4IH3A

2.5 angstroms x-ray crystal structure of of human 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase in complex with dipicolinic acid
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
332
structure length
332
Chain Sequence
b'MKIDIHSHILPKEWPDLKKRFGYGGWVQLQHHSKGEAKLLKDGKVFRVVRENCWDPEVRIREMDQKGVTVQALSTVPVMFSYWAKPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQAPELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELFPVYAAAERLKCSLFVHPWDMQMDGRMAKYWLPWLVGMPAETTIAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGFSMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELEPGKLIESMEEFDEETKNKLKAGNALAFLGLER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase
publication title Human alpha-amino-beta-carboxymuconate-epsilon-semialdehyde decarboxylase (ACMSD): A structural and mechanistic unveiling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 112
structure length 332
sequence length 332
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.1.1.45: Aminocarboxymuconate-semialdehyde decarboxylase.
pdb deposition date 2012-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4ih3A00
4PBEA 3IV8A 3FDGA 1EJSC 2Z28A 1DPMA 4IFKB 2Z24A 2VM8A 1M7JA 4L9XA 3TN3A 4KEUA 3TN4A 3AU2A 2QS8A 2R1LA 2WJDA 4JOMA 2PUZA 4H9UA 2OGJA 4LAOA 3N2CA 2RAGA 4WGXA 2GSEA 1ITQA 2AQOA 3URAA 3K4WA 1RAKA 2FTYA 2GWGA 3RN6A 1RA0A 3LGDA 4C6PA 3ITCA 5G4HC 1WXYA 2DVTA 2D2GA 4HJWA 4RZBA 2Z27A 3GTIA 1POJA 3WYZA 1K1DA 4H9XA 1ADDA 4EPEC 4L6DA 3LS9A 3UR5A 4KQNA 3HM7A 1UMLA 2WM1A 2YXOA 1NDWA 2ANUA 4DO7A 1A5KC 1RJQA 2IMRA 4LANA 3RHGA 1YBQA 2HQAA 1EJTC 2Z2AA 4DI9A 4GY0A 1NFGA 4KIRA 1GKRA 4XD3A 3GU9A 4AC7C 2GZXA 1R9YA 1A5LC 4G7EB 3MDUA 3MVIA 3B0XA 3F2CA 4QSFA 2HNHA 3KM8A 1J6OA 3AUOA 3UBPC 1M65A 3O7UA 1K6WA 3OQEA 4OFCA 3UR2A 4C6FA 3URBA 4NG3A 4H9TA 1P6BA 1RA5A 3LU2A 4IFKA 1ZZMA 4TQTA 4CEXC 4MUPA 1V7AA 1WXZA 3QY8A 4B3ZA 1I0BA 4F0LA 4Z42C 1P6CA 1EF2A 3CAKA 2Z25A 2PGRA 3IARA 1XRFA 4EPDC 4DNMA 4C6MA 1JGMA 1YRRA 4GXWA 2OODA 3ICJA 4KESA 4IH3A 3IPWA 4LAMA 3PAOA 4LAKA 4LH8A 3UF9A 1V4YA 1K70A 4LCQA 4PCNA 4ERAA 5HMDA 4EPBC 3IACA 4QS5A 4H9ZA 4YIWA 3SFWA 4GZ7A 1O5RA 3GIPA 1FWBC 3GRIA 3HPAA 4HK5A 1J5SA 1A4LA 2O4QA 1FWIC 2R1KA 1KCXA 2CZVA 1EYWA 1J6PA 2EG7A 2P50A 1V79A 3HTWA 3F2DA 2FVMA 4I6VA 3F2BA 4CNUA 5A6TC 4ERGA 3OJGA 4PCPA 4G7EA 2VC7A 4M51A 1UBPC 4C65A 3NURA 4C5YA 2P53A 3EGJA 4V1YA 2Q01A 4PE8A 2OB3A 2Z29A 3OU8A 1FWFC 1PSCA 1XGEA 2I5GA 2ICSA 2BB0A 3R0DA 3NQBA 3S2LA 2EG8A 4QTGA 4IF2A 2QPXA 4WVXA 2Z00A 4QS6A 2WJFA 3IRSA 1RJPA 4XD4A 2UZ9A 3FDKA 3IJ6A 5E5CA 4QROA 1NDYA 4DZHA 4BY3A 3E0LA 3IGHX 1XRTA 2XIOA 2FTWA 3GG7A 4ZSTA 1A5MC 3RYSA 1YNYA 2YB4A 2PGFA 4CNTA 1W1IE 4H00A 2Z26A 2HBXA 3QY6A 1KRBC 4CQBA 3OOQA 3BE7A 5FSDC 1FKWA 3GUWA 3ID7A 4BKNA 1FWHC 4LEFA 5CH9A 1RK5A 3E2VA 3PANA 2AMXA 2E1WA 1HZYA 3LSBA 3MPGA 1M68A 4KEZA 4KF1A 1O12A 4GX8A 3S2JA 2E25A 3PNUA 2VUNA 4B92A 4C6IA 3QY7A 4H9MA 4QRNA 1V77A 1VFLA 3LNPA 1EJUC 1UIPA 2Y1HA 2Q09A 3CJPA 3A3WA 1A5OC 1NDVA 1PO9A 4IG2B 4XAZA 5FSEC 4H01A 3TNBA 1EJWC 5HMFA 2I9UA 3NEHA 4GX9A 4IFRA 2Z2BA 2D2JA 4F0SA 3OODA 2A3LA 2OQLA 1FWCC 3GU1A 4R7WA 2VR2A 2Z7GA 4DI8A 1ONXA 4LALA 2DVXA 3QGAC 2FFIA 2HPMA 5HMEA 2EG6A 4C6CA 4F0RA 3WZ0E 4R85A 4E3TA 4GY7A 1IE7C 3EWDA 4NI8A 4KEVA 2KAUC 4GYFA 4XD5A 3D6NA 4DLMA 1PB0A 1FWDC 4PBFA 4AQLA 5LXXA 1P1MA 1EJRC 4LCRA 3DUGA 3T81A 4G2DA 2ADAA 1GKQA 2DVUA 3MVTA 4C6DA 2QT3A 3ISIX 3PBMA 4H9VA 3B40A 3C86A 3LY0A 3A3XA 3E38A 3MSRA 4C6LA 1FKXA 2ZC1A 1E9YB 4C6QA 4DZIA 4HK6A 4XD6A 4UBPC 4CQCA 4XAYA 3T1GA 4C5ZA 4CNSA 1ONWA 1NDZA 2FVKA 4RDWA 1R9XA 1YMYA 2OOFA 2R1PA 3E0FA 4IG2A 1POKA 3S4TA 3MTWA 3FEQA 3GTFA 2PAJA 1KRAC 1YIXA 3JZEA 3K2GA 4KERA 1R9ZA 1ITUA 3LA4A 1KRCC 4UB9A 1A4MA 3URQA 4XAFA 3LGGA 1S3TC 3F4DA 4I6KA 4WHBA 3F4CA 2Z4GA 1E9ZB 3CS2A 4GY1A 3WMLA 4ERIA 4LCSA 2VC5A 1BF6A 2VHLA 1EZ2A 3S2NA 3OVGA 2YB1A 4C6OA 1QXLA 1RK6A 4RE0A 2D2HA 4KETA 4P5UA 3G77A 1EJXC 2GWNA 4DYKA 4C6KA 4C6EA 4EP8C 3E74A 1PTAA 4C60A 3SO7A 4DIAA 2G3FA 2HBVA 3GTHA 4IGMA 3DCPA 1GKPA 1FWGC 4GBDA 3EWCA 4RDZA 4BJHA 3O0FA 4D8LA 3MKVA 2WJEA 1FWAC 4CEUC 3QGKC 4HA0A 2QVNA 1UIOA 2GOKA 4C6NA 2O4MA 4B91A 3UPMA 4C6JA 2HPIA 4IFOA 3GIQA 1FWJC 1RJRA 2YZ5A 4B90A 4ICMA 3ORWA 1FWEC 1I0DA 2R1NA 3K5XA 1QW7A 3E3HA 4V1XA 4HK7A 3T8LA 4J2MA 3TN5A 4IQJA 3A4JA 4NP7A 4ZSUA 3MDWA 3PNZA 2PLMA 4DLFA 4LFYA 1EJVC 1A5NC 4EPKA 2F6KA 2UBPC 4GOAA 5AKQA 2AQVA 4RDYA 2R1MA 4H9YA 1YBQB 3V7PA 4GC3A 4CQDA 4R88A 1J79A 3LSCA 1V51A 1XWYA 3S2MA 4J35A 3AU6A 2BGNE 4GK8A 3B0YA 3GTXA 2W9MA 3DC8A 3GU2A 4RDVA 3RCMA 4XAGA 1KRMA 3TN6A 4INFA 3URNA 4C6BA 4J5NA 3MJMA 4IGNA
chains in the Genus database with same CATH superfamily
