4IH3A

2.5 angstroms x-ray crystal structure of of human 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase in complex with dipicolinic acid
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
332
structure length
332
Chain Sequence
MKIDIHSHILPKEWPDLKKRFGYGGWVQLQHHSKGEAKLLKDGKVFRVVRENCWDPEVRIREMDQKGVTVQALSTVPVMFSYWAKPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQAPELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELFPVYAAAERLKCSLFVHPWDMQMDGRMAKYWLPWLVGMPAETTIAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGFSMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELEPGKLIESMEEFDEETKNKLKAGNALAFLGLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human alpha-amino-beta-carboxymuconate-epsilon-semialdehyde decarboxylase (ACMSD): A structural and mechanistic unveiling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase
total genus 112
structure length 332
sequence length 332
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.1.1.45: Aminocarboxymuconate-semialdehyde decarboxylase.
pdb deposition date 2012-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4ih3A00
1XGEA 3QY6A 2AQVA 3BE7A 1EJTC 1NDZA 2OOFA 4C6QA 4DNMA 1W1IE 4IF2A 5G4HC 1P6CA 2YZ5A 3RYSA 1GKPA 3MDWA 4PCNA 2ANUA 1XRFA 1YBQB 4ERIA 3OOQA 2OQLA 4C6CA 4OFCA 3IV8A 2E1WA 3E0LA 2FTWA 4C6PA 3A3XA 1WXZA 1A5KC 4DIAA 4IFRA 4PCPA 3IPWA 3AU2A 3KM8A 3CJPA 3R0DA 2Q01A 1EJWC 3URBA 4INFA 2GWGA 4C6KA 1A5OC 4ICMA 4IGMA 2WJEA 3B40A 5E5CA 4CNSA 3LU2A 2Y1HA 4GY7A 4UBPC 3T81A 1J79A 1ONXA 3RCMA 4GX8A 4P5UA 4JOMA 4LCQA 1J6OA 3PANA 3ISIX 1A4LA 1NDYA 2CZVA 2KAUC 2YXOA 4H9XA 3FDGA 2BB0A 1RJPA 4LANA 3V7PA 2Z28A 1A5NC 4B90A 4D8LA 2P53A 1FWDC 3N2CA 3S2LA 1FWJC 3UBPC 4QS5A 3SFWA 4LAKA 2HPIA 3MPGA 3OJGA 1RJRA 2EG7A 4M51A 2PGRA 4RE0A 3C86A 2I5GA 3UR2A 4DI9A 1EJXC 4C6BA 4WGXA 4AC7C 2OODA 4GX9A 1HZYA 4QSFA 1WXYA 1POJA 1A5MC 4CEUC 2D2HA 3FEQA 3GTHA 4GBDA 1K1DA 5AKQA 2PLMA 1QXLA 3TN4A 2EG6A 3QGKC 3LGDA 1YBQA 3F4DA 1FWGC 1A5LC 2PAJA 1IE7C 3K5XA 2ICSA 3TN3A 4GZ7A 4DLMA 2Z7GA 4F0RA 2R1PA 3GIQA 3FDKA 4RDYA 4EP8C 2D2JA 1PSCA 3A4JA 2Z2BA 4E3TA 2QPXA 4J2MA 3TNBA 3K4WA 3CS2A 2GOKA 1V4YA 4PE8A 3DUGA 1M68A 1RAKA 2XIOA 2F6KA 4LCRA 1O5RA 3ICJA 4F0SA 2Z24A 3OODA 1O12A 4IH3A 3G77A 1R9ZA 3ITCA 2Z29A 1YIXA 1K6WA 3S4TA 4NP7A 2P50A 4BKNA 4R88A 4C6IA 4G7EA 3QY7A 4KQNA 4QTGA 1S3TC 3UPMA 4DI8A 4B92A 4GK8A 3E3HA 2R1LA 3GTFA 3LSBA 4XAGA 4BY3A 2FTYA 4LH8A 1FKXA 3LA4A 3O7UA 4XD6A 1M65A 3GRIA 2PGFA 2BGNE 3GUWA 2O4QA 3GTIA 4C6NA 4DZIA 2Z2AA 4KERA 2DVTA 1EJUC 5LXXA 2PUZA 2VM8A 3NQBA 1UIOA 1DPMA 4KEUA 4TQTA 2GSEA 4QRNA 4C6OA 1YNYA 4C6EA 4C65A 2YB1A 2UZ9A 4C60A 3E2VA 2FVMA 4RDWA 1EJVC 5HMFA 3LY0A 1ZZMA 4RDVA 2Z00A 5FSEC 3DCPA 2AQOA 4B91A 1KCXA 4J35A 2FFIA 2HPMA 1RK5A 3F2CA 1RJQA 1JGMA 4ERGA 1P6BA 3OVGA 2E25A 3IGHX 4R85A 4HK5A 3IACA 3GU1A 4IQJA 1M7JA 4XD5A 4ZSTA 4ERAA 1RA5A 4GXWA 2ZC1A 4PBFA 1PB0A 1UBPC 1E9YB 3OU8A 2RAGA 3NURA 3T8LA 3GU2A 3JZEA 2Z25A 4XD4A 4DZHA 4H9UA 1NDVA 3S2NA 4RZBA 3ORWA 2D2GA 1XRTA 3PNZA 3NEHA 1RK6A 4G2DA 2EG8A 4C6LA 3ID7A 4Z42C 1XWYA 1FWHC 3GG7A 4R7WA 3MKVA 4CQCA 3B0XA 4CEXC 4C6FA 1NDWA 4C6MA 3LGGA 1FWIC 4GYFA 2FVKA 4WHBA 3UF9A 4H9YA 3E0FA 2Z26A 3CAKA 5HMDA 2QVNA 1V79A 1GKQA 4IG2B 1I0BA 2R1KA 4LFYA 4NI8A 3SO7A 1ONWA 2HBVA 4XAFA 4XAYA 3DC8A 4HK6A 4GOAA 4HJWA 3MJMA 2VR2A 3EWCA 4IFKB 1UMLA 1YMYA 2A3LA 2OGJA 4LALA 4AQLA 4V1XA 4LEFA 4DO7A 2WM1A 4H01A 4C5ZA 1FWEC 2Z27A 2GWNA 4I6KA 4EPKA 2R1MA 3T1GA 4ZSUA 1GKRA 1YRRA 4H9TA 4J5NA 3QY8A 1A4MA 4LCSA 3IRSA 4H00A 3MSRA 3LSCA 4DLFA 2YB4A 1QW7A 2O4MA 4C5YA 1J6PA 1KRAC 4L9XA 2HNHA 1R9XA 1PO9A 4PBEA 4WVXA 2Z4GA 3O0FA 3URQA 1ITQA 4L6DA 1VFLA 3RHGA 1RA0A 1BF6A 3B0YA 3PBMA 1V77A 1I0DA 3AU6A 1ADDA 3WMLA 4HK7A 4F0LA 4KESA 5HMEA 4BJHA 3F2DA 2UBPC 3WZ0E 1V51A 2OB3A 4H9VA 3MVIA 3MTWA 4KF1A 4GY0A 4CQBA 1NFGA 3K2GA 1FWCC 2WJFA 1KRCC 1V7AA 4C6DA 4CNTA 4CNUA 4V1YA 3MDUA 3TN5A 2ADAA 5A6TC 3HPAA 4XD3A 4QROA 4MUPA 2I9UA 1EJSC 3AUOA 4NG3A 4KEVA 1FKWA 1KRBC 1E9ZB 3S2JA 4HA0A 3IARA 1ITUA 1EF2A 2W9MA 2G3FA 3E38A 4IFKA 3MVTA 1J5SA 4KETA 1POKA 4LAOA 4XAZA 4EPEC 4KEZA 1P1MA 3HM7A 3EGJA 2WJDA 5FSDC 1EJRC 2IMRA 3D6NA 3GIPA 3GTXA 2HQAA 4G7EB 2AMXA 4LAMA 4QS6A 4IFOA 3PNUA 3HTWA 2VHLA 3F2BA 2VUNA 4B3ZA 4C6JA 4GY1A 3UR5A 2DVXA 4RDZA 2Q09A 2GZXA 3F4CA 5CH9A 3LS9A 4DYKA 1PTAA 3E74A 1UIPA 1KRMA 3RN6A 2R1NA 4I6VA 2HBXA 4H9MA 4EPDC 2QS8A 2DVUA 3URAA 1R9YA 4KIRA 4IG2A 3WYZA 4GC3A 1FWFC 4IGNA 4UB9A 3EWDA 3LNPA 2VC5A 3URNA 4CQDA 3S2MA 1EYWA 3PAOA 3IJ6A 1FWBC 3A3WA 4H9ZA 1K70A 3OQEA 3QGAC 1EZ2A 1FWAC 3GU9A 3TN6A 4EPBC 2QT3A 4YIWA 2VC7A
chains in the Genus database with same CATH superfamily
