4IH3A

2.5 angstroms x-ray crystal structure of of human 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase in complex with dipicolinic acid
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
332
structure length
332
Chain Sequence
MKIDIHSHILPKEWPDLKKRFGYGGWVQLQHHSKGEAKLLKDGKVFRVVRENCWDPEVRIREMDQKGVTVQALSTVPVMFSYWAKPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQAPELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELFPVYAAAERLKCSLFVHPWDMQMDGRMAKYWLPWLVGMPAETTIAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGFSMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELEPGKLIESMEEFDEETKNKLKAGNALAFLGLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase
publication title Human alpha-amino-beta-carboxymuconate-epsilon-semialdehyde decarboxylase (ACMSD): A structural and mechanistic unveiling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 112
structure length 332
sequence length 332
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.1.1.45: Aminocarboxymuconate-semialdehyde decarboxylase.
pdb deposition date 2012-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4ih3A00
4C6LA 1XRFA 3LS9A 2R1MA 4EPKA 1ITQA 3JZEA 4QROA 4ICMA 4G7EB 1J6PA 4I6VA 4KEUA 4QS6A 3T81A 3UPMA 3URQA 2PGRA 4HK5A 3RHGA 2Z29A 4DLFA 1YBQA 3F2DA 1J5SA 2GZXA 3IARA 4ERAA 1M65A 1ONXA 3O0FA 3S2MA 3MVTA 2Z26A 4UB9A 2PGFA 4PBEA 3ID7A 2OB3A 1YMYA 1EJUC 1FWGC 2HBXA 5HMEA 4XD3A 1QW7A 2R1NA 2VR2A 4QRNA 3MDUA 4ZSTA 2ANUA 4TQTA 4CQBA 3OODA 1I0BA 3S2NA 3EWCA 4C6CA 4GK8A 3PBMA 4CEUC 2HNHA 3PNUA 3EGJA 1A5NC 4GOAA 3ITCA 4XAYA 5CH9A 5HMDA 4EPEC 4H9MA 3K5XA 5E5CA 3K4WA 1R9YA 3B0XA 2Z27A 4WVXA 5A6TC 1FKWA 3PNZA 4KESA 4LALA 2R1LA 2WJFA 4HK6A 1EF2A 3TN6A 1YNYA 3WZ0E 4EP8C 4EPDC 1RK6A 2W9MA 4IG2B 3TN5A 1P6CA 2R1PA 3IJ6A 3RYSA 4JOMA 3IRSA 2KAUC 4CQCA 1M7JA 3A4JA 2VUNA 4E3TA 4C6QA 4IFKB 3C86A 3F2BA 3URNA 1NDVA 2DVXA 1GKPA 4XD5A 1A4MA 4IQJA 2Z2BA 4CNUA 4GY0A 1XRTA 4B92A 4LFYA 4KF1A 1KRMA 2HBVA 3DCPA 4PCNA 2OODA 3IGHX 2VHLA 4IFRA 4DNMA 1KRCC 3FEQA 4LH8A 4DZHA 4IFKA 3LGDA 1RK5A 3E0LA 3DUGA 5AKQA 3S4TA 3B0YA 2QS8A 3EWDA 1A4LA 2YZ5A 4GXWA 1JGMA 3GTHA 2YXOA 2EG8A 3MKVA 1YBQB 4F0RA 1XWYA 2OQLA 2UBPC 2Z24A 4QSFA 4CNSA 2Q01A 1R9XA 4ERIA 1FWBC 4KEZA 4GC3A 4GYFA 4AC7C 1UIOA 3E38A 3S2JA 1EJTC 3A3XA 2D2GA 1NDYA 2E25A 2Z4GA 2A3LA 2WM1A 3RN6A 4EPBC 3T8LA 1NDWA 2BB0A 3CS2A 4H9TA 3CJPA 4IH3A 3MPGA 2I9UA 1BF6A 4GY7A 3WMLA 4GX9A 3FDGA 4V1XA 2IMRA 3GG7A 2FVMA 3NURA 4LCRA 2Z28A 3CAKA 4DIAA 4J35A 1J79A 2D2JA 4H00A 4C6EA 2P50A 1RAKA 4H9XA 3OQEA 4IGNA 1K70A 2YB1A 3PAOA 4I6KA 2E1WA 3BE7A 4RDVA 3N2CA 3LU2A 4UBPC 4C6KA 1GKRA 1M68A 4CNTA 2UZ9A 1DPMA 1PTAA 3GUWA 4NG3A 4F0LA 1A5KC 2DVUA 3K2GA 3HTWA 2P53A 4KEVA 1RA5A 4BY3A 3E3HA 4RE0A 1RJQA 4RDYA 3OJGA 4L6DA 4M51A 1POKA 1QXLA 3QGAC 3AU6A 3GU1A 1W1IE 2BGNE 3QGKC 4WGXA 3D6NA 5FSEC 2RAGA 1E9ZB 3GRIA 1FWAC 1ITUA 1XGEA 3QY7A 2EG6A 3SO7A 1EJVC 1K1DA 4B3ZA 4C6FA 1A5MC 2AQOA 3R0DA 1FWCC 4AQLA 2VC5A 4RDZA 4LCQA 3A3WA 1NDZA 2QT3A 4LAOA 4PBFA 2YB4A 3GTXA 2ICSA 4DZIA 1RA0A 4MUPA 3TN3A 4GY1A 3GU2A 4WHBA 1POJA 2R1KA 4XD4A 2OOFA 1FWIC 3QY6A 1P1MA 2PLMA 3GIPA 4R88A 4C6NA 3T1GA 4ZSUA 3UR5A 1V51A 4HJWA 5HMFA 3DC8A 3QY8A 4Z42C 1K6WA 4J5NA 1S3TC 4KERA 4INFA 4H01A 1R9ZA 2FVKA 1IE7C 1FWHC 4OFCA 1FWEC 1ZZMA 2HQAA 4IGMA 4C6DA 4KETA 4BKNA 3LY0A 4XAGA 3MVIA 2AMXA 4HK7A 4H9ZA 3ICJA 4HA0A 4IFOA 4R7WA 1WXZA 3IACA 2Z25A 4DYKA 3UR2A 3V7PA 1EJSC 2QVNA 4PE8A 4LCSA 2Z7GA 2OGJA 2WJDA 1EYWA 4H9YA 1UBPC 3RCMA 2ZC1A 1A5LC 1RJPA 2AQVA 2XIOA 2GWGA 2Q09A 3MJMA 5G4HC 4C5ZA 1P6BA 3F4DA 2VM8A 4LAKA 4J2MA 1KRBC 3NQBA 1O12A 1YRRA 3G77A 2CZVA 2GOKA 4C5YA 2D2HA 4ERGA 2Y1HA 3LSBA 4C6OA 4GX8A 1V79A 1NFGA 2O4MA 3MTWA 2HPIA 3HM7A 4G7EA 4XAFA 1ONWA 3AU2A 4LANA 1GKQA 3ORWA 3HPAA 1VFLA 4G2DA 3E0FA 4H9VA 3E74A 3PANA 4IF2A 3MDWA 1PO9A 3KM8A 3O7UA 4CQDA 1O5RA 2Z00A 4R85A 4C6JA 5LXXA 3URAA 1PB0A 3B40A 3ISIX 4LAMA 4DLMA 3TN4A 4B90A 1FWJC 1EJXC 1FKXA 2GWNA 1EZ2A 3LNPA 4C6PA 3UBPC 4DI9A 4LEFA 4C60A 2VC7A 2EG7A 1FWDC 4D8LA 2DVTA 2FTYA 4B91A 2FTWA 2PUZA 1KCXA 3IPWA 3URBA 2I5GA 2GSEA 2ADAA 1A5OC 4NP7A 3S2LA 2HPMA 2PAJA 1FWFC 3OU8A 3IV8A 1V4YA 3F4CA 3E2VA 4P5UA 3UF9A 1V77A 4C6IA 3WYZA 4BJHA 1UMLA 2G3FA 4PCPA 1WXYA 1EJRC 1I0DA 4F0SA 4KIRA 1J6OA 4H9UA 3TNBA 4C6MA 4XD6A 3SFWA 3LA4A 1V7AA 1HZYA 1KRAC 3F2CA 4C65A 1ADDA 4DI8A 3GTIA 4KQNA 4IG2A 2F6KA 2QPXA 4YIWA 4NI8A 4GZ7A 4V1YA 3GU9A 1E9YB 3GTFA 4RZBA 4L9XA 5FSDC 2FFIA 3MSRA 3OOQA 1PSCA 3LSCA 2WJEA 1YIXA 2O4QA 3GIQA 4QTGA 2Z2AA 4QS5A 1EJWC 4C6BA 1UIPA 3AUOA 1RJRA 4GBDA 4CEXC 3OVGA 4RDWA 3NEHA 4XAZA 3LGGA 4DO7A 3FDKA
chains in the Genus database with same CATH superfamily
