4IHBA

X-ray structure of the canonical c2a domain from human dysferlin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
126
structure length
126
Chain Sequence
b'FMLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dysferlin
publication title Alternate Splicing of Dysferlin C2A Confers Ca(2+)-Dependent and Ca(2+)-Independent Binding for Membrane Repair.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 27
structure length 126
sequence length 126
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4ihbA00
3HIZA 3APDA 1WFMA 4F1SA 2K3HA 4WWNA 3LJ3A 3TL5A 3JZYA 1DQVA 2FJUB 1E8XA 3L9BA 3SD5A 3ML8A 4L2YA 1V27A 4FHKA 4QJ5B 4QJ3B 4ICXA 3F00A 5CCJA 2K8MA 5JHBA 3DBSA 2BWQA 2WXRA 1E8WA 2CM5A 2CHXA 4FJZA 3IM1A 5H4ZA 3ZW3A 2WXFA 2YOAA 4EZKA 3GPEA 4Y1SA 4LT7A 4KZCA 2Y3AA 4L23A 4TUUA 1RSYA 4ANVA 1E7UA 2CHZA 3OHMB 3QK0A 4J6IA 4WAFA 2V4LA 2WXHA 2ISDA 5CCGE 1TJMA 2NCEA 4NP9A 3ENEA 3QAQA 3MJWA 3PREA 2Q3XA 2B3RA 2Z0UA 4MJJA 4WWPA 3W57A 5EDSA 4XZ4A 1DJYA 2ENJA 3PFQA 4LCVA 4F92B 4DNLA 4GB9A 2ZKMX 2R83A 2WXPA 4IHBA 3ML9A 3PS6A 3R7RA 2QZ5A 4PS3A 4IQHA 4AJWA 3F05A 1W15A 4F91B 1UGKA 3L54A 1RH8A 1DJXA 3CSTA 2CM6A 3APCA 3HHMA 3KWTA 4FA6A 4F93B 2WXOA 4Y1TA 4XX5A 1DJWA 5H4YA 3RPBA 1E90A 4PS7A 2QZQA 3TJPA 1QATA 1TJXA 3PYCA 1QASA 3RDJA 4FHJA 3R7QA 2CJSA 3F04A 2A5UA 3T8MA 4AOFA 4ANUA 4HVBA 4BFRA 1YRKA 4NPJA 3L16A 1WFJA 4ANXA 3QR1A 2NQ3A 3OAWA 5G2NA 4QJ4B 1DJZA 2CJTA 3NSJA 4WEEA 4KZ0A 3IBEA 3L08A 2CHDA 3M7FB 3KWUA 1K5WA 2WXJA 2DMGA 2K4AA 3L17A 3L4CA 4JPSA 2Q0ZX 1DJGA 5CCHE 2CHWA 4G11A 1DJHA 3P2BA 3PRZA 4V11A 1A25A 4A55A 3QARA 4WWOA 2WXKA 2WXGA 2A4ZA 1UOVA 4OVUA 2FK9A 3N5AA 3TWYA 3ZVVA 1BCIA 1DJIA 2WXMA 4LDCA 4NPKA 1DSYA 3NZSA 2KI6A 3QJZA 3DPDA 2NSQA 2X38A 2JQZA 2RD0A 2WXLA 4TV3A 3FDWA 4URKA 3L13A 4XE0A 4PS8A 2WXIA 5JHAA 1W16A 5T8IA 1E8ZA 3FBKA 4L1BA 3S2AA 2D8KA 2WXNA 1E7VA 4FULA 3NZUA 1GMIA 3APFA 4ANWA 5KJ7E 3CSFA 1BDYA 2EP6A 2YRBA 4EZJA 4L1LA 4QAMB 4EZLA 1HE8A 2DMHA 2ENPA 4GNKB 4BGDA 1BYNA 4NS0A 3B7YA 2WXQA 4HLEA 3QR0A 1RLWA 1CJYA 2N1TE 1E8YA 5G55A 2ENQA 4OVVA 4FLHA 4ICWA 4FJYA 2LHAA 3W56A 4FADA 3ZIMA 3F01A 4TS6A 4DK5A 1UOWA 2UZPA 4KITB 2K45A 3HN8A
chains in the Genus database with same CATH superfamily
1CL7L 4DCQB 2VIRB 4LK4A 1A7QH 4S2SB 1CZ8L 4I8DA 3RVWD 1G9EA 1YN6A 3CFDB 1LO3H 4GAGH 1N2RB 4WV1B 4KQ3H 4MXVF 3VFWB 4YBQD 5FA3A 1WFTA 2APFA 1J8HB 4MQ7B 3IFNH 3CVHL 3T0BA 3WMQA 2WGXA 2VKXA 5A16B 1URLA 4S1QL 1IL1B 2VGLM 4OFYD 5I6OA 4LT7A 3ZQWA 1ETA1 3E9TA 4ADJA 4FI6A 1BF2A 4K3JL 3GNMH 1IC4H 1KGYE 4FX5A 3LQAL 3CFUA 2GTZB 5F93C 3EOTL 1U42A 5HGHB 3VFOB 3T71A 3FQXA 1G9MC 3A6BH 3HS8A 1CLOL 4OZFH 4TQPA 4FQPA 1DZBA 4X8XA 3VXMB 1ZPUA 1QSED 1MIML 2WWNA 2NY3B 2WJ7A 4M5YH 3RVTD 5SWSE 1NIDA 3KH3A 4KOCA 3SGDH 1KY6A 1HDMB 5K9JL 2FVNA 2BP5M 4P2RB 3WJMA 3MA9H 3VXSB 3DETC 2WTRA 3UC0H 3RX9A 4BCYA 5ACZA 3ILPB 2F58L 3JWOL 3FSWA 4R8WH 3Q44A 3RU8L 4LP5A 2FHBA 1DQMH 1QWHA 2J8UE 4ZTPL 2J8HA 1M71A 4RDQF 4OIIH 1ETJA 4P9HL 3Q1SL 1XMEB 5H35B 3PWPA 4MMYA 3IGUA 3MR9B 1CDIA 5SV3A 5GRYA 4JFEE 2YA2A 5LBVA 1MFAL 1NCNA 3FRPB 2YO3A 3VFTB 3QB7C 2JKJA 3QJOA 4LHUB 2A9NH 4N3TA 3BP6A 3TF7C 5E2UH 5AW6B 1PDKB 2H6UA 4Z0BL 3ASWA 4H2AA 3FQ4A 4KKZA 3VA2C 3PDGA 4RFEB 4D9RE 2IDFA 5IBUB 5E5MB 4OV5B 1GOHA 1PVHA 2RCSH 4ZOCA 3T2LA 5BS0E 1EO8L 3QQ3B 4UMGA 4UZGA 5CR1A 5LBSH 4AEHH 1G7IA 4POUB 4ZYKA 4M00A 1AR1D 1KEGH 5TGBA 2NNCA 4ERSH 1JWSA 2PYEE 2KMWA 1KPUA 1A66A 1OSPL 4M48H 4I0PB 5DMIL 1NDGA 4H7VA 4WFHD 4CADB 4FCHA 4JKNA 4KH2A 1VHPA 5L6YL 4HG4J 5TDNA 3U2SA 1FNGA 1CT8A 3BUIA 3QORB 4HJGA 4FLSA 2VDOH 4JANA 4N8UA 4HGKC 3ULUH 1ZVHA 1FPTH 4X6CA 5EUKB 1KCUL 4TVPE 1HEHC 1P53A 1KXVA 1Q4NX 5J1AB 3QRFM 1GGBL 1MLCB 4AJYV 3TO4A 3LRKA 3LYRA 3E1ZA 5KSAB 5GXBB 4L3CA 4NQUA 2FECI 1IAIM 3KL0A 5IQNA 3SJVE 4JJ5B 2Y06H 3PWVB 3PGFH 5B21A 1BMGA 4UV4H 3U0TB 1HSBB 2VW6A 2L7EA 4WK0B 1BZ9A 3G08A 4PRID 4TLUA 4AV4A 5CEZD 3OHMB 4AITA 4PW4A 3O9WC 2QQLL 2OSXA 2WCGA 4XNYH 4BZ2H 3MNZB 5SX5K 1IC7L 