2DIJA 1B3YA 1A5UA 1R3SA 1Z3NA 1FCBA 4H41A 1P6CA 2QGYA 2GVJA 4NXKA 3WQ6A 1GGOA 1QBBA 3HQPA 2O9PA 3F5JA 3R7MA 3ITVA 1VPYA 2X16A 3W83A 4QDWA 4UOQA 3AU2A 3GNPA 5K4XA 3EOUA 5I3IA 5D2WA 2ZUNA 1ZCOA 4AWUA 1E4NA 1EX5A 4INFA 1GOMA 1HL9A 3W53A 1W1B1 2CCRA 3S83A 4MF4A 4WR3A 4O0ZA 5A6BA 3VGEA 1RR2A 2VVNA 3FA4A 2XM2A 3ARSA 4JOMA 4UTWA 1D7KA 3W84A 4ZEPA 3ISIX 1T8XA 3ENLA 3PZUA 1QAPA 1F5ZA 1JUBA 5AYIA 3HPFA 3KRBA 2PPGA 5BRQA 3CWHA 2HVOA 5CPLA 2PMQA 4ADUA 1P48A 2CIPA 3G1XA 4YLWA 1VEMA 4RE0A 3UR2A 4EWND 1PCWA 3OLIA 3N9KA 4GWEA 4TTGA 3PWIA 2PU0A 3CV2A 3B0PA 1JDDA 2E6AA 3FAWA 4JHMA 3AO0A 3Q94A 2QUUA 1V6VA 1TCDA 4I8DA 4CCZA 2XU2A 4IPPA 4HPXA 4LEQA 3LMYA 1KKOA 3N73A 5A8NA 3GVGA 2E9LA 3FDKA 3WLKX 3BJSA 2C91A 4TOQA 4MAVA 2E5CA 1TZZA 4DXXA 3H55A 4DO5A 1HO4A 3G8RA 3N34A 1C9DA 4IGHA 1YQ2A 2Z24A 3KOZA 3OODA 3WH6A 3KOFA 1KV8A 2WC7A 4RZ5A 3KW3A 1BPLB 3QC3A 1ECQA 4BKNA 1JRBA 2HWGA 4OUIA 2WHLA 2VO5A 1RD5A 3N17A 1PTDA 5ABEA 4JFSA 3MCOA 1PVNA 1O1HA 1H1NA 2VKZG 3VM7A 1G4SA 1V6XA 4ZO7A 2PB1A 3LA4A 3QV9A 4W89A 3NQDA 2X09A 3VIJA 3MHUA 6PTDA 2PDWA 1AL7A 3CQJA 3EWXA 3K1GA 5FL0A 4ZVJA 5DMLA 4P7OA 4MJMA 2YA0A 1B4EA 1S39A 1ML1A 2XH2A 2ZZ3A 1TJPA 2RGLA 5ECVA 3ABZA 1BF2A 5AHMA 2I7GA 1VR6A 2PP1A 3IEBA 5CC6A 4RDVA 3A6OA 2A3BA 1JQXA 3N2TA 2FB2A 4QDMA 2V5LA 4XSLA 4R85A 3LCLA 1DJYA 1Q7ZA 3M0JA 3ZFHA 3GVQA 3M0MA 1OYCA 4NYYA 1TPVA 3CB3A 2XSBA 4QJ5B 4AX7A 2EJAA 1PB0A 1AQMA 1VBUA 3GU2A 3JZEA 4HSNA 2X1UA 3I3EA 4TMCA 2ZQ0A 4TR9A 5I2UA 5F4SA 3BICA 2YDQA 1Z32X 4J3VA 4HZ6A 1G01A 4CU8A 3BAIA 4J27A 1LL4A 4Q4MA 3RPTA 1Y65A 1FHDA 1R47A 4Z2HA 4C6MA 2HXTA 4PUNA 3KTCA 1MNSA 4WHBA 4PMYA 3GUGA 3W76A 3H2MA 2QVNA 1E4LA 3SECA 3SRKA 3N6QA 4XAFA 2EPOA 2ZRZA 3NTYA 4GOAA 3MI3A 3WQOA 1YMYA 3N19B 5E09A 1OFQA 5FF4A 1GQIA 2GUUA 1N8FA 3M5VA 4YWIA 4H6KA 3WK1A 1GVRA 4AXNA 4I6KA 3WNOA 4H6QA 3VDHA 3AHYA 3G6MA 4H9TA 1VBHA 4IP7A 1KM1A 4AY8A 4H00A 1DJNA 2P76A 2GJXA 4C5YA 4L9XA 3JW7A 1DJXA 3WLQA 2WMJA 3AZTA 1RA0A 3AICA 3EWWA 2OMAA 1EKOA 4K68A 3AIWA 3F2DA 5TBOA 3WZ0E 3TE9A 1TQJA 3M0HA 4H6EA 1A3WA 2D20A 4HOWA 4IWWA 2OZ8A 3CHDA 3EDKA 3NZPA 1THFD 2PDUA 3NSXA 3WQCA 1LT8A 5C9ZA 4Q8MA 4PMVA 3VDCA 3GDTA 4D8AA 2YR1A 3E5BA 1JFHA 1WBJA 5GPRA 3WL1A 1PKLA 4A4AA 3TCEA 3QN3A 2BVDA 3BWWA 4KEZA 2BXYA 1EJRC 3D6NA 1PTGA 2HQAA 3QEZA 4RNFA 2JQXA 3W1PA 4S3FA 1XC6A 3Q67A 2INZA 4F8XA 4ROPA 1I2PA 3NPXA 1LQ0A 2DVXA 3MYOA 3S42A 1DWFM 3FGCB 4FK9A 3SI9A 4MTVA 1UIPA 4X0NA 1W31A 1C90A 4MWAD 1ZQ5A 3W82A 3L7RA 3CV6A 1FY6A 2PP0A 3VOIA 3SW6A 1V3LA 4NZ1A 3DHPA 3T78A 3LCXA 3E49A 4GZIA 3TOYA 2BOGX 3VGDA 1XLEA 1J2WA 4MDPA 3W2NA 3VDAA 1LZOA 5C55A 4WIWA 1E1EA 1EZ2A 5JMUA 2YBTA 5FL1A 3M0XA 4NKCA 1S3HA 1FDYA 4D6DA 8RUCA 4GO8A 2FH8A 5RUBA 1DORA 3MDWA 2YL8A 5J5DA 3TR2A 3TYUA 4BQ2A 2PD9A 3A12A 1H0IA 2VGIA 3B05A 3P82A 3WH8A 4C6PA 3BGGA 3OBAA 4IMCA 3TNOA 2D1ZA 3DHUA 5REQB 3URBA 3BANA 4PRRA 2DY3A 5AVNA 4L4PA 4MY1A 1TRIA 3OLEA 4LSBA 2Y1HA 4UBPC 4CNPA 2GUBA 3RRAA 3TLQA 4LY4A 3LRMA 5HPCA 4EIVA 1OIMA 3RJXA 4YS1A 4H9XA 4ZQRA 5GJMA 4W85A 2FGZA 1RJPA 4ADTA 5CG7A 3W7MA 4JEJA 4IP4A 3ZJ7A 1PUDA 1XM3A 2ZUWA 4IPIA 1DWHM 2DDXA 4O8RA 4L65A 4FAMA 1IGSA 4GHRA 3SN0A 1EEPA 3TC6A 4NI3A 3IUHA 4IIBA 4WGHA 1A5LC 3TXVA 4UTWC 1ZJAA 1IE7C 3BW2A 2ICSA 4GRSA 2XN2A 4ZOCA 5BWAA 3VIOA 3L12A 1S2UA 4NAEB 1JGIA 4R7OA 3K4WA 4JTDA 3ARVA 2PF8A 3QR0A 1R9ZA 1ZJHA 1YIXA 4J1OA 1H7XA 4IUOA 4N9EA 4A6GA 3SIZA 3NQCA 4C1KA 4KRUA 5IFTA 3AYTA 3PPHA 2WSPA 2Y24A 5MF5A 1TZ9A 3ME3A 3GFYA 3QQ0A 3LPOA 4CNOA 1S3TC 3P5YA 4M6QA 4DI8A 2VZOA 2FTYA 5IHSA 5M3WA 3ITGA 3W9ZA 1HKJA 3AXIA 2PDYA 4FX6M 2C0AA 5FF2A 5HQEA 1JCTA 3PJTA 5G2IA 1DTNA 1QNRA 3L5AA 4ZE5A 4QBXA 4QDPA 3GD6A 3L68A 3E9AA 2IKHA 2QUMA 3M1ZA 5HMFA 1DJZA 3DFHA 2P0OA 1WDPA 5C0QA 3QGVA 5FSEC 2XUCA 5D33A 1L2QA 2XHYA 3CNYA 1FA2A 1N82A 3E96A 4AEEA 4PMRA 4E3VA 3ZSSA 2WOQA 4MLJA 1KGWA 1HGWA 5HR7A 3KCJA 4KCVA 3KS6A 5MKGA 1NQ6A 3FSUA 2G4FA 1YNQA 2R82A 5D9NA 1JL8A 4NAFB 3SCNA 4NRRA 1AMKA 1K9DA 1G7UA 3ID7A 1J4EA 1W9XA 4C91A 1CDGA 3BJTA 3DXIA 3I4EA 5I24A 2ON3A 3T42A 1JUKA 4IQDA 3OHMB 4W5ZA 4GG9A 5C9UA 1ZCCA 3OVPA 1Z6KA 5AY7A 3IRDA 4IG2B 4NI8A 4H19A 2XJ7A 3W1TA 1E6ZA 2ZUVA 2ZE3A 1RBLA 1F05A 1RCOB 1VF8A 4HU3A 4CKQA 5LNWA 1ZENA 4F0MA 3WF3A 5C6MA 2D69A 3PWGA 4UR9A 4YPJA 1S1RA 1R38A 3MP4A 4GUIA 1LOQA 1GZGA 1ISVA 1ZL1A 4LPCA 3AYVA 3TW6A 1KRAC 3NQGA 2XIBA 1V08A 2Z4GA 3TA6A 1AZ1A 5AC5A 3SSZA 4EOUA 4PN2A 1BF6A 3B0YA 2GGGA 3KL3A 3VNIA 3I65A 2FHFA 3C0SA 4L7ZA 4JAWA 3VD9A 5DT5A 2QXWA 5HINA 3P5ZA 1Q45A 3AMLA 2WBKA 4CQBA 3R43A 4WJEA 2FVLA 4DZAA 1QI4A 3SCTA 4CNTA 2QULA 4PUWA 1JCJA 5LYRA 2YFNA 5H8UA 2JF6A 2QNEA 2I9UA 4CD8A 1EJSC 4L4MA 2YOCA 1TIWA 2EPKX 4GYKA 1QT1A 4UFMA 4ZB2A 3S2JA 3RR1A 3O3RA 2W9MA 2ZDSA 1XLLA 3PZIA 3U7BA 1CXKA 2IQTA 3CLMA 1VBJA 4MG4A 1XLGA 2ZUSA 3SCWA 4BWLC 5FKYA 4UIOA 2W79A 2HCVA 1OGGA 3L4ZA 3A13A 4JHZA 4N9DA 1XLBA 3ARTA 5A8QA 5D30A 2Z2UA 4AH7A 4B9ZA 3H22A 2AL1A 2F6XA 3G2GA 3W00A 4I6VA 2HBXA 2OO0A 4AB4A 5D03A 4W7WA 2WKLA 1FWFC 3KFTA 2OSYA 3PY2A 4JTTA 4O16A 4X60A 1IIGA 3G0UA 4IXXA 3UCQA 3F4WA 3C0QA 3FCPA 5I3DA 5HATA 3A24A 1F4HA 4JQ3A 1LTDA 1FWBC 3QYSA 3SUVA 4DELA 1A0EA 2UY2A 1XYZA 3SQLA 1ISXA 1L2UA 2ZA1A 4MUZA 4PTNA 3G1SA 4Q4OA 4HTBA 2YDRA 2OQYA 3EOLA 1W1IE 4KRZA 1TPWA 3AWOA 3G1DA 4JIHA 4U5KA 1HIZA 1XW8A 3TYCA 3M07A 1F3TA 3IV8A 3W01A 3WENA 4HOXA 5AHLA 1A5KC 5J5RA 2VL4A 5BU6A 3BLFA 4EXBA 3HO8A 5J8LA 3W74A 3GFZA 5XIMA 2VX4A 3N6JA 3UR7A 3WJXA 3MP3A 5FJOA 1VP5A 4KGJA 2V5KA 3RXZA 3IJIA 2JE8A 5KSWA 2W67A 1XX1A 3DGBA 4GX8A 3F7JA 2DZUA 3GZAA 1X6NA 3CUIA 1HJSA 1PDZA 5CSSA 3BAJA 3T7VA 1LT7A 3WQVA 3E0VA 4JFTA 1CLXA 2OSXA 5F4XA 2V2DA 1LJYA 3UEQA 1KM6A 1H49A 4AC7C 1N7KA 3QW4B 1RVKA 1WOBA 2ZRUA 2ZUTA 1HZYA 