4MY8A 4KMQA 3OP2A 2J7CA 3LBOA 4YTUA 4QROA 2X42A 3ZVHB 4GNVA 1RBLA 2VZOA 3L0KA 5EKYA 4DJDD 3UP8A 4GGBA 4ERAA 4ACYA 5CAHA 4HQVA 1V6TA 5EMJA 4D6HA 3PTMA 4TUFA 4OBTA 4AAJA 2ALRA 4OOZA 3GVGA 2CC0A 1OIMA 4KCTA 2WXDM 3OODA 3TW9A 5BOFA 1J11A 4WKAA 3GDKA 1NARA 3F5JA 5AZ1A 2HNHA 3NL6A 4S39A 3VKDA 3CL7A 1U83A 3ITCA 5EFDA 2OYMA 3IJLA 5HMDA 3QVQA 3BC9A 5LIXX 2GL5A 4H9MA 4FNSA 3NZPA 4IQEA 2X7VA 4J3XA 2XH7A 5A6TC 4KCWA 2B7NA 3TNOA 2PD9A 1SYTA 4TU1A 4WSHA 4NNAA 4PCFA 4IIDA 3VDCA 5FJPA 1W3KA 3STEA 1J96A 1KM2A 5LNSA 4PUDA 1OK4A 5LNUA 3W2NA 1VFUA 4JN6A 1V3HA 2E7FA 4P8UA 3WLOA 2QCFA 4DAIA 1AZ2A 4RLIA 5F7UA 1OCJA 3TQ0A 3GFXA 2EPKX 3GY1A 5BRPA 1MRAA 4JX4A 3WLSA 2ESCA 3S83A 3CO8A 5HNRA 5AHNA 4YCPA 3CT2A 3BWWA 5E6YA 2E68A 4IL0A 3THQA 1R9XA 3AHTA 1TCDA 2Y8KA 3B0UX 4GC3A 1Z44A 4D71A 3VFCA 5BROA 2E25A 1KM3A 5ENLA 3FA4A 4MWAB 5CPQA 3F5LA 3QHNA 1TB3A 2IQ0A 3CJPA 4XQ6A 4GY7A 3SECA 3NURA 4XZLX 3DYPA 2NVDA 4AISA 3LPOA 3UT0A 3TONA 4HHMA 3EOLA 1XJBA 4IP7A 3FHQA 4PTWA 2QJJA 1RY0A 3RM4A 3ZM8A 3WH8A 3K4DA 3RO6A 3CLWA 3CQKA 1R87A 3VGEA 3LRLA 2CHRA 4RE2A 1WDSA 3VD9A 3P14A 5FD0A 3UXAA 4MYAA 5B7ZA 4PUMA 3UJEA 4EANA 3KTXA 1J93A 1QBAA 3MO7A 1VENA 3O1NA 1RA5A 2HXUA 1W5MA 1RJQA 1W37A 1QXLA 3G1HA 2OCZA 4JKMA 4FI4A 3CQHA 2EKCA 3O16A 3R8RA 2DUXA 4QSHA 2JKAA 3SUVA 4UQDA 5FL0A 1BFNA 3RX4A 4DUWA 4AMAA 4MOZA 4R53A 2EG6A 3NQGA 1UB3A 1O1HA 4QX4A 3G5EA 2HDJA 4C1KA 3TTOA 3M6DA 3PP7A 3A3WA 4DJDC 4LAOA 5AYIA 2ZDRA 2CHOA 4LS1A 2FHCA 4HYRA 1F6KA 3RLVA 1CLKA 1MI3A 2L5HA 1JAKA 1P1MA 1UD2A 3EOSA 1K8YA 3GIPA 5BYWA 2VX5A 1K6WA 1QR7A 1V0NA 1C8VA 3C52A 4H6RA 3ZOAA 2IPWA 4H01A 1T40A 1VF8A 4DB7A 1TE1A 1ZZMA 3DXIA 3V5CA 5CGTA 9XIMA 5A6AA 3TFCA 3LERA 3QC0A 2ABBA 4AX7A 4DJFD 3BURA 2OZ0A 2JEQA 2PDIA 5REQA 3VI2A 3I4KA 4KWVA 4FNRA 3CLMA 3ZLHA 1UWRA 2RDWA 1FH9A 4ZENA 2QMKA 4ZOCA 3MMUA 2YCKX 3SQLA 3W81A 3TAOA 1PEZA 4JTHA 2YXXA 3N4EA 4P8WA 3EDKA 5IOBA 3VMNA 1FWRA 1HQTA 1I2NA 3R10A 4GO9A 1CXLA 4RZ4A 3T08A 1DE5A 5E0CA 5F4XA 3VFLA 3M0IA 3TV8A 1OG0A 1NH6A 1ZU8A 1NY1A 3CHFA 3KRBA 4PMJA 5F2GA 4DYJA 4XX6A 4M6VA 1H1YA 4LVDA 2GJXA 1TQJA 1IXNA 1FHDA 4GI4A 2YIHA 4X0NA 3EOUA 5I07A 2OSYA 4FXFA 3RPMA 3P5ZA 3GM8A 1OABA 2AOSA 1QVBA 2V5KA 2ZRWA 4IM4A 4FZIA 1JI2A 4KBXA 4C6PA 4JNYA 2DPEA 4LEQA 2VZVA 4W9TA 1J8VA 3H2FA 4UTMA 3T07A 3C6CA 4LBRA 4MIMA 1WV2A 3U6WA 1B9ZA 1VB9A 1ZBWA 4UOJA 3UXDA 1LQ2A 4P61A 1LORA 4QLLA 1VRXA 1XIHA 4RXFA 4AEFA 3GB6A 1RCXB 1UR1A 2HXTA 4Z0JA 3VU2A 2Q3RA 3GNRA 1JPKA 2PLJA 2HSAA 3BW4A 1XD1A 1ADDA 4DI8A 5CZSA 2OLHA 4UZSA 3EMZA 3UY7A 2W0UA 4WUIA 1TVPA 4Z2GA 3W4RA 1PKLA 3VDAA 4N4QA 3OOQA 5LSMA 3IIXA 3QPZA 1UPPA 5I06A 2W61A 4Q4KA 4H41A 3O07A 1NP2A 3L65A 3M1ZA 1XLFA 5CLTA 1MW3A 3W87A 4FOKA 4TV5A 3PZGA 4QNWA 3FDKA 5HATA 3NZGA 3TYEA 3KZSA 1RP8A 3ZJ7A 1TG7A 4QM1A 1K03A 3MKKA 4JFSA 1KXTA 4KEUA 5G1MA 5E9XA 1FH7A 5EMYA 1OY0A 4UTIA 1FXQA 4UNLA 2BS9A 3DFNA 4I7UA 2OZ3A 3AXIA 4PFHA 1CNVA 5DMNA 2R1NA 1XIGA 1BAGA 1EPVA 3EDDA 3HFTA 4LTSA 1UZHA 2VELA 4C6CA 4XUGA 2XVKA 3FAXA 1TR9A 3CUFA 2FGZA 4D6JA 3KUMA 4PUJA 1OFQA 1JFHA 1O68A 2QHAA 3G1SA 3CPUA 4AHPA 4U4MA 4EXBA 3B03A 4HK6A 3WZ0E 1EKOA 4W5ZA 2J6VA 1KGWA 3I3EA 3O9NA 5M5DA 3WD3A 3AS0A 3HJEA 4IFKB 4FS9A 5AC4A 1EC8A 3FFSA 1H7RA 4IPLA 1RH9A 2X1RA 2Y7DA 2BOFX 5C71A 4K38A 3GD6A 1R86A 4GRSA 3WUBA 1VIWA 3VNKA 2ACQA 1CENA 4NRRA 4AMCA 1OCQA 1WDDA 3M43A 1GPFA 1JD7A 2AAAA 3DFOA 1NFBA 5J5DA 3KW3A 2PDNA 3PBWA 1N82A 3GDRA 4P7NA 4HPXA 2WO5A 3M64A 1JZ2A 3CWHA 1JGMA 3O6DA 3NM1A 2A1YA 4JQ3A 2FYMA 3OGSA 4I90A 4GYFA 1OZQA 3AXXA 3SY8A 2HROA 3NZ1A 1LLZA 2FDMA 4IMGA 3TTSA 3W82A 1B3XA 3D46A 2WVVB 3S5ZA 1BTCA 3UWVA 1ZCOA 4UMBA 2DJLA 2A3HA 3M0ZA 2PCQA 4DIAA 4H8VA 1J79A 4OT7A 4Q3MA 4O1FA 4K36A 3KL0A 5CZKA 2J7BA 4P7QA 3PAOA 2WNZA 2GSHA 2PDGA 4GUFA 1ONRA 1GQKA 3P74A 5LA2A 1VFSA 1NIUA 4NZ4A 2WM0A 4C6KA 4MF4A 4NAEA 4RZ5A 1F3WA 4CNTA 2G3IA 1PTAA 3RU8X 1QWGA 3QR3A 2XH2A 2GGJA 3HG5A 1Q4WA 3PPFA 3LN3A 1T6MA 3LD5A 5FEWA 1EUNA 1Y5VA 2I1OA 3MP4A 5FF0A 1XC4A 3W6MA 1YDVA 2DORA 1H7NA 4C6FA 1OFRA 4AZIA 3TJ4A 3POHA 4IJBA 2HK0A 3ALGA 4Q7BA 4U10A 3W84A 2YBVA 3OGVA 1K7FA 1Q2RA 1JEZA 1CBGA 4NKCA 5H8PA 1DKWA 3M0MA 3TYDA 4LY8A 4XVEA 1S38A 1W3LA 1QI4A 3ES8A 2VGBA 1FWIC 5I3HA 2FB2A 4JTQA 4NX0A 4YMZA 2V5DA 2XZ7A 4Z1YA 1IYXA 1TPWA 1S3TC 4AD4A 2XZ9A 3VD3A 3LLXA 1R9ZA 2YDRA 9XIAA 2C71A 4W86A 3DX5A 3LCWA 1XCWA 4NQ1A 4BKNA 5C5YA 2YZRA 1YTEA 2AMXA 1JUBA 3V35A 4UOZA 4DYEA 4J3WA 1EJSC 5FJUA 4WEVX 4GFSA 3WQ8A 2WNQA 3LHYA 4PB3A 1JGIA 4H9YA 5AYYA 4IPJA 3EWBX 2AQVA 3RM8A 4HMNA 2G41A 3PVFA 3RG6A 2O9TA 1RD6A 5G5IA 3AZSA 3QFEA 1DHKA 2D1ZA 4M29A 3TH6A 4XIAA 4O54A 1F3EA 1O5KA 1NQ6A 2ZRUA 4ATLA 4Y8EA 3RIKA 2V68A 2EPOA 1OK6A 3LG3A 1YRRA 3FY1A 4MPKA 1W1VA 4C5YA 4M80A 4WXYA 3WK0A 7REQA 4MB4A 4OV4A 4C6OA 1V79A 4ROPA 3IANA 1IEIA 1HKVA 1DWJM 4LANA 4G9PA 2I57A 3REQA 2OT0A 2A79A 3W27A 4MLRA 2EKGA 3OIHA 4UFKA 3GR4A 4L5ZA 2WSYA 1QHZA 3O15A 3EKLA 4FLQA 1PIIA 2ZRXA 4IMAA 6ALDA 4Q4OA 4G6CA 3U5UA 4X9YA 4J7RA 4KEMA 4Q6JA 2FTYA 3W2MA 4DF0A 2RDUA 2GVEA 1FY6A 1Q3NA 3P60A 5FIPA 4GGHA 4MJ4A 3SBFA 3IRDA 2QLYA 1WBJA 2QCHA 4BJHA 3DENA 2G3FA 1DWHM 3LPFA 6PTDA 1F9CA 1DIKA 3LA4A 3F2CA 2CLHA 3AIUA 3HURA 4V27A 2YSWA 1N8WA 3AZRA 4YS1A 1VGAA 4AIBA 1TTPA 4XB3A 4H4IA 2VL4A 2E6DA 4GVHA 2Y61A 3LSCA 5G2HA 4R33A 1T0OA 3CZLA 5F2MA 3GYCA 3A64A 3VE7A 1HXJA 1Z32X 5CPLA 2VQTA 5HWMA 3Q45A 1HO1A 1SGJA 3LBMA 1H1ZA 4N02A 3RR4A 2Y2WA 4O19A 1JDEA 3CTTA 1Q7MA 1DORA 1H11A 2A3CA 1FQ0A 1MWOA 4S2BA 3BV7A 4V15A 3TA9A 5DXYA 2X0YA 2GJXB 4L80A 4UOQA 4HNNA 3F2DA 4WDWA 3IARA 4J3SA 1QI5A 1BXCA 1J10A 1TPFA 2XTKA 1TTJA 3S2MA 1TR1A 4UB9A 3QPEA 3HG2A 2PDBA 3T44A 2OELA 3N2MA 3UA3A 4ZMGA 1YMYA 4EAMA 2C19A 1ZP4A 3HQNA 2VR2A 