3RWFA 3NIDB 4LQFL 3S96B 2UVEA 5KSBF 3MUY1 4M7ZB 3FRPG 3T77A 4LHUG 2IFFH 2NNAB 2WINA 2FYYB 3OWRA 2ZP9A 3GFUA 3D25A 1ZV5A 4DP7X 5J3HD 1HHKB 1KTDA 3IGLA 3LNGA 5IBTL 3X11B 5BVPH 4JPIB 1IGTB 3MV8D 2P4AB 4ZO7A 1AXSA 4PTTB 2XG4A 1NPUA 4WI2A 4S0SD 2F1BA 5DUPL 5E94B 1L9RA 3QJTB 4UAHA 2PO6C 3K5SA 5CLYA 1MUJB 2V2WB 4JCWA 3KDMA 5D7JD 3ECVA 3GBMH 2IAMA 4PJHF 5GGVH 4APXA 4QHLA 3V6ZA 4WW1B 4FQLL 4FZ8H 5HY9B 4L2LA 2WVVA 5DLLA 3F7VA 3MYJB 4IBSA 5CBEB 5CD5D 3KZ8A 3LHAA 1NH6A 2FHFA 2VXSL 1OEZW 4PJ6A 5T1KD 3FCSA 2A4ZA 1JFQH 2ADIB 4ZPVA 3MHZA 4UINL 3SKNA 5HXMA 3UROR 2XV3A 1LLAA 3RVUD 4N20A 1S5HB 3GXUB 4P2QA 3QQ9D 3K4ZA 4W9GC 1L7IH 1EUUA 1IAII 1MHCB 1KCBA 4A2HA 5SWQB 2JI1A 4JL2A 1ZDQA 1BDYA 1UJ3B 4PD4J 5D7HA 1G7JB 1ACXA 1F58L 3N04A 2YUZA 3DV6A 2FSEB 3HS0B 4WV1C 5FHBH 3P11L 4RGNC 4NNPH 5HHXL 2IANB 2OZ4H 1U58B 4MB4A 4LNVA 4W4OA 1MQKH 2VDLH 5DYOA 2VDNL 5DRWA 4CU8A 4IM8A 1NBVH 1N5YH 1NZRA 3HPLB 4PGDA 2A4EA 4ZOBA 5IW1B 3VWJD 1HWHB 2XWJB 1U8QB 4ZUVB 4L4TA 32C2A 1M6OB 1PLGH 1J8HE 2B20A 3CDCA 1PZBA 3HG1D 3T4AA 5DJDB 5EU5B 1IJNA 3VTAA 5J0BA 1QSFD 1AKJB 4CDHA 2ZCKH 3UADA 1CG9B 2Q9OA 2ODIA 1OB1B 1QRND 1SYSB 1FLRL 5JW4Q 3DX6A 1WQVT 2FZ3B 4TUUA 4KRPC 3ULVD 3SPGA 3TWCL 4ODSH 1DFBL 1RUML 1TJHL 3DIFB 4ZFZA 2XQYK 2XQYA 2VAJA 3L3OC 4JQIL 1CTOA 4G9FE 3PFQA 5EFIB 3WLWD 2KBGA 4WTZA 5T1MB 1BLIA 4P4KD 3AABA 1EMTH 2G9KA 2UXFA 3IB4A 5LAXB 3U0WL 3VXME 3WE1A 5GZOC 2C8NA 2GSIA 4JJHA 2FUTA 1I3VA 2CZNA 2ZUQB 2EEBA 1IZKA 3PGCA 3UO1H 1PQZB 1IKFL 4P2RE 3K80A 2YD7A 2Y1AA 1CU4L 3QEGH 1WPCA 5ANMA 4NZUL 4WO4B 4QGYA 1HJCA 4XODA 1I8KB 2ZOOA 3BLKA 2I5YL 1KUMA 3NCWA 2EABA 3OB0K 3RDJA 4Z3FA 3RY4A 1XF3B 5JORB 3IMSA 1Y18A 5I16A 3EUUA 1Q0EA 4HUUA 3UBFA 1FNFA 1U8CA 3IYLW 4FKHA 5EEWA 2X3BA 2XTJE 4Q4EA 3RY6C 3CMOH 3ZYOA 5DZAA 5FHAL 5AOJA 1M1XA 3X1EA 1BLNB 4N0FB 4XZUA 1MY5A 3TBYB 3SDAC 5T1LA 4JDEB 4K7FB 1JN6B 2COVD 2IQ9L 1Q9LA 3FU9A 3IMUA 2MIZA 3QDMB 3ASOB 2J1YA 1H6UA 1AC6A 1NLDL 4TUOA 4FG2A 3U1SL 4BZ1L 5I1KH 3HLKA 4ZX5A 4JAMB 1B4RA 1AI1H 2D7QA 1OPGL 4JRYD 3WELA 3SDDD 4C56A 1X5AA 1HAUA 2CK2A 3ZE2F 4I77H 2B2XH 2FIKB 2YA0A 3D51A 4YDZA 1O6VA 3WIHL 3P1VA 2XFXA 2AQRA 2F7RA 4L4VA 3T3PB 1JXKA 4U3CA 4NN6B 1JZDC 1A65A 1JPSL 2YBGA 4MKMA 3IPEA 3MROA 1D5BA 1IFHL 1E5ZA 4YK4B 4X83A 4Z0XA 4PMFA 4XBGA 2AJYH 4PW9A 1DQDH 4P2OA 4QYOA 1EH9A 3Q0HA 1MW3A 4JZJB 3H7BB 4PJ5A 2FQDA 4X7SH 3LPFA 5HYEA 3NMEA 2LABA 2R2HA 2EYTB 4M9PA 5J1SC 1B4JL 1U30A 1YN7B 5B39A 2JTDA 4UMSA 4OTXL 4YFEA 4LEOB 5IFAL 3AWGA 4KX7A 3GMLB 3VWKB 2O5NA 4HXBH 4PSRA 1MI5A 2CLVB 3ZLQC 5I30H 2BXYA 1R5IB 5C0AD 1R3IH 5INDA 1AE6L 2OKMA 4QJ5B 1OXYA 5D1XC 3SGKA 1X7SA 3FO0H 1MW0A 1Q1PA 5FX3A 5EF1A 3EG9A 2YBRB 3MJ9A 4I18A 4MAYA 5KOMC 1HILB 2LU5A 4OZHA 4WWKC 5DRZA 3B9KC 2F2HA 1E9PA 3FBQA 5GJTH 3FXIC 3NIDE 4G8AC 3BW9A 1PZ2A 5DJXA 1P7QB 3FN9A 3V5DA 1E4WL 1YNKL 5LUMA 2YK1H 3TJEH 4CL7A 3AY2A 1JI1A 3P2TA 1XGQA 5CM1A 3RNQA 3SKOB 2XWTA 4Z3HA 4N9GB 3FB5A 3QXAB 3C8DA 4ABWA 4HJIA 1AQ8A 2E6QA 3VG0L 1OKEA 2A74B 4JO3H 1RK7A 3RIAF 3WXVL 5IHBA 5EO0B 3IFOB 2X4NB 4U1LA 3VGAB 1AQDB 1O7VA 2EACA 4GXVH 2JI3A 2OR9L 3KHOA 3DDFA 4H2CA 1FP5A 2ENSA 4AGMA 3FQ2A 5F3FA 2H2PC 4P99A 1J5DA 3MBEC 5HYFA 3ZK0A 3V6OA 1SDDB 1G7QA 2DN7A 2R0KH 4Q6IB 3WHXB 5FFGA 4NYLB 4QRQB 4RFNB 5EIIB 1MXGA 2XI9A 1VEOA 4FABL 4L0ZA 3B2DC 4NCC2 1JCKA 4X7EC 4LLUA 2CGRH 3FCTB 5FGRA 1A4JA 3I9PA 4EXPX 1VPOH 3RHWF 3K2MC 1WDAA 2X70B 1S3KL 3UTZA 2XVLA 5IMOA 1XF2B 3NUKA 2D7PA 3KPRD 1D7DA 4ALAL 3PJSB 1RIHH 1B0GA 2EDDA 3X2QB 4HU2A 4YDJA 5MI0C 1Y6KR 4XMWA 3PNWB 5AVVB 2WCPA 1ZJAA 4TF4A 1W6LA 5F96H 3O8XD 3V79C 1DHKA 3FTXA 2BVTA 4LDLB 2AJVH 4G8EB 4N1EA 5AOLA 3ULUE 2X4PA 5IB4B 2IANE 3D3VA 4FNSA 4EO5A 1A6UL 2X4OB 4KXZH 3TT3H 5EZLB 4F7MB 7PCYA 2CUHA 1MRFH 1SYVB 3O41A 3QJFA 4A7SA 1SEQH 4ICWA 4R5VA 1NANI 5D4IA 5KBMA 4OJFL 2KZKA 2QGCA 3SDXA 4V1DE 3ZXAC 3EYFB 4WHYG 4XVJH 5EZJB 1WRFA 3HA0A 4QNPF 3O4LB 3TOPA 5HGBB 2EKSB 1B0RA 3OR6B 1IX2A 1FYTA 2PR4L 1B6DA 2BSSA 2MOQA 5KSUB 3SPVB 1ZHNB 3BIKA 1MRDH 