1UP0A 4GCXA 5HMSA 4NZJA 4PUDA 4U2YA 4DJED 1VBRA 1ZALA 1PKYA 4H4IA 3TQPA 1YBQA 2VI0A 4JNYA 2EAWA 3LLFA 4PGLA 1BYAA 2QDEA 1K9FA 3L0KA 1UWSA 3H7VA 2DPEA 1KW1A 4LUSA 4TO8A 1EXPA 1PSCA 3E0WA 3LHVA 1E6NA 1QNOA 4J2MA 3F03K 4ORMA 1M68A 3OYXA 3RX4A 4EWJA 1PHQA 5E6ZA 1XL9A 4V28A 3Q37A 1W8SA 4WSHA 4DWSB 3MUAA 3LGEA 4X63A 2O9TA 1QPQA 3UZJA 3CMJA 1PHWA 4GMEA 2GFTA 2WO5A 3BGJA 4ICCX 2VTFA 3LSBA 3T44A 5T9CE 1XLJA 2CLHA 4ZBCA 2QCNA 1ME9A 3STEA 5CJNA 2HVNA 3TC3A 4NT0A 4GIYA 4JTQA 2EBNA 3KBWA 2A3HA 1UZDA 4MYXA 5E93A 4EACA 3APTA 3OEXA 3RILA 2QVHA 2YGYA 3VCRA 1R3TA 2I57A 1XBZA 3UA4A 1YNYA 4P7QA 1C9WA 4RUBA 4UNIA 4D6EA 1UPPA 3CAWA 3D46A 4UXDA 3L4WA 2AQOA 2G4JA 5KITA 2FMNA 3OBEA 3MMWA 3VKJA 1FP8A 6A3HA 3AZRA 2Y63A 2BHYA 4HK5A 3ZS4A 4XD5A 4GXWA 3ALFA 4F0HA 1WQ5A 1OFOA 3EB2A 2ATMA 3N29A 3VI2A 3B8WA 3BURA 4C7GA 3AIRA 3NURA 3OVRA 3UJ2A 4E2BA 3EPOA 4AC1X 3PHAA 4F40A 1E5JA 4IMFA 4LRTA 4OIFA 1TE6A 2VCCA 3VOCA 1F61A 3WFAA 4XQ6A 1D3CA 2ZOXA 3ZM8A 3LHYA 1OK4A 1PX4A 3VYLA 1FWIC 3CLWA 4AD3A 1UA3A 1V0MA 3BW3A 1N8WA 4FEZA 3BL3A 4X3ZA 5EL1A 1XYLA 1P0KA 1X7FA 4K8EA 3OW1A 4XZLX 3BCJA 3RLVA 1QATA 4UTKA 3BMVA 3LRLA 1ZY9A 3L67A 4ACZB 3SFKA 5CC5A 4IOTA 2PBOA 3E1F1 3HZ3A 4B5VA 4AU0A 1B30A 4UQDA 1ISZA 3CPRA 3PULA 1QPRA 4DJDC 3W7JA 2D23A 2OXNA 5G4EA 2OZ3A 3TCSA 1BKSA 1XBXA 1I0DA 3EDJA 4Y2WA 2GVGA 7CGTA 3G5EA 3GY1A 2CPUA 4H83A 4HIBA 6XIMA 4JTKA 3DFPA 3SZ8A 1YNPA 3KRUA 3NXLA 4XZNX 2IKIA 3AROA 3PG8A 1NFGA 2YDSA 3RCNA 2J62A 1ZP3A 3VKCA 3EKGA 3MDUA 4UQBA 5B7ZA 3HPAA 1PPIA 4MUPA 3RIKA 4OJYA 3SADA 4GGHA 1UWQA 3KHDA 1A5SA 4HMDA 3OBKA 2CLOA 2ZZ7A 3MVTA 3ZVHA 2GQ3A 1XF0A 3VCNA 2O0TA 5DEZA 3MSYA 3EDEA 3L5LA 4LBSA 4G7EB 5E0CA 1IIHA 1M03A 4W93A 3LM3A 1SW7A 1W54A 2GGEA 1WKYA 4GE8A 1SFSA 7PTDA 3LCFA 1LROA 1IT7A 5DCBA 3R10A 3HGOA 1NP2A 4PMZA 3UXKA 4GH3A 2CZFA 3LS9A 3T4WA 4I9TA 4M5PA 1F3EA 4AIUA 3WYZA 2WVVB 1GEQA 1UR0A 3TTEA 4O4WA 1CENA 4BCEA 1PZ0A 4TXEA 3R25A 3IIPA 2IUZA 4HTYA 1UR3M 3P8IA 1JF6A 2H9AA 3H4WA 3OZPA 4IZGA 2WCSA 4NJIA 1QI0A 3PUGA 1Q8JA 2HS6A 2X7WA 2BX7A 4IL2A 1EJTC 3AUJA 2XZ7A 4E38A 3NO1A 4O1FA 1YDOA 1NF7A 3O05A 3IK2A 3I7SA 4E8CA 4U28A 3TZNA 1SZRA 4JY9A 1JCYA 2DZWA 2WKGA 1BXBA 5XINA 4D6IA 1S5VA 3C2FA 3CJPA 1TPFA 1E4MM 1XCXA 1QNSA 5BNKA 4KMQA 4C6KA 2Y7FA 2XN0A 4HNNA 3JRKA 4OUEA 1R0MA 2IPFA 4YL2A 4EF8A 1OYAA 2W5FA 1W3TA 3KUMA 3E02A 3C6CA 1US0A 1XH2A 1LOLA 1V7YA 1E6PA 3W1XA 4LNYA 1AFSA 3EA3A 3W1AA 1HVQA 3LXBA 3VNLA 1T8QA 4O53A 4HMNA 4FOJA 3U4FA 3EOEA 1A5NC 2Q6ZA 1J9YA 2NLIA 4QJ1A 1FCVA 3VX0A 4HMEA 5BXPA 1L6SA 4QS5A 1W56A 4AVFA 3VMNA 2H3BA 1JYNA 4DI9A 1MUMA 4W84A 2FQIA 1QR7A 4R53A 3GTNA 1SO3A 3GDKA 3GTHA 5C71A 4I7VA 5LA2A 5EMJA 2A21A 3MZ2A 1J11A 3HMJG 5EMMA 4QXIA 3LENA 4UQ9A 3TQKA 4Z1CA 2DZPA 2X1RA 2E9BA 1VFFA 1W91A 1PX8A 1W3NA 3PAJA 4RDYA 2VFIA 2CBIA 4S38A 2PP3A 4EP8C 4N6FA 3W3OA 3EMQA 3S9ZA 3PS7A 2YW3A 2J78A 3EA1A 3GXMA 1V4YA 1JZ3A 4J3TA 3BLKA 2BVYA 4MKSA 3TX9A 4PUUA 1MW2A 3S4TA 2BNJA 3WDQA 2A3AA 3HBLA 1XRSA 5G4WA 4OTKA 2J47A 1TV3A 4A8RA 3I4KA 2QMJA 4J3UA 4PRTA 2QYGA 4QTGA 1NY1A 3HJEA 1PWMA 2G3NA 1AODA 3BTNA 3R58A 1EFZA 1UP3A 3N2MA 4LB3A 2J25A 4G1KA 4A3QA 1EO5A 1AG1O 3CHVA 2PGFA 1UWIA 4PC8A 5CLWA 1VJZA 4R33A 5E70A 2Y85A 1F6PA 3P6LA 1F8IA 1L8NA 3AXHA 1EJUC 1A3HA 2VM8A 3KL0A 3HFYA 1UIOA 3C2YA 3OVQA 4KEUA 3W4RA 1BWKA 5A8MA 2A79A 1E6QM 4TVUA 1TPDA 4ROQA 3W22A 3VC6A 2FVMA 2V5DA 3O6DA 4JFWA 3R8HA 3DCPA 3PFMA 2NQ5A 1LRQA 3AIEA 1JCNA 4XZ9A 5A6AA 1JGMA 1V0LA 1G67A 4ZFMA 1KO0A 4P8WA 1MXDA 4ERAA 1RA5A 1J0KA 4AEFA 1WDRA 2PDQA 4RXGA 3ABOA 3K4AA 4E8GA 1V3IA 2WSYA 1SMAA 2NQJA 5PTDA 5FEPA 3TW9A 1NARA 3BAWA 3ALGA 4W9TA 2PDPA 1FXPA 5I06A 3DYPA 1G9HA 3S46A 4PUKA 1FWHC 3BG3A 4YYCA 2NXIA 3BW4A 3FX4A 4WJXA 4MHBA 4LVGA 3DECA 3QRHA 2G3IA 1QI3A 3USZA 4AUBA 4Q7BA 3N2XA 4HA4A 3DKJA 2XWEA 5CZKA 1DTUA 4IMAA 4D6FA 4K1WA 3E0FA 5TD4A 4MY8A 4MB1A 4B5NA 1WKFA 3SO7A 3W0KA 5HJYA 1V6UA 2A3EA 1AD4A 1EC9A 1E0VA 1JCLA 1QK2A 2QDDA 4N4QA 1KM4A 4B5WA 3R11A 5FF7A 2V2CA 4TMBA 4A8NA 3U2ZA 4I7WA 1IZJA 4OECA 2Z27A 3GDMA 2VENA 3T1GA 1A3XA 1JJKA 1KLZA 1W0MA 1GKRA 1CXEA 3ABRA 2V69A 3C2OA 3VGBA 4O0KA 4FI4A 4K37A 1EIXA 2QPSA 4K36A 2O4MA 2Q3RA 1TO3A 2HNHA 1KB3A 3NYDA 4M81A 1RQHA 3FEMA 3GXTA 1V77A 3EBVA 5M1TA 1XLKA 3RUBL 1HKIA 3CQIA 4AD0A 2AL2B 1QPOA 2CHRA 1VPXA 2FPVA 1ZSXA 1VGAA 4XIAA 3WEOA 5CZJA 4V1YA 3RITA 1S5WA 4XD3A 3QOKA 2J66A 2NXHA 2PODA 3AUOA 3VOGA 1J0HA 2NQHA 1VPQA 1QO2A 3UETA 5I79A 4BQ3A 3RM4A 4DVOA 4F2UA 2CWXA 3SGUA 1HNYA 1RQBA 4XAZA 4I5RA 4HYWA 2V82A 5EKYA 3FK4A 2Z1BA 5FSDC 3CO8A 5T8GA 5I03A 2WVTA 3N2OA 2BXVA 3WLOA 3GKFA 3PJWA 1VHNA 1I45A 1SPQA 3ARXA 3QZ6A 3GXDA 4KWWA 1FP9A 1GONA 4XK2A 2DIKA 1IXNA 2OEJA 4QNEA 5FOOA 2XYLA 4XKMA 4XZMX 4A8LA 3PVFA 2DUAA 2PLCA 3URAA 4S1FA 1GOOA 2E77A 1B3OA 2MUCA 2PDNA 1FHUA 1WYIA 2WPBA 4CCEA 1GWJA 4A3YA 4Q6JA 2PDBA 1WZLA 2AAMA 3NM3A 3MMDA 3SGZA 3LCWA 4ZMGA 1H7PA 1KC7A 3KRSA 3QGAC 1GVFA 3I3DA 3DN5A 4S3AA 4MB4A 2VRQA 1B3XA 3QY6A 2VEKA 1JI2A 2FDSA 3C52A 4NAFA 1JZ4A 2YZ5A 4QG6A 1DIDA 2E8ZA 3WDJA 1DJWA 1IEXA 2YCEA 4RK8A 4YTUA 3PTDA 1TTPA 4S3DA 3U57A 4Y9MA 5KMYA 2CLPA 4QAIA 3NR0A 4Z2IA 4PYSA 2TSYA 3SBFA 1VCFA 4ML9A 3AYRA 2EEXA 2GWGA 1A5OC 4HZ8A 1MUWA 1LDCA 4CNSA 2VZVA 