3VM5A 1XLHA 2PMQA 1L8NA 4IFKB 3DI1A 2YW4A 3AIBA 4XBJA 5E70A 1BG9A 3T0BA 2FLIA 3C6CA 4WGXA 4WCJA 3LCGA 2OT0A 4NZ3A 4E2DA 1ZJHA 1SO3A 2CLLA 4UNLA 2CLOA 3MI3A 1TR1A 1FH9A 5C55A 2P1FA 1TREA 2PTXA 3PG9A 4HZ6A 3MBDA 2GDVA 3ZJKA 2FMNA 3LXCA 3BGJA 1V03A 3PZNA 1OY0A 2OQHA 5CSYA 1GVRA 2PTYA 3CYJA 4NNCA 3LGEA 4RNFA 1BWKA 4ATDA 4HSOA 3MDUA 5I0DA 3TP4A 2XSBA 2Y89A 4UCFA 3PPCA 3E0VA 4PL1A 8A3HA 1PHQA 1IEQA 1HL2A 4RV3A 5BYWA 1RY8A 2CBVA 2QAFA 1H60A 1O5QA 2VC9A 4GQRA 2NUWA 4B5SA 2CETA 2YA1A 3IGXA 4RLIA 3T0TA 4DRSA 4F9JA 3CB8A 5FEPA 4BEQA 3EKLA 3W7CA 2FZMA 2FGBA 1FHVA 2DSUA 5I07A 4HA4A 2V0TA 4GGHA 4YIWA 4XX6A 2V5CA 1RUSA 4F4RA 3WFAA 3EEGA 3WMCA 3CWNA 5CPOA 3L9CA 3WLMA 1Q85A 2P50A 1W1A1 1E4NA 2FTPA 1XBVA 3HV9A 3FGCB 5LGXA 5A3HA 2PU0A 2MANA 4O4VA 3W37A 4G7FA 3CAVA 4JL2A 3UYCA 1XW8A 3P61A 1EUAA 2ZXDA 3KEHA 3W1MA 3NAVA 4GJIA 1WKFA 4LPCA 3W2NA 3T05A 1FWFC 4KWSA 1CBGA 4HCDA 2I5GA 1KXQA 3S2LA 1CDGA 3QPYA 2ZX9A 4ZVJA 4U2ZA 2INFA 3LPOA 2DT0A 5E5CA 4W89A 1S5VA 2WKJA 3UR7A 1YXCA 3CV2A 3RM9A 4G8TA 1H11A 2PCEA 1ZTVA 2GLKA 1LOLA 1E70M 3AS1A 4KPLA 4WKFA 4R34A 4DXKA 4JEJA 4XQ6A 1SMAA 2HBXA 1J18A 4A3RA 3NNTA 4O8RA 3IIXA 4FX7A 4BWLA 3G1HA 3HV8A 2Q8LA 3PANA 1EXBA 1XX1A 3MQTA 1Z44A 4EWND 1TB3A 1K7EA 4Q6JA 1EKOA 3OQ8A 4IMAA 1HT6A 5AZ0A 2X05A 3KFTA 1X1OA 4PMRA 3CJPA 4ZENA 4XAZA 2E9BA 1HKWA 3HPZA 2XUCA 2YFNA 4CN1A 3LI1A 4H01A 3SRKA 4J7RA 3TNBA 3SQMA 1S2VA 2V3GA 4B5UA 1GHSA 4X0NA 1MRAA 5A8PA 2NSXA 2ZX6A 4PTWA 1Q2RA 3WLLA 2B7QA 3SUVA 4FALA 1R85A 1LWHA 2CCRA 1P0BA 1V6XA 1IXOA 3DKLA 3VU2A 1LROA 2HPMA 1WX0A 4XZWA 1K77A 3EWDA 3PJTA 4CN4A 1EFZA 3W6LA 3S1GA 2WMGA 1FWDC 4QQUA 4R53A 5A6AA 3VZZA 1K3UA 1KGUA 4RNJA 4G2DA 1QO2A 2GPTA 5CSRA 4H6EA 4HSNA 4Z0JA 3ISIX 1ITXA 3QSTA 2QJMA 5EY5A 4O1AA 1WCGA 1X98A 1W3HA 1FDJA 5CPQA 3PPHA 1TCDA 3BGAA 4CNSA 3GVWA 2VRQA 4PEEA 3AALA 2E1DA 1SR9A 3DIPA 4W4QA 3GZAA 2VNCA 1YIXA 1R9ZA 2AAAA 2UY2A 1TV4A 3TW6A 1S3TC 5CZSA 3TMQA 3R12A 3IIZA 4LX4A 3VDGA 4TO8A 4Y6GA 4PB3A 3TOYA 4EK7A 1HTIA 4P2VA 1BF6A 1BPLB 1X6LA 3R13A 2ISFA 4YHGA 1HJUA 1K9FA 3NZGA 1HJWA 1PDYA 2ODOA 3G3MA 3S1XA 4KETA 2ONEA 4JTAA 3T0AA 4NZ5A 3B06A 2O9PA 2QPSA 3PM6A 4DX3A 1ZUAX 3VIOA 3KS5A 4U5IA 5FEZA 2QCLA 3LCLA 1OABA 1GVQA 5F1UA 3UNDA 1TV2A 3BZGA 3MKVA 3EKZA 4CEUC 1S38A 1WBHA 3MCNA 4AD4A 4C6JA 1Q5MA 5JBFA 2AKMA 1J0IA 3S8HA 1YNPA 3GW3A 2V2HA 4PMZA 3ELFA 3S47A 1QW7A 4WZHA 2J7EA 5CC6A 1LLOA 1Q66A 3A9BA 5HINA 4YXGA 3WJSA 2XGIA 3N73A 1K7XA 3QW4B 4UIOA 2NT0A 2HISA 3KBVA 4UOQA 1V3HA 2R94A 4O14A 4E8CA 2ZX8A 5GJNA 1R2RA 3SIZA 2ZRXA 3REQA 1EPXA 2AKZA 4RDVA 4YN5A 2QAPA 4Q4SA 3MS8A 3TA9A 1MQPA 1W6TA 4S39A 5A8OA 3TXVA 4LV9A 5EA9A 1BD0A 4Q8WA 1Z7AA 1SM9A 1ZJIA 3M6YA 3CMGA 3AIVA 3ZT7A 1OZQA 2HS8A 1ISZA 3NDZA 3B9DA 3TN3A 2R9RA 3LUTA 2Y5SA 3AU2A 3VGGA 2WCGA 2WJDA 4IUGA 4BI6A 3VXGA 2QLYA 4GYJA 5D2WA 3WLKX 2RAGA 3ANVA 1W5MA 4H8HA 3DESA 3IJ8A 3TNOA 2GDQA 2FDMA 3KWXA 5H1WA 2ZXBA 1UKQA 5CPMA 4IQLA 5KMYA 1PDZA 2CLHA 1K1DA 3SRDA 3IJ9A 1B9BA 1UMLA 3G5EA 3OP2A 3AS2A 2WM1A 3H70A 3W81A 1FWWA 1XFBA 4PN2A 1PIFA 4CNOA 4XSLA 3N2XA 5F4SA 3C5QA 6XIMA 2OOGA 1W31A 3R58A 2QQ6A 1EP2A 4AZ5A 4BQ5A 2G3JA 3U2OA 4H2CA 4AY1A 4LF1A 4DWSA 3D47A 3ZWSA 3URBA 1XD1A 2ZRWA 4MB4A 1AH0A 3LRLA 2VR5A 4XTDA 4AZCB 2QUNA 1XLMA 4D6FA 4O0ZA 3KZSA 1NH6A 3SN0A 1HF6A 3SY5A 3WH9A 4Z2HA 5CAKA 5HR6A 3BAJA 2GVJA 2PWGA 3BCFA 3V35A 4LAMA 2C13A 1UZHA 3PSVA 3SCRA 8XIAA 3FHQA 1TA3A 1V4YA 4ERAA 4JTUA 3RCYA 2ZZ7A 4GZ7A 2C7FA 4NZCA 4MWAD 1J5SA 3GM8A 4N9EA 3W1QA 4DB7A 4DJEC 2X1SA 2CFFA 4LEQA 1G4TA 2NSOA 4UTTC 4PA8A 1YADA 5A2AA 1F7BA 3CL8A 3LPPA 1XYCA 3SSZA 5LXEA 1OFQA 3HGOA 1M41A 2WZTA 1VFFA 2Z29A 3NQBA 3TKFA 4JCMA 1KFJA 3E49A 1WAUA 4WVXA 1B4KA 1RJPA 1G94A 4YMZA 5DXYA 2DP3A 4ZTXA 2PBOA 1F3EA 5ABFA 1NP0A 2CERA 3TOPA 2A79A 1F76A 1I60A 1KBKA 6PTDA 1W1YA 3O6YX 4KFPA 3A4XA 4ZSTA 1YNYA 2XN2A 4IMGA 3VD4A 4U3AA 4HP5A 4BI7A 4YPJA 3DG6A 3U5YA 5I00A 2MUCA 3QQ0A 4X0VA 3KBSA 3W87A 4YS1A 4US5D 1FBAA 4IWWA 2WHMA 3QR0A 4R9OA 5LIYX 1DIEA 3ARUA 1J11A 3ZYZA 2DUZA 4QR6A 3QKEA 3WNLA 3L2LA 3DX5A 3VE9A 1DWGM 1TX0A 3L23A 3AIEA 3F5JA 4H3DA 1PYMA 3P3BA 5DMLA 1VPQA 1PE1A 1AL8A 2IXVA 3BJTA 1JCJA 4QIUA 1OC6A 3GAKA 4AIOA 4JTCA 2HJPA 3WSUA 5HMEA 1LDCA 3KRUA 4MADA 3WF2A 2YKKA 2QKFA 4AZHA 1E9IA 3UG8A 4O54A 2DUAA 1HO1A 1NF7A 1NM9A 3IV3A 3B8TA 2OLAA 2D20A 3IIOA 1FWRA 2OSXA 2OXNA 3MU7A 1KXTA 1DYSA 1D2KA 2OPJA 4LCRA 3EDFA 1UP2A 5G2HA 3E6EA 4RE2A 3P14A 2HWGA 1FHUA 4JZ5A 1YNQA 1JF5A 4FR1A 4HPJA 3O6DA 4P7QA 1A3XA 1JIBA 2VEMA 1GVOA 1POKA 1ICPA 2VZOA 3I3DA 1F9CA 3PTMA 4MWAB 3TIMA 4D6EA 2QULA 1XICA 3LK6A 1DJZA 4ACYA 4L61A 4AZBA 1XLDA 2PF0A 4WQ6A 4LVBA 3TSDA 1X7IA 6A3HA 4TV6A 4QAWA 3P5YA 1MW2A 5M3WA 4BS0A 3LHZA 4ERIA 1DWAM 1IEXA 3G3DA 2D2OA 1E1FA 2HVMA 3CIVA 1ZBKA 4RE0A 4ZQNA 2WKLA 1EEPA 2GWNA 3FOKA 5FAGA 4J40A 2DJLA 4C6KA 3ITGA 1O94A 1LL7A 2ON3A 4DIAA 1FDYA 2WNZA 4RDZA 1S5NA 1KA9F 4UFMA 3QGKC 4YJ5A 2DIEA 4L4LA 1Y8BA 2HPIA 4CU6A 4E0CA 2ZTJA 4J27A 4ENLA 4KCVA 1VPYA 2XH7A 4GG9A 5A5WA 1UWIA 2NVDA 5BU9A 5F1VA 1IWAA 2NVCA 4WDTA 3CB3A 3A13A 1TFVA 2YJQA 2DH2A 1K9EA 4A6GA 4M6VA 4NHVA 5U4NA 2AQVA 1I8JA 3L7RA 3ABQA 3S83A 4F8XA 4GK8A 4ASTA 3V1HA 1XIEA 3DC8A 3AMLA 3GU2A 5HPOA 1Q4WA 4A22A 4PTDA 1D8CA 2BOGX 2P3ZA 1JDDA 3MO4A 3T0CA 3F4NA 1DPMA 2Z24A 3V0TA 4IIDA 1OBAA 3AXXA 4HN8A 4I90A 2G0WA 4KFOA 1TIMA 4NSBA 3B8SA 3WG6A 1PHWA 3TFXA 3R89A 4WSHA 4XUGA 2J9YA 1WAWA 4DAFA 3SBFA 3ZT6A 1MW3A 3UFYA 4HCHA 4UTIA 1PCWA 1TJ0A 2O56A 1MFUA 3UGVA 2IPGA 2NXGA 1LBLA 1EGMA 4S3AA 2YXOA 3DYPA 3G6MA 2OYKA 2CPUA 2RDTA 3IK4A 3RHGA 2HQAA 5DFAA 3SCTA 3JUGA 4DI9A 4NAFA 4FNTA 5DEZA 4FNPA 2G3NA 3CM4A 1P0NA 4G7EB 1F4AA 4CNPA 3T78A 3M7WA 2CZEA 4LJ3A 3AUOA 1AW2A 