1WTGT 2UWEF 3SCMD 3HG2A 4FQCL 1NIBA 3ZY7A 1AO7A 2Y5EA 2FO1A 2VR3A 4HC1L 5EU6E 5IHUH 4DP0X 3L4WA 3E3QC 5GISL 1DVFA 1W72H 2H6PB 5FO7B 5D2LA 3IMBA 4K3DL 2V4LA 3K8LA 1RZKC 2BNUA 3UIZA 3FU6A 4D9LL 1KIRB 3VGEA 5IR1A 5E1QA 2C4XA 4LFHG 1JAEA 3EFOB 3V4UL 2ZAGA 5IB3A 2BIQA 4C4KT 4TQEL 5HVFB 4WKZB 3GGWB 1AGEB 4LSRH 2WLIA 1FAIL 4UQ3B 4O2EB 4MZ3A 3DX0A 3KYOA 3TBWB 4AG4H 1XXDC 1NM4A 1XGYH 4XC1L 4XNUL 5T3ZH 2LAGB 2JLLA 4LKCA 2GJ6A 4GSRA 1W0WB 3HFML 1PY0A 4LSQH 4OF3A 4B9ZA 1LD9A 2BZCA 1C16B 4PTUA 2UZIL 5AL8A 5CN1A 4AYBA 2BNRB 2X2UA 3RWEB 3C87A 4HGWA 4X4XB 3UGEA 2CLRB 3OZ9H 3EGSB 4NC1C 2BP0B 3SEPA 3UTSB 1PU0A 4MDJA 5A40E 1P5UA 2CA4A 1OAXH 5JPMB 3H4HA 1QA9B 1JZEA 4MYPA 3NPSB 3MC0A 2GG1A 1DDHB 1JPEA 2W60B 3IU3B 4ZMTA 1GSKA 5I8CB 1A1OB 1PF3A 3GRWH 4NIYE 4LVHC 5JR1H 3QDME 1MJ7L 2AGJL 4OFYA 3HHSB 2B08A 2A6DB 4HKXB 2APSA 3RL2B 4JLRB 4PGBB 2XXGA 4N2IA 1FFOB 4YEFA 2NX5B 3CVHA 3ERXA 3BISA 3OZKA 4H4NA 3T5WA 3UOAB 4Y4HB 3MJ7A 2DOCA 4PJIF 4JZJC 3PV6A 1INDH 1UXMA 2GABA 3UBHA 2DQGH 2K0RA 2NSMA 2WKGA 4I48A 3T3PE 3B83A 3QO1A 4Y9FA 3U0PB 5IESH 2VR5A 3O0LA 4CSSA 2E8YA 1OGTA 4GAJL 3KJ4C 4Y16B 3GLAA 4P3DB 2AXJA 4PLNC 5EC1B 1SN0A 3DURB 5HVGB 3AG2B 5IUSA 2GT9B 3IGFA 4N5EC 2N1TE 3CNKA 5EPMA 1NGXA 2CRIA 5D7SL 4H5SA 4DZBB 3C9NA 5DZ9A 1EXUA 1DBBL 2Y7LA 5DD3L 5JOPD 1PEZA 1DVUA 1MFEH 3VXOA 4E41D 1UB6B 1ZWIB 4N8CL 3ZDYB 4NI3A 5J6HA 1HEZB 2EXWD 3CVBA 5IROD 4NSKB 3FT2B 3QZLA 4NFCA 4S10A 4HKZA 4OJDH 5JOEA 3W39B 4BD4A 4PGZA 1DQVA 5DJ2A 1TIUA 5CCJA 2Y5TA 1QLFB 3OJ2C 3RTQC 3EBAA 2DWEB 2L3BA 2YGQA 1JXDA 5FCUH 3WE6A 1R3HB 2QGEA 4OF0A 3SDCB 2ENYA 3P73B 3TX4A 2D9QB 1WTLA 3GMRB 4KZCA 5LG6A 4FXKC 2GAZA 4LSDA 4O4YH 3WFCL 3IRPX 1OSZB 2MQ3A 5FUZH 5FGBA 4JHWH 3QAQA 1VB9A 3MLWL 2MCAA 1KCSL 1SOXA 4N2BA 2QHRH 1ZTXH 4Y2OB 4UQ2B 1FRGH 1CXFA 5AYQA 4NWUL 5IGXL 4YSQA 4MS6A 1YEDA 3NH7L 2AKRB 3TEXA 2CK0H 3IKCB 2EVGA 4PY7B 3VXRB 4AIOA 5C0FB 4H0HB 3U7WH 5JDJA 4IRSA 3GBNL 3DMMB 3APCA 1C5BL 3QSKB 5AKVA 3WS6A 4E9VA 3V7AE 2Z4QA 2NNFA 3MOBH 1GZHA 1WZMA 1KJVB 5D6DA 3UXFA 1ITCA 2B8OT 3FTGA 5AYTA 5HI5D 4WI8A 5AW0B 3QHZH 4HS3B 3IDYB 5D7KD 5FDWB 3ARFA 3LV3B 2SEBB 3E8UH 1I9EA 1OPOA 5G2NA 2HWZH 3IDXL 4F7TA 3HUJA 3LY6A 4RMBA 4PW3A 2DM7A 1H3PL 3ILQD 1FV1A 5ESQA 3M8OH 3VXTB 3TEZA 3G5XA 3QUMA 4MMZA 1MFDH 4EBQH 5K59F 1NCWL 3U4BL 1JFHA 1IAOA 2QPSA 5E1AA 5JW4N 4E9XA 3D0VA 5EOQH 1ZJBA 4R7DA 4YL4A 1UWFA 2RD0A 4L37A 4Q4IA 2VDKL 4PRAA 4ZAKB 1I4FA 4X9FA 3L3GB 2FWLB 2VN5A 3L5XH 1MHEB 3K4AA 1DVYA 3GK8H 1NMCB 1BGXL 3AXLA 4ONFL 4IOFD 3OV6A 5D1ZI 1EBPA 2YXFA 4NUJA 4OIBA 1HN1A 1VCBC 3LXAA 1UGNA 1R5WA 3CCHB 1J7VR 3GDBA 4ZUWA 4HKBB 4IK6A 1KPVA 4EN3D 3MV8A 2J8OA 2E3VA 2BIOA 4DF9A 1PJ9A 4OB5H 1E5CA 3CBJB 3ZX1A 3GMMA 3QC5X 3G6JB 2H3NA 3O4LE 1KCVH 1CGUA 2HRHA 2D0HA 4ODBD 1SRDA 4ZMWA 3BUPA 4ZFFB 4D3CH 1GYCA 5D7JA 2HTKC 1JNLL 4FS0A 1UXSB 1CTNA 1J8RA 2Q76A 2Y2YA 3V10A 2Q8AH 1AHWC 1IBGH 1U8MB 1ZANL 4F7EB 2ED8A 4HSAC 4ZUUB 5FWQA 5T1KA 3MUHL 4ES9A 4ZD3H 4J5VA 5A2JH 1J9TA 4WAFA 4JGNA 5A2FA 1FSKB 4W81A 1NGYB 1FJ1B 1HXYA 3QWRD 1NINA 2P5WB 4AYFA 3ZSTA 3HB3C 4XN9A 5AB2A 5DK2B 3BH9B 1MAMH 2N3JA 2IXQA 2DQHL 5FWRA 4OFQA 5TJWK 3H1ZA 3K81A 4YHKH 2H6OA 5IHWA 4F7CA 1GHFH 1RUQL 3GI9L 4I3RL 2ZWKA 1LDPL 2QSCH 1CFQA 4G7VL 1JS4A 5FO9A 1FG9C 4Y19A 1JMXA 2AZUA 2MQ0A 3SPHA 2OXGB 1M7IA 5KBNC 3M1CA 3UTSE 2V3EA 3NJIA 2R27A 1CYXA 3VWJA 5C09E 4EF3A 4QY8A 1U91B 1YRKA 4O5LL 3MGOA 1EDHA 1FBIL 5K33A 3IDMB 2WC7A 3HG1A 2H1XA 1TSRA 2N7AA 4MNHA 4GUOA 2ED6A 3LZOA 2P24B 2BVQA 6PCYA 4XO9A 2Q0ZX 3DSNB 4YL9A 3K74B 5KWYC 3QZMA 1QRNA 1IGYA 2FJGB 3QISA 1FF5A 3TPUA 4AGPA 2CO2A 3MMEA 2NX5E 5F9WC 1MREL 1ZHBA 5IWLC 4NJAH 4YR6B 2YPVA 1BVNT 2WW8A 1CFMA 4AEIH 4Z7OB 1BD2D 1S46A 2Z92B 4UTCA 1G9HA 1XH2A 1NL0H 3POCA 3NDZE 4NCDA 1ORSA 5LVEA 2Y36H 1HTYA 3TVMD 1FGVL 2IBBA 1NCIA 3OAUL 4XPBH 4BJLA 4MNGE 4JHAL 2ZXBA 3ELQA 1NEZA 4PV9B 1CF8H 4X4ZA 4JQIA 3MX0B 3QH3A 5DUML 5IJVB 1KWGA 1DLFH 2AK4E 4CVUA 3CXHK 4QHNB 4EN2A 5PAZA 4OF5A 4DP4X 4EAEA 4OLVL 3L1OH 5EC2A 