1E3XA 1QBAA 5DXYA 4UZSA 4P5UA 3W7PA 5A2CA 1J6OA 2YCLB 4F0KA 1W3LA 1UHVA 4N4PA 2E6FA 3MV01 3AJXA 2DQWA 1QFEA 5CPNA 2BB0A 5KTLA 1NU5A 1XFCA 4IIDA 5A2BA 3H70A 5IXEA 1OG6A 1TFVA 1MO0A 5CSUA 3VGHA 3PSWA 3BPWA 3C86A 2OLHA 4JX5A 4YYFA 4AIOA 3W26A 1MEHA 1XH0A 2ISWA 4FZIA 2HK0A 4O10A 1W1VA 3O6YX 4CU7A 1OHLA 3QGKC 1CXHA 3Q65A 1RY8A 1EA9C 2X8RA 2PRHA 5DELA 4JL2A 3CV7A 5ECUA 4S3GA 4W88A 4GZ7A 2ZXAA 2QAPA 3W7NA 2QIIA 2R1PA 2Z1XA 3A47A 4UR7A 1H7OA 3EXRA 1TB3A 1PBGA 3S5ZA 5CGMA 3CIVA 4GI9A 2VMFA 1GQNA 5CXPA 1W3KA 5AC8A 1XIEA 4PCTA 2CEQA 2DV0A 1UH3A 4L1GA 1KFKA 2Y61A 3Q2DA 3WK2A 3DBNA 2FFCA 1S1PA 3WLHA 2R91A 3ANYA 3FVMA 1Y5VA 4V15A 2E28A 2X40A 3W75A 1ISWA 3TTSA 3E3HA 1OFAA 2GDVA 2R1LA 4ZB0A 1FKXA 5REQA 1TX2A 2YPIA 1V3MA 5CZSA 3GUWA 4JY8A 2E7FA 3RFAA 4O1DA 1Z89A 3L21A 1U30A 1EH9A 4Y9OA 3B3DA 3AMDA 3HGRA 3E12A 4CU6A 1WZMA 3NGJA 1SSGA 3GBDA 2OVLA 2PURA 2C1GA 4Y6GA 9XIAA 1OFEA 4IQLA 3G1AA 1SVDA 3IUDA 4QGCA 1FWNA 5D8ZA 3M43A 2WZMA 4J35A 2HPMA 4ZQOA 4ERGA 5CAKA 4A2SA 3UWYA 3APGA 3WY1A 3GM8A 1RLDA 2PS2A 3IACA 3UG3A 2HE5A 2HNEA 2NUYA 2Q3OA 3FJLA 3SB0A 3UJSA 2OWWA 3LXCA 3BCDA 4RCXA 4GYJA 1T41A 3N6HA 5A8OA 1UBPC 3UWVA 3WLTA 3MW7A 4DXVA 4NIRA 1OZMA 1AH3A 3S2NA 1WUFA 4GC4A 3M4HA 1JCMP 1A5CA 1TWIA 4M7TA 1EX1A 3DEQA 4EANA 5TNVA 4CEXC 3I10A 5EGRA 1EO7A 2NVCA 1U83A 4M6UA 3KCLA 3C2EA 4B5TA 2FTPA 2V30A 3PZGA 2R9RA 4O11A 3G3MA 3P14A 4MDOA 1I0BA 2R1KA 3L5MA 3CXOA 3L0NA 1WUEA 1ONRA 2HBVA 4FLRA 4WSJA 1VLIA 2IPJA 3MJMA 4Q7NA 4GUHA 4QJ4B 1P0BA 2TAAA 2NWRA 2O92A 3V0SA 2PEVA 4ZGYA 3EEZA 3USBA 4ZENA 1B3VA 3GDBA 2DJLA 4D6JA 2R94A 2ABBA 3M0ZA 1NOUA 1YRRA 3GE7A 3GHSA 2RDWA 1RPXA 3DH7A 4HN4A 4DUXA 4PTDA 1WKDA 4MWAE 3P62A 2WVSA 4L4OA 3NL2A 1GOKA 4GYPA 3OGRA 4NZ4A 4NX0A 3NYZA 1YDNA 4JCMA 5FCZA 3P81A 1B57A 3CZ8A 1V6TA 3WMLA 3NFUA 2PE4A 4HK7A 1DXEA 1M41A 3SJ3A 3P61A 4GY0A 5CZTA 5C2XA 5E6YA 4O17A 5FJUA 1TKKA 3C8NA 4HPHA 1E55A 2V67A 2J13A 5EFDA 2PDFA 3FLUA 4DXKA 4J4KA 3H24A 3R4IA 2Y8UA 1S2CA 1K4GA 4S3BA 4HD5A 4LVFA 2G3FA 3E38A 2ZYFA 3NPUA 3W07A 1XS2A 3W02A 3QTGA 1LG1A 1KXHA 1QW8A 1MW3A 1RXOB 2AMXA 1Q4WA 4AZCA 1CXLA 5CPOA 4LAMA 1SJDA 4FALA 4DBWA 4GBUA 5LHFA 4DJEA 8A3HA 1VHCA 4I9AA 4QEEA 3HPZA 1BGAA 1TG7A 2Q09A 3CC1A 3DI0A 4IIFA 1TTIA 2W66A 2CZDA 2QS8A 1Q66A 1R9YA 4IG2A 3N1AA 4JNMA 4Z2LA 1UH4A 3RAOA 1RQEA 4HHHA 2OPJA 4JKMA 1PX3A 3EWDA 4CD6A 3NG3A 1PAMA 3LNPA 4IT1A 1YPXA 3N4EA 1ZP4A 2GJPA 1I2NA 3GHRA 1R46A 2JEQA 1HN1A 4WKAA 4H9ZA 4I5XA 5AYXA 1DOSA 4UTHA 3AIQA 4PMNA 2WSKA 3CL8A 2VFGA 3A3HA 3VFCA 4NNCA 3T55A 2DEPA 2QCFA 2XVPA 3OOQA 4C6CA 4DAIA 2DZVA 3MUY1 3BJFA 1BTCA 1ME7A 1BSLA 2ZA2A 5JH2A 1LWJA 1DVJA 1KTBA 2NQ9A 3GHUA 5TF0A 1U1HA 1G4EA 5F2LA 2BMBA 3WQGA 5E5CA 1XDMA 4JN7A 4R27A 3CYJA 4PEKA 5ABHA 1J79A 2VELA 4JTCA 2PI6A 1A4LA 2XSXA 3N4AA 4MIMA 3IJQA 2BVWA 1BWLA 1MW1A 1KQYA 4HZ7A 3M5YA 4IIHA 1OEPA 3FXYA 3UXAA 1QCWA 5EMUA 2QV5A 3N2CA 1LQ2A 2X2YA 2VX6A 3IAQA 1RHCA 1T0OA 3SFWA 3EMZA 3EAUA 4OT7A 2HPIA 1GVOA 3OZMA 3IGUA 3PSVA 3RO6A 2I5GA 3FHAA 1TZ7A 5IBXC 3V35A 1YXYA 4ZXLA 2J7HA 3M16A 4ACZA 4QQ3A 2VDIA 3G0XA 2OX4A 4HGXA 5M17A 4IX0A 3WK3A 3NQ7A 4NF7A 1HT6A 1VLWA 2ZZ1A 2WAGA 4AVNA 3SQSA 3ES8A 2OLAA 5E1QA 2YXGA 2NV2A 1V5XA 1W5OA 3IJDA 5EMKA 2QJMA 3UY7A 3T4CA 2YXXA 1Z41A 2W0UA 3I6RA 1BRLA 4A21A 1WV2A 5AC4A 4LYRA 2E1DA 3LOTA 4DJDD 4LCRA 3W6LA 3HGSA 1W6TA 1FH8A 3G77A 3SAZA 4GISA 4JTHA 1DIOA 3SCVA 1FRBA 3EDFA 1UQYA 3IIZA 1TRDA 4H7CA 2NX3A 2W91A 3ARQA 3THCA 2POTA 2GYIA 4GFIA 4PMQA 5AHNA 1WCGA 2J77A 1QNVA 3LMZA 3CB8A 3M0YA 3WLLA 3VVGA 2X41A 4NX5A 1GOWA 2P10A 1Q6OA 5BMXA 1XSKA 1OX6A 2BY1A 2DW6A 3R12A 4QRNA 2RUSA 2X1SA 4C65A 1LL7A 1Q4NX 3TYBA 4FF7A 1UKOA 2WNWA 4JQAA 1CIUA 1Y5XA 2XINA 4R3UA 2OFJA 2G5WA 5HWJA 4UOZA 2ONEA 5CG0A 4RL3A 1TSIA 1FHVA 3NQ6A 4A2RA 4CD7A 3IIVA 3B8IA 3IGHX 1F8MA 3LNMA 3WUEA 2VFFA 1NH6A 1W5PA 1OWQA 1BGGA 3GVWA 5IFPA 1AD1A 4FA3A 2G8ZA 1EJ7L 2QCCA 3AFBA 1W1TA 4XD4A 1X8FA 2TODA 1VKFA 3HA1A 1NDVA 4RLIA 4OWGA 1E5NA 5A6SA 1ZFJA 3IAPA 1YADA 1GG0A 4Z42C 3CO4A 5I78A 5HJLA 3W7IA 3M5ZA 4DHGA 4D6CA 4HNUA 3NEVA 4ATLA 2ESCA 1BG4A 3MHFA 1K3UA 2Q71A 4H7VA 5AOUA 3R94A 1BYBA 3M0VA 2FVKA 1O60A 3SDOA 3SM0A 3UF9A 1UASA 4EF9A 3IANA 3GXFA 1SO6A 1SQ7A 1I60A 1LLOA 3WDIA 3U8GA 4LYKA 4QLLA 4HT3A 3RMEA 1UWRA 5A95A 1X1OA 1R7AA 4O8AA 2JGYA 1LCOA 4JDYA 3T07A 3EWBX 4AQLA 2WPGA 4FR6A 4AVOA 1P7TA 3WBWA 3AIUA 2XVLA 5C2CA 4JX4A 3LSCA 1D3HA 3WH9A 3VGGA 3O0FA 3PF3A 4UTIA 4TTUA 3TOPA 5GNZA 4GQBA 3L65A 3S9YA 4Q8NA 3R8RA 4TX6A 5DLCA 4I7UA 2PZNA 2GGHA 4G56A 1V02E 2I1OA 4X9YA 2INEA 1REQB 4K1GA 1DWGM 3U48A 4FO4A 1MNZA 3W38A 5CPTA 4IHCA 5KINA 1O1ZA 4HPJA 2PWEA 5G2WA 3ECQA 4J3XA 3S1VA 1VIWA 5DBTA 2R24A 3IGSA 1O68A 3L4UA 1SR9A 4Q7IA 2PDXA 5D9PA 3H7UA 4XWUA 2RDUA 1UW9A 4J7RA 3P60A 1J5SA 1VQTA 2C19A 3K8MA 3ZXWA 1QMLA 3WQPA 3MT1A 4NZFA 4MWAA 1D8WA 4DJFA 4KWVA 3S1WA 2ZC8A 3NZQA 4PTWA 5DCDA 3W2UA 2D0HA 3UJEA 2DZAA 2WANA 2WZHA 1HW6A 3UQNA 1UD2A 2RDTA 4MMWA 5HAOA 1K77A 4HJFA 1PTAA 1EP1A 3T2QA 4KIRA 2WMGA 3DHDA 1TPEA 1Q65A 4DBSA 4B3KA 4HYRA 3NDOA 5LNSA 3W2JA 3H2OA 4FSAA 3EXTA 3UFYA 1CYGA 4LWWA 1FWAC 5HXMA 4LTSA 1WOAA 4KS0A 2GJXB 3GAKA 1QU4A 3RO8A 1FTXA 9RUBA 1KLYA 4ZQNA 1K02A 1UC5A 4QP0A 3ARZA 1XRFA 