1Z48A 4RXGA 3R8GA 2VDIA 4DY1A 1THFD 4Q22A 2YPIA 4RNFA 4CEUC 4DBSA 1JUEA 1ZBKA 3UESA 4JN8A 3LUTA 4NAFA 1E1CA 2J24A 2VRQA 3B8WA 1A5NC 4UQAA 1TE6A 1PKNA 2D22A 5AN7A 3W29A 3K4WA 4WF7A 3CZKA 3D3AA 4JN7A 1BKHA 3RILA 4XTIA 2V63A 1PTGA 1XPYA 3BAXA 3CM4A 1YNYA 3UXLA 4MGGA 3LB0A 4B9ZA 3B8TA 1DJNA 1RK6A 3M41A 4S3GA 3G3MA 2ACSA 1LYXA 3TJLA 4YTQA 3VDHA 3CIXA 3VD4A 4QQ3A 1UOKA 5EBUA 3GNXA 2X0HA 1JYXA 5CGMA 4I3GA 4PTXA 4ZR8A 3OG3A 2ZQ0A 3CZ8A 3P81A 1OQFA 5A94A 2J7GA 1E6PA 1W9XA 3M0VA 2WC4A 3B4UA 2DW7A 5BWFA 1Y0EA 2PF0A 5FF7A 4HMEA 2J9XA 1Q8JA 3WO8A 5FJJA 2QDEA 1RPXA 1XYLA 2YXGA 4F0RA 5F1UA 3OBEA 2UBPC 1U1JA 4L7ZA 4QJ5B 1XD0A 1VP5A 1GTHA 4H1ZA 3TQPA 4WY0A 1JYNA 4DJFA 4GH3A 2V5LA 2EAWA 2Y4SA 2D2OA 2R82A 3ABZA 1ZLPA 3R94A 3CS2A 4IL2A 3ZO9A 1TPDA 4F2UA 2Z28A 3WF3A 1W9BM 5CBIA 3N25A 2GQ8A 3LCLA 4ZXOA 1DJIA 3W7MA 1E4MM 4R9OA 1TVLA 4RL3A 4IGNA 1ELSA 2PDWA 2X1SA 2FZDA 3L4TA 4I6KA 2C8NA 3IUIA 1UWQA 2RUSA 1BQCA 3ITOA 5CBBA 2XGBA 2X1TA 3WQFA 1A5SA 2PWUA 1V0MA 4ADSA 1UA7A 3TZFA 3HGOA 1MW1A 1S5WA 5HMSA 1XLAA 4RZ6A 1WDWA 4CKQA 1XYFA 4HSHA 4X3ZA 1HJSA 2BGNE 4AG0A 5FSEC 4H2CA 3HQOA 2PU0A 3VUSA 1GPWA 5LZLA 4IOTA 4AD0A 2VX7A 2OX1A 3NQFA 3NL5A 3R0DA 3RNDA 4M7TA 3EEGA 2XFRA 3DESA 3TP4A 3VINA 4ADTA 3OHMB 2BXVA 4JNZA 3PC0A 1O95A 4JBRA 1V6XA 1X1ZA 2GUUA 2P10A 3EDJA 4NJJA 2REQA 4WK9A 4CVWA 1D9EA 3I7RA 3VA8A 3H8AA 3BCFA 3S47A 3DFTA 1C8QA 5D03A 3M0LA 2C1HA 1TZ9A 2ABAA 4Y96A 3EXRA 4QG6A 3C0SA 4UFHA 1PWMA 1G01A 2X16A 3G2GA 4QAWA 2EJ1A 4N9CA 3UR2A 2QVNA 1BEUA 1DIDA 2YJQA 1PHQA 2Y70A 4GIRA 4NNBA 3PN8A 2V81A 1F6PA 4O17A 2FPYA 4K6AA 1A5LC 3I3BA 1RJPA 5HINA 1R0MA 4D2JA 4DBUA 3GUGA 1TO3A 4JQ4A 4LU0A 4O0QA 4NAEB 3NDZA 3PM6A 3WJWA 4XVDA 4N9EA 2HEJA 3VIJA 2HISA 4ZO9A 3R0UA 1GZGA 3ONCA 2D2HA 1JRCA 4EACA 3ES7A 1UA3A 2J75A 1E72M 5E1QA 5CC6A 3OZMA 2H90A 2NWSA 2EF9A 3EX4A 1F07A 3ANYA 3TVAA 3CHDA 3A5FA 3LHUA 3N4AA 3PANA 2A3EA 4PRTA 4GVFA 1DV7A 2G96A 2Z00A 3EDFA 1J4EA 3TK7A 2Y24A 3R79A 3RRXA 4DI9A 1FWDC 1V02E 3AHXA 2X05A 4M1BA 3W24A 1B54A 1ZBVA 5AC7A 1YTDA 4JTFA 1F74A 4E2VA 4LVFA 3G1YA 4QBXA 1JCLA 3CHVA 3H7VA 1ZFJA 4WXZA 2P3ZA 2ZZ7A 3WBYA 1QUMA 3SZ8A 2XFYA 5AHIA 4QITA 3MSGA 2A3BA 4EAYA 2PDQA 2H8ZA 4KQNA 2F6KA 3VGGA 3QR1A 4MJMA 3N11A 2J4GA 3BK0A 1SR0A 3QR0A 3NQ8A 3EEZA 3KRZA 3WX7A 4FEZA 2ZUWA 1ZB5A 1FCQA 3IK2A 3OZPA 3WNPA 2AL2A 4UTHA 1O5QA 1I2OA 3GZAA 5DLCA 4RDWA 4DXXA 3WH5A 3E02A 3WDIA 4QDWA 1GYNA 1EWEA 4L56A 1XRFA 2B7QA 1ITQA 3P6LA 1QOPA 3V0SA 4MFEA 4UQEA 3WQ6A 3REQB 1E73M 2JKEA 1FTXA 1ONXA 3PPHA 1CT5A 1G5AA 3T55A 2PGFA 1CB2A 3PFMA 4OKDA 3GX9A 2GVLA 1QW7A 4RNHA 3S1UA 4BEQA 1DHPA 4Q6XA 5D09A 1NQKA 1J0HA 4TQTA 3QQ1A 4FXRA 4AEEA 3NTYA 1Z41A 4UNIA 1B90A 3T78A 2QUMA 4AD3A 4AWUA 5AOUA 3GBDA 1FWWA 4B5UA 5GQBA 1F8IA 4U3CA 3B0XA 4UFLA 5BOOA 2I16A 1JR1A 2PEVA 3DECA 1HO4A 2QJIA 1WNOA 4GI6A 3UG8A 3CUJA 2XSXA 3BG3A 1NWUA 4UQCA 3AJXA 3I65A 4WDUA 2QNEA 3E1F1 3RR1A 2X1IA 5I3GA 3B3DA 1WDPA 3N4FA 3TN5A 1X96A 4MKNA 4ZO7A 2KAUC 4UZUA 1M7JA 1DEDA 1XFBA 2P0IA 3T0DA 1Z9AA 5AZ0A 3URNA 3VC5A 5LNRA 1NDVA 1U22A 4KGLA 5LNVA 1J2BA 3MS8A 1FWSA 3LTYA 4PCNA 4Z1AA 1K9EA 3CAQA 2XM1A 4HCDA 3D47A 4PSRA 4DNMA 5CBJA 1JXKA 5HUOA 5HULA 1TZZA 3HMJG 2Z2UA 1MNSA 2J74A 3CUXA 3EWDA 2EO7A 4JL1A 5BXSA 4J27A 4H3DA 8RUCA 3QGVA 3VIPA 3LMYA 3UPWA 2Q8ZA 2WSRA 3V1PA 3VILA 3VAVA 4J28A 1BHGA 2CHNA 4N7QA 3QM3A 5G1TA 2FMOA 4JTJA 2WM1A 4AH7A 3PG9A 3LNMA 4RPQA 5I03A 1A47A 1ZJAA 3AMLA 1ECEA 4LVGA 3WBXA 3FA5A 3LDVA 4NJKA 3RJXA 4PUUA 1BWLA 3ZR4A 4FX7A 1E1CB 1NP0A 2A7NA 3LPGA 3TLLA 4DUXA 2XGIA 1EGVA 2X1UA 2Y5SA 1O4UA 2E8ZA 3A3HA 2QXWA 1IEQA 3H2NA 4N6FA 2CITA 3T09A 1XP3A 4MB5A 3AYVA 3W0KA 4EOUA 3SIZA 3AIEA 3TKFA 4ES4A 3CZGA 2WHMA 3NGFA 3H7RA 3O06A 3ABXA 3WLIA 3B8IA 4CQ8A 4L6DA 1POKA 1VD6A 4ZGYA 1VS1A 4WGXA 3D6NA 5EGRA 2JQXA 3CZEA 4LYRA 1FWAC 3M0YA 5A8GA 3A4AA 3B8VA 5HJXA 3AYSA 2GGGA 5DO8A 2ODOA 5FACA 4LXFA 8XIMA 4AQLA 3TDFA 2VC5A 4HSNA 4PBFA 1IQ8A 1B3VA 2Y63A 3EWUA 1A3XA 2OG9A 4C1LA 3HU7A 4M8UA 2POZA 4JTGA 3EOEA 4XD4A 3AUJA 4WY0B 1P4CA 4F2TA 2MANA 4R88A 2NUYA 3NQ7A 3WNNA 5G4WA 1R2RA 1ME8A 3QMRA 3G1XA 2J47A 5F2LA 3EX6A 5F4SA 3TQKA 4JIHA 1G6CA 3ZFHA 4G5DA 4HA0A 3ZIZA 2BV9A 3HIJA 1VZWA 2OO0A 2QCGA 4GYKA 4QP0A 4WX2A 4DAFA 3B04A 1E40A 4B5SA 3THCA 3H21A 1CXFA 7ODCA 3GWQA 3AICA 3F4DA 5KSWA 3GQYA 1XM3A 2PODA 2PA6A 4JIQA 1E0WA 3GH4A 5FOOA 3WDPP 4CUCA 3OVPA 4LAZA 2OEMA 5H8UA 2O9PA 3UERA 3LSBA 3TAKA 2CZ5A 1IGWA 2BGSA 2HPIA 3HM7A 4GLEA 1UH2A 1N8IA 1M1BA 3CC1A 3AHZA 4UR9A 1VFLA 3BG5A 3MDWA 1P0NA 5HR6A 3DI1A 4D6DA 1QHPA 3TYCA 3WNLA 4C6JA 4QNEA 3W1RA 1K4GA 1LL6A 3V16A 2GDUA 3NSXA 1TV4A 2YDQA 4FOUA 4OBRA 3OLGA 3O8AA 3UXIA 2QAPA 4JTAA 5HR7A 5JIPA 2WZEA 4UTJA 1H61A 4LVAA 3MI6A 1V4YA 4JL2A 3UWWA 4C6IA 4MKSA 5CZTA 3FA3A 3SUUA 1P0DA 1V93A 1TMQA 2NW0A 1EJRC 3TX9A 1EHNA 1SUXA 2J88A 1B57A 2V8ZA 4QCFA 3H4XA 3THDA 1UWIA 2PDKA 3BSMA 1TPH1 1BGAA 4FNQA 3HPZA 1SO6A 3A4WA 2VMFA 4V1YA 2WCAA 2QV5A 4AXNA 5K9DA 3G6LA 3KHJA 2PBOA 1UROA 4R3UA 4L4MA 5JU6A 2PDUA 2FVLA 1KFKA 3XIMA 2IKJA 4Z1DA 1KBLA 3FJ6A 3UVIA 3LGGA 4O0ZA 3RMJA 3GC5A 3O2LA 4Z2LA 4DUVA 2WLZA 2CXGA 3JZEA 2PLCA 3G0XA 2PGRA 5CPNA 3KP0A 3APGA 4DLFA 1YBQA 2PWFA 1J5SA 3NSMA 4I8YA 3KTSA 3ABQA 3MVTA 