4U3CA 2FIQA 1P0KA 1UD5A 3DBPA 1RA5A 4J3UA 3QZEA 4MY9A 4FEZA 2CLKA 2WQPA 3A24A 3EWWA 4TOQA 2E8ZA 3E2SA 2QHAA 4ZE4A 3KCOA 5C9XA 4ZL1A 3OBKA 2ZRUA 3QV9A 2I14A 4RE4A 4GIEA 4GXWA 4PUKA 1QWGA 4DUWA 4NRSA 4UFJA 1GJUA 4UTWA 3O06A 3CAQA 3PAOA 4QDWA 2Y5JA 1K9DA 1JJKA 3ALFA 3WQEA 2E9LA 4B5TA 1SUXA 3G24A 1Z32X 2OYLA 1U1HA 3IACA 4WSJA 1DL3A 5CPLA 1DQUA 2CITA 3M6DA 3SJ3A 1BF2A 3GIPA 3QYSA 5HQEA 4K8GA 2OQYA 3SUUA 1UOKA 4HU0A 1Z8AA 1CTNA 3SCVA 1YTDA 5ECUA 1FVPA 5G5IA 4EACA 2OWCA 4BR1A 3BLOA 3PZ9A 4J2PA 5C9UA 3SN4A 3UZYA 3WQWA 3LZ3A 2ISSA 4PE8A 3WLJA 4WKHA 5CJNA 3UGRA 4Z0SA 2YL5A 5T9BG 3KOFA 4IF2A 1L6WA 4AVOA 2GQAA 1G4EA 4AF0B 4BY3A 3R94A 9XIAA 4PFHA 1JXKA 1XRTA 4G9PA 4A05A 1TZ9A 1GUVA 3CEUA 5JMUA 1GOXA 3QHNA 1ZY9A 5EMUA 4IIGA 2Z26A 2DSKA 4I7WA 1KQZA 3HFYA 5CH9A 1TJRA 1FP8A 4QCEA 3B05A 1XCXA 3VM7A 4FI4A 4EKJA 4CGTA 4DHGA 4H6KA 4KRZA 3LM3A 1IXPA 5G4WA 2OVLA 4ZOCA 4U2YA 2W61A 2NX3A 1F4HA 3CASA 3Q37A 4RXGA 2BY1A 2NWRA 1MXDA 1LT7A 4IMFA 4C7DA 4DBEA 3G1RA 4QNEA 3PZTA 1UR1A 3FSUA 3FY1A 1UR0A 4NQ1A 2A3LA 1AVAA 3NXFA 2G50A 3ZM8A 4R7WA 1FCQA 1LLZA 1R7AA 4AEFA 4LUYA 2ZZ5A 4D6IA 2P0OA 4HPHA 2CLIA 3P62A 3WLTA 1KM6A 4C6CA 1VAHA 4AWEA 1NWRA 4W84A 2D0HA 3GDBA 2BMBA 1CT5A 3AI0A 5D8ZA 4DLMA 1PB0A 5LXXA 2NQJA 4XB3A 1A5AA 2ESCA 1TV3A 4KGJA 1FQ0A 5A94A 2BODX 3LB0A 2CLMA 1U33A 4MB1A 4JX6A 1XP3A 3UXDA 3BC9A 4H9VA 1OK4A 3C86A 4IM4A 3MUCA 3UA3A 1DTUA 1X96A 2J7DA 3F7JA 3B4UA 1XSKA 3G1AA 4GO9A 1T8XA 1BSIA 3EA1A 1W2VA 4BF7A 3O0KA 4XAYA 1HKIA 2FH6A 4J9JA 3E0FA 4MZYA 2ZRYA 3W7GA 1R2TA 4S2BA 4CCCA 5AOUA 4IIBA 3GHRA 4YYCA 3LA4A 1PAMA 5FOOA 3O8AA 3UZZA 4GNJA 4V15A 5HQMA 4GVHA 2Z4GA 1BYDA 2EQDA 3PJWA 1VB9A 3A22A 1ISVA 3MJYA 2VDHA 3EMZA 3RMJA 4BHYA 2PTWA 1DE5A 1RK6A 3TQPA 3EXSA 4UQCA 1RBOB 1LM1A 4B3LA 7TIMA 3WBYA 1MMFA 1LWJA 3VIFA 1VHCA 5HATA 3P81A 1QPNA 3TMLA 4GBDA 2XH2A 1XLEA 1XINA 1HJQA 2VX7A 4FK9A 1H41A 4LVAA 4HHLA 2ZXAA 3PUDA 2PDYA 1TPEA 3E2QA 4O8AA 3VKJA 3HGSA 3AMDA 3GIQA 5FL1A 1MI3A 1FWJC 4MKSA 3OLDA 2YZ5A 3WIJA 2R1NA 1XLJA 2QZRA 2G5WA 5CZTA 1TV8A 1NP2A 2YCKX 2C8NA 1KO0A 1V08A 1UJPA 5FEXA 3NGJA 3QZ6A 2DGAA 1E15A 2C16A 2YDRA 4DBWA 2IS7A 2XVPA 4LS0A 4D71A 4H6RA 1TPB1 2J7FA 7PTDA 4M29A 3VI2A 1IWPA 4J5NA 4DJFC 1IR2A 3MCMA 2HK1A 5HDRA 3GB6A 4WUIA 2YCEA 4OIFA 2VM8A 2W5FA 2OMAA 4JQ3A 1N8FA 1C7SA 3NSXA 1XKJA 4ZO8A 3S6DA 2XIJA 3WNPA 2VZSA 1XR2A 4JN6A 3TQ0A 3GDKA 1MSSA 4LRSA 5DCBA 4L1WA 2WWDA 2G8ZA 2OX4A 4Q3MA 4C6PA 4DF1A 3TYBA 2DVTA 2FFCA 4X9YA 4E6MA 3HQPA 1DWJM 4H9XA 3DHUA 1XISA 4W87A 4O15A 4W8BA 5ENLA 4XTIA 4Y96A 2ANUA 2QJIA 3W88A 1C9DA 3TQVA 2J8GA 1FH8A 2HXTA 3UQNA 3RPDA 3VOHA 3O6AA 3BW3A 4RW5A 2BFGA 1GZ1A 3KM8A 2Z1SA 1PJ9A 4IL2A 1XIDA 4Y8EA 5D4YA 4JTDA 2A1YA 1VFSA 1OIMA 5SWUA 1H7XA 4O19A 1AQFA 1XS2A 4GO8A 2DQWA 2PWVA 4Z2IA 3AICA 3L68A 1OYCA 3BXWA 4LT9A 1EF2A 3GC5A 3CAKA 5K9XA 1V6TA 4HGXA 3W71A 5KTLA 3K30A 4XIMA 2PDKA 1H5YA 3WQGA 4C7FA 2PDMA 4KRTA 5A6BA 3BG3A 1R6WA 4KESA 2GGHA 2V63A 3V0UA 1QNRA 2Y7DA 1O7AA 2OWXA 3GRIA 3QH2A 1O5XA 2WHJA 1HKVA 1D7KA 5AFDA 2XSXA 3F2DA 1TTPA 3SJNA 1QUMA 3SRFA 1XLKA 5I5RA 2TYSA 3VNMA 5REQA 4DPPA 3RLGA 1RLCL 3CHCA 3UPBA 3PC0A 4KT2A 1YKWA 2FZDA 2BB0A 5HJYA 3U5UA 1WO2A 2YW3A 2QPXA 4DO5A 2AMGA 3OTRA 1FRBA 5FCZA 3USZA 2GJXB 2QCDB 3IJ6A 3PJUA 3NQFA 4RR4A 5CBIA 1QVBA 2EPLX 2PDQA 1UC5A 2WHLA 4YU1A 3CQ0A 3UJEA 4I8DA 3TTEA 4PEKA 3T44A 4H00A 2PEVA 4AIBA 1E0XA 1XG3A 2VWTA 2XZ9A 2Y24A 1A49A 4UCGA 4HMEA 4DJEA 2F61A 3CHVA 2GK1A 4PCFA 4UTTA 1E6NA 3NZRA 5H8UA 2OLSA 4NAEB 1WOBA 2JQXA 3P84A 1F05A 1XUUA 4NU7A 5DY3A 3NQVA 1M7OA 3OHIA 1VCFA 4UTMA 3KAOA 3A3WA 3IVUA 4IG2B 4O17A 1OGSA 3QZAA 2VJXA 1UKTA 3PY2A 2DORA 4D6HA 4M6PA 2Z2BA 1EA9C 3FKKA 4JY8A 2C14A 3HF3A 3L0GA 1JFHA 3W2UA 1Q65A 3ITVA 2PODA 2Z7GA 3W6MA 4CUCA 3STFA 4CNNA 1GQIA 4RNHA 2DVXA 3SADA 3NTYA 2F8QA 4MKVA 3ZVHB 4GY7A 5BWFA 1KFLA 2X16A 5CCZA 4GYFA 1JPMA 4PODA 1V02A 1XRVA 4FIRA 4OUIA 3WLPA 3W7OA 4QAIA 3ZLGA 5DMYA 2QJHA 2NT1A 7ODCA 1GVYA 1JZ5A 4A35A 3H6OA 3LY0A 3E38A 3WL1A 4XWUA 5EMKA 1DJGA 4WF7A 5LIKX 1HKKA 3W7IA 3I10A 4RCXA 3R1ZA 4QG6A 2AGKA 4FLOA 2WPBA 3GNDA 3A47A 4QJ5B 1S5MA 3TX9A 1FA2A 1LL4A 4WHBA 2YDAA 4IPLA 5D38A 1E9ZB 1PZ1A 5AC8A 1YDYA 4AD5A 3GG8A 4LCSA 3TSBA 2AOSA 2VC5A 3AYVA 2VDGA 1LLWA 1XLBA 2P5NA 2PRMA 3BV7A 2ZVIA 2FHBA 2A4AA 2WHKA 3MCOA 1OFPA 3MC5A 3AIQA 3OGVA 3E0IA 1OD8A 2DV0A 1QOXA 3E74A 1PTAA 3B0UX 2OLHA 4UTHA 2B4GA 3DCPA 4S1FA 4H8NA 1A0DA 1E0UA 1UWTA 1WKDA 4I9MA 2IPJA 1FFQA 1WKEA 3RPTA 4GUGA 4M56A 1TR9A 3NQEA 1QRQA 1N8WA 1E5NA 1SZFA 3VUSA 3BQ5A 4MPQA 1AUSL 1KQYA 5CPTA 4HHMA 3WEZA 2GUBA 4QCFA 2BGSA 3B9OA 3MWAA 2R1MA 4ICNA 3P6LA 4LV4A 3IUIA 4A4AA 5DO8A 2IPWA 4J35A 4YVVA 2GGGA 2BGNE 3IJDA 1AMYA 4WR3A 5HUOA 2EAWA 4PSRA 2AL1A 2E6FA 2V8ZA 2YR1A 4ZB0A 3DU0A 1XCWA 3W7PA 4H7CA 2PPGA 3HN3A 2YSWA 5EMLA 1SW0A 1RQHA 1BVZA 2QCFA 1REQA 1QNOA 1WDRA 4J3WA 4Y7EA 1R87A 2VENA 3BZJA 4LAOA 1MDRA 2GWGA 2E8YA 3NUKA 4DBDA 1SGJA 1KBBA 4A3YA 3N9KA 3NO3A 2DSVA 5G4HC 5C0QA 3F03K 4RZBA 3GTIA 5CBJA 3GG0A 3CT7A 4RK8A 1LG1A 3CLWA 4AU0A 1S2UA 2EPOA 3VX1A 3FN9A 3EPMA 4HNOA 1CLVA 1U1UA 4E2OA 4V2XA 3G0XA 1JYWA 3QF0A 3I3EA 2WANA 3EX3A 3VK5A 1DOSA 1A5LC 2JF7A 4QSFA 1P7TA 1K6WA 4AUBA 3BLLA 5I03A 2XN0A 2DSZA 