2J7BA 4C7FA 3ZLGA 3LX9A 2E1WA 2FTWA 4O13A 4UCGA 3ZIZA 4US6A 1E1FA 2A1YA 1GVIA 4QX4A 1ODUA 3UWEA 1E73M 7TAAA 4RZ4A 4ICMA 1AH4A 1XCWA 5HNNA 3KHJA 1N8IA 3TKFA 5CC3A 4XO7A 5H1WA 1ONXA 2HJPA 4GVFA 5AFDA 2P8BA 5D04C 1LBFA 1OCNA 5HQLA 4WDWA 3WH5A 1UR8A 3EX4A 2PA6A 2VFHA 3U7VA 2XFYA 1W2PA 5FAJA 3VMPA 1ISYA 3S2LA 5KZDA 4AYSA 1VFTA 4ZL1A 2DQXA 4FR1A 2EXOA 4ZZ9A 2QCGA 2QJGA 1Q6DA 3DI1A 1Q63A 1SUXA 1ZU8A 2QUVA 3AXXA 3REQB 3WQEA 4C1NA 4DY1A 2CLEA 4JIQA 3MCMA 2EHHA 2J6VA 1LLZA 4AD4A 3ABSA 4GQQA 3FYYA 4PMOA 1PXGA 2QJJA 3M5XA 3STPA 1AVAA 3FV9A 3W2KA 3DENA 4HZMA 1NWTA 1R30A 6REQA 5DO8A 4N02A 3LHZA 2F6KA 3L23A 1V93A 3NA8A 4FNRA 4DYEA 2ZZ4A 1DWJM 1MQRA 1FWWA 5BOEA 1E0TA 5JQ9A 3KBMA 3T6CA 4ZR8A 1V6WA 2VCBA 3H2EA 2P5NA 2FDMA 2HXUA 4GK8A 2DJXA 3SRHA 3UA3A 4LUTA 4V33A 4L9YA 3OO2A 3CT7A 4XD6A 4N0RA 3B4YA 5EU9A 1DKWA 3EWYA 4GJIA 2VJXA 3A4AA 3WNKA 4BQ4A 1Y7VA 4JN8A 2DVTA 3STCA 4REQB 3D3FA 3BC9A 3W7CA 3RLGA 1JZ8A 4RW3A 4C6EA 1OD0A 4LYQA 2D22A 2POZA 1OFPA 3AS1A 2A7NA 2BTMA 3QSRA 4UMCA 2GQAA 3M7SA 2Z00A 3C56A 3UWQA 3TTYA 5TIMA 2WMFA 4JYEA 4U3AA 5JU6A 4M19A 3FHQA 1PIGA 4IQJA 1MFVA 2J74A 4RE2A 2ATSA 1CECA 2NT0A 4LUYA 1XISA 1XIJA 3MHGA 4J40A 1S38A 1IWPA 1DEDA 3POCA 3TFXA 3VABA 3V1HA 4EXAA 2CNCA 2O9RA 1RP9A 1Q6QA 2AOSA 3LPGA 1QHZA 3JZUA 5JXQA 1KFWA 2PTDA 3V5CA 3INPA 3GR7A 3ES7A 4GQRA 3UXIA 4NILA 3CZJA 3G1HA 3CEUA 4FIRA 3SCRA 5CSYA 1JEZA 5LGZA 1YXCA 3O0KA 3QJAA 1I4NA 4MOZA 2ISVA 2F9RA 3MMUA 6ALDA 1O95A 1XYBA 1TV8A 2ZE0A 3W23A 2E8YA 4HNOA 1WB0A 1CLKA 1S5NA 3QMSA 4MFDA 2VYOA 3ABXA 4KWUA 1WZKA 1JPKA 2OSWA 4V1XA 4B5SA 4D6HA 4G8TA 4WOQA 1OCBA 3ERPA 4M3PA 1GOQA 3H23A 4GVHA 2ACSA 5D2XA 3LK6A 3HPSA 2VUYA 3LDVA 3VNZA 2FGLA 3VK5A 1QW7A 3E6EA 4Q4KA 3URQA 3TJLA 3NUKA 3FJ6A 4IQEA 1L6FA 3WDRA 5D9MA 2V2HA 5IHRA 1PZ2A 3NO3A 3B9EA 2OT1A 3FKKA 3SY5A 3A4WA 2DSWA 4HCLA 3HN3A 3EKLA 1T40A 3HG2A 1WDQA 2FZBA 3CWOX 3K2GA 4UOJA 3KRZA 3SUTA 3NO5A 1V7AA 4U3CA 4ACYA 1BG9A 4GQGA 1P5BA 4NG3A 3QQ1A 5LIWX 5K9CA 1ITUA 3BMXA 3MA8A 4DM1A 4HN8A 1E0XA 3EPNA 3TEVA 2CLFA 4LAOA 2GPTA 2QMKA 4L1XA 4GUJA 2NQLA 1XDJA 3EGJA 1I9CB 3U2OA 4R7JA 4WKHA 4QLKA 4GLEA 1U1UA 3V0UA 2VUNA 5GNXA 5FJRA 2J8GA 4MYAA 1HKKA 4AZ5A 4AX6A 2WSRA 1BLIA 4UFHA 5CH9A 1PIIA 1XIHA 5LIYX 1H41A 4GXMA 3DBPA 2RJGA 3TVAA 2BHZA 4IIEA 1RLCL 4IGNA 3W7RA 2QCDB 4O14A 1KFJA 2VC5A 3FYOA 4CQDA 3PTKA 3S2MA 5I7GA 3SCQA 3VNKA 4PMXA 5AC6A 1NAL1 4KCTA 1F2JA 1H62A 2AQVA 2CYGA 4RR4A 4W86A 2X0YA 4PTMA 5HK4A 1HG3A 4JQ2A 2VZTA 4MKVA 1V0NA 4XTIA 1S2TA 2ALRA 4IPLA 2HROA 3O1NA 4TVDA 3RR4A 1GEHA 4S23A 3SUWA 1TWSA 2YL9A 1JNDA 2JGQA 3T2PA 3TW7A 3B40A 2FGBA 1SFTA 3EDDA 4HHMA 4DJEC 3CHFA 1HVXA 1W1ZA 4Y96A 4I8YA 5ABFB 1EBHA 2A4AA 2H8XA 3P74A 2G41A 4X2RA 2V3GA 4UTFA 3L4VA 4MJ4A 4ZO6A 4AXKA 1FHLA 3XISA 4PSPA 3MQTA 1XLMA 3ZO9A 3HQ1A 4ENLA 4MLRA 4XSMA 3FIGA 4N9CA 3JVAA 3OJGA 2PGRA 1F3XA 4I9JA 4QJ3B 1QPNA 1XHGA 4JIIX 3VZXA 4GX9A 3GNNA 5DXXA 3MUZ1 1Y0EA 2BDQA 3WMBA 4UTTC 5CKSA 3BLPX 1W9PA 2E67A 4B2DD 2PLMA 4AF0B 5A94A 1QXLA 2QJIA 1Z9AA 3UWWA 1OZQA 1WAWA 3LPPA 3ABQA 2DSZA 3K5XA 4LU0A 5D2YA 2D0FA 1JNEA 3VC5A 3LI1A 3NIYA 1XGDA 4NSBA 1C8YA 3DG6A 2QEZA 4U4MA 3KBSA 3UWZA 1F73A 3ZVIA 4S3EA 2PSNA 4PMJA 3VA8A 2Z2BA 4Q8QA 4NQ1A 2QPXA 3CS2A 1U2YA 1AJ0A 3ITYA 2C13A 1O5RA 4DF0A 4WSKA 2Z29A 1IXPA 4WDXA 5A6MA 4GZEA 1CWYA 3JUGA 3NJ3A 3BOXA 1MW0A 2E3ZA 2XPKA 3WMSA 2PC8A 2V8ZA 2UWFA 2A2IA 4UQAA 2YBUA 5LA1A 3GXIA 4LOCA 4M1BA 3VIIA 3G22A 4JZ5A 4LQ1A 5DQPA 3GTFA 5CQ1A 4H2CA 3PUDA 4O18A 2OOGA 2Y8VA 5BCAA 4GIEA 1CGTA 2ZRWA 4MZYA 1GVQA 3CAVA 3B0VC 3WD4A 3ZT7A 4ZOAA 1CZ1A 1ADSA 1R3RA 4HU4A 4XZHA 3ARWA 2CWNA 3BOFA 4E6MA 2GSEA 2YCKX 3HF3A 1MUCA 3F5KA 3HQNA 1QO5A 5JVLA 3S5NA 4XUGA 1ZJBA 3WQWA 3GBEA 2VT0A 3N04A 1EQPA 1U22A 4YMZA 5FJIA 3DYMA 3WG6A 1AW5A 3TMLA 3VPLA 4CD5A 1QRQA 3OVGA 3BH4A 3GHTA 2F61A 3MV11 2DH3A 1KM0A 2GJLA 1X97A 2R8WA 2FKPA 3P3BA 1X98A 3CTTA 1NSJA 2P3ZA 3WIJA 4E2OA 1GZ1A 3GW3A 2GLKA 1RK6A 3GSMA 1IWBA 4HOZA 4B2DA 1OX5A 4M8UA 1XWYA 2FH6A 4YVXA 1W32A 3GW0A 3OHIA 3MKVA 3RX3A 4DB7A 1UR4A 3ZLFA 2HVMA 3M7WA 3HMCA 2DIEA 1WZAA 4G1NA 1OFDA 3ARUA 1C3FA 2ZRXA 4BK9A 4Z1YA 3P2VA 4H9YA 2QDGA 3WBYA 4H04A 1KWGA 4GQ0A 1OG0A 1J0ZA 2ZTKA 1WPCA 2D3NA 3BAYA 1E6RA 5C2GA 5BXRA 4QSHA 4AY7A 3QFEA 4Q8VA 3I7QA 1BVZA 4GGBA 1EC7A 3QR3A 4NNBA 1XLFA 5HR6A 3LG3A 4HQVA 1NWUA 2E40A 2VX5A 3M64A 1XJBA 3MKKA 2YB4A 3K4DA 3MP5A 7TIMA 1K8CA 1Q85A 3HQOA 4WVXA 5D02A 1ICQA 1R2TA 3BV7A 3G24A 3WNLA 2X30A 2KX9A 3DKLA 3NXFA 4U33A 1ADDA 1OCJA 1EPXA 2X7VA 2D73A 3PBGA 3KOYA 5I5RA 2CHOA 3VCCA 3UG5A 1GG1A 2VEIA 2H9AB 4LAUA 4HP5A 1V3JA 4JTRA 4QAWA 3RGTA 4GA8A 3BSMA 1KRCC 1TVPA 4BF5A 3W6YA 1ZLPA 1B90A 3NSMA 2J79A 2QGHA 1JZ6A 1EDTA 3S6OA 3KVLA 2FPYA 4H7ZA 4C1LA 1PV8A 1GORA 5U4NA 2AL2A 1E9ZB 1IR1A 2EPHA 4UTUA 3N9RA 3O6AA 5D37A 3G0SA 4CLMA 1AUSL 2GJRA 1WKEA 1JG9A 3GDRA 3B9NA 3JS3A 2WNQA 2I5IA 1H11A 1R2SA 2PDJA 3B8TA 2VOMA 2WNNA 1KXVA 4IFOA 4PB3A 4WEVX 1YDYA 3WF0A 2RDXA 1KFEA 4XZIA 4W4QA 2P88A 1Q6LA 4GIAA 4C1NB 1KGXA 5I3HA 4RNIA 1CI1A 2D3LA 2FZ8A 1DJGA 4GXPA 1KQZA 1YTKA 1ZRQA 4JBRA 4GC3A 1NQKA 5EPDA 1FDZA 2PWUA 2NV1A 1Q6RA 1DJHA 3KLKA 3URNA 1IR2A 1WXJA 4YVPA 3VU2A 1M01A 3RRXA 1XKYA 3W73A 3IJ6A 5KZ6A 1QOXA 