1DJXA 1VFFA 2OB3A 2C91A 1UUQA 4QFUA 1LT8A 2HBXA 4K8HA 4I7WA 1NEYA 3DKJA 4NIRA 3TSDA 1EB3A 3KOYA 1HFBA 2ANUA 1MUMA 2XISA 2XFWA 3SRKA 1SFJA 3EWCA 1VJIA 4I9MA 2YL8A 5AVNA 4N9BA 1GEQA 1HL9A 2V5BA 4FAMA 2XPKA 2FTPA 2PTWA 2QYGA 3TTEA 4WVXA 2QCLA 3U4AA 1TIMA 3ALFA 1AD1A 3M7WA 3R2GA 5D04C 5XINA 3WDRA 3VX0A 3M0KA 3P84A 1OT1A 1QPOA 2Z1XA 1H49A 1UWSA 4AD2A 4FF7A 4QDPA 4AY7A 4NNCA 5G4EA 4JOMA 3EKGA 4TOQA 4CQCA 1Q8AA 4OOUA 1WP6A 2HWGA 3AIVA 1JNEA 3L67A 2ISSA 4W8AA 5D32A 1A80A 1G4SA 4A05A 1FXPA 2R24A 1LM1A 1HX0A 2AL2B 1KRMA 2DSZA 3N14A 1I45A 2J79A 3ZQ9A 3IGHX 2BG5A 3FEQA 2PZNA 1WZKA 3N3MA 1LBLA 4X2RA 4PB4A 3LCGA 3O6YX 1YADA 2VP8A 1UWTA 3BANA 4GXWA 3VD5A 2WBGA 4HKPA 3TE9A 1TTIA 1H2JA 2MNRA 3WEZA 2ZICA 4C90A 2J8TA 4TMBA 3AMDA 3G8RA 1GG1A 3NWRA 1Z7AA 3S2JA 4XBSA 4UTUA 3MI3A 4YN5A 1D8WA 1OFPA 1NDYA 1W3NA 2NV9A 3GNOA 2UWFA 1C93A 1R6WA 2XN0A 3RU6A 1E3ZA 3WK2A 2B7OA 3A4XA 2YYTA 5A8NA 2CPUA 5K4XA 1BF6A 4AXKA 1R3RA 4XZ9A 2NQLA 2EPHA 5XIAA 4B9YA 3ARWA 1L6GA 5H6HA 4O18A 4EWND 1XBYA 2V0TA 4DVOA 2DZSA 3GG8A 3MMDA 1GUVA 1TYGA 1SW0A 1LRTA 3LENA 1UR4A 3WN6A 1EDTA 3VOCA 4U28A 2F9RA 4UTTA 1GJWA 1RP9A 3UWQA 1MXGA 2FKPA 3PZUA 2YW3A 3BICA 3RLHA 1XH1A 5TD4A 3S2CA 1YHTA 3GU1A 1J0KA 3PTDA 4MNMA 1XYBA 3MUY1 1OGSA 1I8JA 3TYAA 2Q8LA 2NX9A 2FDSA 2CYGA 3DFHA 1KFEA 2PDXA 1K1DA 1HVXA 4IPIA 2AQOA 3KEHA 2W67A 1NDZA 2I7GA 2OLSA 1US0A 4FLRA 1OD8A 4IJCA 1RA0A 2VGGA 3QYQA 3H26A 4MWAC 1AMYA 4IJRA 4WSKA 3DZ1A 3WK1A 3W83A 3O6AA 4CNNA 4GWEA 1AH4A 1C9DA 4JFUA 5EMKA 1CX9A 3QC3A 5I7GA 5A2BA 1QJWA 1VHCA 3G1FA 3L0NA 1XPGA 2TYSA 2XH0A 1J12A 2HQAA 4QR6A 1TJRA 1E6QM 3MVIA 5CCZA 1HW6A 2OPJA 4J2PA 1TELA 4FB7A 4R7WA 3BMVA 2OYKA 3V7PA 3T0CA 3KBNA 5CC7A 2OGJA 3JW7A 2YCLA 4L65A 1UBPC 1VYPX 2ISWA 3H24A 3GXPA 1UMYA 1BPLB 5IHSA 2ACUA 1JZ6A 1XISA 1B3YA 5I77A 3MJMA 5G4HC 1S3HA 3W7NA 4K1WA 4QEHA 4L64A 3R25A 3RRAA 3S5YA 1A3HA 4O28A 1GVEA 1LQ0A 2D73A 3ZLFA 2WVSA 2RGMA 4O12A 4K8EA 2GOKA 3RAOA 3XINA 1ZY9A 5KETA 1WQ5A 2NV2A 4GUHA 2O4MA 3MTWA 4HN8A 1EXBA 1UH3A 2C0HA 4NZ3A 3O0KA 1RZMA 4IF2A 1BG4A 5KTLA 2XWEA 4N2YA 4LC8A 1JUKA 3ZSSA 4Y9OA 1UWAA 3VO0A 4KRZA 1UR9A 3GKAA 3VCNA 1Q85A 5DANA 1BYCA 2ZYFA 2GWNA 4OVXA 2EPLX 7ENLA 2ZX6A 5D2YA 5AC5A 4J3UA 1XIJA 2I5GA 2GSEA 2TPSA 3DG3A 1LWJA 2PWDA 3PBYA 1WZLA 4OZOA 5A6BD 4HNUA 1FX6A 5EB8A 3HG4A 3A12A 3AWOA 3C3UA 1WXYA 2INZA 3DBNA 4HYVA 1H7PA 1GHRA 3DG7A 4KIRA 4PMOA 5HA7A 4Q7NA 1EO5A 3UWEA 2VYOA 3KBJA 3WDJA 4DZ5A 5DX7A 1DE6A 2I17A 3WFLA 1PCWA 4DHGA 3BAJA 3L4YA 3HV8A 4HNCA 3T2PA 2XSAA 2Z2AA 3ARYA 4L1XA 1VR6A 3NO3A 3AUOA 3KVLA 4FA3A 2E5BA 4G8TA 8XIAA 1TX2A 4JGDA 4HA1A 3IJ9A 2QF7A 1G7VA 4GCXA 1IR2A 2RKXA 3LS9A 2ISFA 4FP1A 3W1UA 5HXMA 4ICMA 1N8FA 1O5XA 4TTUA 5FKYA 3DGBA 1EIXA 4Q32A 3MJYA 1TRIA 4Y2WA 3ARTA 1IT8A 3GHUA 4AZGA 1UC4A 3A6OA 4AZCA 1S46A 4U2YA 4TTGA 4YL2A 1IIHA 2PP1A 4B5XA 3UY8A 3HGSA 2I5QA 4NZ1A 3S2NA 6ENLA 4LAUA 4PCTA 3PBMA 4AZBA 4IT1A 1XLHA 1QRQA 3CZJA 4BCEA 2VTFA 4NYUA 4C91A 3ZSTA 2ZA3A 2OSWA 3OPSA 1OSEA 2WCSA 4XAYA 4A2RA 1E0UA 1FOBA 2PDLA 2Z27A 2AMGA 2ZA1A 4PUWA 2O7QA 3VCRA 3W7QA 1EF2A 1CGXA 3SURA 2PTXA 4CNPA 1Z6KA 4EPDC 1T99A 2W62A 4WR3A 4IMCA 4GVGA 3E5BA 1Y65A 1DTNA 1LTDA 1IF2A 1WKDA 4L61A 3WF1A 4KS0A 1ALDA 2P8BA 4QXIA 2PDJA 3WF2A 3RGTA 1V6UA 2RDTA 4M3PA 2OODA 2DJXA 3BL3A 1FP8A 4IMEA 4E38A 2YA0A 5FESA 3IGUA 3S4TA 5EMMA 3UFYA 2EPMX 2R94A 4M0XA 5JBEA 3RLGA 3LZ5A 2BHZA 1M9HA 1YBQB 3T0TA 4JYDA 2OQLA 1FCVA 4P8VA 1DWAM 1QOQA 1AJ0A 3W37A 3DHDA 2JEPA 4GQGA 2Z4GA 1XS2A 3A24A 2F61A 1FDJA 2BB0A 3VNDA 2XWDA 2IMRA 3DYOA 5DMLA 1W3JA 2PC4A 3FJNA 4ZFMA 1IZCA 1OYAA 3ITXA 2PWEA 2G50A 1TV2A 2WBKA 1F3TA 3DFPA 1VAHA 3W73A 1DOSA 2NUWA 3BE7A 4ENLA 2OFJA 1UC5A 5T9BG 1Q6CA 3KOFA 3N2CA 2DSUA 4ZA0A 4GMEA 3UYIA 3E0WA 3U3HA 1CXEA 5A6MA 2VX6A 1IGSA 4A29A 4I9TA 2ZUMA 1IWPA 4DBDA 4W5UA 4DM2A 1ODUA 4ASTA 3UWYA 2NT1A 4JTIA 2J77A 1VH7A 1H41A 3GRIA 2VEIA 2XU2A 4AD1A 2ZOXA 4JFVA 5A6KA 3MSYA 1UR3M 1BGGA 4AHQA 4GI9A 3OZOA 4PCSA 4Z08A 1EF3A 2E9BA 4LYQA 1FWCC 4RDZA 1EDQA 3ZLGA 3GTNA 2QT3A 1S2VA 4WOZA 2YB4A 3GTXA 4DZIA 1E70M 3WLLA 3WY1A 1ZAIA 1UD3A 1UWUA 1QDSA 3B9DA 3K8KA 3ZT5A 2C16A 3PJTA 2NQZA 1GJPA 1TUFA 3I6EA 3OLIA 3VIHA 1DP0A 1S1PA 2V9DA 2WKGA 1XGDA 1EA0A 1XYAA 3BGGA 3O63A 4KERA 3N13A 4D6GA 4KFPA 1KTBA 1OYCA 4KWUA 3WQOA 1HUVA 4NX5A 3A9IA 2SFPA 1GG0A 3SM0A 1T41A 1WKYA 1TV8A 3PUOA 4IFOA 4JY9A 1TX0A 1WXZA 2Z25A 4DYKA 1AQHA 1V3JA 2D23A 3ZWTA 3W1PA 4U5KA 5EY5A 2I5IA 3OVRA 2Z7GA 1BYBA 3CUHA 3L2LA 2WNWA 4S3DA 1VFHA 4MM1A 1UH4A 1V08A 3SCWA 1P6BA 2E09A 2J9ZA 4TXEA 3QBUA 1B2YA 5CG7A 4HP5A 5E9AA 3R11A 2GVJA 1BQGA 4NXSA 3UJ2A 4HHHA 5HQLA 3TFXA 1XQKA 4ERGA 4GZEA 2PDCA 1XIFA 4ZTXA 4HCHA 3FK4A 1KQZA 1TJ2A 4BZYA 3E0FA 4W88A 4DUOA 3EYPA 4URIA 3A23A 1UYQA 1KGXA 1TJPA 1HP4A 1H60A 1Q65A 5FJTA 1PB0A 4LAMA 2OEJA 3VC6A 3VNMA 1CWYA 1TPUA 3QMSA 1ZAJA 3VZXA 5HUPA 3WLQA 1F73A 1ME9A 5CJMA 3EWYA 2JIEA 2IQDA 4AVNA 4DX3A 3VE9A 2PLKA 1DQUA 3FLUA 2ZXDA 4O57A 4J40A 3IPWA 3TYBA 4DNHA 3C0LA 4B5WA 3IIOA 2QCEA 1W5NA 3DH7A 1TV5A 1SU5A 4F40A 3CXOA 4UCGA 1LRQA 5LGXA 2ZX9A 1WA3A 3IS4A 3AS1A 1W17A 1X97A 1XCFA 4HTBA 1SMAA 1UMLA 3NPWA 3AIRA 4XK2A 1YDYA 2ZC8A 8TIMA 3EPNA 5EMUA 3TNBA 3TMQA 2F2HA 1UP2A 5C0QA 