1IT7A 5I77A 4LVGA 1O68A 1V3JA 1ZZMA 1KR0A 1LTDA 3QC0A 1TE1A 4MUPA 5LHEA 1R2SA 2RDXA 3FV9A 1V7AA 2J78A 3RCNA 3W2MA 1I0BA 1G7UA 2YDSA 4GI9A 1EX1A 2DZXA 5IFTA 4IQDA 2P88A 3LBOA 5G1MA 2AL2A 5BROA 1FP9A 3LERA 4M6UA 1H0IA 2I16A 4IXXA 3IPWA 3OBAA 2NXIA 4H2HA 2ZE3A 4YYFA 3GKFA 1RXOB 3KHJA 5TBOA 3W24A 3LBCA 1PKNA 4RJEA 3FAXA 4M7TA 4RNIA 5D8WA 3DC0A 3AOFA 3N12A 1XV8A 2YBUA 1JULA 1QCWA 2CZVA 3AS3A 3S2CA 5A6SA 2FVMA 3VABA 3BVJA 5HQLA 4MYXA 4K3ZA 1ME7A 3SGGA 5A6TC 2VVNA 1BWVA 3WJZA 1X8FA 3NWRA 1A3WA 3QC3A 4LVDA 3S1VA 1NELA 3MP5A 1V3KA 3WFLA 2Q3RA 4QTGA 3I6EA 4DJDA 1ZCOA 3TC3A 2HK0A 1KLZA 2H6RA 2CEQA 4QROA 1C93A 5TF0A 4JTQA 3H2CA 3E0LA 1I9CB 4S23A 1WXJA 5M1TA 4R7OA 3AXIA 4Z08A 5BMWA 2CXGA 2X8RA 2OGYA 2BY3A 3IVSA 4CQAA 1OFOA 4CCZA 4IGHA 2OX1A 1TMLA 1UA3A 1GVIA 4WJ8A 1GWJA 3WELA 5K9CA 3N13A 3PZGA 4ORMA 1JZ3A 5GJPA 2AMXA 3LSBA 2H3DA 1H7PA 4KEZA 3ZIZA 2BVWA 2L5HA 4GD0A 1HFBA 3TQKA 3ABRA 3B9AA 2BBFA 5ABTA 1AA1B 1L8PA 3QLDA 1EYEA 2CC0A 3NA8A 1OCNA 4K68A 2ZWZA 3UZWA 2XDFA 1V77A 2XWDA 2HSAA 5D9PA 3B8DA 4P7NA 3C3NA 3R8RA 4PTNA 3VNKA 5HMFA 4GX9A 1ZP3A 1VKFA 1ONRA 1CB2A 2D3NA 4JL1A 4DWSD 3VKCA 1LG2A 1KBIA 1E6PA 1ZS2A 5DRCA 1GVFA 3OEXA 3VD5A 4X2PA 1U2YA 2VX4A 3QEZA 1Z3NA 3PP7A 1MUWA 4HNTA 3I7QA 3EB2A 4PUUA 3HPSA 3UVIA 1E1EA 2QGHA 3WK2A 1OINA 1G9HA 3RDKA 3FCPA 1UR8A 3KHDA 5BW6A 4F0HA 1ESWA 1XYMA 4CD8A 2GSHA 3W00A 1UW9A 4QG9A 3SB0A 3UR8A 1ZAIA 4JYFA 3NQ2A 5DT7A 1Z89A 4CVWA 5AECA 2E28A 2DVUA 3C3UA 4C6DA 2Z0IA 1VFHA 4HYWA 9XIMA 2BXYA 3PBWA 3H2MA 2Z1XA 1J0HA 2ZC1A 4N02A 1BRLA 3PAJA 1VZWA 3B9EA 4H8VA 4KW2A 1DQWA 3RU8X 1GQLA 1QPOA 5HUPA 4GKTA 4ZE5A 1GG1A 2FVLA 5DY2A 1NDZA 3W9ZA 2YZRA 2OOFA 3O6CA 3S4TA 1W32A 2P10A 5LZLA 5CZKA 4JDBA 2ZZ6A 4ONVA 4WRHA 4HA3A 3MKKA 4D6CA 3QV7A 4BCEA 4LUSA 1F3WA 3DHPA 2UY3A 2OFJA 4DBSA 4AYSA 2FZ9A 1MNSA 3CS2A 4PR4A 4MMWA 1A5UA 3EX1A 4OHQA 2VGIA 1G6CA 1NU5A 3W7EA 3F1QA 1Q7ZA 2VO5A 3REQB 1I2NA 2ZRVA 3VD7A 1QXLA 4AX6A 4ZB5A 2DZAA 2PCQA 4GBUA 4C6EA 3TJIA 1AODA 1CGVA 2JALA 4JTIA 3T6CA 4QHRA 4HU8A 4UNIA 2VCAA 4LTSA 2H8ZA 3GNNA 5BWAA 3CO8A 3H12A 4A8LA 2QJNA 1H7RA 1ECEA 1AFSA 4FPSA 3QFEA 1US2A 3RITA 1UKOA 1MEHA 3T0DA 3RR1A 3BPWA 1XYBA 3BSHA 4ACZA 3Q58A 3NVDA 1HVQA 1LZOA 1SSGA 2YA2A 4NXKA 3R8HA 3T4CA 1AW5A 1XH2A 3B4YA 4FOKA 2CHOA 2PDNA 1EGZA 3AU6A 1R3WA 5EYWA 4KS0A 3MSDA 4JTJA 4MY1A 2HNEA 1WPCA 2BG5A 3H7VA 3QXBA 2F2KA 3NL6A 5AHEA 4L65A 2QGYA 2ZC8A 4DWSB 4WY0F 4IGNA 4PBEA 1DJIA 1TPUA 4XZIA 4ZGYA 2SFPA 1VBRA 2IQTA 4MFEA 3NPUA 4E4UA 5C54A 2HXUA 1JPHA 1OB0A 4FX8A 4HMDA 3MUY1 5F2LA 3P74A 4MLJA 5LNRA 1AQ0A 3M0KA 2QMJA 3NPVA 3CL6A 2OZTA 3TDFA 4BA0A 4AX7A 2V2CA 3B0PA 3OZYA 3EB4A 3S1WA 1TA3B 1RHCA 1JDCA 2RGMA 3W1NA 1KTBA 2XM2A 2R82A 1YLVA 4H04A 4LOCA 3N2BA 6REQA 1XL9A 4PRTA 4DO7A 3H2OA 1B3WA 1C8VA 3V5OA 3BW4A 1E4IA 1HL9A 1IYXA 4EXQA 3TZFA 3CTTA 1AH4A 1J4EA 4NJIA 4YTRA 3AXMA 4KIRA 4XZNX 2XFWA 4AC7C 2ZA2A 4GZJA 2V69A 5KETA 9CGTA 1C9WA 1SJCA 3B0XA 4Z2LA 3QHOA 4DJFA 4JNYA 1YYAA 1M65A 2XU2A 2X41A 4AIUA 3G22A 4C6FA 4LUIA 1ZFJA 1E55A 1IXNA 3W3OA 3G0SA 4EAMA 2VZTA 4KH2A 2ZOXA 3W1XA 5I6SA 4EIVA 5RUBA 1UZDA 2WVVA 1EF3A 4F0LA 5D03A 1UZ1A 4AB4A 5BXRA 4DNMA 2VCBA 5ABFB 3RG6A 1UZ4A 1W3TA 4GI6A 5IBXC 2PLCA 4PUNA 4XZHA 2V2DA 5CAHA 1MUCA 1WNOA 4Y9NA 2BHUA 4L80A 1C7TA 1AJ0A 1TQJA 3HPAA 2VWSA 1XM3A 3S6OA 1F07A 1FH7A 2P76A 1YPFA 3WENA 1E1CA 2VD9A 5KZDA 3W22A 3SW6A 5BOEA 4F48A 3KCLA 2ZUVA 1UH2A 1UBPC 3GBDA 3BJFA 4JIHA 3VD3A 4FNRA 1HJXA 4W85A 1S5TA 4H83A 3SR7A 2PC8A 3P0WA 3SCOA 4QS6A 3TU9A 1JR1A 1W1B1 3EXRA 3U2EA 4OOZA 3N1AA 4R33A 1MWOA 4PMUA 3GXMA 1R38A 3IGHX 5AHLA 1KWKA 2QCNA 4X63A 3UWQA 3W01A 2ISVA 4IMEA 2P8BA 5E6YA 3SSJA 4AD1A 3RYSA 1X7FA 3NM1A 4R3UA 3EOOA 4K37A 4KWWA 3UY8A 2OEJA 5HOSA 3BK0A 4CQBA 1E4LA 2H9AA 4OTKA 3KL0A 1QJWA 3SEPA 3PZQA 1R3TA 4NNAA 3MPGA 4YL2A 1SZRA 2I57A 1Q7MA 3COTA 4MYAA 2ACUA 1O12A 5E0KA 2YXXA 4W5UA 3ZJ7A 2JGQA 1OWQA 1W3IA 1XHGA 5C6MA 5M2FX 3U57A 2I56A 4RW3A 3STCA 1KWGA 2Y8UA 3ONCA 4XVEA 1YTEA 1UIPA 2Y1HA 3H8AA 3PN8A 2WMHA 5BRBA 4AWTA 2X1RA 3W27A 3N4FA 3H4GA 1UD2A 4IFRA 1ISXA 5HANA 5A8NA 1FWNA 1YE4A 4GABA 1CPUA 4REQA 5AY7A 3CHFA 5HBFA 3HFTA 3W85A 5I23A 2DEPA 4N6FA 1OVDA 2J47A 2F9RA 2WPGA 1V6YA 4WGHA 3DECA 1VGAA 4LYQA 2DT1A 1L2QA 4JIIX 4F0RA 1XIIA 4WLCA 4US6A 3RX2A 3PF3A 1Q7QA 4W93A 3BSGA 1X6UA 2ISDA 6XIAA 2WQDA 4GINA 1V02E 3SUSA 4YLWA 4D72A 3UERA 4A3QA 2P3EA 4HN4A 3T81A 3SRHA 2QT3A 1QR7A 3H2NA 1UWRA 3IAPA 3NSNA 2VGGA 4PMDA 2JEQA 3C4UA 3W75A 3GR8A 3ZR5A 1FCBA 4I5XA 2GGJA 4MG4A 1XIHA 4O4WA 3MTWA 3W07A 3MANA 4PMOA 6CGTA 1XSIA 1BXBA 2ALDA 3THQA 1B31A 3IIVA 1ITUA 3UNTA 4PMQA 1YXYA 1FXQA 3CHDA 1W5PA 2KX9A 1VCVA 3BURA 2V82A 1BEUA 1U5HA 3ZR4A 3N6JA 3RAOA 4PC8A 1UASA 3TR9A 2O0TA 1LRTA 4FSAA 1W9VA 1EZ2A 2B0MA 3VCRA 1SU5A 2YB1A 1KGWA 4C6OA 2B7OA 3PBYA 2D2HA 5D02A 4EVZA 3C0SA 1J0YA 1XKYA 1T40A 1XSJA 2GGIA 3EX4A 3L4UA 1SJDA 4M3PA 4C60A 4EAYA 1K4HA 4FX6M 3O9NA 4AIEA 1GKPA 3FYYA 3VMNA 3O0FA 1M04A 2C6QA 3R43A 4HA0A 3VNDA 4DUXA 2R91A 4B15A 4C6NA 2Q3OA 2J6VA 1OJXA 5D37A 3EKGA 3H54A 3WNKA 1CXEA 3KDNA 3A4AA 3CQHA 1E6SM 3LHWA 4C1NA 4ZSUA 3MDWA 1VJSA 4UNKA 1A5NC 4LC6A 3OB8A 3NDOA 5LIXX 1EBGA 1NFBA 3O07A 1HKJA 1EL3A 3RJYA 5EL1A 4RDYA 2ABBA 