3MJYA 1DIKA 1XGEA 3VIPA 2DZTA 3K1DA 1M9HA 5HUPA 4FOKA 3QLDA 2ZRVA 1KFLA 3NL5A 3TIMA 4GNJA 4FMVA 2OLSA 1B4KA 1DWAM 1VBGA 1OVDA 1RBAA 4OFCA 3WQDA 1DQXA 4AAJA 2G3MA 4DIAA 5DANA 3CZGA 1OC6A 2WMHA 2ZADA 3KM8A 4MB5A 1PL9A 2C18A 2ZX6A 3WLSA 3TONA 2QF7A 4AZBA 1ZBWA 4GINA 1XC4A 2WC3A 1XR2A 4IGMA 3K13A 3VNJA 4UMAA 2Q8ZA 2J7DA 3KDOA 2JKEA 5CBIA 3W1LA 1F74A 3LTSA 1CPUA 1UYQA 3ZR5A 1A0CA 4UFKA 5FEWA 4IP5A 4GIRA 4D8LA 3NCOA 4RV8A 1H7WA 5HWNA 3RM9A 1TJRA 1JYVA 1NWRA 3PZOA 5K9XA 1U1JA 4B5UA 3YPIA 1RJRA 1EWEA 1CNVA 3N15A 1Q13A 5FA5A 3D5HA 3CYVA 1OC7A 4P7RA 1EQCA 3CBWA 2E6DA 4K8HA 1ZHAA 4UFIA 4S3KA 1I1WA 4CEUC 2VEGA 2XGIA 1EA0A 2WWCA 5KEZA 2QCHA 3ZR6A 2PFHA 3SRFA 4GNKB 1E0UA 1VB9A 3F4DA 5A1AA 3IK4A 1S46A 1JDEA 3WO8A 3IJ8A 4A35A 4OGZA 4YCOA 2Z7GA 3AMCA 3R1ZA 1KA9F 4JYFA 4ZOEA 2WMKA 1YXDA 3BXWA 1XQLA 3A4JA 3WJZA 4MNJA 2GOKA 1NELA 1SJAA 2BOFX 3GH7A 3RDKA 1YPFA 4KWSA 1GJPA 1O12A 4IH3A 4DPQA 4WY0B 4GO9A 4LXFA 4NP7A 5A6JA 3TDFA 2BODX 3T0TA 3UR8A 5CGTA 3AALA 4G7EA 3V36A 3QPYA 3QMTA 3THQA 4E4FA 2X1IA 3UPMA 2QCEA 4PSRA 7REQA 1XG3A 3HPXA 8XIMA 2DU2A 2E09A 3TUUA 3SUUA 2NWSA 4BY3A 8XIAA 3AIBA 4RNHA 3QSTA 5CPQA 5A5WA 1I75A 1PCKA 2DUXA 2QPUA 1D3GA 2RKXA 4QG9A 3QBUA 2ZXQA 3SN1A 2A3CA 3IGXA 4AHPA 3R13A 3VDBA 3OG2A 1DXFA 3ELFA 1V6YA 4ZXOA 4E4PA 2XIQA 4TQTA 3DIPA 1MQPA 1OJXA 2VWSA 3KTSA 5I09A 3GO2A 1XH1A 4B5XA 1GK8A 4LRSA 4YTTA 2QKFA 3AZSA 4R9XA 3NPWA 3OIXA 3PN8A 3MUXA 3VKKA 4YTQA 4Q33A 3SY8A 5EFFA 4QQUA 3W37A 1P6BA 1QASA 4ZQMA 3STGA 3UNDA 1M7JA 4BFAA 3L2LA 4QCEA 1VZWA 3CUXA 3CQHA 4XUYA 3M47A 1Z48A 2Y4SA 1XYCA 4HNTA 4G7FA 3VILA 3DU0A 5EBUA 4H8NA 4ATDA 3VTRA 3DOPA 2G50A 4H9UA 4LT9A 4AFYA 1GHSA 1ZAIA 1GJWA 2CW6A 3D3AA 1QK0A 2EG8A 4KIEA 1W5MA 3OGVA 3WQ4A 3A22A 4HVXA 3GX9A 2HS8A 4EKJA 4I5UA 2D2OA 4UC5A 3TU9A 4AD1A 3BLLA 2ZCGA 1H7NA 3C5QA 2Z26A 3P67A 3ZMRA 4Q8OA 5AYZA 2VP8A 1YDVA 4GPNA 2ACUA 4JKKA 1H3GA 1IYXA 1YE4A 2A3LA 4LY8A 3N11A 3WJYA 3GR8A 1JPIA 1K8XA 1FWEC 2PWHA 3DHFA 4MJZA 2JKAA 4J5NA 4CVWA 1O66A 1AH0A 2WKJA 1UP2A 1VYPX 3QF0A 1KBBA 2HK1A 3C0LA 2E0PA 3NQEA 1UB3A 1E51A 1R5YA 1KD0A 5IDIA 1XYFA 1RALA 5F1VA 4P61A 4WRHA 4DF1A 4YVVA 4L6HA 5CPSA 4LUJA 4JQ1A 5JBFA 1OX4A 4JR5A 1ITXA 5G1YA 2ZTJA 1OM0A 5BXTA 1KBIA 4KF1A 4I3GA 3H2FA 2DZXA 4P7NA 1XV8A 3HJZA 4F79A 1BKHA 3AQUA 2NW0A 4MJ2A 1O5XA 2ISDA 3UNTA 4NAEA 4XISA 5LXEA 1MYRA 5ABTA 3WJSA 3STFA 1TCMA 4FHAA 6REQB 4CQAA 2ALDA 2PDCA 3BSHA 3W7LA 2UY5A 2YFOA 1RVGA 2PWVA 4XZWA 5F2MA 1KR1A 1JD7A 4ES4A 4KGLA 1MWOA 4XBSA 2BVTA 3GWQA 4MZ1A 2CXGA 5F4WA 4DJFD 3W1RA 3WNMA 2F38A 1BEUA 3PNUA 1DV7A 4YCPA 4Z1BA 3TSMA 3UZ5A 3ZWTA 4FLOA 4PODA 3SEPA 5BYWA 1IWAA 1C7TA 2PDKA 1K8ZA 5DMMA 3DYOA 4JTGA 4H9MA 4Q4PA 2DVUA 3ONCA 1SJCA 2F84A 2OYMA 3C8FA 4UB9A 2V81A 3W28A 4E8DA 1Q6EA 1FWSA 1JQVA 1JCXA 2XVNA 3BG5A 3IJ9A 3TN6A 3BZJA 1QOQA 4OU1A 1C8VA 1VRXA 2INFA 1T5AA 2HSAA 1VYRA 3REQA 4C6QA 3I6TA 3ARRA 3SUSA 3T8QA 1TJ0A 2WM0A 1TVNA 4JXCA 3ANUA 5I3FA 4LBRA 4ZO9A 4M1RA 3E0LA 4F48A 1K7XA 4IFRA 3IPWA 3ZT6A 1NIUA 1JAKA 2IPWA 2G37A 3ZVHB 4MGGA 3GXNA 2J7EA 2CITA 3II1A 2KZHA 3MC5A 4WZHA 1LRNA 1X1ZA 3LU2A 3CUGA 1PEZA 4GY7A 4NYUA 5H2ZA 4POCA 3RCMA 4F66A 4P8XA 4BS0A 1ADOA 3LQGA 3CU2A 2HMCA 4LCQA 2PDMA 3LYEA 2CZVA 4XKYA 3NQFA 1Q2SA 3NVDA 3EMCA 4D6GA 2CESA 1K8YA 1B9ZA 3RMJA 4O54A 2YA2A 1FCUA 1A5AA 2TYSA 1LBLA 5ABFA 5CBBA 4ECLA 3MPGA 3KVMA 4K38A 4N2YA 1IZKA 1TWZA 2W6RA 1WP6A 2FMOA 3GNOA 5D09A 4C6BA 4BHYA 1R8LA 1AQ0A 1B9BA 2H8ZA 4QSFA 4MNMA 2WZEA 1XIIA 4GVGA 3TN4A 1S2VA 1M53A 2WLYA 1WDDA 3KAOA 3CPGA 4KH2A 1ESWA 3E5PA 3W70A 3A21A 3ZYZA 2PDLA 5MKGB 3TN3A 3PFRA 3AMKA 1XLDA 4XB3A 1DHPA 4MB3A 3EXSA 4A05A 5CC7A 1K6AA 2PTXA 3UESA 1R86A 3V5FA 2Y7GA 4HSOA 4WXYA 1A80A 2OEMA 1XXXA 3N3TA 3UJRA 3QZEA 4K7YA 1RAKA 2C0HA 5K2ZA 2YCJA 3MS8A 4HSHA 2WHJA 5GJPA 3W7HA 4LBUA 1RV8A 2B4GA 5DY3A 1W2VA 2PTYA 4UUIA 5CCZA 1B0IA 3B03A 2YL6A 3GS6A 5DMYA 3PTQA 2Z1WA 1FBAA 3W88A 5I3GA 3ZJ8A 1DQWA 4JTJA 4LH8A 1GZJA 2VVSA 3U0HA 3A5FA 3TAOA 4BI5A 4L80A 1QW9A 2X0SA 6CGTA 3B8VA 5AHFA 3WSUA 4WKFA 4URIA 1SZEA 2WHMA 1DE6A 3FVDA 5IRPA 3WD0A 1KM2A 4JCLA 1H09A 1IV8A 4RE3A 4RDWA 1REQA 4K6AA 4ZFCA 2V6AA 3UG8A 4Z0SA 1CT5A 4UTMA 2ZRYA 2OR2A 3HV8A 3ZZ1A 3MANA 3UWUA 2PF0A 4JTUA 1UKSA 4LGXA 2E25A 1XBVA 5AHEA 3DFNA 1Z8AA 3CH0A 1FFRA 5D9OA 3VIHA 3ZWSA 4UCFA 1E9YB 2Y8KA 4OBRA 1OF6A 2GSJA 3G3DA 3IUIA 4BWLA 4FB7A 1UROA 3W7QA 4E2DA 2V63A 4AZIA 4L4LA 1DXIA 5D32A 1ECEA 1VS1A 1RH9A 3B0XA 3GXPA 4X0VA 1FUYA 1Y5WA 4IICA 1OCQA 4ML4A 1HJQA 2GK1A 1IZCA 1CW2A 3RJYA 2OEKA 3GNXA 5HMDA 4O15A 3IVTA 3WNPA 3ATZA 4DO6A 3DC8A 2R14A 3SURA 2J7GA 1HP5A 3ARPA 4LALA 1SMDA 2GVLA 5H6HA 4UFJA 3RM8A 1T7LA 5CAHA 2NX9A 2PLJA 4O52A 2GWNA 2R1MA 1KTNA 4AMCA 4CQ9A 3QV7A 1TYGA 3THUA 2VD8A 4DZ5A 1JR1A 1NFPA 1CXIA 1JYWA 4QFUA 4W7VA 1ZAJA 1J0YA 2JF7A 5BROA 1QJWA 1X1NA 3G1YA 1LYXA 1AZ2A 4MWAC 3AU6A 3BLEA 1CGYA 5LIXX 3M46A 3B0UX 2ABAA 4KESA 2NXGA 5HMEA 3VKAA 1IQ8A 1HTIA 1PWLA 2AQWA 1QHOA 1UWUA 1XKJA 4JFVA 5IDZA 1HXJA 3W7GA 3QV8A 1FWTA 4Y7EA 1LL6A 4J2PA 2P0IA 5CSRA 1SZFA 4QE5A 3POHA 3BK0A 5FJTA 5A6TC 1W37A 3GFXA 4Q4QA 2OCZA 3QMRA 3MZNA 2BOEX 2WMIA 1EPVA 3GLCA 4HNLA 4TX8A 3KS5A 3IIOA 4KKXA 4KETA 1H5VA 3GNRA 5BRPA 4N7QA 3ONBA 4RJEA 4OQVA 