2PTDA 3MKCA 1W9PA 1KRAC 4CN6A 5BXRA 2ZTKA 3ENLA 1ZENA 2P3EA 1FCBA 2ISVA 1KBJA 3OIXA 4JQ2A 6XIAA 2VFFA 1OHLA 4O16A 2W5FA 3C2FA 5C6MA 3R7MA 2CZFA 5IBXA 1SR9A 3UCDA 1N55A 4C6BA 2YFOA 4GBDA 1DWGM 1GORA 4HPJA 4ZQPA 1OADA 4NYYA 3KWSA 1EQCA 5HOSA 4W7VA 4QLJA 2E5CA 3GC2A 1VPXA 2VEFA 1IHIA 1XLJA 2CCRA 4AIOA 3EB4A 1YX1A 1QCWA 4L9YA 1GW1A 4J1OA 3V5FA 4NI3A 2E9LA 1VFOA 1LBFA 4GQ0A 2GLKA 2YA1A 4PBEA 4ORMA 3TSBA 2KZHA 3N2XA 3ZJ6A 1ONEA 3LCIA 1SZEA 2G0WA 5K4ZA 3RX3A 1XBVA 3TUUA 4IXXA 3PNUA 3EGJA 1PX8A 4MNLA 1G9HA 4QCEA 4QJ4B 3F5KA 3HOJA 1R9YA 4EIVA 1PDZA 4A8IA 2D24A 1QW8A 3W7CA 4JTRA 5I3JA 5I3KA 4TVCA 3N6QA 1Z3NA 1WOBA 1GVFA 3V4BA 2ZE0A 1EBGA 3INPA 3AIBA 2ZX5A 3HQPA 3WCZA 2R1PA 2Z1SA 5HDRA 3A4JA 3L7RA 2YCIX 2ON3A 3GG0A 1RR2A 4GVIA 5A6JA 2HS8A 3D0CA 5FJRA 2A6NA 3AISA 4OUIA 3IK4A 5JVLA 2PTYA 3S5OA 1KW1A 4NL1A 4A35A 3CWNA 1VBUA 1RK5A 4Q8TA 5AKQA 3L68A 3H2OA 3FVDA 3N12A 1GVSA 1XQLA 4CNOA 2BHYA 2ZUNA 5D9OA 1Y5WA 4AYSA 4DEFA 3EAUA 1X1NA 3H53A 3P3BA 3PBUA 4PMQA 1P6WA 3WH9A 1FWBC 4KEZA 1Z69A 1OC7A 1FBAA 2FGLA 1EP1A 3T8LA 4AZCB 2BFGA 1TQXA 2BGQA 2I9UA 1W91A 5C2CA 3I10A 3ARUA 1C7SA 4I5RA 3PZ9A 3QZ6A 4LCRA 1W1PA 4QISA 3MBDA 3ITVA 4J35A 1T8XA 1R2SA 3NQMA 3F4WA 3AXKA 3FAWA 1KWGA 3SY1A 1I2RA 5IDIA 4Z0SA 4DWDA 1EGZA 3VOGA 3ARRA 3MUXA 1FDZA 3BAWA 1Q6FA 5CEWA 1AVAA 2B4GA 3LQGA 3C4UA 2OWCA 1GKRA 1R85A 2TAAA 1DPMA 2WKLA 3RX2A 1LLWA 4JIEA 2CBUA 1CPUA 5HPCA 3PZIA 1OINA 3CV7A 5D9MA 2VR5A 3K1GA 1V0LA 1OF8A 4E4PA 1VEPA 3WFZA 3BMXA 2E40A 2WSPA 2FFCA 4Z2KA 2ZZ1A 3NM3A 3RLUA 4OECA 2G95A 1ODZA 1JPHA 2IKIA 2ZADA 3U2CA 5BW6A 1Y7VA 2XUCA 2Z0IA 1LP6A 4G1KA 1HL2A 4Q8OA 5A6BA 3SW6A 3VM5A 4F48A 1G4EA 3MUCA 2HV5A 5K3VA 1GT8A 3W7IA 1MQPA 4M82A 1P1XA 1QPQA 3PR2A 4C6NA 1WXJA 1DXEA 4UIOA 3NEVA 3UEQA 1GOOA 2WB5A 4JYFA 3C61A 3WELA 2FVKA 1BVWA 1IE7C 1FWHC 2WZMA 4IGMA 3NG3A 3TYZA 1W54A 4QQUA 4IICA 5A8QA 4HIBA 1TRDA 1SJDA 3IAQA 1E6RA 2QUTA 3I68A 1QNQA 1E15A 3W6LA 2Q09A 5D9NA 2GDVA 3STCA 2VJXA 1XIDA 1W3HA 3I3DA 1XLGA 2QJHA 1Y5XA 3FXYA 3I4EA 4LAKA 3RMEA 1KQYA 4LV9A 5DXXA 4W4QA 5HJYA 1G67A 1QAPA 4ZVJA 3C56A 1CGTA 3NQBA 3QMTA 3ZJ8A 4KWWA 3PK7A 2DV0A 4XV0A 1MSSA 3VM7A 4BFAA 4NSBA 4Q8NA 4JHZA 3VZZA 4H19A 3QEZA 4PBGA 4BF9A 4W8BA 5K9CA 2RGLA 4E2DA 1IEWA 4I9JA 1GONA 1OG6A 4JTUA 3QQWA 1XBXA 5IFTA 2QW5A 3B40A 5JMUA 5I6SA 3C8NA 4S3EA 4YU1A 1QU4A 2O9OA 5EFFA 1DQXA 4XSLA 4ACZA 2RH9A 4D8LA 4B91A 4JQ1A 3QV7A 1KCXA 5BWAA 2FLIA 5IFPA 2A6LA 4FLOA 3DDMA 3LI0A 3OU8A 3BLIA 3E2VA 4AHOA 3Q2DA 1T96A 3GFZA 3IV3A 3CGTA 3BAIA 3WMSA 1OGGA 5D8WA 1PYFA 4WKFA 1VPQA 1QNSA 1AH3A 3LK6A 3S5NA 2WPGA 1GQLA 4HHLA 1C3FA 1JPMA 2WKJA 3AYTA 4OTKA 1DJQA 2CLKA 2CKRA 3C8FA 3LCHA 4LBUA 3WBWA 3ABSA 3GDBA 4IG2A 4ZFCA 2R8WA 1FVPA 3VOHA 2Y88A 3EWWA 4US5D 2CLPA 2GSJA 1YXCA 4HT3A 3PULA 2H3DA 1DJYA 4DJEA 4IQLA 1LL4A 2RFGA 1EJWC 5D2XA 4LWWA 1H0GA 1C91A 4DO7A 2QPUA 4RV3A 1VRDA 2W27A 3FW6A 3UA4A 3DOPA 4EPKA 3SR7A 5I5RA 3R0KA 2WV8A 2VI0A 9CGTA 1KBKA 3WF0A 4ZZ9A 4ZQMA 3RHGA 4GI8A 1S5NA 3AFBA 4OJYA 3RCYA 4J9JA 1XLBA 5DY3A 4B5NA 3DFSA 1J5TA 3ID7A 3M47A 2J7FA 2V69A 1W32A 2CZDA 4LUYA 4IWWA 1CLXA 3FV9A 3DHFA 4JTLA 1OFDA 3AXMA 1G1YA 1DL3A 3CHEA 4RUBA 3RITA 4JTDA 2XIJA 3PZQA 3VCCA 3LRKA 4JY8A 1NAL1 3NIYA 3NQ2A 1OX4A 3AIQA 2CWXA 4EKJA 3WEMA 1KB3A 3GH5A 3B9OA 3GDTA 3WBEA 4WKHA 2NXIA 1UJPA 2WMFA 2J78A 3LOTA 4PB5A 3PZMA 4AVFA 3EWZA 3WF4A 4I8DA 3DEQA 1TA3B 1ISVA 1TCMA 2HVMA 2ONEA 1Z89A 4C6QA 1BKSA 3W7PA 4ORIA 2GK1A 4MAVA 5MKGB 3DCPA 5JUVA 4PMUA 4G7FA 3GW0A 2J66A 1KRCC 1VCGA 3BOFA 4AZ6A 4ZCWA 1DIEA 4JX6A 5ABEA 4DF1A 3KWXA 4IX0A 2QUVA 4HOXA 3N6JA 1RXOB 3QTGA 3W7GA 2Q01A 2C7FA 3W1TA 4S3CA 3B9NA 1I2QA 2OT1A 4W7UA 4RKAA 3BARA 3L66A 2D2GA 3ELFA 5C54A 4YVXA 3TTQA 1SPQA 1UP0A 2R9RA 4K37A 1NTHA 3VNZA 5I3IA 3OTRA 5D2TA 3QLLA 5M3WA 3HN3A 3FOKA 1C8XA 4RNJA 1V7YA 2A0NA 3T4WA 1QBBA 1GJUA 4H9XA 1W3IA 4P7LA 2VKZG 1MYRA 4AY1A 2PS2A 1YPIA 2WZTA 4DWSD 4MY9A 4CD4A 1HIZA 4KCVA 1KLZA 1SW3A 4H6QA 1ZCCA 3GVQA 2WMIA 5L6UA 2W4XA 3TEVA 3EX2A 1QO2A 5C8BB 4LUTA 3DBPA 4O1AA 3SRDA 3WDQA 4V28A 3K2GA 1U5JA 1ZJHA 4EXAA 4KEVA 3E3HA 1X7FA 2C1IA 1L6WA 1W1IE 3WENA 4CU7A 2ZXBA 3OA5A 1PV8A 1E9ZB 3SCRA 2UY5A 1XGEA 3VNIA 3QY7A 1HKKA 4A8NA 4WSJA 1L6YA 3ARVA 5A6SA 2V2CA 1ISXA 4AU0A 4PTVA 2PMQA 5LIYX 2A5HA 4JCLA 4A3UA 4ZODA 4JHOA 2ZDSA 1AMKA 3HJZA 1FWNA 2D3LA 4OWGA 4IUOA 3Q65A 2QULA 1FFRA 4TV6A 2VEKA 4N9DA 3HPXA 1RY8A 3KS6A 1PAMA 5GJNA 3QTPA 1H7XA 4LBSA 2OX4A 3DC8A 4J5NA 1EC7A 4JHMA 1NWSA 3VKKA 1CYGA 4INFA 3VOJA 4O10A 3UNTA 5G1YA 1WZMA 2CBVA 4RR4A 2FGBA 2VOTA 7TAAA 3SY5A 3IGSA 1NM9A 3MT1A 1SFSA 4Z1BA 7A3HA 1HKIA 2E4TA 1E4LA 1R3TA 2P8CA 2GJNA 4HMDA 1OIFA 2XIOA 4MG4A 2D20A 1SMDA 5HNNA 4C5ZA 1VBHA 1UP3A 1M04A 4MSSA 3RJYA 4DELA 3CQIA 1JULA 3TZNA 3IJQA 4PGLA 1X7IA 3GS6A 5EYWA 1AQ0A 4JTCA 4WLCA 4LPCA 3G77A 3WUEA 3ZYZA 2CZVA 2JFEX 1HJQA 2BVWA 5DT5A 3NPXA 3VNYA 3VZYA 2GUBA 2J62A 3NQEA 4S2CA 2IUZA 5AECA 2F38A 1YTKA 5PTDA 5C9UA 4YTSA 4GKTA 2F8QA 3PUEA 4JYEA 5I3DA 3T0BA 5BMWA 3CMFA 2ZXAA 1ONWA 1JL8A 1MEWA 3W9ZA 2DSVA 3ORWA 2YLLA 1H09A 4POCA 4IUGA 4K7VA 2PRHA 4S3BA 1PUDA 3AXHA 4R85A 5MF5A 3GKFA 4FSAA 4DJFC 2Q8XA 2QV4A 3S9IA 3ITLA 4DM1A 2GQAA 1EYEA 2CERA 4CD6A 3M5YA 3M7SA 3T9PA 2HJPA 