4U1JA 2IG2L 5HHQA 3EIFA 4NM4H 5GIRA 3ZDYE 2WO3B 3IWUA 1FL6A 3Q5YA 1EQWA 1RY7B 4LCUA 4U6YB 5EZJA 4XVUD 2LTQB 3MRPA 4NZRH 1J8KA 3VJ6A 1U8HB 3WBDA 5FDYA 4GQZA 4PRBA 3IEAA 1QBAA 2QADD 1QHPA 2CO7B 4LL9A 5D1ZD 3LB6D 3VDAA 4P9MH 2BRQA 4NNYA 2EIZB 3QCVH 4HWZB 4WCYL 5D5MF 2HLAA 4OUUB 1G7HB 4XPAL 3AQYA 2JCCB 4KKRA 5DEGA 5CGYC 1OTTD 3OAYH 4QHKJ 3T0WA 1T21A 5C6PB 3MLSH 4KXAA 2DWDB 4AT6A 1ZTMA 2HMID 3QUXD 4Z7WF 4JRYA 4YPGB 4MJJA 5T3ZE 4L8CA 3N40F 2VDRB 2HG5B 4LCVA 2HLEB 2H5UA 2W0FA 2N59A 1A64A 2WXPA 4G43B 1TETL 4ZQTA 3FQNA 4PPTA 4E5XA 1SHWA 3ATEA 2XIDA 4UT6H 1UFUA 4N6RB 2ZQKA 4K5MA 3BPNC 1WK0A 3CH8A 5GS2D 4WU5B 2E7BA 3WIHA 1HE7A 1U3HA 5E2WH 1TCMA 4ZOEA 1T0NA 2PXYB 1A6AB 5H4YA 4EI6A 4UTAH 1R17A 1XV8A 3MXVH 3N85L 5E0QA 4JFSA 4NRZA 1Y0LB 4FHJA 4RIRB 1N4XH 1KTLA 4LVNC 2Q7YB 4NBYB 3L16A 4FP8H 8CGTA 2YA1A 1PKQE 1MWAH 2F54A 1UD6A 4E2OA 2AJXH 2JKNA 2CHDA 2ZSWA 1U21A 4KV5E 4N2HA 1E2WA 3K3QA 5CMAA 5A6LA 3BZDA 3TTSA 2VZOA 3WEBA 4KZEH 1I8UA 4Y5XA 3P2BA 5AW5B 3UBXB 4AQ1B 1T04B 2X2IA 3SE9L 4OVUA 5FW7A 3WNNA 1KTJA 3TH2T 2DEXX 3SZKC 4XVTL 1YUHA 2FBJL 3BKMH 1CXLA 4DK3A 5I6XB 1FGNL 3BQUD 4NAQA 3LNIA 1UM5L 2H32A 4PMEA 1Z0NA 1E42A 3VFPB 4XTRC 1PTZA 1BZDA 4NQTA 3NJNA 2C4FU 3QS2A 5DZNA 1DQLH 5AB0A 1X6NA 2V7NA 3OG4B 5BRZB 1UXLA 3EJRA 4AZUA 2X0UA 3HRPA 3MRBA 3MLVL 3PWLB 5BZWA 5HYSG 5F88B 1HYSC 3HZKB 1U2HA 1KSRA 1ASQA 5FLUA 1EGJL 5I8EA 4L3FA 2ROXA 4OCWL 1KBPA 2BJML 2H7WA 2OP4H 2V8MA 3MCKB 3QNXB 5HVWA 3G6JE 1UWEH 4W9KC 1JOIA 5CJXC 2OTUB 2HFGL 2D31B 5SWSD 2YD1A 5HPMB 3ARED 2W80C 1FN4B 1YECH 4KO7A 4MXWH 1F42A 3DJ9A 1G9MH 5MERA 2O5ZH 1I8LC 3QRGH 3RUGB 1G43A 3ABMB 5HJGA 1XGRB 1K2DB 1X5FA 4YIQB 2APVA 2R0WL 3QZNA 4GMTL 2QQNL 1N6UA 1YDPB 5LNGA 1TCRA 4Q0XL 5E4EB 1ZTXE 2KLRA 3MLTB 4N2AA 1UH2A 2P5WE 4HT1L 2GUYA 4LOUD 1MCLA 2FWOA 2EXYD 3D0LB 4HH8A 5EU4A 1O9WA 2YLHA 4XP5L 4QR7A 1SFDA 4IBWA 1A3RH 5TPWL 4OGQC 5LNDA 1NAMH 1DVTA 3UBXG 3W11D 1CURA 3BKCL 2AQQA 5TE7H 1CVSC 4L18A 3O8XA 1OE1A 5J6GA 3RAJL 4OFVA 4G1EB 3T0EB 4R96B 4B5ZA 3HBPA 4A2EA 3DHMA 2EYRA 4FDWA 4BQCA 4C58B 5BRPA 1DJWA 2WNKA 3X3GL 1OGAB 4NBZB 1BVNP 4FFTA 2ZXCA 3GSRB 5DK3A 2COQA 5E9DB 5ETUA 4TLKA 2DW5A 5L0QC 3S88L 1QW8A 1KTKE 4ESKA 4AV0A 5C0GB 2ICCA 5AENA 2HTLC 4WI5A 1PNDA 5EBWA 2CKBH 2J6WA 4GG6B 2QDWA 4F2MB 3FO1B 1PMYA 3ABLB 4TVPD 2YLKA 4G11A 4HIXH 4WTWA 2ATKB 4YFDB 4A1RA 5TE6H 1MJUL 3ZE0F 4EDWL 3HI1A 1Z5LB 1Q9OA 4X6BA 2ETWA 2P9RA 1AAJA 1KIUB 2X4UA 3MRDA 3CH1B 4Z7OE 2HJLB 3QXTA 3SJVD 1UD2A 3GXNA 1IGML 2VXTL 4G1MB 2KPNA 2WVUA 3CFTA 5LQBH 5E08L 4B9PA 4PJDE 2DL2A 3MO1B 3S3BB 1E9QA 2ZOLB 3SKMA 1DP0A 3F6JA 2LTQC 1NSNL 1AIFA 1LGVA 1YNTA 3C8KA 3EFFB 1UQSB 2EYSA 1VF5C 2Y72A 3QDAA 4HWBL 3CPLA 3NRPA 1WFUA 4WJG3 3PWNB 3V4PL 3WTYA 5GGTA 3VVWA 2ORBL 1AH1A 1BSIA 2WD0A 4H8VA 1MF2L 4LNRA 4KWUA 4NQSA 4PRNB 2BSRB 3MV7D 3CFCH 5IK3B 5CSBA 2F53B 4HUVB 4BUHA 4LRNH 1KLUA 5KVEH 4KUZL 2DTSA 1ILUA 4N90D 5CGTA 3TN0B 4UNVA 4KJPD 3ROOB 3O11B 3TA3D 4Z78A 4GW4B 5CJBA 5KYUA 2R7EB 4P4RB 2GBAA 3BSHA 1EAJA 3NVQA 4MD4A 4NI6A 1K8IA 5FF6B 1NCCL 2JCCE 2FATL 5KG9B 3TH3T 2HJKB 1CGYA 4I2XA 4WI0B 3DJSA 1R24A 3SB3A 5ESAA 2QKIC 4XHJC 3SBPA 1ZVYA 3TO2A 3CHOA 2BXZA 5C08B 1NDMB 5ICZA 3P4OA 5H37A 3BJ91 4IDJL 5IQ9A 5LWYH 2E27L 1KB3A 4QXUH 3TBVB 3ENEA 3WTWA 3TYGH 1LK2A 1RZJC 1BFOA 2OI9B 4YUEL 2GHZA 3C60B 4YWGL 4A2FA 4F9LC 4JY6B 5KW9H 4PWKA 2YAOA 2VW7A 4L3EB 5CIPA 2XDHA 4L5FH 1JVLA 2F61A 2H2SC 3CDYA 3NFSL 1K85A 2VDPL 2XIIA 2EC9U 3RGBA 3KLLA 3SE3A 4EUPB 4KXBA 3Q6GH 2XVBA 4RRPG 4RNRB 2F5BH 3VFNA 2LAAA 1JNHA 1P7KB 1LO0L 3EF4A 2DQ6A 4E41A 2JJWA 2YQ2A 4KGLA 3FSAA 1E6OH 4PS4H 1WGVA 3NCXA 3KLDA 5JQ6H 4HDIA 3WSQL 2OSLA 4JM4L 3LKOB 2DWYA 1HIMH 4PJBB 1DCEA 1SLXA 3OXRB 4WDIA 3RBSA 3U46B 3GUTB 2N56A 2NXZB 2VLKE 1UYWH 4YSCA 3CN3A 1R3KA 5MHSE 1ITBB 3EYSL 1Q9KA 2EIDA 4JFTA 1HCFX 3N0AA 5KEZA 4N3UA 4G7SB 3SGDI 3QW9A 3L3DA 3WDHA 2ZD0A 5JYLA 1J8HD 5IF0B 4PLJD 1AZCA 1LQBC 2KI6A 3QUHA 3I6SA 4FQXC 3C09B 3GIVB 4OKVA 3MRMA 5ERWA 1FZOA 3DTDA 5I66B 