4E0CA 1EDGA 1KBJA 3TLLA 3V5OA 3OZOA 4FPSA 2GQ8A 3I7RA 2QCMA 3HTWA 3BCFA 3UYCA 4B9YA 3AMGA 4RDZA 2GDQA 3DGRA 2C3ZA 5F2IA 1SGJA 3E74A 1X96A 4DX3A 1B5TA 2ZXBA 4EPDC 2JKPA 3V0TA 1HF6A 3BG9A 1XIGA 4X61A 1QNQA 2FHCA 3MCNA 3WD1A 3F4NA 1XUZA 2XWDA 1NF0A 1A5BA 4YTRA 1OT1A 1ONEA 1JDCA 3A3WA 3T0CA 3PWAA 5FESA 4EPBC 4D8ZA 3TN5A 5EBAA 2CBJA 2VZSA 3S5OA 3KWXA 2OX1A 4IF2A 1EP2A 2TRSA 3EWUA 2V9DA 5HA7A 3LI0A 3SQMA 4AW7A 5HNTA 1JDFA 3SSJA 4PFHA 4BR1A 4XVDA 3LV5A 3AYSA 5HPOA 1IT8A 3VD7A 1W5QA 3UZXA 5BXSA 2Q01A 3FXGA 4DO4A 4K3ZA 4F9DA 3WH7A 4ZODA 4UQCA 2P1FA 4WX2A 3IS4A 1Q5MA 2REQB 3OZYA 4GVIA 3T81A 1YW1A 1V0KA 3B9OA 1V03A 3AJ7A 2X05A 1SO5A 3MO7A 2VGGA 3EA2A 1H1ZA 2XZ9A 4DQWA 1EBGA 2A85A 1J18A 1MVYA 4KCWA 4L56A 4PCSA 1L6WA 3TTOA 3B8UA 4QEHA 1FWDC 4JDBA 1H2JA 2DP3A 3G1VA 1GQJA 1YKWA 5JUVA 3WJWA 4M51A 4ZQPA 4IL0A 5LSMA 1FCQA 1HJUA 1I2QA 1TTJA 9CGTA 2BY0A 4TV6A 1WXYA 3WBXA 5C5YA 2NV9A 1ZJIA 1PYFA 5F2GA 1KXTA 1HKMA 4V2XA 4PB4A 1FOBA 3W7DA 2J9YA 3PPCA 3W27A 2PAJA 3S0CA 3DFYA 3QHNA 2VURA 3GB6A 4CNNA 3V4BA 4H8HA 4JNZA 1XGZA 2PDIA 3UGVA 3WQ8A 1TV2A 3L9CA 3AXKA 4IPJA 3OB8A 2D2JA 4JTAA 2CFFA 2DFAA 1NEYA 3TNBA 3E2QA 1ZB5A 4H3DA 4Y90A 5LHEA 2W27A 3CK5A 2ZX7A 5FI8A 5H91A 1B31A 2WQPA 3CZEA 2J88A 4GZJA 3MBFA 4OZOA 3BGAA 5E0KA 3BMWA 3AI0A 2D0GA 2Y5EA 4EAYA 1K9TA 5HANA 2PBGA 1H61A 2J9XA 1US2A 2ZX5A 1HX0A 3FA5A 4JYDA 5KZMA 3S8HA 2WV8A 1VAHA 3R0UA 1P0DA 4BI7A 1L6GA 4E5TA 4FOUA 1XCFA 2HRWA 3NQBA 3B04A 4GI4A 3MO4A 4MADA 1E4IA 1S5TA 1DJQA 2HEJA 2PLKA 2YB1A 4MAZA 5AVHA 2DZBA 2V3DA 1Q8AA 1DE5A 3VOJA 2BS9A 4QCFA 1EJVC 1JZ5A 1LUCA 5C70A 3WEZA 1ZZMA 4B91A 1W9DM 1OABA 5KETA 2PWDA 2BSLA 1DWIM 1XPYA 3LQLA 3GU1A 1TJ1A 4NNAA 3QW3A 1Q6GA 5A69A 1UQZA 2Y62A 2XVKA 5BU9A 3K8KA 1GW1A 4JTIA 3NL3A 4EK7A 4DZHA 4DBEA 1H4PA 1M7PA 2D2GA 5H8MA 1OINA 3W7EA 5I0DA 1U5JA 3W24A 4XAPA 1LBMA 1FFQA 3ITTA 4FNPA 4GUGA 1A0DA 4KRTA 3MYPA 4R7WA 2ZVIA 3RLUA 2J7FA 3Q45A 3NQ8A 1UKQA 4DN1A 5DN1A 3C2RA 1FQ0A 3T0AA 1NDWA 4Q6XA 3WMCA 1QUMA 3LGGA 3A64A 2PZ0A 4O4VA 1ZS2A 3CAKA 1W9BM 2AGKA 1V79A 4O50A 1ONWA 3ZJ6A 2OO6A 4C90A 1WDWA 3S2CA 1W3HA 4IFKB 5A6KA 4FNQA 5AHIA 4U5IA 3MSGA 2Z0IA 4DBUA 4QG8A 1TPC1 3VIFA 1SFLA 4C5ZA 1ZTVA 4TVCA 4JX6A 4AD5A 2VRKA 1ODZA 1XRVA 4RPQA 1TWDA 4NZ3A 3MBDA 1E71M 4JGDA 4W87A 1A4MA 2WZIA 3IRSA 2IXVA 3FA3A 1GVYA 1J6PA 4ZTXA 5EMLA 3WNNA 1JPHA 5D8WA 3XIMA 3L66A 4QNWA 3RHGA 3GQYA 3TJIA 1R2RA 1M7XA 3UXLA 1P0EA 4IMGA 1KM3A 1EGMA 4DUVA 2UBPC 5K9DA 4O12A 2IKGA 1UZ4A 3QQWA 2UY4A 1JZ7A 2FZNA 1ME8A 4W5UA 1HKVA 4CNUA 2E9MA 2YIHA 1CEOA 3DDMA 2ADAA 1UC4A 4B3LA 2WCGA 4O28A 5FJPA 3EPMA 1NOWA 4LW7A 3WF1A 2NUXA 4PUEA 4PUMA 1QTWA 5DMNA 1HL2A 1KRBC 2V3EA 3I3BA 1ICSA 3UZYA 1KFCA 3PM6A 4S3JA 1RPKA 2J75A 1GCYA 2PU1A 3C3NA 2WJDA 5LIUX 3GTXA 2Y88A 2NQZA 5ABGA 3W6MA 4XTDA 1Q7QA 5FIPA 1B3ZA 1P7TB 3WEMA 4X9SA 2G3JA 4ATWA 1CTNA 3A23A 4CD4A 4YTSA 2NZLA 3PC0A 1MEWA 3V1PA 5EYWA 1XFBA 2GZXA 4DYKA 4FNUA 1HL8A 4CUCA 3B06A 1V8EA 5F7UA 1RP8A 3W87A 3CHCA 2YZRA 2BGSA 3GG8A 4MY9A 3A4XA 3A9IA 4WDUA 3O15A 2HZGA 2V68A 4OOUA 2NLYA 4L61A 4UTTA 3VFLA 2DSKA 3HURA 4J28A 2QCDA 1XIFA 2OZTA 1QNPA 2ZX9A 2F8QA 3MUIA 2GL5A 2B31A 2E5BA 1BFNA 3H2AA 3EX3A 1YTDA 4EX4A 2YYTA 3LLXA 2OQLA 1I8JA 4FX8A 3NM1A 2XGZA 5JBEA 3IIXA 2Y70A 1B3WA 1F9CA 2PTZA 3R0DA 2BWGA 1UZ1A 1VD6A 3T40A 2GDUA 3DAQA 3CT2A 3HGJA 1JFXA 2JBMA 3T05A 2YDAA 2O7SA 1KBLA 3PG9A 2OWXA 3PTMA 2VDGA 5D05A 1NDYA 3QV6A 2KAUC 3UCDA 2XSAA 3CGTA 3MI2A 4Z17A 3GR4A 4QE1A 1GQKA 3TFCA 3FDGA 4XIMA 2WVVA 1NTHA 3WQ5A 2VZUA 3EYPA 2VDHA 2QLYA 4HPGA 3VUSA 1A53A 1P4CA 4LAKA 2YCLA 4N6EA 1SR0A 2EG7A 1Z7AA 5AZ1A 4FXFA 4X22A 1DIEA 4F2BA 4WF7A 1YTEA 5DCEA 3GYCA 3K8LA 4B4HA 1EJXC 1EGVA 1XG4A 3FW6A 4Y8FA 4AEOA 5K4ZA 1LOSA 1Q7MA 3BOLA 2Q02A 2FJKA 2GSHA 3QTPA 1GYMA 3R2GA 2YBVA 1OYBA 3UCCA 2X0HA 5FEZA 1JPDX 3LGDA 4L1WA 3OQ8A 1UKPA 1FWGC 1J5TA 4F4RA 5FD0A 3TTQA 3OLGA 2EF9A 1TE1A 1O4UA 3F5LA 4CQ8A 2FJUB 5E9XA 2AKMA 3WBEA 3H21A 3V75A 1XYAA 4LX4A 1H1YA 1MZHA 4E3TA 3WLRA 3PPFA 2CERA 1XD1A 1UOKA 1IEWA 2XIOA 3ICJA 4GACA 3LEPA 3EOSA 3NL6A 4G6CA 1XLAA 2ZWYA 2WLZA 1LLWA 3GC4A 2W3ZA 1N55A 4AZHA 2P50A 4R88A 3NQAA 1BHGA 4JHOA 2XIJA 8CGTA 4F9JA 5DBUA 3PK7A 4BF7A 4Z1DA 1MZRA 4B92A 1TQXA 3P7YA 1KCZA 2YJQA 1U5VA 2F7FA 1G1YA 2B7OA 4RKAA 5LZLA 1UD8A 3GVRA 4WQ6A 4KFOA 3GH4A 4M80A 4CN6A 3PZQA 4NJKA 3H54A 4AWSA 4GNVA 5H8PA 4IMEA 4UNLA 1TA3B 1BYCA 4FNSA 3E2VA 1W5NA 1VEOA 3PBYA 3QZAA 4GH1A 1TPB1 1E6XM 3N4FA 4GI6A 4Z2KA 3E2RA 2BASA 4N42A 3CZLA 3M41A 2ZWZA 2ZFAA 4CCCA 4NZCA 3TR9A 4LAZA 3IJ7A 5F1UA 1MMFA 7ENLA 1E70M 3HV9A 3CWNA 2VRJA 1T6MA 3ZT5A 4IISA 1YHTA 3SCSA 2QDHA 2Z1VA 3K46A 1VRDA 2VOTA 1W1A1 3TSBA 2QHAA 2RAGA 2OT0A 3UYIA 3W7KA 5AN7A 3RU6A 4NY2A 1XRTA 1P1XA 3PNZA 3TV8A 3S3GA 5JIPA 1JI1A 2OYKA 3TYDA 4AMAA 3N25A 4C6LA 1D2KA 4LV9A 4ORIA 3UJFA 1GOXA 1JUEA 3GG7A 3GIYA 2XIMA 1JPMA 2CBUA 2DORA 3VOHA 5B80A 3MWCA 3HFTA 4NJGA 1BSIA 3P0XA 1GVEA 1FWRA 2AKZA 2YX0A 3AS2A 1X6LA 1M3UA 2WMIB 1QWGA 1XDLA 4JPGA 3NQMA 4IM4A 3KE0A 3W1QA 4QR6A 3LZ5A 4XO6A 3QFWA 3BLIA 3FJ4A 2G97A 4DYJA 4ALDA 1AJ2A 2FZ9A 4QIUA 3UVIA 1YX1A 4AD2A 5A8GA 3KLLA 2QV4A 3O2LA 2JIEA 1E15A 1TREA 3PZNA 4DO7A 4H01A 1ITCA 1KM5A 3ANVA 1BTMA 2GQ9A 2C15A 