5CJ5A 1B3ZA 1JAEA 2OKTA 1ME7A 2BASA 2ZVIA 2ZA2A 1XSJA 2PDFA 4ZBCA 4NP7A 2BVTA 2PAJA 1FWFC 4Y7EA 3CV1A 5LNWA 1Q7QA 1MDRA 1OJXA 3NDYA 1AK5A 3PWGA 1DWIM 4HTYA 3NOYA 4ZOBA 2A85A 1M6JA 3KE0A 4DO6A 5HQEA 2YOCA 1QI2A 3E2SA 4NT0A 4RE3A 3WMCA 3BUVA 1IEXA 3VKAA 2PP0A 2Z1WA 3ARZA 1SJCA 1Z42A 3WKZA 1LL7A 3EXSA 2A21A 3EX3A 1W8SA 3GTFA 2DQWA 3PS7A 3C2RA 4A3RA 3PJWA 2A7PA 3JRKA 1U30A 2BX7A 2A7RA 4UFMA 2GUYA 5FA5A 4CEXC 2HS6A 2AKMA 4O1EA 4ZB2A 4H2HA 3L21A 4YHEA 1HTIA 4MLJA 4XWUA 3UZ5A 3THAA 3B05A 4QS6A 3P80A 1KFCA 2Y7FA 4XO6A 4XIMA 2GZXA 1CGYA 1UD8A 2ZTJA 1E6NA 4B5TA 1EGMA 1M7OA 1HVQA 1FWGC 3WMBA 5HMEA 2PPGA 3T0AA 3IUHA 1WKFA 4JTTA 1X38A 1QNVA 3R43A 3SN1A 4NY2A 5JH1A 2OKOA 3EOOA 3DFYA 2ZUSA 1R38A 5C9WA 2Y0FA 3V5OA 2V38A 3L4WA 4L6HA 3SFKA 2DZPA 4XKYA 2QVHA 3KBWA 4O14A 1GCYA 4G1NA 3PWIA 3KZPA 4JIPA 3PNZA 1D3CA 4GH1A 4U2ZA 4YXGA 3PHAA 4BQ3A 2RHGA 3GAKA 3OEXA 3APYA 1C29A 1E4IA 3KOZA 4UQBA 4IG2B 1JD9A 1K77A 3S1VA 4Q4PA 4LC6A 3W72A 4E3TA 1VC4A 2WWDA 3C86A 1GOQA 4IIGA 2D69A 4GPNA 2VC9A 3OHIA 1YNQA 3VIOA 2PRMA 2Z2BA 4FX8A 5LIWX 4YWIA 4QDMA 5HK4A 5C7HA 3OQ8A 2QR6A 1AW5A 3GNNA 4PMVA 3ITTA 2XIBA 2WZIA 3V18A 5D4YA 3KVKA 3ZR6A 5KZMA 3NFUA 3VIKA 2JKPA 2ZWZA 1HGWA 4S3JA 4WDTA 3L0GA 2QS8A 3R13A 2YZ5A 3XISA 1V6YA 3GTHA 4AZHA 1TTQA 2GFTA 5D2VA 3F7JA 4F3HA 3SGZA 4GNKB 3W6YA 1W6TA 5A95A 4QGCA 3OW1A 3RN6A 1PZ1A 3G6MA 1KWKA 2DEPA 3NXFA 3MPGA 1Q66A 1A0DA 3SDOA 3UWZA 2FZBA 4AIUA 1BLIA 3CAKA 5EL1A 4AF0A 2C15A 5KITA 2V3FA 1KM5A 1E5JA 5T26A 3FSUA 1XRSA 5BOEA 2VVSA 1CLVA 3VYLA 4FR6A 1GVOA 2WLYA 1OX4B 1UR8A 1ZGDA 4Y9NA 4XBKA 3G22A 3DHUA 2TRSA 3V0UA 5EPDA 4QAIA 4CCDA 3EA2A 3W70A 3GBEA 2QMJA 3E49A 1JZ4A 4LYPA 1MVYA 4RDYA 3QOMA 2GPTA 3DI0A 4W89A 1GHSA 5FCZA 2RAGA 2GK1B 1PPIA 5T9CE 3WQ4A 1LOLA 1EJVC 4O0KA 3Q58A 3H7UA 3L4VA 2CETA 4LCQA 2DSKA 2VCCA 1B3WA 1OVDA 3B06A 3R89A 2ICSA 3QYSA 4ICCX 3LM7A 4NZ5A 1WAWA 3KOWA 2I14A 2VRKA 4GY1A 3S1GA 1B30A 2OOFA 4O11A 2HRWA 3QY6A 1QPRA 4FOJA 5U7SA 5REQB 3PTKA 4UQ9A 4BWLA 1EEXA 5SWUA 4US5A 1GTEA 3B4YA 3GR8A 1RCOB 1V02A 4PTMA 4OHQA 2D0HA 1UQZA 3QSTA 4ATWA 4M6PA 1PIGA 3HZ3A 3WD0A 1Q7ZA 4M6QA 4GFIA 1UASA 2V5CA 3SCPA 2WMIB 3WLKX 2WWCA 2OTDA 3WQPA 2V82A 1US3A 2VM8A 3WQWA 2I9EA 1FP9A 2E6FA 1F3XA 1W9DM 3APTA 4WOQA 2Y7GA 3RF9A 3HGJA 2INEA 3TIMA 1K7EA 1K7XA 1AW2A 3PPCA 1ICPA 2JIWA 1E0TA 1XX1A 3SRFA 4YPJA 1OFEA 2R14A 3RO8A 4QE4A 4OIFA 5BRBA 4H9VA 3NXLA 1U1HA 1LWIA 4GYPA 5M1TA 2A4AA 4MUZA 3KP1A 3G18A 2VNCA 1AFSA 2Q6ZA 2FH8A 1M41A 1PL9A 1DIOA 1FKXA 1XH2A 4D6CA 1RQBA 3W2KA 2WJZA 2FHFA 1YE4A 1F5ZA 3UNDA 5ABGA 4UXDA 3U57A 2HPMA 2YA2A 1PDYA 4LF1A 4PTNA 2FZNA 4NILA 4EXQA 4RW5A 6XIMA 3WYZA 1XG3A 3TC7A 2IPJA 2Y7EA 3GHRA 2DH3A 4GC4A 3K4AA 4S3KA 3CYJA 4XUYA 1HZYA 2QPSA 4HYWA 1HJUA 2WSQA 5D30A 2OWXA 1UD6A 2NWRA 4HZ6A 1R3VA 4B4HA 3HQ1A 1BWVA 3SCOA 1LROA 3ARPA 3ONBA 1WBHA 3BLFA 1K9FA 4GKLA 4PRWA 3GXTA 3MV11 1J2WA 1E43A 3UETA 1JDCA 1UZ1A 2UY4A 3GDMA 3QJAA 4XAZA 4YCOA 5I78A 1PJ9A 1XF0A 2DQXA 3M6YA 3H23A 3MWCA 1PZ0A 4PUEA 3W1LA 1CGUA 1LCOA 2J27A 5AFDA 3UR7A 1AUSL 2XVNA 4I6VA 3RPDA 1YLVA 5TNVA 3UWUA 1KBBA 3PF3A 4X63A 5F4WA 2VEMA 2EXOA 3EB3A 2VFEA 3WH7A 3KAOA 2IS7A 1GEHA 4E0CA 3IWPA 3W1NA 4JFWA 1X6NA 4K8GA 1Q13A 5A1AA 1GW9A 3S8HA 5A2CA 5EA9A 2VDHA 4ZTYA 3WIJA 3WJYA 1OT2A 1JRBA 1U2YA 4DWSA 3W75A 1W8GA 2AQWA 4QHRA 1PE1A 3NNTA 4KPLA 2C6QA 3RXZA 3KCLA 3M9YA 2FJKA 3KX6A 2NQJA 3W1AA 3IUDA 3L2MA 3LM3A 3NA8A 2YBTA 2H8XA 3HGRA 3TJIA 5E5CA 2E1DA 4R5EA 1FKWA 2IQTA 1PKMA 2ZRYA 1AZ1A 4Z17A 1KXVA 3AC0A 3GK0A 1BG9A 2OVLA 3MMWA 4F2BA 3BTNA 1BVZA 5KINA 3P2VA 1W1TA 3M0XA 5DCDA 3S1WA 1J01A 3C2VA 3BZJA 3WDHA 2DIKA 4JKLA 4AY8A 3HB9A 3O05A 2PFHA 1E71M 4WD0A 3S0CA 1CIUA 2VFHA 3AIWA 1E9LA 1XRTA 4O1DA 4B92A 1CZ1A 2FQIA 3U8GA 3K13A 1V3MA 4PFMA 1KCKA 2JGYA 2ZUUA 3EA1A 4M1RA 3DN5A 5ECUA 1TMLA 2BY1A 3I6RA 4IFKA 1KM0A 4XZWA 2GJLA 4H7VA 1H0IA 3KL3A 4UTWA 1AL7A 4C1NA 2POTA 3H2AA 3UG3A 4O4VA 4CNSA 2CEQA 5J5RA 2ZZ5A 4ERIA 1DJWA 3IGXA 3RM9A 4M19A 1UIOA 3E38A 2VEPA 1RHCA 1TPVA 4A6GA 4JQAA 2Y8UA 1H4PA 1DWFM 3AMGA 3EBVA 2NXGA 3H70A 4HVXA 1VPYA 2XM2A 4RCXA 1YPFA 2QIIA 1Q6EA 4XZIA 3VX1A 4LRSA 5A5WA 2BY2A 5AYBA 4KKXA 4XKYB 1ECQA 5CLWA 3QKZA 4JFTA 3OQEA 1ZPTA 3NPVA 1ESWA 5GNXA 1ISZA 2WVVA 1TWDA 2CNCA 1UUMA 2J8FA 3LRMA 3TC6A 5KEZA 1HP5A 1EOKA 2H3BA 4F9DA 4D72A 5E0FA 3EXTA 3VNJA 4XSMA 2NVAA 4FHAA 1HL8A 3BDKA 2Q02A 3NQ6A 4J3VA 6A3HA 1XIBA 2OEKA 3QHMA 3OVQA 4JIIX 3H4GA 1ITXA 3T8QA 3WD1A 1H63A 5AY7A 1LWHA 3EX1A 2QJNA 1LRNA 1A53A 2V3EA 4XZMX 4DPQA 3N6HA 4R7OA 3PBVA 4G56A 1LOQA 1W2PA 2OOGA 4PULA 1BYDA 2LLEA 1T7LA 3MCOA 4B16A 3G0UA 5LKYA 3C0JA 2R6OA 5DT7A 3AI0A 1B0IA 3TN3A 5HNTA 5LIKX 2BOEX 2J9YA 5IXEA 2D3NA 3TMLA 1J0IA 2P5NA 4M7SA 5T8GA 1CW2A 1TJ1A 2VT0A 1MO0A 8A3HA 1E1FA 2PI6A 1JCXA 4WRHA 1OFAA 2ZBTA 1M7PA 1XSKA 3PSWA 3QLDA 4HU8A 3FYYA 4GZJA 4HZMA 4C6DA 4KETA 5HBFA 2W6RA 4HK7A 4AF0B 2OXNA 3OLDA 1E5NA 3KHDA 2C14A 4N0RA 3IJIA 4HU3A 3LHTA 1CECA 1Q6LA 3I6TA 1GVIA 3BO9A 5IHRA 7REQB 1EPXA 4W87A 3WH6A 3MZ2A 1CCWB 4CU6A 2YDAA 3BZGA 2XIIA 1XXXA 4X2PA 1L6FA 3N9SA 1EQPA 3AHVA 1TPC1 2V2HA 4A21A 3S46A 3BW3A 4XAFA 4E8GA 4UFJA 4LJ3A 1MUWA 4G2DA 3B8DA 4YYCA 4BQ2A 3LGEA 3PG8A 3LQLA 1JZ8A 4FNPA 2VZUA 