1JDAA 2ERJB 1E43A 1ND0A 4QXGH 1NPNA 5EULV 2J57A 3OHXC 5H94B 3MJ6A 5BRZE 1S2EA 1XB3A 2E7MA 3GZQA 2OYPA 2ARJA 3D69A 5B1CA 5FFLA 2WBKA 3BT0A 3VRJA 1SEBA 4Z7AA 1L6ZA 2ICEB 4Q89A 1KIPA 2YAEA 4V33A 4XAWH 4X2UA 1INQA 1G7LA 3VXMD 2ENQA 2Y4SA 2R1WB 4X4YB 3NABH 3KPOB 4OQTH 2NY3D 3DX7A 1ZT4B 1N59A 3ZBMA 3K6SA 1BZ7B 4AZ8B 2O26U 4PJ7B 4P2RD 3MLZH 3OC8A 1QAWA 2J6EL 3VXSD 1RD6A 4ENZA 1KPRA 2FX8H 3EHBB 4HWUA 4BXVA 4XO4A 2L7UA 5E24E 1GPOL 5A7BA 3HMWH 4X80H 4XNQB 3RUGE 1A3ZA 5GGQH 1XIWC 3F00A 3P0YL 5JUEH 2JB5H 2XWCA 4K5NA 4AEFA 2FEJA 2X4RA 2IALB 3PP4L 2GTWA 3QHTC 1CD9B 2EEXA 4YDNA 1R3LA 1RZGA 2V9QA 1JV5A 3HLAB 2BMKA 3WUZA 1KCRH 4XCNB 1RZQA 3BD5A 5I1IL 3Q2VA 2CD0A 4LHUD 2AC0A 4JVUA 1QX1A 3JTSA 1F6FB 2NY1B 5EORH 2VN7A 3ZPDA 3RWHB 4X6FB 4OLXL 5AOKA 4OD2B 4BELD 3T0EE 3GMQB 5I26A 4JRLA 3K6IA 3ABKB 4QAWA 1RIVL 4BFEA 5FB8A 4AMKL 2JJVA 5FKPB 3UMNA 2FD6L 4EN3A 5EZOH 4NWTH 1Q9WB 3OR7B 4LOEA 1JPGB 3LSOA 5DJCA 2B7DT 4XX5A 1XD1A 1A7QL 5E00A 1LO3L 4GAGL 2TAAA 2JKTM 4KQ3L 4LL4A 4FMVA 3ESMA 4Q58C 4I0PD 4NZJA 3MBWB 3IFNL 4LBEB 4JUTA 1U8PA 4OZIF 2AP2A 2WLHA 4G3YH 3NQKA 3QORD 2NQDA 3NSJA 4G8FA 4GS7C 1MVUA 2XKNA 3Q5TA 4F2ME 2CRYA 2ZXWB 3DHPA 3EH1A 4L4JA 1IAMA 1F4AA 3H4FA 3GNML 1IC4L 4APQA 4ZMOA 5HDQH 4BK5A 3ZT6A 3VI3A 4YNYB 3G5ZA 5KSAD 3ZKNC 4AEEA 1EHLH 3N5AA 1VADA 1Z6JT 2JJTA 2J7LA 3CC1A 2FR4B 5I1EH 4LLQA 2IPUK 1TZAA 3A6BL 2WB1A 3QWRA 3A4FA 3IGAB 4LCCA 4DGIH 5HYJE 3EBIA 3W0WB 1J1PH 5CBAA 4TTDC 5DRXA 4XH2B 4M5YL 2HVBA 1M3IA 1RZFH 5G4OA 2LGNA 4M8RA 3DBXB 3MA9L 2A7BA 2GBTA 3I9GH 4EZJA 1NQBA 4M7JH 1CDYA 3HC3H 3UC0L 1JTPA 4IU2B 1TU2A 1MCQA 4IHOA 4KY1H 4PR5A 4LRIC 2VISB 1QFWM 5F8QC 3T9WA 2WVTA 1ANUA 1QLRA 4LGPB 4Y4FA 1JK8A 1CLCA 4R8WL 1COBA 2F53E 3VFRB 6FABH 4JNXA 1DQML 3VE0A 1TR7A 1R0AH 1IBHA 3HAEA 2ARWA 1D6EA 1CBJA 2FL5B 3VRIA 4OIIL 4F3FA 2A9CA 4NT6A 5IVZB 4UT7H 4Y4KB 1TNNA 2KERA 3AQZA 1T5WB 2P8LA 4QO1B 4FOMA 2NSXA 5C2BH 1KCWA 4KDTC 5EU7C 4ZUTA 3IJYA 1EEZB 2A9NL 2IV8A 2TSBA 3C60C 5E2UL 1CCZA 2XOTA 4IKLA 1LXMA 3DROA 3GSQB 1M2VA 4C83B 2DLGA 3MRKB 2FCBA 2LLNA 1CFNB 4BFFA 2RCSL 4PEEA 2ZSVB 4P5TB 1WS8A 5K9OA 5LBSL 4AEHL 2AQ2A 1R4XA 5JIMA 5KVDH 3E9UA 2IQAB 4UQEA 1XGTB 5J5EA 1KEGL 3ATDA 3IJHA 4L3EE 4UYPA 3TVMA 2QVIA 1OCRB 4ERSL 1M9WA 4B9KC 5I6KA 4M48L 1TQBB 1X7QA 4X8JB 4JREB 3GJFK 3A47A 4J3WA 5L8KB 3ULUL 1C9SA 2VDOL 1M7DA 1I9IH 4HMDA 4L9LB 4OIFA 1FPTL 5DHMC 5FYKU 3L7FB 3MV9B 5D2NC 5B3JF 5J57B 1WC7B 1P6AB 5AW3B 4BZYA 3EJYC 1ZHKA 1UTDA 1JGEB 4HVBA 2X4QB 2IAND 3L2MA 2Y06L 4PJBE 4BV1A 4ZMZA 5CZVH 1QEWB 5C97A 5D1ZA 3PGFL 5EUOF 5CFAA 1G1YA 3DUSB 3INOA 4UV4L 5JQHC 4MCZA 1QFWI 1GCFA 2ZG1A 4WW2A 2N1KA 3BWAA 3VXPB 2OMYB 2WIIB 3IGKA 4KKBC 3AAZA 3GSWB 2Q2EB 4P0DA 2B1AH 2YD0A 3BFWA 3ATAA 4XNYL 4BZ2L 5CWSB 2V5TA 4P59H 4GUCA 1T1XA 1AKJD 1KZQA 1RJYA 4JZOB 2EIJB 3CQQA 2IFFL 2JVUA 5TQ0H 4AW4A 2V2TA 4PJFA 2YPLB 3IMRA 1R34A 3X14A 3DXAB 4K73A 4FA8A 2FTAA 5BVPL 1FVDA 2C9UA 1D7FA 1PL3A 3MI6A 1KBVA 4UNUA 3I02B 3QZWB 1WA1X 5ADOH 3RYMA 2C7FA 4MS8D 5KUMA 4RGMB 3FT4B 1QABA 4IRJB 3NQIA 3KM2A 5KVEE 3FUJA 1HI6A 5I1AB 3KNBB 3O6FB 4HFWA 1FI8C 1K8DA 1S8DA 2WWKO 3VX1A 2WYTA 4KI5C 2R15A 4PJ7E 5LNEA 2BCMA 1RZKH 1NCAH 3GBML 4AVKA 4WI6A 5GGVL 3I3EA 5GRXG 2DLHA 2Z1KA 1ONQA 2FYVA 2PYFB 4FZ8L 5AVQB 5DS2A 4WO4D 3QJHA 4H1LA 4NO2A 1FUNA 3LJ3A 2H4EA 2BVUA 4JFFE 1JFQL 4WSGA 4XXDB 1UWXH 3NJMA 5AOZA 5E1HB 2X1OA 3T8XB 1U8LB 1BREA 3MA7B 1NPJA 3MTXA 4L48A 5J1TC 3NPZB 1AZNA 3C6SA 3NCEB 4Z3GA 5B7FA 3M17A 3QEHA 1L7IL 2FBOJ 1IEAB 3GXDA 5BRQA 4L5FE 5DC2A 2W9DH 4HSCX 1YEEH 5HPOA 3OD3A 3QDMD 3QDJE 1Y07A 1KYOJ 4NP4H 3QWNA 5FHBL 5JHLA 3RWGA 4NNPL 5GSRA 4O2CB 4XR8C 1M9SA 2OZ4L 4K7PX 4Q2ZB 1DQQB 1MQKL 2VDLL 4FQIH 1N5YL 3KE0A 1NBVL 2O6CA 4PQXA 1KB5B 3OG6B 1ETZB 4BEIA 4GP8B 5INCB 4PJ9C 3JTTB 1BPLB 1MN4A 1HK6A 2BINA 3H2PA 3AT0A 2C3VB 3WMSA 1KULA 1BM3H 4NO5A 4J4PA 5SWSA 3CDZB 4UU9A 1PLGL 2AV1B 2HJFA 3AREA 3LEXB 4G8IA 1A02N 3EO9H 4HIJA 1TFPA 3S5ZA 3TS8A 1PG7W 4JFYA 3WEXA 4PWFA 2EINB 2ZCKL 4I85A 