3UCDA 1KBLA 1V0KA 1LBMA 1GYMA 4NAFB 4RKAA 3BMVA 3NIYA 1MZRA 3WQ6A 3BV4A 3M0XA 3KBJA 3I7RA 1ML1A 4JDYA 5HMSA 1W91A 2QF7A 2X1UA 3C2YA 3LV6A 3CH0A 4Q7IA 5BXTA 2C91A 3UXIA 3WUFA 3AJXA 2Y7GA 4PB4A 3GFYA 1EIXA 2I1OA 4PTMA 3GY1A 3VGEA 2PDPA 2W92A 2A85A 3EOUA 4MAZA 3DZ1A 3QQ1A 3FXYA 1W1VA 1K7FA 2VXNA 3SCUA 1ITQA 1P0EA 2WZMA 3O1NA 4DO6A 5D2VA 3EYPA 1SMDA 3G0UA 2VDIA 4YTSA 3QPZA 4I5UA 2VOMA 2C71A 2FJUB 3P7YA 1NWSA 4WXYA 4H8UA 5CKSA 3BJSA 4E3VA 1FUYA 5AHFA 1Y5WA 1YBQA 1HGYA 1EJTC 1QK0A 4GY0A 2PDGA 1KB3A 3G1DA 3R11A 2CESA 3ITTA 1G67A 3MV01 3GFZA 5FF2A 4GWEA 5EKYA 3DHDA 1U1JA 1XF0A 2NQ5A 1SJAA 1FXPA 3MZNA 3CBWA 4Z42C 5JH2A 3SI9A 4IMCA 3W7JA 4L7ZA 3HMCA 3VGFA 5I02A 4GYKA 1YXDA 1DORA 2VRKA 3CO4A 3TVAA 2ZX5A 2C0AA 3P5ZA 1R3RA 4H1ZA 2INEA 4PCNA 2V67A 3GH4A 2ZUUA 2YL9A 4X9SA 1H4PA 3GR7A 1TUFA 1A4LA 3TSMA 1B4EA 1P4CA 4NZ1A 1KCXA 3WUEA 4IPPA 1O1HA 1OCBA 1US0A 3BAYA 1VS1A 1E6QM 5A6KA 5D09A 5B7ZA 3IEBA 3KRBA 4O1FA 3CUXA 3V16A 3ARPA 4V1YA 1T5AA 4GACA 2WNQA 4DELA 3R0DA 2BHZA 1EZWA 1QNVA 3W1AA 3VGHA 3FW6A 4GHRA 2ZWYA 1YE6A 1TTQA 2UZ9A 2OELA 4DZHA 3OZPA 5KZ6A 1Q4NX 1W17A 3GC2A 1VHNA 1XH0A 1D9EA 3IRDA 4JX5A 1UQYA 2FYMA 3GG7A 2ZUNA 4CD7A 3ZR6A 1P43A 1LWIA 1P5BA 1W1ZA 1W1IE 3JS3A 3BAKA 3OVPA 3PJXA 4GVFA 1KRBC 3H22A 5E1QA 2QDDA 3SDOA 1HQTA 2JGYA 3W1UA 3POHA 4BI5A 1GOQA 3K13A 1VFUA 3I4KA 2JKAA 1M68A 1TJ1A 3CC1A 4UTLA 1KCZA 4KF1A 3GIYA 3ZT5A 3PNUA 5IDZA 4FOUA 2V68A 3PPFA 4C6IA 2DT2A 3NQAA 3QY7A 2REQA 1VFLA 4GXMA 1EJUC 1BTCA 2E9MA 3NZPA 1QPKA 3KL3A 3L5MA 2PTZA 4U10A 1ECQA 1EDTA 1XQKA 3WY1A 4MF4A 3OIXA 1ISWA 1R3QA 3T4WA 4HNVA 3H4XA 1WDPA 3T8QA 2E6DA 3UXLA 2CBIA 2WLYA 3QTPA 4URIA 5CPNA 4D8ZA 4ADTA 3P67A 4NX5A 5LGZA 3QGAC 2FFIA 1VEOA 3QLLA 5FA5A 5T8GA 3UPWA 3N29A 5CGQA 3SUWA 1ISYA 2WYSA 4D8AA 3D6NA 4BF9A 5A6BD 2EO7A 1NQ6A 4O57A 2I5IA 3EPOA 4TU1A 1AJ2A 3MY9A 4Q8QA 1G0CA 3ZWTA 2Q8XA 3H2EA 2DU2A 1W9UA 4Q4QA 1NFPA 4A29A 3UY7A 2C1HA 1V0MA 3M9YA 3ES8A 3QW3A 4IXHA 4DZIA 1UB3A 4HK6A 3EPNA 3T1GA 2AGTA 1W5QA 1EWEA 3TLQA 3IIPA 3FEQA 4N9CA 2WM0A 1WP6A 5AZ1A 4Z1CA 2OTDA 4D6JA 5I7GA 1GVEA 3RX3A 3EOEA 3TCEA 3URQA 5K4XA 4S3EA 4XAFA 1TWSA 1DJXA 3NL3A 3BARA 3GXNA 2W0UA 4UTWC 2GQ3A 3CUFA 3C56A 4D1JA 2H3BA 5K4ZA 4E8DA 2HVOA 1XIBA 4O1EA 4J3TA 1C8QA 2P0IA 3PUEA 1UROA 4CD6A 4XG1A 3Q94A 2E3ZA 4Q8PA 4P5UA 3WFZA 2CZDA 1A3HA 3PFRA 2EJ1A 4EP8C 2PDXA 4F0MA 3BCDA 3G1SA 1TV7A 1GOMA 3NQ7A 2QUUA 4DJED 4J3XA 4IHCA 3L0NA 3EMQA 3S6TA 4D8LA 3UCQA 1VJZA 1EC8A 3I6TA 1KFKA 1PKMA 1UPMB 1JVNA 1KCKA 1L6SA 3GH5A 2QCCA 2E6AA 3WDPP 1I0DA 2O9RA 3IJLA 1DQXA 2VGFA 3VGBA 3MMWA 1JL8A 4NP7A 1Q6LA 1LRNA 3MMUA 2D73A 3CQIA 3N2OA 1EJVC 3RNDA 1GZGA 1KFEA 1PX3A 2KZHA 4OU1A 3V7PA 4HMCA 3UZ5A 1KM4A 4LBRA 3P8IA 2JIWA 4TX9A 1D3HA 5CZ0A 2DZSA 5C7VA 4JIEA 2EHHA 3DFQA 1XGDA 3S5OA 3TN6A 3AIUA 2QPUA 2OR2A 4BQ2A 4ADUA 3V5FA 2XYLA 1VYSX 4I5RA 4JX4A 2HDJA 1EJSC 1PCKA 2FZBA 3C2VA 3L4VA 1PPIA 1ZENA 1DXIA 4QEHA 4W7UA 4CVUA 4XIAA 3HPXA 1RCQA 1QOQA 2QS8A 5IOBA 3HG2A 2VEPA 3LENA 4FZIA 4QE4A 3TCSA 4QFUA 1CXHA 1RAKA 5HNUA 2ZQ0A 5GNYA 5B7YA 1SW7A 3RN6A 1C29A 2QW5A 2EJAA 4AZIA 3U9IA 3KTCA 4P7LA 2WOQA 2E68A 3AWOA 4EPEC 5EBUA 3VDCA 4KQNA 3GYEA 3FFSA 2EPNA 1PL9A 5DXXA 3GW0A 1IEWA 1NDWA 3U7VA 3VGDA 4DZAA 3A4WA 3GQYA 2ZUMA 1HJSA 4XD3A 1W8SA 3CV7A 2WV8A 3I3BA 1EC9A 3NYZA 4AC1X 3LQGA 5REQB 3W0KA 2F38A 4QE5A 3MZ2A 4HD5A 3PB0A 1KGXA 2WZIA 4R27A 3W74A 1B90A 3OQEA 1WB0A 4DM2A 4YVPA 2ZTKA 4NG3A 1QI4A 1J8VA 1M03A 1HG3A 2CWNA 4NL1A 3BH4A 3V18A 3THAA 1E71M 1HW6A 3QY8A 4O1CA 3V4BA 3WDIA 5AHMA 2Q8ZA 5C2XA 3G1VA 5M17A 4AD2A 3WQFA 3BMWA 3W7DA 4AFYA 1VEMA 3I4EA 4IH3A 4EWJA 4LAKA 3M5VA 3UF9A 3MHUA 3KBNA 3KCJA 5HMDA 4QS5A 2DDXA 3SFWA 4YNGA 5HULA 1E6XM 2W67A 2DZWA 2FHCA 1AQHA 2HEJA 5H91A 4JFWA 1JZ4A 4QLLA 3JU2A 3TW9A 1RQBA 1PIGA 1PZ3A 2C18A 3OJGA 3LRKA 2UV8G 4NT0A 4OV9A 2ZFAA 2PWFA 3KWSA 3QRHA 1J0ZA 2PRLA 2DZBA 2QJGA 3QPEA 1ZQ5A 2WLZA 2ZUTA 3GAYA 1PSCA 4Q8UA 3KTSA 2ICSA 2Y70A 2HZGA 2VRJA 3GD6A 3W2JA 4JR5A 3CZEA 4XO7A 5J5DA 3H21A 1IHIA 5LNWA 1H51A 4O50A 1GOWA 1FY6A 1K02A 4RE3A 3AYSA 4JIQA 3MKCA 2R14A 2V6AA 5D9MA 3OZOA 2WC4A 2QEZA 3WJWA 3IK2A 5IBXA 5FJPA 3GO2A 2V5KA 4AY7A 3N9SA 2RUSA 5M03A 4Y8FA 3AMCA 4OZOA 2BY2A 3EWUA 2WSRA 1GNXA 1R30A 1NY1A 2E4TA 4G6CA 3GUWA 4WOQA 3NEVA 4GQ0A 3VDAA 4W88A 1RK5A 1GQNA 1I2PA 1UKPA 1DIDA 4ZQRA 2G41A 3L5AA 4RZ4A 4H7VA 8TIMA 5I3HA 1QU4A 2I9EA 4X2RA 3UXAA 4IIEA 1NSJA 4O53A 2QF8A 4U4MA 4XBKA 5FF7A 2G97A 2PDHA 1PO9A 2FJKA 1ZBWA 5DBTA 1Z48A 3GXIA 2YYTA 3OODA 3QBUA 1KM2A 3GH7A 5A8GA 4D2JA 2QCMA 3ZSSA 1CXLA 4E4PA 2BVDA 3WEOA 3ITYA 2J8TA 3DFNA 3F4VA 4MLRA 1KKRA 1SR0A 1X38A 3T55A 3WD2A 3TXZA 4IX2A 1Q6RA 1W3JA 1YPXA 3SY8A 2YXGA 2OSYA 1ME9A 1OGBA 1P1MA 3V75A 4LW7A 3ABOA 3L4YA 1F8MA 1TZ7A 3NGFA 1LORA 4QJ1A 3PPGA 3L2MA 4UFLA 3IJIA 3ONBA 1XLAA 3UG4A 3PBMA 1SQ7A 4RUBA 3NO1A 3LXAA 4JAWA 2EKCA 4JNZA 3VNYA 4XD6A 4NZ4A 4C5ZA 3WN6A 4Q33A 5D33A 1MDLA 1EB3A 2W79A 4D9PA 4ZOBA 1UD4A 5T26A 2PAJA 4ZQOA 1U83A 3PR2A 4ZTYA 2F84A 2VKZG 3UWZA 3ZS4A 2J6XA 3C0QA 4KWOA 4UR9A 4DJDD 5LNSA 4GY1A 4LYRA 2PDCA 2YBTA 4WDWA 3FJLA 1XDLA 2OZ8A 5LA2A 5IM51 1H62A 4MZ8A 2ACRA 4N7QA 3UP8A 1O6IA 1AH3A 4XZMX 2QVHA 5JH1A 4GFIA 3CEPA 2VTFA 4JICA 4DYKA 