA 1V1JA 4HL6A 3HYCA 1IY2A 3WK5A 5HK9A 1SUEA 4N3GA 4HGQA 4WK6A 1Z37A 4AZTA 1KVRA 2WF9A 1Y1SA 3KOXA 4IYJA 4RXUA 2C29D 5JH7A 3MHPA 1YDFA 4TKZA 3RT1A 4OH1A 4HAZA 3HLYA 4IEEA 1MT0A 1A1VA 2R7AA 1M2WA 3P1JA 3PZRA 2NZUG 1GGEA 4PZ0A 5E6SA 3O92A 3SEQA 2VHJA 2IS2A 2IQIA 4P82A 4PZEA 4QGAA 2ZYVX 2GM9A 3F1KA 1T36A 2V3VA 4I4IA 2X3FA 1ADCA 3K2QA 3WRVA 1WY5A 2ZYDA 1M0SA 1E79D 1XWFA 1EE9A 1AS2A 2Q07A 1TU4A 3C1UA 5J59A 5LC1A 2VDNB 3PFBA 4X3CA 3X2EA 4ZK2A 1I1HA 2O1SA 3GP8A 1JQBA 1L5HB 5K3SA 1CF9A 4ENUA 2IHVA 3HKEA 5D5QA 4XWOA 5G4KA 5K3FB 4Q1DA 2FCAA 3FKJA 1U98A 2XR1A 4R6WA 2YIDA 1E9FA 2WA2A 2Z58A 2R44A 5BSMA 1LLFA 3NJ8A 2PAAA 5L3SA 2WILA 4Y2YA 1PW5A 2Z2YA 4ZOLA 3TXYA 2WQ6A 1NJ5A 5AW1A 3U4CA 4CGYA 1D07A 3GLQA 4JMPA 5ESRA 4OX9B 3SJBA 1KIMA 2P3SA 4II3A 4LDQA 4BVHA 4C7KA 4EUKA 1QPZA 2AX4A 4QQ8A 4EJSB 1KSHA 4KAAA 3WSWA 1KR5A 1SBQA 1WKBA 4Z3OA 1VLMA 2IUEA 1Z0DA 1TQ8A 1PTJA 1YJXA 3WGMA 3BL5A 2HHJA 3EIXA 3FTCA 1EVJA 2PWZA 5DWVA 1WZUA 3HDYA 1TZBA 1VMDA 1KQGA 1R8QA 1YFJA 2Z6AA 1X14A 1DMSA 3BH6A 3DBHB 1G8PA 3FFWA 3GUVA 1YDWA 3D3EA 3QI7A 4WH0A 1L1FA 3KTDA 4ZVOA 2WAYA 2XBUA 1H3EA 1SC3A 1J8YF 1QJ4A 2OC9A 2X6QA 4R98A 4ZVTA 4JJ4A 3UQZA 3TIXB 1G5HA 4YJGB 5FRDA 3ZCPA 1VIVA 4L4ZA 5FPHA 4UPVA 4P08A 1ZUIA 1VKZA 4LJSA 4CM3A 3I72A 1NNI1 2Q6VA 2C5SA 1DQPA 3KOOA 4Z7JA 2QY6A 1C9YA 4R69A 1K7YA 3DLHA 1IWOA 1E7WA 2PTGA 2X2OA 4U63A 4EYEA 4RS4A 8LDHA 5ESWA 2H9IA 1H2AS 3BWEA 4PZ9A 4CU5A 3NALA 1X80A 4BRZA 2X1VA 3A4LA 2JFVA 4BQOA 2X8BA 4AXBA 3L8GA 5F7ZA 3LUBA 1XAHA 3PFWO 2P65A 3T3OA 5KYVA 2G0TA 2C9DA 3OQIA 4JJZA 3VH1A 4JT8A 2H85A 1NE7A 4L9SA 3G17A 2EHJA 4P92A 3RSSA 2PSSA 3QA3E 4JUCA 2YY6A 1K8XB 1OCEA 3PYMA 3HL0A 1DQSA 2QE7A 4P4SB 5NULA 1W1IA 4BRSA 4DRXA 4EGCB 4G9GA 1DX9A 3L84A 4H1TA 3R6GA 5DYTA 4D9GA 1G7TA 1U4OA 4RKRA 5EJ9A 4K3UA 2ZRMA 1S2DA 4DDHA 4KR7A 3STVA 4EHIA 2WAOA 2OWEA 2DVMA 2C2WA 2GYWA 4E4YA 3OQOA 3G6KA 3P0FA 1O58A 2YIJA 4GPD1 1IOZA 1M75A 1K6XA 2VO1A 2EKQA 4CN9A 1CP2A 1H2EA 3ZIAA 5JAHA 4XUEA 3G9TA 5IAAA 4HNAB 3OTGA 1QYVA 2FF5A 3OPYI 2I3ZA 1CTQA 4UHDA 1S8FA 5CM8B 5EJFA 4B33A 4Q24A 5C3MA 3TSZA 2ZATA 1J7KA 4MAMA 4PNZA 4QDKA 5IW8A 2GCOB 3Q7EA 3QE4A 4MVYA 2ODWA 2WBLC 3H0CA 3LWZA 1HG0A 3DZGA 4BUZA 2VT2A 4LRUA 3ZYCA 5KTKA 3LF2A 3D5TA 4MVJD 1ODKA 4E0BA 1YUMA 2C5GA 1XALA 1RYYA 2FWJA 3HDJA 3OIFA 4OM7A 4ZOLF 4YRTA 4BVFA 3HLTA 3WAGA 4CEHA 2R8YA 3C3EA 3OZGA 1HNXB 1X92A 2LKCA 5J23A 3NAGA 3H4IA 1P1FA 4M2LA 4PYQA 1Q74A 3BVPA 3FFBA 4NHEA 1Q6YA 1W48A 2FE4A 3P0JA 2HKIA 2OA0A 3FJ1A 2Q0HA 3VR5D 3AUTA 1IHUA 2BLNA 3U3JA 4MPDA 3NM6B 1PD1A 3LQQA 4EFKA 3I04A 1ZVJA 2FN4A 5KOJA 2H9AA 5IXYA 4HLNA 4AKIA 3CV3A 4MTLA 5EQDA 2V9CA 2EFDB 3WIUA 1Y8ZA 2A9PA 2NO5A 3RBAA 2W2LD 4L5CA 4ZP1A 3UJDA 3X1KA 4W5NA 4HDCA 1H69A 2GAJA 1ZNYA 4X1YB 1QAMA 2HA7A 4W5WA 2IGBA 1HM5A 1JYFA 1KARA 2O06A 2GZDA 2VG8A 4WWHA 3BEDA 4QBFA 5J1TB 2QN9A 2EBHX 1Z6QA 2OTCA 5ALXA 4F93B 1NOIA 5E95A 5FOQA 4Q82A 5EQJB 1ND6A <