3U4AA 1W2KT 4KAQH 4JY4B 1BQUA 3DX8A 4IGBB 1DN2A 3X3FH 1N7MH 2Y1VA 4UTBH 1JWUA 3QIUB 3LDBC 2P8MB 1U8JA 3VWKD 2R39A 4ODSL 4AKOA 3BAIA 5HGDA 1FFNA 2J8UA 4HCFA 4HWNA 4KQ4H 4TYUA 1EHAA 1FNAA 4DVRH 1KGCD 4N5ED 1JVKA 4KKAD 1EMTL 3PLYA 2WLKA 4OFKA 5DZVA 4GINA 5FA3B 2X05A 3UIYA 4JFEA 4PP2B 4YH6A 1ROWA 4GAAA 3UO1L 3BE1H 5AW8B 3F12A 4XN5A 2IADA 3C5ZB 4YXHH 5FUOH 3QEGL 5CD3B 3NRQA 3QWOA 5ALBH 3RX5A 1BYPA 1GYUA 3X1NA 4XWOD 3ZRSA 1P7QD 3GB7B 4TNFA 2WXQA 5BS0A 2C3XA 2IOIA 5KBPA 4WEBH 2EICA 3CD4A 5GS1C 2JF1A 5DQ9B 4WJKB 2Q5BA 3CMOL 5CJOH 3VU1A 3SHSA 4FG6D 2BVYA 4Q9RH 2PYEA 1KWKA 3CSTA 1PAZA 3G9VA 5EIQA 2NTSP 4P5TC 4MCYA 5DO2C 3N40P 3WJJA 3U79A 3S3CB 3LH9A 2DWSA 3RWCB 3B2PA 2OYMA 4YMPA 5I1KL 4DEPC 1UKTA 7CGTA 4PWGA 4DGYH 4H0GA 5FPIA 4RX4D 3MGAA 2W88A 3RFZA 1AI1L 4ZODA 1T1WA 2WSKA 3MKKA 15C8H 4LFHD 4ANVA 1CF1A 3SJVA 3WN5B 4I77L 2B2XL 4Q14A 2EE0A 2WKOF 4HIHA 3RIKA 2WK2A 5FW8A 3ZTJH 3PWPB 4MMYB 4HLZG 4L9LC 5E4OA 1UUSA 4BKSC 3HG0A 4OZGF 5IOKA 1ZLUK 3PHQB 2OSWA 3ME0A 2AJYL 1DQDL 1HNGA 3ARBC 3FQRB 2QV4A 4MASA 5I0VA 2VLJE 3KCWA 4YQXH 1DBMH 3SPCA 4EI5C 2G3ZA 2ADYA 4X7SL 1XGPA 4K3GA 1NBZB 4DW2H 1H5BC 1F02I 3PXLA 4ZBJA 4HWBA 2OR7A 1U33A 3V4PA 5IIEA 1NIEA 2VMDA 4HXBL 3K6OA 5FKAA 4J1UA 3KPPB 1XR8A 3QR2A 5DSCB 2JTYA 1GC1C 5I30L 1R3IL 3BZFA 3TA3A 1OARH 2RHEA 3SKUD 2YKKA 2XCMC 5SX4H 4MVBC 3FO0L 4YGVB 1BV8A 1WUZA 2VLME 4N2NA 4BKTC 2VJ8A 3ZUNC 1SMDA 1U92A 1EAPA 3FPYA 3TNMB 1D7BA 4NHUA 1DVXA 2Q6WA 2UY7A 1FNGB 1CT8B 1UJTA 2I60H 2XXMB 3BYTA 3O4LD 4HJGB 4JANB 4JPSA 2GC7C 3IFPB 1HHJB 3FO2A 5GJTL 4JFQA 4EZMA 4RSYA 1ZOXA 3HZYB 3NSXA 1F4XH 2BP8B 2FK9A 4GRMA 5JLZB 2A0LD 3UMTA 3OPZH 4YDLC 2YK1L 3TJEL 1CVRA 5FK9B 2MCPH 2KLTA 1TZHA 3DVNA 2NDFA 2YPLE 4FNPA 1MCJA 3DXAE 3MVSA 1BPVA 1SXNA 1JHTA 2HN7A 1E8ZA 3RKDC 3V5KB 3EOAA 1E7VA 4X9IA 1BZ9B 2XXCB 3G08B 4JFOB 1H0DA 4JO3L 3H53A 3IFLH 1X5KA 3MXWH 1T5KA 5BMFH 4U3HA 4M1CD 4PJXB 4GI9A 4HHGA 3HBGA 4GXVL 3RWFB 3PL6A 3W5NA 5CEXB 2O4EA 1HWWA 2WJ5A 5CEYA 2VITA 3MODH 1A6TB 4OD3H 4Y2DB 4HG4K 2OULB 5IOPA 2R23B 1BAWA 3GSVB 2R0KL 4MBRA 1XCTB 3HB3D 2C9SA 4MQXC 3RPIA 2BNRD 3APDA 4HAKA 1KTDB 5TH2A 3TEWA 3K0YA 4U33A 1TZIB 1WBXB 3DVFA 1T2XA 4QRUA 4JG1H 2IPKB 3BO8A 1X5MA 3F2LA 1AXSB 2CGRL 2ZOKB 2ZWYA 4MJ2A 4QIRA 3WN6A 3VNZA 1VACB 3V4VH 4DCQA 2VIRA 1VPOL 4S2SA 5E99H 3OSVA 4LLDB 4WK4B 3CFDA 1N2RA 4XMZA 4HJ0C 3VFWA 3GPEA 2P80D 1YYLH 4FNUA 1NM9A 1J8HA 1OWWA 2CHZA 4MQ7A 3EGXB 3KDMB 1RIHL 3CSPA 2ISDA 3S3SA 4JRXB 5A16A 2YEQA 4G80B 4BINA 5LGHH 1IL1A 4IBYA 3V6ZB 2XLLA 5F96L 5KAQG 2NUPB 1SMOA 5CGMA 1B2YA 1A47A 2AJVL 2ZZUT 4PJCF 3RGVB 1MEXH 4R2GB 2GTZA 3F83A 2C4FT 3EJJX 4XI5D 3TT3L 3VFOA 1MRFL 1V5JA 2YQGA 2P5EB 2W5PA 2F74A 3G6AA 4Y4HD 3SKNB 3Q5OA 1SEQL 4N4YB 2D2OA 4FAAB 4PUBH 5B38B 3DECA 1WUNT 4P2QB 3JT0A 3VXMA 2CO1A 3OZLA 4XVJL 4Y16D 4E9SA 1SVBA 3BVDB 4XOEA 2X1WL 3R8BB 3ULSB 3V2AR 4P2RA 4XN1A 3MRIA 3DV6B 1L5GA 1DE4B 1MRDL 4Z3TA 1RK0B 4HAFA 5DMGD 4DSYA 4RMRA 1JIBA 2XICA 5IHUL 5ID1B 2X0WA 4I7ZC 3ILPA 4BRVA 1KGIA 1SBSH 3GSOB 1W72L 1OT1A 5DYOB 5DRWB 3TP4A 3QXWA 3INUH 4Z3EA 2IBGA 3MCG1 3FAXA 3STZB 1FAKT 3KL5A 4LEXH 1UA7A 5H35A 3COOA 2R9HC 5AVZB 3APNA 3FL7A 3MR9A 4L4TB 4NKOB 4LSRL 5F6HJ 1NJ9B 2CO3A 3B9DA 4UM8B 2VLLB 3SDCD 3T4AB 3G6DH 2DIAA 3F65A 5HI3C 3WFBH 1GCYA 3VFTA 4AG4L 3FHAA 5T3ZL 1XGYL 4PRHB 3SE8H 3CWGA 5IW3A 3TEUA 3ARPA 3L13A 1WWBX 1PDKA 3WIFB 2E59A 4LSQL 3T1WA 1GH7A 3DX6B 4EVNB 4RFEA 5A3ID 2E46A 3PUUA 4OV5A 1L4IA 3E3QE 4UM9A 4EZLA 4ZQKB 2ICWJ 3KJ6H 4PD4K 5ICUA 5C8JA 3OZ9L 1RERA 2Y7QB 1QBBA 1UUNA 2HT2C 4ONGH 4BCXA 5I8CA 1NGWB 2Z7YA 3REVA 1GAFH 1UZ8A 4NJ9H 3RIFF 1CDGA 1OAXL 3VXRD 2ZP8A 4JKMA 3PGCB 3F64A 1E6JH 1YC8A 4CADA 3DMMD 5HYIA 5GRVL 5JDSB 2NY0C 3GRWL 4R84A 3BT2H 5LDSA 2X9YA 5JR1L 3QORA 4U1SA 1JGIA 4W9ZA 1VAHA 4FTVE 2DQMA 2OFQA 5EUKA 5J1AA 1E5YA 4F33B 3S4SB 1DQKA 2DI9A 5KSAA 2X6AA 4HUUB 4FQQA 2AJ3B 2P49B 3OL2A 1INDL 4JJ5A 4N2EA 2DQGL 4ZNEE 3PWVA 5IESL 3WTVA 1M1XB 3RI5F 1JP5A 2H26A 1HSBA 4WWPA 4NZFA 3VRLF 4PY8J 