2XN1A 5CGTA 4CN6A 4NF7A 1I4NA 4AVNA 1PXGA 3GDMA 4NX0A 4UUIA 1QAPA 1GGOA 1QTWA 2XG9A 2DZTA 3DG7A 1J96A 5I3GA 1REQB 1MW0A 3STPA 4UQDA 3FA3A 4MGGA 3SCPA 2XVGA 3QV8A 4B91A 5HWMA 3ARTA 1OYAA 5FIPA 1RJRA 1TRDA 3KLLA 4V28A 4DPQA 3MMDA 1AG1O 3RIKA 3CUGA 2J66A 1J5TA 2ZUSA 5ABGA 3FEMA 2J77A 3A4JA 2Y63A 5A8QA 1W3KA 1UUMA 4JBRA 2HVNA 1N55A 1XYZA 3IGUA 1X6NA 4WSKA 2XH0A 2WZHA 3WDRA 1ONEA 4HZ8A 4N9BA 1NF0A 3KS6A 4GGBA 3CYVA 2A7NA 3QV6A 2HV5A 3GTXA 5D2XA 4AHOA 1I75A 2UY4A 4JTFA 5KZMA 3V5CA 4OBRA 1V8EA 5BMXA 4AH7A 1EA0A 4W9TA 1QBBA 3FDGA 4K36A 1U22A 2Z28A 1BWLA 3B3DA 1XQLA 3OG2A 2J8FA 4JQ4A 1UC4A 3FA5A 1MRQA 1K6AA 1MZHA 1FWSA 3WK0A 3IUDA 2DZUA 8CGTA 1BYAA 4JTKA 1PVNA 3GVGA 3PBUA 1E0VA 2AL2B 2A3BA 2IW0A 3UU0A 1LQ0A 1TV5A 2QIIA 2E5BA 2ASHA 4DXVA 1UR9A 5LA1A 3RILA 2E0PA 5FF4A 1JAEA 4EANA 4L4PA 1ADDA 3LMZA 3W7HA 4A3HA 4IIHA 1Q13A 1F6YA 4JCLA 5CG0A 4GIRA 4TX8A 3WLHA 4WY0B 3RO8A 2YX0A 3AHXA 3PVFA 3VIGA 2Z2AA 1JZ6A 3THCA 4M19A 3OLGA 5D04C 4B16A 3BLDA 3LCIA 4FO4A 3C0JA 3CWOX 4K8EA 2HNHA 4RPQA 2Y2WA 5EMJA 2PDUA 4O0KA 4IUOA 2YFOA 2QV5A 5L9FA 4H9TA 4NZJA 4OKDA 3TYUA 1TVPA 2A3AA 5KSWA 3WJXA 4FLSA 5E93A 4W8AA 5F7UA 4BEUA 3OLIA 2J7CA 2E67A 4AEOA 4NUWA 5H8MA 4C6MA 1YRRA 2GSJA 3M0IA 3B97A 4HYRA 3TC6A 1JCXA 2IKIA 4XK2A 5DCEA 5FEWA 3W2KA 1PS9A 2GYIA 3NOEA 4Z17A 3NQMA 3V3WA 5K7JA 2YBVA 4OUEA 4JIRA 3LV5A 3U8GA 3VYLA 1XJBA 1XDMA 1CNVA 1R86A 3M7SA 1VPXA 2PLJA 4S38A 1RSCA 3UWVA 1YX1A 4ERGA 1QATA 4YTQA 3UWWA 2YCLA 4Y90A 1OHLA 3U3HA 1C92A 4C65A 4Z1YA 4DYEA 1BQGA 3BLPX 1B57A 3GNXA 3CUHA 5M5DA 2Z7KA 3AWNA 2YPIA 2W6RA 1RP8A 1PEZA 3S5ZA 1JCTA 4QJ4B 3TTSA 3QMTA 2VEKA 2AAMA 1E56A 1UOZA 2FB2A 4TMCA 2FTWA 4NVTA 1OGGA 1DKWA 2QCGA 4PUDA 4B5XA 4J3ZA 4LC8A 1VR6A 2V5LA 3BE7A 5FSDC 1R47A 5I78A 1TG7A 2GL5A 1JNEA 2Z1VA 4NYUA 5CSUA 3MI6A 3LLFA 1DV7A 4NKCA 4XISA 4JHMA 3U4AA 1TMHA 3W7QA 4X61A 4AAJA 1JYXA 4P8WA 2E25A 4J4KA 3QKZA 1EJ7L 2GJRA 3ZLFA 3VFLA 1MNZA 1IEIA 3LCHA 1A5OC 1V0NA 1QFEA 2QCHA 1TWZA 1JD9A 1JPIA 3VOIA 4DJFD 3GXFA 2V5JA 3R8GA 3U48A 3L0KA 3QOKA 1SO4A 3L67A 4BQ4A 4LUSB 3WD4A 3W7KA 3VX0A 2ZADA 1R46A 4O28A 3M16A 5JIPA 1TYGA 3UYIA 3DFPA 4E3TA 4A8IA 2VELA 3M43A 1Q3NA 4ALDA 4XD5A 1EOMA 4QISA 4UR7A 2VMFA 3ITLA 4JTEA 5HWJA 2BXVA 4MKNA 3B8IA 3ANUA 1EJRC 1GQKA 1NVMA 3EX2A 1KXHA 4ZOEA 3PS7A 4N0RA 3LDVA 3MSRA 4PH6A 5E0CA 1RCXB 4CQCA 4I9AA 5A6JA 1ONWA 1E73M 2Z1BA 1YMYA 3VNJA 3L21A 3WQ4A 4FNUA 4TVDA 3S1UA 2YDQA 5EFFA 4ACZB 3K2GA 2VC6A 2WBGA 1YDNA 4U28A 1A4MA 2XVNA 1HUVA 5MKGA 1O95A 1TO3A 1PUDA 3WMBA 4JGDA 5KEZA 1IEVA 4GQGA 1H1ZA 1NWUA 5G1TA 4AHPA 2PGEA 3LHVA 3AUJA 5BZAA 1JNDA 5CZJA 1R3YA 2W91A 1J0JA 1UUQA 4OV4A 1UKSA 1RV8A 3PB2A 3W73A 2O92A 3OYXA 4M0XA 1XI3A 4PTXA 4YVXA 3QM3A 4AISA 1E6RA 3SO7A 4F40A 4GYPC 2HBVA 1JQXA 2VI0A 4GUIA 3WD0A 2QVNA 1US3A 1J2WA 5K9DA 1HNYA 1D8WA 3I65A 1QHOA 3P60A 2GJXA 5A8MA 2QDHA 4DJDC 1FWEC 1H1YA 4YCOA 3K46A 3TA6A 5IHSA 2CWXA 1QDSA 1UP3A 3RLUA 3PNZA 1Y7VA 3L65A 1QPRA 3ZJ6A 3TYDA 5XINA 3IS4A 4UR8A 3M41A 4GC3A 2C3ZA 4QJ3B 2PFHA 1KLYA 5HJLA 4IOTA 2POTA 3F4WA 2W9MA 4ZBCA 1SO6A 4Z1AA 5FAJA 3S42A 4WIWA 3L4WA 4R5EA 1JG9A 1XFCA 3VTRA 4FMVA 1VYPX 2XIMA 1S5WA 1LOQA 3IV8A 1EQPA 4IP4A 4FNQA 2JBMA 4EE9A 4IGSA 3SY1A 2WVVB 2WCSA 1P6WA 3ZXWA 3DEQA 4MJZA 1V6UA 4IQEA 1WDQA 3OPSA 1CYGA 4A2SA 4JOMA 4E2VA 2O9TA 3CXOA 3N2CA 2X1IA 4P8UA 3E96A 3BQ6A 1KR1A 4N2YA 1KC7A 3CGTA 5C70A 3H55A 3UESA 3AIWA 1WXYA 3ZLHA 2Y4SA 2Z27A 3WYZA 4CQ8A 4YWIA 1UWAA 1TPC1 3CUZA 2HTMA 2HROA 1Q8AA 2ZXQA 3EWXA 4J1OA 3OYZA 1PWMA 1E1CB 4TVUA 4IP7A 4O16A 3W2LA 4AYGA 2WVUA 1GQJA 4JYEA 4I7UA 1R9YA 3W02A 1CENA 2C15A 4CCEA 1W1TA 1BGAA 1UA7A 3KVJA 2QJJA 1KM1A 2WAGA 1PKYA 4FLQA 4XKMA 3K1GA 1JDAA 5HNRA 3EWZA 4QDMA 5AYYA 3HG4A 3QN3A 2X7WA 2Y62A 1F8IA 4RXFA 2IXUA 1Z9AA 1F61A 2W4XA 1W9BM 3DFTA 4A3UA 2RKXA 3KTXA 1W9PA 3N6HA 4GJ1A 5DELA 3ICJA 2Z6JA 3BOXA 1DXEA 1XPYA 4TVCA 1K70A 1G5AA 1E51A 1XCFA 1BKHA 3LI0A 4PCTA 2H9AB 5C9ZA 1O5RA 1BXNA 1FOBA 3ATZA 4LYKA 2X0YA 4JTHA 2XJ7A 4LB3A 3EXTA 1V79A 1ODZA 2J7HA 4JQ2A 3OHMB 3M0YA 5F4XA 1SO5A 1GORA 5MF5A 3KP1A 3M5ZA 1QASA 2YL6A 4M51A 4WD0A 1JUBA 2QV4A 4QLKA 2WZEA 3EX6A 3ERPA 3EZ4A 3UZXA 4HTYA 1K8YA 4HPNA 4REQB 2Z00A 1TSIA 5JBEA 5E09A 3AC0A 5J5RA 2XIQA 2VR4A 3ARQA 1UWSA 2OZ3A 2FQIA 4ATLA 1E4MM 3S9YA 4J3SA 4PSPA 5FF3A 1Q45A 1KXVA 4ECLA 5IHRA 4CNTA 2W63A 4NXSA 1OD0A 1JZ7A 5LNVA 3ARXA 1OSEA 1XYFA 2J74A 1QHZA 1T7LA 3BW2A 3T7VA 2BHYA 4B4HA 1SZGA 1D7FA 2R24A 3MP3A 4EF9A 3WK3A 2VUNA 4NJKA 3KVMA 2TODA 2VX5A 3GXPA 1X8CA 2BOFX 4M6QA 1DJQA 3Q65A 3CIWA 1DWIM 1NOWA 5IDIA 1GONA 4HOXA 3CZ8A 2VEFA 3S3GA 2TAAA 2I9UA 3TJXA 3N11A 3FYPA 3SUTA 4WK9A 5FKYA 2VFFA 4MHBA 3TR2A 1FWCC 4UOJA 4F3HA 2V9DA 3WUBA 5A6LA 4JN7A 3TYCA 3BCJA 3P8JA 4DI8A 3QSRA 1CGXA 4TIMA 2OEMA 2EG6A 4JNMA 4S3GA 4I8YA 3N4EA 1H7OA 1YW1A 4ZODA 3M0JA 1E0WA 4D6GA 4PBFA 4QM1A 2OZ0A 5AYXA 1KV5A 5AB3A 3H4WA 4YHEA 5LYRA 5CC5A 4NRRA 1RR2A 4GISA 4GVGA 3DFHA 4HU4A 3WDQA 2WXDM 2PWHA 3CHEA 2IQ0A 4ML4A 2XSAA 1ADSA 5HNTA 1Q6CA 1H7WA 2FVKA 3FVMA 1ZSXA 4JKKA 1BLIA 1GZJA 1RLDA 3JW7A 1I2RA 1NJJA 1VFOA 3PZIA 3WLOA 4C1NB 3HJZA 1GYLA 4NJJA 5BNKA 4UB9A 5GVJA 2OEKA 4QDPA 3VZXA 3LGGA 1VFTA 3F4DA 1QT1A 4LY4A 1MQRA 4GLEA 3T07A 3VKKA 1ZU8A 