1JRCA 2FHBA 3PR2A 3RLHA 2FPTA 1CCWB 5CEWA 1GT8A 5LKYA 5FF0A 5D38A 1LP6A 4PBEA 3FGCA 3NSNA 4AYGA 3N9SA 2Y0FA 2BP1A 1VFLA 3O6CA 3PJUA 4O1CA 1RZMA 4W8AA 2ACQA 3PZTA 4F0LA 4XBJA 1T96A 2OB3A 4O1AA 3VO0A 1DHKA 2GJNA 1MDRA 3BAKA 3LZ3A 2WVUA 3CUJA 2I56A 2VEMA 1CGVA 2I9EA 1UMYA 1E0WA 3C2VA 4QROA 3AXMA 4IX2A 4JTSA 4L9ZA 5G1MA 3EKZA 1K4HA 4JIPA 2XH4A 4JL1A 3CASA 4JFUA 2ZBTA 2AAAA 2CBVA 2ODOA 3WLPA 1P1MA 1A50A 3L0GA 1YEYA 4I90A 3GIPA 3N2BA 3SR7A 1S5MA 4CN1A 4AWTA 1K7EA 4NJJA 3KBVA 2TMDA 2E68A 1DBTA 2PGEA 3GNDA 3WN6A 1KKRA 4M56A 5AB3A 3W72A 2IQDA 3VD4A 4A29A 4Q22A 4AZCB 5GQBA 1XYMA 3WUBA 2QF8A 1SO4A 2CXEA 3AHTA 3MMTA 3LBOA 3WDPP 4DNHA 3PBWA 2G96A 5C9XA 3KZSA 3QM3A 1P43A 1EYWA 4H1ZA 4FIQA 2X2GA 3ZQ9A 1R6WA 2P3EA 1K70A 4EE9A 2VC7A 4KFNA 3ZSTA 3OA3A 1B2YA 4DPPA 1HP4A 2IPGA 3N12A 4M29A 3P80A 5SWUA 5CLTA 1DL3A 4BZYA 2OU4A 2C16A 3PBUA 3CQKA 1ZBCA 4JICA 4JN6A 1J2BA 3KOWA 3QVQA 4Y8EA 3U6WA 4HU0A 2Z6JA 1ENUA 3RX2A 1H0GA 1W17A 3LHUA 4WK9A 3DFQA 1Z42A 4JKLA 3WQFA 1UR9A 4OV4A 4ZE4A 4Q4SA 3PANA 2O56A 4AHQA 1YLVA 3NZRA 4L6OA 1EHAA 4BEUA 4PR4A 5HOSA 4FS9A 2X1TA 4TUFA 2XN1A 2Y7EA 4DWDA 5IBXA 2WW5A 3ITLA 4Y9NA 4TX9A 4PL1A 1OFRA 4F3HA 4WGXA 4GKTA 2V5JA 1POJA 1R85A 4I9MA 2D2HA 4AG0A 3BO9A 3QPZA 2MANA 2O7QA 1OK6A 4QLJA 4O19A 3GAYA 3O63A 3P8JA 4J9JA 3MKCA 4UNKA 1UUQA 3G6LA 1PS9A 1JDAA 4DLMA 2CU0A 3TYEA 2BV9A 3GIQA 1UPMB 2ZZ2A 1W3IA 3W1UA 2CC0A 1OY0A 1EGZA 2YYUA 4PZVA 4P7LA 4PE8A 3DUGA 4DAFA 1HFBA 5E9AA 5GVJA 4IMDA 3AC0A 5JH1A 3LUTA 3A9BA 3EX6A 4EXQA 4GFSA 2NT1A 3PUEA 2WC4A 2IKJA 3LHWA 3H6OA 2FIQA 3QYQA 5LGXA 2Y2WA 2H90A 1JXJA 4ZCWA 2DT1A 3ZLHA 3DFSA 4WY0A 4US5D 2CLIA 2UV8G 3GRIA 2GVYA 2JALA 5BWFA 3UZWA 6XIAA 1S2AA 4Z08A 2IQ0A 1TV4A 3SCUA 4PFMA 1WE5A 1SU5A 2QZRA 2WZTA 3HG5A 4LVAA 5LNUA 3E2SA 4WLCA 3XINA 2XFRA 4C60A 4YU1A 2WHKA 5T26A 3RPMA 1DP0A 1CB2A 2EGZA 4LV4A 3UZZA 2VC6A 1SM9A 1UZHA 1XLHA 3KL5A 1EXBA 3VDGA 4HBKA 3VZYA 3KBNA 1CBGA 3TMQA 1GQLA 2OGYA 3SN4A 3KBJA 4ZSTA 3EWZA 3GKAA 3R5EA 3S47A 4WY0F 3CUHA 3T8LA 1MXGA 2C8NA 2Z25A 2WK2A 4S39A 1KXQA 3LTYA 3RPDA 3KDNA 3M6DA 4FF5A 4L5ZA 3WELA 1JXKA 3V18A 4UMBA 4MPKA 3VKBA 3TROA 1YYAA 1VFOA 3BLOA 3QOMA 2ZVRA 3PZMA 3WUFA 3MY9A 4UTJA 4W8LA 3T0BA 1B1YA 4C6FA 2J8FA 2VGBA 2CHNA 3GG1A 4O57A 6ENLA 4UTLA 4P8VA 2REQA 4GD0A 4LC8A 4B16A 1LWHA 4IJBA 1M1BA 4LFYA 5LNVA 3B4UA 4HJWA 4B4FA 3MU7A 1BWVA 3F4VA 1UMLA 1SZGA 4MVAA 3APYA 4FXRA 4AY1A 2A7PA 5HUOA 4WOZA 2ISSA 3RNDA 5DX7A 4AF0A 5JBDA 4LEFA 1TV5A 2F2KA 4F2TA 2JK2A 3BUVA 4MNKA 2VNCA 1VFUA 4LVDA 5HNRA 2VEPA 3W2LA 5BRBA 3MSRA 1GW9A 3LHTA 3HIJA 2BLEA 3S1XA 3AHZA 3KTXA 1PO9A 2H6RA 3PBMA 2PCEA 3N3MA 3OP2A 2XISA 3LB0A 3IV3A 4D71A 1QI2A 1TPH1 1MEIA 3RG6A 1OQFA 2EO7A 4ONVA 4A3RA 5HJXA 4RNJA 3MVIA 3WBAA 3MTWA 1GPWA 2GGIA 1VC4A 1J0IA 2QJNA 3GC2A 2OZ0A 1I6NA 3DZ1A 4GJ1A 1OX4B 2PRMA 5IM51 4M24A 1VEPA 2VQTA 1IF2A 2NSOA 3UERA 1BXCA 2PDGA 1UUMA 1G4PA 2G0WA 5C9WA 2HTMA 1V3KA 7A3HA 3M0IA 3A5VA 3M0KA 2ZDRA 3HM7A 3G1RA 2Y89A 3B97A 3HG3A 2ZIDA 2XM1A 4DBDA 1G69A 5FAGA 4PULA 4HNCA 4AZGA 1BD0A 4QS6A 5MHBA 1SW0A 3C0JA 3R79A 4DJDA 1AW2A 1KGUA 3RU8X 3G18A 4LS1A 3FKRA 4GY1A 3OG3A 4LB4A 2XGBA 1BQGA 3W81A 1YE6A 4NZ5A 3TAKA 3RN6A 4XX6A 1OB0A 2QW5A 3EZ4A 4XVEA 1TIMA 3NZ1A 4S2BA 2CZ5A 4Y9PA 1CGUA 1J12A 4AISA 3O06A 2BY3A 3SGGA 1H63A 3CL7A 3D0CA 2BBFA 4FXSA 4AWEA 1FDJA 2QQ6A 1QWKA 1HUVA 1X8CA 4DNMA 2A7RA 3VNMA 1JYXA 3WLIA 3RYSA 1C91A 2I16A 5A6BD 5FACA 1YBQB 4HPNA 3R89A 3RK8A 3NPVA 1Q6CA 4UQEA 2C6QA 1GNXA 1C8QA 1Q6FA 3VMOA 1GOIA 1RUSA 3OGSA 3LM7A 5CJ5A 1CXFA 1M7OA 2ISFA 4WXZA 2ZA3A 3KVJA 1G6CA 4BI6A 3H7RA 3DC0A 4KFPA 1HQTA 1AA1B 3CUFA 3WD2A 1L6YA 1FWJC 1FH7A 6TAAA 4EAMA 3P0WA 2ZKMX 3KZPA 2VXNA 3TWAA 4D72A 4GYPC 1A5MC 3FEQA 2QIWA 5LIKX 4GBDA 1W1YA 1K1DA 5I3KA 1TA3A 3BSGA 2IW0A 2OG9A 1Q3NA 3THAA 3VNDA 3EEGA 1EL3A 5GNYA 2MNRA 2XIIA 4JIEA 3CL6A 4RPPA 4LF1A 3W71A 4F0RA 3AS3A 1F76A 1EEXA 3VIMA 2EQDA 1K7FA 4JQ4A 4WCJA 3BV4A 3ITXA 3VIKA 1DQUA 5DY2A 3BAXA 2AGTA 3ITCA 3E0IA 1Q2RA 5C7HA 5KZEA 1L0PA 2C7FA 1M6JA 3SCOA 1I1XA 2WXDM 5FEXA 3W25A 1GYNA 2D24A 2OJPA 1WAUA 5AECA 2ZZ6A 3C3UA 1KCLA 3LLDA 1JF5A 1GYLA 1IXOA 4AZ7A 4JS3A 3UG4A 4ASTA 3AHVA 1KFBA 1U33A 3P84A 1M65A 2ZUUA 2BGNE 3GTIA 1NFBA 3QXBA 3GC5A 2HE8A 5M2FX 2Z2AA 4KERA 4BQ5A 1NOFA 2IS7A 4CCDA 3SCPA 3H4XA 2FZMA 2VCAA 3LD5A 1J10A 4HYVA 1NWSA 4MSSA 3HOJA 4QISA 5LA0A 2WB5A 4AHOA 4IGSA 2YLAA 3L2MA 3CMFA 3N14A 3TYAA 3F1QA 1KCXA 1F6KA 1VH7A 1A47A 1L9WA 3F2CA 2J8TA 1RJQA 4YXGA 1TMQA 3UY8A 1VCVA 1LQAA 2X42A 3WL0A 2ZC1A 2FLIA 3ITOA 2W62A 2Z1KA 1WBHA 2VFEA 4XV0A 3TYZA 1WX0A 4H8VA 3UPWA 4A22A 2J6XA 2O55A 3V3WA 4ILSA 4X2PA 4LC6A 2DZSA 3BVJA 5HNUA 3UGRA 3VD3A 1L8PA 3NNTA 1J8VA 1UD6A 3HU7A 1GVSA 3UXDA 2QUTA 4PRWA 1I2RA 3QLLA 1VFHA 2HDJA 5E0FA 3PBVA 3H53A 4IJCA 3TA9A 4GYFA 3VAVA 3TXZA 4WDTA 2V5CA 1XICA 4ZA0A 1IEIA 2OWCA 4GUFA 1TR1A 4XAYA 4HK6A 2VR2A 3LV6A 4TU1A 2PC4A 2PWGA 4L64A 4PA8A 4NU7A 2XFFA 2XH0A 1AW1A 1AQHA 4S3CA 2WM1A 4EPKA 3SRDA 3DFOA 4Q8PA 4ZSUA 1IHIA 3M9YA 2B81A 1IEQA 4LCSA 4DLFA 4S2CA 1ELSA 4HMCA 1CX9A 5K3VA 4HB7A 1BVNP 2B0MA 3B9DA 4M6VA 1RSCA 3T2OA 3WLJA 2OTDA 2F6UA 2VEFA 4OBSA 1SW3A 4HA3A 5C54A 4W8BA 2B7QA 5I6SA 3U4AA 3VNYA 3GG0A 1XD0A 5JIWA 3UP8A