5DQDH 1Q9LB 4XMXA 4D9QE 4HHAB 4YHZH 2WO2B 1TTFA 4ZAKD 3MNZA 2H45A 3CFBB 4JO1H 1JXGA 3S96A 1MFEL 1N9PA 1EXHA 5EZPA 5F3BB 2BNQB 4C56B 2YGVA 5D6CB 5I73C 3F5WA 3MFFB 3LKPA 4MHHG 4HJJH 3RPBA 4HV8A 1C12B 1I9JH 2DZEA 2ZOTA 3T2NH 3OMZA 1KXVC 1JZ7A 2QGDA 4JPIA 4LP4A 3KS0H 3EKCA 2HT4D 3TO4C 2XQYG 4PTTA 3D48R 4KKCC 3FT9A 4XX1E 5FCUL 2CJTA 3W5MA 4WTZG 5E94A 3GRGA 2TSAA 1QR4A 4PJ5B 3E1F1 1AZVA 3SY0B 2ZP0T 1PJWA 2R2HB 4O4YL 5DA0B 1RUAH 1MUJA 2JK5A 2V2WA 3RVXC 3CK0H 3WNPA 5FUZL 1SOKA 4JHWL 4DVBB 1XCQA 3S3DB 1A25A 1HYSD 3F85A 4F8NA 1PAMA 1KN4H 3ESNA 5ABZA 1KELH 1YVLA 4PJEE 4NZDA 5JXED 5HY9A 2NY4C 2QHRL 1ZTXL 4WQOA 5HP5A 3BCFA 4XT1C 3MYJA 1FRGL 4GLRH 1IEBB 1WD8A 2WXLA 2AEPH 3WEAA 2CK0L 2IWFA 4JCLA 4ZSOB 1BVLB 5I75B 3QIWB 1L9TA 4AQAB 3S4SG 3B2XA 3EADA 3U7WL 3VQMA 2P5WD 2WSDA 2XN9B 5LBSA 3BOVA 3N55A 5A6IA 4FMKA 1E9PB 2NYYC 3MOBL 4M6AA 5SWQA 4PJXE 2EC9T 4DAGH 3FCGA 4GBXB 1MFCH 3REWB 2P1YA 3TCLB 3BW9B 1UJ3A 3LVEA 3Q13A 5DJXB 1G7JA 1IMHC 3QHZL 1BZ8A 3NCJH 4FJYA 4LLAA 4JM2B 4QI3A 2FSEA 3E8UL 3HS0A 4QRPE 2HWZL 4Y1AB 3WDIA 3V9CA 2XWTB 2NNRA 4RZCA 4Z95H 2IANA 5DZJA 5D55A 2OQJB 4PI0A 5AAPA 1T83C 2IAMC 3M8OL 1A3QA 3UZVB 4K71C 1HEJC 4JG5A 5AD0A 1MFDL 4ACPA 4L2YA 4K0OA 3HPLA 4EBQL 2V9UA 2BPBA 4G82A 2A83A 3HMXA 4V1DA 3ECBA 2XWJA 3EBHA 2EDTA 4YZFE 1U8QA 5EOQL 4ZMAT 1OP9A 3IM1A 4ORZC 1FIGH 2YOAA 2PWGA 5C0BD 5AAMA 5DJDA 2I07A 1MHPH 3L5XL 5KVGE 1CICA 5C0RH 2WXHA 3GK8L 1CG9A 3BVVA 1SDAB 1OB1A 3DYOA 2YAFA 3NACH 1K4DA 3BGFC 3CG8A 4BKLB 4CN4A 2UXTA 5EU6A 2FZ3A 1UD4A 4BUGA 2BFGA 5DS8A 1PEWA 3DIFA 3G5WA 4LLUB 3MGTB 3K1KC 2P5EE 3OMNB 2ZUWA 4BCZA 5T1MA 3FN0H 4HPOH 2IIJA 3FTZA 4OB5L 5IMOB 2XVKA 3A23A 4LF3B 4W4OC 3R19A 1KCVL 1N0LB 4MB1A 1C8PA 4R26H 3OLDA 2GPZA 1OT4A 3QC6X 1PQZA 4YDJB 4D3CL 1BWWA 4YBLB 3PHOA 1X5ZA 5BQ7B 1KBGH 2F1EA 4FQ1H 3T0DA 2Q8AL 1IBGL 4WO4A 3D4YA 4Q6YA 5TDPA 1E9OB 3IN2A 3Q6FB 1CDBA 3O41B 3QJFB 3H56A 4G6AC 1GR7A 5A2LH 4A7GA 4ZD3L 4EXKA 5KAQF 1N6VA 4X7DC 3KL3A 1SXBA 4X6CF 2A6IB 1MAML 3VGBA 1KG0B 4BH7B 2GJRA 5KN5B 3BC9A 1FYTB 4K7FA 4YHKL 2PW2A 2DQFB 4HIPA 2ARJQ 1NLBH 3QDMA 2PWHA 1XEDA 1GHFL 1AO7B 1R3JB 4NC2B 4I9XA 5T8IA 2QSCL 4IBZA 5FIEA 3Q06A 4HJUA 5HYQA 4JAMA 2ZX5A 1HOEA 2EDQA 3AWFA 3QUZB 4R4FH 3DGCR 4E9QA 2DLIA 3WFDH 2FIKA 3UAEA 3H0TB 3OVUB 1Z5HA 1RLWA 3IF1A 4B9IA 1F97A 2WLIB 1MWOA 1HKFA 4L8DB 4ZI8A 1OGSA 4MSWB 2OZ4A 3ULAB 5AL0A 4TMPA 2O6DA 3S35H 1RZJH 3H7BA 5TE4H 2PXYD 4P46B 1NBYB 5IVNA 1YN7A 2M2DA 4LEOA 5JZ7C 3GI8H 2H2SD 3VWKA 4NJAL 1OLLA 3QWQB 1GGCH 2CLVA 4G9DB 4AEIL 3EJPA 2WXFA 2EXSA 1NL0L 2B5IB 2ILLA 1KTBA 2Y36L 5FYLH 3U36B 4XPBL 4N2KA 4NP9A 5FV2A 3SOBH 3X17A 4Q9BA 4U1IB 1IIKA 2R69H 1CF8L 1HILA 4M8VA 1ZK5A 1DLFL 5F7AA 3L1OL 1JRHI 2UXVA 4UQCA 4WGWB 1CXIA 4NM4L 2NTFA 3CVHB 3FONB 4OCYH 2FEEL 3HCVB 2AEQH 4P2OC 3FF7A 2BNQE 2BHZA 3GXMA 3MJ7B 5DC4B 4NZRL 2XWBB 1N0XH 3PV6B 4FN0A 1MFBH 3KLAB 1WHOA 3WLBA 4MTMA 1JYWA 2DYSB 3QCTH 5F1OB 5BRZD 3SKOA 4N9GA 3QXAA 5CN3A 2NY2C 5AALA 4DPAX 1E28B 3MRRB 4P9ML 5E8DH 1EFXB 2WP3O 3QCVL 5ICYB 3KS0J 2A74A 4FZEH 2DBJA 3ZDZB 5EO0A 3EYQD 3IFOA 2X4NA 4ZPTA 5EPMB 2HX8A 1ZRUA 1NGXB 4BQ8A 3C9NB 1Z9MA 3SGKC 2NXYC 5I75C 3N0PB 3NP4A 5J6HB 5D7LE 1ZD6A 3MLSL 4RX4A 4K94H 4I18C 3WO4C 4MAYC 2LT9A 1SDDA 4KX8A 4Q6IA 1XWVA 4N0CC 4QRSA 4QRQA 5EIIA 1PD1A 1ADQA 5LG1A 1Y7VA 3JWNG 4I4WB 2DS4A 3L5WB 4KROB 1ED3A 1BBDH 1QW9A 4A6YH 4JVWA 2ZJSH 2YD8A 1EO5A 4GW5B 4UT6L 1UADC 4ZSOE 3WE6B 3FCTA 3CZFA 2C1PA 1WBZA 4FYSA 4JHBA 5C70A 4L1BA 3ZE1E 1N10A 2XN9E 2DEYX 2XACC 4R90H 2DJMA 5EOCH 2X70A 4HU8A 3IMVA 5E2WL 1B9KA 1XF2A 5LCVH 1XIWD 2Y22A 4UTAL 3UAJD 4UBDD 2RALA 3MXVL 2R2BB 5C3IA 5FC9A 3PNWA 4N24A 1F3JB 1N4XL 5DJYA 3CX2A 4FP8L 4Y1AE 5D7IB 5BOPA 3O2WH 3T0ED 3L4VA 4AQEB 1MWAL 4GRWH 3NFNB 4H8QA 5IB4A 5B7MA 5IFJA 4OCLC 3H8NA 2X4OA 1S9YB 5EV7A 1T0OA 2AJXL 5EZLA 4F7MA 4PWEA 1KV3A 5DMKB 1SYVA 3JWDC 5E7FA 4KK6C 1MZZA 3V6OC 4JO2H 5K9QI 4KZEL 3JZYA 1OGAD 4IRSB 1JXJA 4YSAA 1MHHB 4BQ6A 2ESVD 3EYFA 1OAJA 3J07A 3HKZA 5E9DD 