4L4MA 2PA6A 3L66A 2XHYA 3LPFA 4XKYA 3N14A 2D0GA 3GVRA 5AC4A 4L64A 1Q6EA 5K2ZA 1LL6A 4S3JA 1Z41A 3DYMA 3VKBA 3B0VC 1Q6FA 1TPVA 2A5HA 3K8MA 4RV8A 1IV8A 2J7BA 3WBWA 4EF8A 2B7NA 3KOWA 3WX7A 3SCNA 1RZMA 1Y5VA 3K4DA 3EWCA 3CNYA 1KW1A 3E5BA 4LRTA 1UIOA 3GYCA 3GBEA 3CWHA 1Q8JA 1GOOA 4B5NA 3SCSA 4S3DA 1T0OA 2A21A 7CGTA 1Y0EA 3PSWA 1BAGA 1BXCA 4OE7A 2NX1A 1KNWA 1ZJAA 2GQ8A 4M7SA 4DLFA 4E38A 1YEYA 4DNHA 2PE4A 4ZFMA 3UW6A 4H9YA 1YBQB 1QBAA 4R88A 4MY8A 4F79A 3UWUA 1XWYA 1ZP4A 3I6RA 1XBYA 3B0YA 3BWWA 1B3ZA 3BTNA 5DF0A 3YPIA 4OECA 1J01A 2QCEA 1MEIA 4G1NA 1H2JA 3RCMA 2F7FA 1OADA 2QUVA 2WMIA 3MJMA 5E9XA 4HQVA 3MSGA 2OWWA 2PP3A 4DQWA 2WC7A 1YHTA 3WQ8A 1V3LA 1TPH1 4JQAA 4K8HA 2HRWA 1WV2A 4GI4A 4LQ1A 3ZSTA 3HGJA 1FCVA 3HJEA 3SM0A 5HXMA 4C90A 3SGZA 2W27A 4MDPA 1HXJA 3PTDA 3ME3A 3TK7A 3UJ2A 2OJPA 3C2RA 3R5EA 3RPMA 3G18A 5EB8A 1HIZA 3LGDA 4DY1A 4MDOA 2F2HA 1S2TA 3VE7A 2A3EA 1M6JA 1DTNA 1D3CA 4P7OA 1TPFA 3HGRA 1A5CA 4L6DA 3LS9A 4LSBA 3LHYA 4FXFA 2RJGA 1GPFA 2IMRA 3AISA 1UBSA 2X0SA 3XISA 2PWUA 1NFGA 5C7HA 1Z42A 1B3XA 4JHOA 1VBUA 4X3ZA 3VIKA 4B9ZA 4HKPA 2VEGA 4FOJA 3W84A 3SGUA 2WKGA 3O16A 3ABXA 1N7KA 3P80A 1XDJA 3CIXA 4IISA 1A0CA 2G4JA 4KMQA 3UEQA 5PTDA 1HX0A 4KCTA 1C8XA 1WXZA 4CU8A 4HZ7A 4JEQA 3GX9A 3R25A 2O7SA 3CUJA 2QNEA 2Z25A 2PGRA 1XRFA 3DXIA 2PP0A 4PYSA 2DQXA 1DJWA 3T08A 2DPEA 1G1YA 2DT3A 4DF2A 3ZZ1A 3KDOA 6TIMA 1K8XA 3RR4A 1OG0A 2E40A 3QR1A 3OVQA 5EGRA 2WJZA 4LCQA 1O1ZA 4P8XA 5LIUX 2INZA 4YCPA 3GFXA 3K1DA 3KX6A 4FR6A 4H9ZA 4E5TA 1QO5A 2YGYA 4JTRA 3LM7A 2OSWA 4HU3A 4CD5A 4LYPA 1FWIC 4GRSA 1BGGA 2YLLA 2ZYFA 1I1XA 4MOZA 4Q4OA 4PB5A 4OBTA 2FZ8A 4I6VA 3IGSA 4O0QA 1E3XA 7REQA 1S39A 1Z6KA 1V6WA 3WEMA 2REQB 3BMXA 1B5TA 3SIMA 5ECVA 3DYOA 3U2CA 4CD4A 2E6YA 3EGJA 2Q01A 1S2WA 4UTUA 2HE5A 1ODUA 3UVAA 5C9WA 1W5NA 1GJPA 1JYVA 3LQLA 1NWTA 3VVGA 4GIYA 4NZFA 1VBJA 2CHRA 2GQ9A 3ZJ8A 3CMFA 3VKDA 1JUKA 4Y9PA 2E09A 2BOEX 3ITOA 1IZCA 1B1YA 5D2TA 1S2AA 4GKLA 1OX4B 3A64A 2VGBA 1UWQA 3W4RA 1FKWA 2TPSA 5BOOA 3LLXA 3OW1A 2E1WA 4UQEA 1P48A 3W7LA 4UC5A 5CPSA 1KFCA 3MA8A 4XBSA 3S2JA 1QHPA 2O55A 1C91A 4B92A 3N3MA 1VH7A 3G8RA 2Q09A 2NUXA 1NDVA 1HP4A 3GG1A 4PRWA 2CU0A 2XPKA 3EMCA 1F6PA 1EHNA 2BGQA 1MW1A 4H7ZA 4MJMA 4KIEA 5HK4A 1OEPA 3P2VA 1JDFA 3SECA 2V5DA 1C8YA 1AZ1A 1WUFA 4HJFA 4HNNA 3HPFA 2FPVA 3L5LA 3NQDA 4WXZA 4HYVA 3MYPA 4ORIA 5HA7A 3VC6A 4EOUA 5BXSA 1DWFM 5DLCA 1BG4A 2PDIA 4NI8A 4M1RA 3RLVA 4LNCA 5CBBA 2QUMA 1XLLA 3TYZA 2YCJA 3M1ZA 2YCIX 1VENA 3ARVA 5HAOA 2ZRZA 4Q8MA 2NQHA 3VDBA 3THUA 1QNQA 3B8WA 4F0KA 3MMTA 3FX4A 4M81A 4WOZA 1HVXA 4LS1A 4N9DA 4Q7BA 2PTDA 1B3VA 4N4PA 1SFSA 4CCDA 5AYIA 3U7BA 4W86A 4KERA 1XPGA 3PZUA 4BF5A 3TTOA 5FJOA 2NW0A 1E72M 3VMPA 4FB7A 5BXPA 3GTNA 3WNNA 3EDJA 3OGRA 3FHAA 4M1BA 3WQPA 3TAKA 1RVGA 2Q02A 4HZMA 1M7XA 1H09A 2V3FA 1JZ8A 1H49A 2Y7FA 1T6MA 3P82A 3JRKA 4GE8A 1SFTA 4A8NA 2WSQA 4S3BA 4L9ZA 1HJVA 1OQFA 5I2UA 3G77A 2XFYA 1EJXC 4BQ3A 3RF9A 3N19B 1LOSA 1TWDA 3MYOA 1FCUA 4G1KA 4KWVA 3O15A 4JKLA 1DJNA 1S1PA 2WB5A 2PSNA 4AWUA 1V3MA 2PU1A 4B5VA 3KOXA 3GHSA 1FWAC 2V3DA 3FVDA 2WMJA 3UJSA 2XISA 1FX6A 2IKGA 1TPWA 1ZAJA 2J27A 1W0MA 4AVFA 3DOPA 3T8LA 3VIJA 4IQJA 5CLWA 3A6OA 2PLMA 2B7PA 4LFYA 4QEEA 2Y6ZA 1K4GA 4EXAA 3CLMA 1ITCA 4GOAA 2PURA 4B5WA 3DERA 3S2MA 1WDSA 3QTGA 1JF6A 1V7YA 3IVTA 3AMKA 2XIIA 4U31A 4JPGA 1Q6GA 4DUOA 1EDQA 1VJIA 1MEWA 4HNCA 5I24A 2R6OA 2HCVA 3UT0A 4GYPA 3T2PA 3LOTA 3LNMA 2R1LA 4JFSA 4KFNA 1IT0A 3MBFA 1GHRA 1LQAA 2GUUA 2CHNA 4GI8A 1JRBA 1U5VA 1AMKA 3TZNA 2DW7A 2NV1A 3AXHA 1RA0A 4H6QA 5DX7A 4PMXA 4FXJA 3ITCA 3W7NA 3UCCA 1TCMA 3VOGA 2D2GA 1CX9A 1POJA 1BYBA 1JCLA 1CXFA 3CPUA 1VYRA 1S46A 3HM7A 1H7NA 4KEMA 1OT2A 1T99A 4UTKA 1ZNNA 1QI0A 4PFMA 2A7PA 2EXOA 1T96A 4Y9MA 1XXXA 2PWDA 3PBVA 2ZZ4A 5XIAA 4S3KA 2WWCA 1OC5A 1XBXA 2GZXA 3PBGA 1IWBA 4L9YA 3E0WA 4GFSA 3UBPC 2ATSA 2PDFA 3UR2A 4DWDA 2Y61A 5LSMA 2CKRA 1BFNA 1RBAA 1DBTA 3LU2A 2GGEA 2ZVRA 1P0DA 4WEVX 3AJ7A 2C1IA 3WO8A 3N25A 4UTFA 3L2IA 1XRSA 1CCWB 3ARRA 1UP0A 3M44A 1BSLA 4AEEA 2A7RA 3IARA 1QW8A 1Q63A 1PZ2A 1JGMA 4F2UA 2CLPA 1PX8A 3N3TA 4RPPA 3RUBL 2VZVA 3OA5A 1QI2A 2CW6A 1RALA 5C5YA 3WJYA 1LRQA 1PWLA 1H5VA 1BVWA 5DMMA 1X1NA 5JQ9A 1N82A 3EWYA 4GZIA 3NG3A 2BVTA 3HA1A 1CGYA 3ECQA 1TWIA 4HK5A 2X40A 4FNSA 3RM4A 4LUTA 1YDOA 1QK2A 2O4QA 1THFD 3VD9A 2VCCA 1QI3A 1U30A 3PHAA 4LS2A 3N6QA 3U2ZA 4K7YA 4TR9A 4V27A 3HTWA 4O10A 3HG3A 1LQ2A 5L6UA 3PWIA 3BGGA 3J7HA 2XFRA 1BQCA 5CQ1A 4ZQPA 3TONA 1OC7A 2BS9A 5HR7A 1KTNA 4Q6XA 4JXCA 3GR4A 3SQSA 2GOUA 2WK2A 2RDWA 1KCLA 4PULA 1B54A 5D9OA 3IRSA 2A0NA 3FDKA 2D3LA 2GVYA 2IKJA 3MP4A 4ZXLA 1N8IA 5DT5A 2EPHA 4X22A 2A3HA 1W2PA 3BAWA 4XO6A 4AG0A 5FJIA 2VQUA 4ZQMA 3WF0A 3QFWA 1RQEA 3CU2A 1GW9A 4NI3A 2EEXA 1RH9A 2DY3A 3N9RA 4Q32A 2Z1WA 3D46A 3M0VA 3KW3A 3WD1A 5CEWA 4NNBA 5TD4A 3LD5A 4QXIA 3AHZA 2NLIA 4A2RA 4PMNA 2D0FA 3VOJA 5KITA 3PUGA 4FA3A 5H8PA 1JRCA 3TFCA 1SZNA 3LNPA 3AS0A 1SFJA 1ADOA 1WZAA 4K1GA 3KBMA 4IZGA 1PIIA 4IPJA 4MSSA 3DGBA 3HG5A 2D2JA 1ZLPA 3N17A 1GEHA 5AVNA 1OZMA 4LGXA 2CLEA 3GU1A 4OVXA 2V5BA 2MNRA 4JTTA 4RZ6A 5D32A 1B9ZA 2A2IA 2I7GA 1JPKA 5E0FA 4Z2KA 3WZ0E 4K2SA 2CYGA 2PF8A 1OX6A 3H2FA 1LUCA 3LRMA 4OQVA 2Q71A 1H0GA 1SZEA 3AO0A 5IXEA 