1KFWA 3WFAA 1GWJA 4LNYA 3F4VA 2XINA 5D8ZA 4B90A 1K8XA 7XIMA 1O7AA 5CSYA 1EJXC 1M3UA 4HHPA 4UTLA 1UKSA 2WQDA 3W38A 2ZZ2A 2EG7A 2FTWA 3G24A 8CGTA 1JCTA 4LVBA 1PIFA 2JF7A 2YGYA 1A5OC 4JS3A 2QCMA 2CLMA 1SFLA 4Q7IA 3S6OA 3KS5A 4CD8A 2IW0A 4PL1A 4LUIA 2YCEA 1OF6A 3HG3A 3MP5A 4RE4A 3ZZ1A 2JF6A 2BXYA 1I0DA 2Z7KA 2GOUA 1CI1A 5CSUA 3FIGA 4M81A 3ABOA 4CCEA 1IXQA 1V3IA 1L9WA 2PGEA 4UTTC 3T42A 2BMBA 4V33A 5D9PA 1NOUA 5DF0A 3TXZA 3UZYA 3E2RA 3GU9A 1KFJA 3UJSA 1PZ2A 3LMZA 3G0SA 3ITYA 1GNXA 1S2AA 2R91A 4WZHA 3AO0A 1PSCA 2RJGA 3B97A 4H83A 4B4FA 2OZTA 3GW3A 1ZTVA 3BLDA 2YYUA 3PZNA 4QTGA 3ARSA 3LXBA 3HO8A 3PB0A 4LW7A 3ZVIA 2VURA 1GOMA 2G97A 1VBGA 3SI9A 3KOXA 2DZXA 3QSRA 1KD0A 2BY0A 3CL6A 4I5UA 2AL1A 4QE5A 3VIMA 5KMYA 3URQA 1CB7B 5K7JA 3GLCA 2XN1A 1YQ2A 3W26A 1AJZA 1OFBA 1GOIA 2Y6ZA 4KRUA 4L1GA 5BU6A 3CH0A 1DBTA 4NAFB 4LS0A 1SQ7A 4W85A 4X22A 1NSJA 5EBAA 3T05A 3VMPA 3WLPA 1EFZA 5JXQA 2IXUA 1EXPA 1OYBA 5I00A 3GNDA 3IIZA 1JZ7A 1M7XA 1XGZA 2ZFAA 4JEJA 3M5VA 1NF0A 3H55A 3K5XA 5D2WA 4A2SA 1A49A 4L9ZA 3FGCA 1YPXA 1GVRA 5FAJA 3V3WA 3VGHA 1RD5A 5MHBA 4FXSA 4WGHA 1JCNA 4C7GA 1RVGA 2VUYA 1DXFA 1A5UA 1QOXA 3AS2A 3EA3A 4H8HA 4MPQA 1TJ0A 1UKOA 3QV6A 2A2IA 4YWSA 5TIMA 1S39A 1IXPA 2V3DA 4MB3A 1ZHAA 1YE6A 3W2LA 3W53A 5C70A 2ZX8A 4B3LA 1A4MA 3AYRA 1QW9A 2QCCA 4IQJA 2P0OA 4GY0A 4PYSA 3R1ZA 2ZUVA 4HU0A 1OX5A 4LQ1A 3BPWA 1JCMP 3UXKA 4KRTA 1TKKA 4LH8A 2DZAA 1DJZA 3NYZA 2J7HA 1I1WA 3ARQA 1JIBA 3TLQA 2VXNA 3WLMA 1H1NA 1JJKA 2W3ZA 5DCBA 2V6AA 1SO3A 2EG8A 3GH7A 4QSFA 2E9MA 3ARXA 1UZDA 3CMGA 4BF5A 3CMJA 9RUBA 3TWBA 2IPFA 4S3FA 3GXIA 3KRUA 2I56A 5L9FA 4H9TA 1QO5A 4GX9A 1HKMA 1N7KA 3O6CA 4DWSB 1HJXA 4I7VA 3EZ4A 3SGGA 2CLIA 1ZBCA 3JVAA 4HNLA 1XLIA 5FI8A 2OQYA 2YL9A 1Q45A 4D8AA 4TX9A 1MRQA 4NZJA 3LEPA 1IIGA 1UG6A 5K2ZA 4FK9A 3OBAA 1S2TA 4ZO8A 1WZAA 1EUAA 4P8XA 2YB1A 1D7FA 3MANA 4FF5A 2OR2A 1DVJA 3DAQA 5LA0A 4KT2A 1QK0A 2ZWYA 5DRCA 3AS3A 1JPDX 3EPMA 1KXQA 1EA9C 5AC6A 4F0LA 1TWZA 4A8RA 5ABTA 4L6OA 4O4WA 1XUUA 3N17A 5IRPA 3M44A 4Q4QA 4O8RA 3BCDA 2DSWA 3V0TA 3BLKA 3W00A 3CEPA 3PBGA 4PMYA 3CEUA 2FIQA 4A3QA 3N73A 3N9RA 1P7TA 3BCJA 1VCVA 1NU5A 1F6YA 2W92A 1OM0A 4B3ZA 2REQB 4HBKA 2W66A 2WANA 4FXJA 2MUCA 1ZL1A 3CH9A 3B9AA 3W7HA 4C1NB 4PEKA 3G8EA 3NSNA 3TSMA 5I09A 2R1KA 3TCSA 3UU0A 3L5LA 4Q33A 3UR5A 3FKRA 4GIAA 5RUBA 5TF0A 1AG1O 1UZ4A 1X6LA 3ITGA 4UR7A 3POCA 2G3JA 3QF0A 3UD6A 1UBSA 3TROA 4K1GA 1MZRA 3CTLA 2PU1A 2DZUA 2OMAA 2V3GA 2Y8VA 3TU9A 3AROA 1ZUAX 4LOCA 3FEMA 4GACA 1W2VA 4RNIA 3CASA 2Z6JA 3R8HA 3UYCA 2PRLA 2OZ8A 1TFVA 2YL6A 1S2WA 4PZVA 3BJSA 3IJDA 2WC7A 3GDLA 3MSDA 1OEPA 4D1IA 2XVGA 1EEPA 1B4EA 2QGYA 5CKSA 3BOLA 3JZUA 1C92A 2CLEA 4FIRA 4DXKA 1RUSA 4XZBA 5LA1A 5CG0A 1W3TA 3SUSA 1E51A 5DN1A 2H6RA 2WYSA 1KTNA 3GIYA 3R4IA 1LDCA 2PE4A 1XIIA 1EBHA 1JDAA 3AU2A 3LTPA 2YKKA 1JG9A 5LXEA 3CUIA 1KKRA 3IEBA 1VYRA 1PVNA 3E74A 4F0HA 1Q6DA 1PO9A 3QV8A 3M46A 2DZTA 3FSTA 4CQDA 3GVVA 3FX4A 3ISIX 4DLMA 3N15A 2EQDA 3AJ7A 3WUGA 4TR9A 1D3GA 1AL8A 1YDNA 2BXZA 5ECVA 4C60A 4QG9A 1OGBA 3TW6A 3Q4DA 1VFTA 1V6WA 4ZXLA 3S42A 2HTMA 4CD5A 5CC3A 4DN1A 3KXQA 4XAPA 1MDLA 3UF9A 1V77A 4C7DA 1P0KA 3WJZA 3C2YA 2FZ9A 2BVYA 3E0IA 3P8IA 3BV4A 4YVVA 3O3RA 4PTDA 2GDQA 2X30A 3USBA 3BAKA 1E9YB 4NVTA 4L9XA 4CCZA 5F2IA 3BMWA 3OG2A 4BS0A 1U1UA 4YTTA 2WPBA 3UGVA 5I02A 1XR2A 2PDYA 4HGXA 4P7RA 3W25A 4PEEA 2ATSA 4L4OA 3NEHA 1ZAHA 5C55A 3A9BA 2CKSA 3MZNA 3C2OA 1R3YA 2WQPA 1PX4A 3WK3A 1XKYA 2VENA 1B31A 4DJDA 1B9BA 3WQDA 5I3FA 3H12A 1RPKA 4JR5A 1OCBA 4GYJA 2HNEA 1B3OA 3T40A 5AHMA 4TVDA 3JU2A 2NX1A 3W88A 1XRVA 1F05A 3WNMA 3L4XA 4CQBA 1X8CA 4B15A 7TIMA 2V5JA 1E4NA 4BEUA 3LHZA 3MUZ1 3GVRA 2DW6A 3HA1A 3TC3A 3RPTA 1AD4A 3BVJA 2P1FA 4YJ5A 2YCJA 1MXDA 3WSUA 3C0QA 3ZR5A 5CH9A 1UD5A 5T91A 1TV7A 1F7BA 1W5QA 2FZMA 1W5OA 2NQ5A 3GHTA 4LB3A 3FJLA 3SCNA 1BXBA 2R1LA 3SEPA 4J3ZA 4ADUA 4XKMA 5F1VA 1QPNA 4UNKA 4JCMA 4PODA 2DVXA 2BBFA 2XJ7A 3LI1A 2VOMA 2V2DA 1XINA 3S6TA 3TXVA 1J0JA 3FNDA 4Q4MA 3AOFA 2OO6A 1UJQA 4D1JA 4O13A 3E0LA 2HVNA 3OYZA 3W1MA 1YXDA 3SCVA 3KTCA 3CBWA 4WY0F 1A4LA 2YBUA 2YXOA 4GXMA 3QZAA 4PRRA 4ECLA 1TWIA 3N29A 4OV9A 5JBDA 1KCZA 1IT7A 4Y90A 1QATA 4PMXA 3M0HA 3LBCA 3TJXA 4GABA 3M5XA 4UFIA 4IPNB 1GOWA 3WMLA 3ZT7A 1LLOA 2DGAA 3WD4A 4MB1A 2NSOA 1MQQA 4ZOAA 3TA6A 2XVLA 1OC6A 3LCFA 1W9UA 4AD5A 2UY3A 5FJIA 1PS9A 3UVAA 3FGCB 4TX8A 3IVUA 5HAOA 3BXWA 2PDMA 3USZA 3KFTA 4Q8QA 1V5XA 1V03A 2DUZA 4UBPC 2ZRVA 2P88A 1JFXA 4ML9A 5AHLA 2UZ9A 1EWDA 1ADOA 1F4AA 5IBXC 1A5KC 2X2GA 4H6EA 2J13A 1QNRA 4KFNA 4ONVA 4BY3A 2FJUB 2ALDA 1GYLA 1VQTA 1AQMA 4NZCA 3TCEA 3QGAC 3AU6A 1JQVA 5CQ1A 3U4FA 4HOWA 1KXHA 3ABRA 2O7SA 2PC8A 5HNUA 5A3HA 2FHBA 3SO7A 5B80A 4H7ZA 3CAWA 2DP3A 3ME3A 1GOKA 2O56A 2WHKA 3BOXA 1F4HA 3DKLA 1KGUA 4FIQA 3LV6A 2JK2A 5FF3A 1K9TA 5CJNA 4TIMA 1A3WA 1G69A 1E0VA 3FCPA 2ACRA 2GGIA 3GU2A 1POJA 3UG5A 2W91A 3QV9A 4BQ5A 4R27A 4ZSUA 3GHSA 4NHVA 3LV5A 4FNTA 4EF9A 5A69A 1Q5MA 2BVDA 2PZ0A 2V30A 1PKYA 3FVMA 1FWEC 4S3AA 3BSHA 4XAGA 5GPRA 3NDOA 1QPKA 1ML1A 5DFAA 3KCOA 4PE8A 3MW7A 4MAZA 1I4NA 2GQ9A 1OZMA 5TQLA 3RCMA 1O1ZA 1W31A 3AQUA 4OU1A 3UZZA 5FEPA 2Y5EA 3N04A 4IXHA 5HJLA 1A0EA 3UZWA 1BRLA 1C9WA 2E6YA 4QJ3B 7CGTA 1GK8A 3AZTA 4GO8A 3N19B 4D8ZA 1E6ZA 4L4LA 3CIWA 4O8AA 2DZBA 3LLFA 1XYZA 1H3GA 4GX8A 3F1QA 3G3DA 2TODA 3UQNA 5M03A 1JZ3A 3K30A 4ZE4A 3U9IA 1P7TB 4HPHA 1FFQA 3WLNA 3IVSA 5HWJA 3HPAA 4O53A 3THUA 1KM6A 3MA8A 3U2EA 1KLYA 3NAVA 1O5RA 5CPSA 3T7VA 3URAA 2INFA 4JPGA 2PB1A 1Q4NX 2QJMA 1CGVA 1WE5A 4JX5A 3LNPA 4HNVA 4WQ6A 1E55A 2CBIA 1E56A 1V8EA 2PUZA 3OBKA 2BLEA 3H2EA 1DTUA 3AMCA 3DFQA 3F4CA 5BXPA 4GE8A 3VKCA 3BH4A 1HKWA 3PAJA 4LUJA 3PSVA 1BSIA 1XH0A 4X60A 1Q2SA 3W01A 4XD6A 2PF8A 2FH6A 3FS2A 1UR0A 2WMJA 4C65A 4LYKA 1FRBA 3IIPA 3TOPA 1VFMA 1VHNA 4UC5A 1A5AA 5DQPA 3GXDA 4RZBA 1GQIA 1ZJBA 2FFIA 3QRHA 4I9AA 2WZHA 3OZYA 4DJED 1WPCA 3N3TA 2F7FA 3CO4A 3SRHA 1W1ZA 1UIPA 3UCCA 1WO2A 1GZJA 1I2PA 3W22A 1O6IA 1XLEA 2VFDA 2DU2A 1HJVA 3OA3A 1ZNNA 1ZP3A 1P48A 4BQ4A 5H1WA 1VBJA 1PX3A 2R1MA 4IHCA 1BF2A 1JVNA 3UPMA 4HK5A 5HPOA 1PBGA 4PA8A 5C9RA 1OBAA 4E2BA 2GGEA 2BWGA 4QE1A 4L1WA 3VGFA 4H7CA 1NELA 1OCNA 2J8GA 3KBVA 4LS2A 4QRNA 1XCXA 2XVPA 1I6NA 2OJPA 4JTSA 1I0BA 2Y62A 4GK8A 2VX4A 1KA9F 1W56A 3C3NA 2X0SA 1XYCA 5FEXA 3MO4A 3BLOA 3W2JA 3G1VA 3V75A 3N2BA 4LUSA 4D6IA 1M01A 3EDEA 4LRTA 3ANVA 3MCMA 4KESA 4HOZA 1W1B1 3QN3A 2WJFA 4RW3A 1SSGA 1FWTA 1YYAA 2PTZA 2W9MA 1IWBA 1R46A 1GZ1A 3RYSA 3NQVA 4GZIA 2D0GA 4ZB5A 1PTDA 2AGTA 3CIVA 4LF2A 2QF8A 3WBAA 1GKPA 5FJOA 2GVGA 4CNUA 4JZ5A 3MHGA 4KCUA 4LFYA 3DU0A 3CQJA 3PPGA 4A22A 1Y8BA 2HBVA 1SSDA 3L9CA 4D9PA 4E2OA 1ICSA 4LY4A 3KCJA 3UR8A 3TOYA 2ISDA 2BDQA 4HA3A 4BF7A 3MV01 3K1DA 1MNZA 5CZ0A 5LHEA 5FAGA 4KWOA 1XIMA 2OYLA 3WQVA 4WJ8A 3RCNA 4UWMA 2XGZA 2HK1A 2YW4A 1TVNA 3MMTA 2F84A 1KBIA 1X6UA 2F6XA 1AJ2A 3WEOA 5BU9A 4NJIA 3WL1A 2VGFA 4Z2HA 1SO4A 4V1XA 1S5VA 4FPSA 1K6AA 4GUIA 1XL9A 2PWHA 2X7WA 4FALA 1HJWA 1PCKA 1JNDA 3SCQA 4XO7A 3VUPA 3COTA 3S6DA 3NZRA 2H9AA 2P50A 3BQ6A 3PZOA 4K7YA 3VXGA 1LZOA 2WVTA 1K70A 1NF7A 3UZXA 1I1XA 1X8FA 3SN0A 4BR1A 1T5AA 4TVUA 3NYDA 4AYGA 2E1WA 3BG9A 1VKFA 2PSNA 4DBEA 1VCFA 2OU4A 3LU2A 2NV1A 1A0CA 4LX4A 3IJ8A 4YHGA 3PZTA 5DBUA 2YLAA 5DELA 1K4HA 4QLKA 1VLIA 4DJEC 2DVUA 2QIWA 2ASHA 5E93A 4CU8A 1UHVA 4XTDA 4CN4A 3OJGA 3HBLA 3QGKC 3NVTA 2G3NA 2O92A 5H2ZA 3PWAA 5GJMA 1IZJA 4GQQA 2XH4A 2NVCA 4KFOA 4RJEA 4RV8A 3A22A 1VBRA 3V1HA 2QDHA 2NT0A 3QZEA 5IDZA 3H54A 1TUXA 4PUNA 4MUPA 4HCLA 4HNTA 4JXCA 4Y9AA 2VEGA 3FJ4A 4WHBA 4F66A 5CPOA 4KH2A 1XDJA 2PLMA 4NRSA 2E5DA 1UCWA 1XDLA 4GHRA 4Z42C 1BWKA 2VO5A 4PUKA 5EMLA 4N6EA 5U4NA 1OX6A 2YCLB 1S2UA 4GJJA 1XFCA 1BTMA 1S2CA 3B0PA 3WG6A 3ICJA 2IPGA 2OWWA 3VTRA 3R5EA 2Z1VA 3W7DA 3L4ZA 4ROQA 3VKJA 4AWEA 1K02A 1EYWA 1P0EA 5KZ6A 1MQRA 2WOQA 3BLEA 4FNUA 1IR1A 4WJXA 4HPGA 2GWGA 1EIBA 3R12A 3AHYA 4M6UA 1LT7A 1B1YA 4J2MA 5XIMA 3STPA 1EL3A 3TYUA 1OB0A 1N2VA 4OQVA 3DGRA 2FB3A 4O50A 3HFYA 1EZWA 1H5YA 4AZ5A 1OD0A 4U33A 1NFGA 3TR9A 2NX3A 1EP3A 4JKKA 3W7EA 4G7EA 4UR8A 3E96A 3WQEA 4MDPA 4GNJA 2FPTA 1UOZA 4FR1A 3W86A 2CWNA 1R7OA 6TIMA 1QMLA 2VVNA 2QJGA 5LHFA 4IPPA 4O1CA 4K2SA 1XLLA 3NO1A 4FO4A 3P8JA 3W1QA 4MFDA 3W1XA 4F9JA 2DH2A 3SIMA 3BW2A 1EZ2A 3WLJA 3UBPC 2NUXA 3E5PA 2VC7A 4HSOA 2OLAA 3MU7A 2CU0A 3URBA 3W7OA 3NQAA 4S1FA 1PHWA 5FL1A 1RQHA 3OGRA 3RFAA 1R3QA 4P5UA 1J9YA 3W7JA 4ILSA 3J7HA 3L23A 2NSXA 1H7WA 5FF4A 4MY1A 4PCPA 3SB0A 1E0XA 5I23A 3IIVA 3RUBL 2VZTA 1D8CA 1HT6A 1D7KA 2QQ6A 3GE7A 3GTIA 4W93A 4OBSA 3CB8A 2QEZA 1JZ5A 4JICA 4JAWA 4AB4A 4LGXA 1KC7A 3MWAA 1GGOA 3G1DA 2WHJA 4BI7A 5ABHA 1U33A 2B31A 2CLFA 1BRLB 1MEHA 1WX0A 1YIXA 4RX0A 1JYVA 4AX6A 1SZGA 3GIQA 4FLSA 4F79A 2WK2A 4MMWA 4Z2JA 1QASA 4Q8UA 1RJRA 2B81A 4UCFA 1E9IA 1XICA 1UQYA 1WCGA 2O55A 1IT0A 3VNLA 1C90A 1HF6A 4MZ1A 1FUYA 3WLTA 5HWNA 2ZVRA 2UY2A 3GO2A 1Z8AA 4M5PA 2B0MA 5BCAA 5GJPA 2C13A 2DT2A 3IJ7A 4IGSA 3T2QA 3C5QA 3CNYA 2FMNA 3KL5A 3UCQA 2OQHA 1Q6OA 4GINA 1MFVA 2PDHA 4D6EA 5M17A 2DUAA 4FX6M 3BJTA 4ZB0A 3MYOA 3NCOA 1TWSA 4GA8A 1ADSA 4X61A 3WNOA 4GUGA 4W8LA 5CAKA 3MI2A 1SZNA 4IP4A 1XC6A 3SGUA 1XDMA 2EGZA 4LSBA 1HNYA 3NO5A 4ML4A 3EWXA 2PURA 2VWTA 3CV2A 4DBWA 3H4WA 3LXCA 3N9KA 4EPEC 2NQHA 1C8YA 1ZSXA 4JD4A 1BYAA 3VIGA 4Q8PA 4F0MA 1XI3A 2FPVA 1AQFA 4TO8A 3BLLA 1SO5A 2XFFA 3NPUA 4EP8C 3QW3A 1KNWA 4C7FA 4OE7A 5CPMA 2AGKA 4CD7A 2DY3A 1TPEA 5I79A 1YNPA 3IRSA 3PUDA 1SM9A 2DT3A 1G94A 1QT1A 1AW1A 3GXNA 3SQMA 1G4TA 4M56A 4KF1A 3WD2A 1MZHA 2PD5A 5DMYA 2VGIA 2E6AA 2VQUA 4AEOA 2VHLA 4WIWA 4IFRA 3WQ5A 3MUIA 5EU9A 3QXBA 2VD8A 3ZS4A 3A47A 1TV3A 1PZ3A 4MDOA 3DIPA 2IXVA 4NUWA 4LT9A 1EX5A 1IZKA 2Z24A 3SJ3A 1RALA 3LX9A 1HG3A 2EEXA 3CV6A 1UD4A 3SCTA 1ZS2A 4MADA 4GXPA 4Q8MA 4EPBC 5GNYA 1GOXA 1H50A 1NDWA 4ZQRA 1MW2A 4IH3A 4UTKA 1JYWA 3MYPA 3KLKA 1V3LA 3GG7A 2NLIA 5I24A 3GNPA 4ICNA 3MQTA 3W2UA 3GC4A 4H00A 1VJZA 4MWAD 4EX4A 4PC8A 4LUSB 1YKWA 3G1AA 3GZ3A 4Q8VA 1RLCL 1DJHA 4OUEA 1L8NA 4PN2A 4IIFA 3TWAA 4RDVA 2Q3OA 4GBUA 3PY2A 5A8OA 2JGQA 1M68A 4DO5A 4NJHA 3GUWA 4NG3A 1FHVA 1KKOA 2RDXA 2P53A 1V6VA 2VR4A 2TSYA 2DFAA 4F8XA 1XIEA 1REQA 1WDRA 3CUZA 5BRQA 1H51A 2EPNA 4IMDA 1LUCA 1FH8A 3P0XA 4EVZA 4YYFA 4RK8A 2F6UA 2ZZ4A 3MHUA 4REQA 1RV8A 4ZEPA 3B0VC 3NR0A 1WUEA 3SUWA 3P67A 1GVYA 4UTFA 2ZUTA 4CVUA 3D5HA 3B8SA 6REQA 3Q94A 3MY9A 2QGHA 2RJHA 4E5TA 1J0YA 2WMGA 3QH2A 2HVOA 2BY3A 4U5IA 2WMHA 4B3KA 1NWTA 1AODA 3MHFA 4HJWA 3QY8A 2CW6A 2KX9A 2EHHA 1G4PA 5E70A 3LXAA 1H