3W76A 3WF1A 3S5YA 4RX0A 4IP5A 4DVOA 4L1GA 3FA4A 1W37A 2JF6A 3MW7A 4XSMA 3AIRA 2NLYA 1KTCA 3A3XA 5C71A 4C6LA 2GFTA 3RM8A 1RY0A 4GUJA 4IMDA 1VD6A 1WZLA 1XYAA 1DVJA 4MB3A 1KKOA 2EF9A 3LHUA 4OOUA 2CBJA 1IF2A 4MWAC 1KRCC 1I2QA 2NZLA 1W8GA 1ZRQA 3TW7A 4I6KA 4POCA 3R0KA 3T40A 4TMBA 4ZXOA 6ALDA 4Z1DA 3ZO9A 1XLGA 5FD0A 5AHIA 3DHFA 3SAZA 1R5YA 3LXBA 3UA4A 4GJJA 3B9NA 1GT8A 4KCUA 4MJ2A 1MXGA 4Z2JA 4PUMA 5T9CE 1S3HA 3VUPA 3N04A 2WC3A 2WJEA 5FJTA 1XLFA 3AQUA 3DG3A 1EEXA 2ZKMX 3TUUA 1CGWA 4JFTA 2BV9A 3LHTA 4LVFA 3QYQA 5AN7A 4V1XA 2C79A 2QMKA 5AC6A 3NPXA 1PX4A 2UBPC 2TRSA 3Q45A 2D1ZA 2JFEX 5AKQA 3WNMA 3P93A 1NARA 2VL4A 4QNWA 1KFWA 3ZQ9A 4Y9OA 3CZJA 3TH6A 3WQVA 4S3CA 4W5ZA 1CXIA 3AHVA 3XIMA 1FHLA 1BHGA 4H4IA 1CGUA 4XAGA 1WOAA 3TROA 2G95A 3LZ5A 4HHPA 4M8UA 5H6HA 4P61A 2EPMX 2OCZA 3VMOA 1MQQA 4AMCA 2FMOA 3MHFA 1WQ5A 2GVGA 1M7JA 3CTLA 3JR2A 1K03A 3FXGA 4ZA0A 5C2CA 5D30A 1LT8A 3QR3A 1OYBA 2HS6A 5EMMA 3WKZA 4XVDA 2J7GA 2CLFA 1HO4A 3DFYA 1H63A 3FIGA 2ZA1A 3ARZA 2VZUA 4KKXA 1P1XA 3IJQA 4DXXA 3PUOA 3AYRA 4FLRA 3BG9A 3TJ4A 5HPCA 1GJWA 1I6NA 2YLAA 3WDJA 2CZFA 4UQAA 1OIFA 4ZR8A 5TQLA 1JGIA 4RZ5A 3MUZ1 3WQCA 3NXLA 3FKRA 4R9XA 4ZEPA 2YCLB 8XIMA 5BOFA 1G4SA 3W25A 4UOZA 3GHTA 4OFCA 2D22A 3GUGA 4I9TA 3W86A 1RBLA 1P6BA 1Y5XA 3K4AA 1R3VA 4K38A 4C7GA 1YTKA 4I9JA 4IFKA 4TQTA 4CEXC 3BICA 3AZSA 2BX7A 2BNJA 3QMSA 1OG6A 1VQTA 5JXQA 1P6CA 2FDSA 1DIKA 1F2JA 1JI2A 3W70A 2IKHA 4G5DA 2XWEA 5C8BB 1G4PA 4PMJA 4LAZA 4MNJA 3NCOA 1O5KA 2OO6A 4LH8A 3W23A 5IFPA 4GZEA 2E7FA 3W83A 4JY9A 2YIHA 4EPBC 3RU6A 1BKSA 5E6ZA 1K9TA 1EGVA 1TRIA 3IWPA 1FWBC 1QW9A 2VFEA 3KVKA 1WE5A 1ELSA 3G2GA 3C8FA 4PRRA 4ZMGA 3ARYA 2WNNA 4CNUA 3M4HA 2DZPA 4PCPA 3A5FA 3KXQA 3WK1A 4N42A 4IJBA 1WYIA 3NURA 3UJRA 2PWEA 3LTYA 2OB3A 5TIMA 4MUZA 1VLWA 2ZE0A 2EG8A 1XH1A 3NDYA 2PD5A 1OFBA 3S0CA 3VINA 2FPYA 2VURA 4B2DA 3WD3A 5MHBA 2OKOA 3HOJA 2XINA 4ROPA 4S3FA 2CKSA 4Q4PA 3FK4A 1UR4A 4AW7A 1MO0A 3B03A 3BSMA 2YB4A 4MM1A 1IXQA 1AZ2A 1WZKA 4LF2A 3FSTA 5D2YA 2ISWA 5EBAA 5HJXA 2A3CA 5HNNA 1FWHC 1UR3M 4C1KA 2D23A 1UD8A 3F5LA 1TQXA 2EBNA 3FJNA 4H19A 2PBGA 3C52A 1A0EA 5EMYA 4GX8A 2JIEA 3E9AA 1XLCA 3W7RA 1AL7A 2OT1A 1LJYA 1B3YA 3FGCA 3AHYA 3LEPA 3W1LA 2D24A 4KWUA 4O1BA 3N2TA 2NVAA 3JZUA 2WMKA 1IZJA 4HA1A 1NTHA 5FL0A 2WO5A 1EO5A 3FJ6A 1W3LA 3C2FA 4XZLX 1EDGA 5G2IA 3CQJA 4LBUA 3NQ6A 5BRPA 4DM1A 5MKGB 2X30A 3LN3A 2VR2A 5CJMA 1DJHA 3STEA 4JTGA 4LNYA 1OM0A 3U4FA 1ME8A 3T2OA 1IIHA 5E9AA 1TE6A 2DSWA 2G3IA 1IE7C 4F2BA 2JKEA 3VILA 1F74A 1XUZA 3EOLA 4AQLA 3WQOA 1IR1A 3R0UA 3A23A 1ZBCA 2XFFA 1UPPA 4K7VA 3RK8A 3TYEA 3M46A 5A2CA 4BFAA 5J8LA 2ADAA 3H23A 3NM3A 1EC7A 1J12A 4ICCX 2FGZA 2ATMA 2PD9A 1JDEA 1CZ1A 3VKAA 2GJPA 2E77A 4IICA 4UBPC 3A12A 3V1PA 4UTJA 4H41A 3F5KA 2VX6A 3KLKA 2VFGA 3C2OA 4V33A 1UG6A 1WZMA 3GDLA 3M07A 1KRAC 3JZEA 2D69A 3GK0A 2W62A 1B3OA 1R7OA 1TX2A 2V81A 3A5VA 4DAIA 2NQ9A 4HT3A 3FYOA 3VOCA 4HSHA 5LKYA 5FACA 4AZ7A 4PCSA 5JIWA 2POZA 4K6AA 2X1TA 1G7VA 3K8LA 2CNCA 2DFAA 2XH4A 1E9LA 3GWQA 3CMJA 4WJXA 3PG8A 3IANA 3OO2A 2QIWA 2Y7EA 3S2NA 3CV1A 3BANA 2NXHA 4HVXA 4PGLA 1XYLA 5KINA 4P7RA 3H2AA 1AD1A 3GLCA 4UXDA 1XIGA 4Q8NA 2VQTA 5GPRA 3WH7A 4HOWA 1EP1A 2QR6A 3OGSA 2WSKA 2G3FA 2PDWA 3TLLA 4BJHA 5LIWX 5FJUA 1V6VA 5LNUA 4D1IA 1MYRA 2G96A 2RGLA 4LU0A 2OU4A 3W7MA 2X09A 1DWHM 4ICMA 3ORWA 2IPFA 3GDRA 1XIMA 1HL8A 5BCAA 4HK7A 1W3NA 2Z2UA 4J2MA 3TN5A 2VUYA 1R3SA 3WBEA 4UZSA 1BTMA 1VBHA 3GE7A 3CUIA 4EPKA 3WBXA 4Q4MA 2YOCA 4JS3A 1Q6OA 2B31A 4RL3A 1J79A 3WQDA 3NYDA 2QUTA 1WDWA 3FNDA 3UETA 5CLTA 4MB5A 5FJRA 2JK2A 4CLMA 3OG3A 3BG5A 1UH4A 1SPQA 4AXNA 1I45A 4INFA 1MXSA 4JFUA 3MSYA 4F66A 4HPGA 4D6DA 1F73A 1UD6A 4HOZA 4M80A 3WF4A 1X1ZA 3EOSA 4S2CA 4L9XA 5AHNA 3A3HA 1LP6A 1NEYA 4PBGA 4KEUA 3TN4A 3UXKA 4IT1A 3UJFA 3QOMA 3PK7A 3WLIA 2RDUA 3URAA 1BYCA 3QVQA 4OGZA 1M7PA 4ZO6A 3HBLA 5B80A 1UH3A 3CZGA 2XVLA 1Q2SA 3MO7A 3L4XA 3WMSA 3W6YA 4A8RA 1FDZA 4GQQA 3UR5A 1RD5A 4AZGA 4UWMA 3HB9A 1A5KC 2GVLA 1PKLA 4PMVA 1WDDA 3GC4A 4KRUA 4JFVA 1GKRA 3S5NA 4MZ1A 1DE6A 3APGA 4EXBA 1J6OA 3O7UA 3NFUA 3WNOA 1I2OA 3SN1A 5F2GA 4E4FA 2I17A 2PB1A 1OFRA 3Q2DA 4DZ5A 1O4UA 1KFBA 3SFKA 3XINA 3EBVA 3WLNA 2GJNA 2WNWA 4EPDC 4ADSA 4HNUA 2CXEA 4FIQA 2ZICA 2OODA 3HO8A 4WDUA 3KZPA 3EB3A 4HPXA 1L6YA 1AQMA 1YQ2A 1F3TA 3L4TA 1ZCCA 1VCGA 4QE1A 4XAPA 2BDQA 1W54A 1ZHAA 4GVIA 5G4EA 4IX0A 3U6WA 1EHAA 1Y65A 1JCYA 1J6PA 4LBSA 1OFDA 2EG7A 2ZBTA 2WSYA 3F2BA 2BY0A 5DMNA 2LLEA 1AK5A 2VC7A 1NOUA 4QG8A 2NQZA 3ABZA 1XC6A 3BAIA 1K8CA 3DFSA 3OZMA 4GMEA 3V36A 4C5YA 3S9ZA 3ITXA 1V5XA 2Z6IA 1A5BA 3MI2A 1W9XA 4AZCA 5C9RA 1W5OA 4JD4A 2UY5A 5A1AA 4XD4A 2E5DA 2JKPA 3BO9A 3E12A 1EBHA 3ZFHA 2JE8A 4QQ3A 2ABAA 1A80A 1XIJA 3FS2A 4Q4KA 1L9WA 3QQWA 5HWNA 1TZZA 1B0IA 4R7JA 1Q6QA 3NSMA 2A6LA 3OOQA 3H53A 3RRAA 4ZZ9A 4PUEA 2EGZA 4IJRA 3ALGA 3E2VA 2RFGA 1J9YA 4CKQA 2F6XA 3VPLA 4OT7A 4QX4A 1E6ZA 4DYJA 7TAAA 3QJAA 4L5ZA 1EO7A 6TAAA 4AXKA 4PUJA 1F3XA 1EPVA 1CECA 3WUGA 1QOPA 2ZX7A 3O63A 5AYZA 3M0LA 1J10A 2H8XA 4LB4A 3W26A 1CW2A 3WBAA 4UQ9A 1EUNA 4F0SA 1DHPA 2OQLA 4TTGA 3V0SA 1DXFA 4UMAA 1RPKA 1QPQA 3DENA 3WH6A 3SCWA 2A6NA 4UMCA 4WKAA 1ZGDA 5I06A 4LALA 4AD0A 1WBJA 3APYA 4XKYB 1TVNA 4JHZA 4AWSA 3BOLA 3N18A