5DFVD 3FB8A 2G3MA 3O4LA 4X4ME 2E75C 1I82A 5E5LA 5HGBA 3D39B 3BKML 3FW6A 4TKWA 2NZIA 3QXUA 1GY2A 3OR6A 3FTGB 5B3SB 3P02A 4BE5A 1QSZA 1EAQA 5KSUA 3SPVA 3ARFB 8FABB 2R29H 5LN4A 1TF4A 1TVBB 1E50A 3HUJB 1DQLL 1ZSDB 2QFPA 3SYAA 2ZX8A 5I0WA 1W8EA 4ODUB 1U4EA 3B34A 3QCUH 3U82B 5ESQB 2H6PA 2JQMA 1K4CB 4MMZB 5IJCC 1KIRA 1HNYA 1QPXA 5E1AB 1BW8A 3EFOA 2Y6SD 4E9WA 4UDTB 3D0VB 4OAWB 2H1LM 4R7DB 2OP4L 4U7KA 4UQ3A 1UWEL 2PCPA 4PRAB 3IDIB 3T3ME 3AG4B 1YECL 3AXLB 4MXWL 5BOZG 1E90A 3WYRA 3V0JA 1BWMA 1W0WA 2K6WA 1G9ML 4K2UH 1C16A 2X3AA 3KPSB 2O5ZL 3DGGB 5DFTA 4A2DA 3F04A 3QRGL 5EO9B 3S8FB 3FUFA 2X0VA 2IOOA 2J1XA 4X4XA 1SLWA 2F53D 4W9LC 2CLRA 1DJZA 4FNRA 1HJBC 3ZKQD 2FGZA 4HIIA 1OTSC 2WNWA 3UTSA 1UA6H 1A0QH 4HUMB 2XFGB 5JPMA 2ALAA 3BAKA 2H3NB 1DVFC 2HRPH 2JFCA 1QA9A 3BH8A 4UUJB 2P80A 1LE5B 2W60A 3OC5A 5F2FA 3IU3A 1SJVA 4A6YB 1GW0A 4OJCA 4K9EH 1YLBB 1A1OA 4QHUB 1A3RL 4J28A 1FCGA 2Y1YA 1U8OB 1NAML 2Q76B 3CU7A 4NHCH 1KBKA 5C0NC 2A6DA 3L3JB 5DJAB 1A7OH 5DUBB 1P0SE 5TE7L 3AS0A 3RL2A 2EUZA 3TH4T 4PGBA 3UZQB 1JTTA 1CGWA 1TENA 2NX5A 5C08D 1AXIB 1GGIH 4C59B 1FZJB 3B9VA 2VUOA 2D7NA 3V0DA 1RJZB 3ALPA 4OZHF 3RB7A 5KJRH 3C60D 3JWNC 3U0PA 1QHQA 4L3ED 1FQ9C 4Y16A 4MNGA 4P3DA 1TMQA 4FFZH 1C5CH 5K93A 3DURA 3DIVA 1WFNA 1P5UC 2GT9A 1W80A 2CKBL 3NFPB 3RVWC 5T33H 4DZBA 1CFQB 1JDDA 3F3HA 5IVXB 3IRZA 4Y19B 1UB6A 1ZWIA 4HIXL 2FH6A 4XPHH 4E42A 5TE6L 1HEZA 1NGPH 1RCYA 1W0VA 2JV6A 3B43A 2IDQA 3DBSA 4NSKA 4AIZA 3W39A 4EZKA 5LQBL 2NXZD 3MGOB 1O5DT 1QLFA 1VA9A 2BS71 2DWEA 2WZ0A 5H2BA 2VDNB 1R3HA 4WUKH 4MNHB 3QFJD 3AY4A 1MELA 2CLZA 3GMRA 2EDEA 3V4LA 1P4UA 3QEUB 2XKUA 3KYNB 1EERB 2WYHA 2DIEA 1OSZA 3LQAC 4Y9CA 1PLBA 1A4CA 2E7HA 3D18A 4XVSH 2EVIA 2GBUA 2P48B 2E9GA 1F3DH 1U3ZA 4IRZA 1NWOA 3CFCL 4YBHA 1DO5A 2TRYA 1H3GA 1KIQB 4NO3B 4Y2OA 2XWDA 4UQ2A 4LRNL 5KVEL 3C6LB 3LZQA 4K7PY 1RVFH 4MA7H 5AKRA 2AKRA 3IKCA 3VMNA 3HEIB 4PY7A 3DX1A 1UT9A 5F1SA 3JTBA 1N18A 2Z91B 2H9GA 2P7TB 3ZDZE 2A9MH 4OI7A 3DMMA 3S6CA 2VDMH 1F1GA 2BIPA 2TRHA 3C5JB 5IQOA 3LKRA 4U1JB 3JWOC 4KZ0A 4Z7IA 1YJDC 4I1NB 5GIRB 3OX8B 1OV8A 4LOVA 4DFIA 3D33A 3Q2WA 5D1QB 5GRVK 5LWYL 1J9QA 3EHBD 4X6DE 2SEBA 4QXUL 3VGFA 3P69A 1QFUH 3DRTB 1NGZA 4JHVA 3SDXF 2OL3H 1PKQA 3TYGL 5CU9A 4MLSA 4DESA 3SO3B 5FGBC 5KW9L 5JPNC 4YAQB 3VXTA 1L9NA 1PG7X 4NNYB 4L5FL 1BQRA 1J87A 3AB0C 3EW3B 1MCKA 2J4WH 3IE4A 4RAVA 3BWUC 2AERT 3QUYA 2VMFA 3Q6GL 1TPXB 3ZQXA 3U48A 2F5BL 5EOCJ 5DEGB 1QLEH 4YE4H 5HI4D 4YHNB 2AXGA 4CC4C 4ZAKA 1T21B 2WQ8A 5D2LF 1L7TH 4HJEA 3L3GA 3TA4D 1MHEA 4IRSC 4K15A 1AMXA 1E6OL 3F7YB 4PS4L 3SE6A 3WS6C 2QSQA 1NTDA 2NY1D 4AC2A 4BFNA 1FORH 5JQ6L 4AM0B 3GEWB 4QHMB 1GZHC 5D7IE 5D6DC 2EDJA 4E5XB 2R0LH 3NZHH 4PB9H 5I1GH 1HIML 5CR8A 5L8JB 3CCHA 4TM9A 1V3JA 3CFKA 1UYWL 2JKWA 4QOKE 1PZ5B 3F7QA 4IJ3C 3UCRA 3NJXA 1T1ZA 1SHMA 4MA8H 1T0NB 2CDFB 3G6JA 1VFOA 1RKRA 4YFLF 3D39E 2VT0A 3QP3A 4AQOA 4ZFFA 4XP6H 3BI9X 4HK3N 4NRZB 4PJAE 1NEZG 5I8KH 1UXSA 3S37H 4W9EC 3H9YA 4NAMA 2F54B 3PPSA 1HNFA 4QXGL 4YC2C 4ZTEA 2A6JA 4JFUA 1NOFA 5L4IA 1U8IB 2X9ZA 2NRDA 4QMEA 2H0JA 2ZSWB 3MUUA 4QRRB 4AL8C 2XUWA 4IHBA 4Y5XB 3QS3A 1VZGA 2P5WA 2EEAA 4ZFOL 3HVNA 4XAWL 3KW8A 5J3HC 3W0WD 5DK2A 3BH9A 1YUHB 3F05A 3RA7H 1OAZH 2BH0A 4N2DA 3NABL 3QNYB 4OQTL 3VACA 4B9CA 3MLZL 2CM6A 1UURA 1XR9B 2FX8L 2QPFA 3KPSE 3HJEA 4UOQA 2VDMB 5E95B 4AENA 3HMWL 4X80L 3US0A 5GGQL 5JUEL 5FYKD 1T4KB 2JB5L 5D7JC 3WEOA 4BFRA 2OXGA 1H19A 4XCCH 4D8OA 5FGCE 4JPVH 1DSWA 1A6PA 2BZ7A 1DBKH 2P3YA 5CD5C 3O2VH 2ITCB 2JKLA 3KXFB 1E4KA 3LH8A 3AT9A 1U91A 4LPTA 1T89C 4H25A 4U2ZA 1ZKAA 4E5XG 2XWRA 5CCHE 2CHWA 2ZIDA 3K7UA 1KCRL 3IDMA 1Y6NR 3O4OC 1PZAA 2LE9A 4JPWH 5DRNA 3RVUC 3N44F 4LCWE 4DKTA 2BOBB 2HSIA 2QPDB 3DSNA 2Z8RA 4ZJ9A 1G7MB 1I8AA 2CCWA 5MERB 3HNSH 3SIKA 3QQ9C 2FJGA 5EORL 3BFOA 2EE6A 1O7DC 3AS3A 5B8CB 1U3JA 4YR6A 3K6DA 4P57B 1F56A 3APFA 4P5TD 5DO2D 1TCRB 5DK0B 5EZOL 2Z92A 4NWTL 2O1AA 3MBXH 4DGVH 4W9DC 3BDYH 4GRWE 5EU4B 2K70A 4MA3B 3VH8B 1MCSA 2VRQA 3HPJA 2B4CC 3MLPA 2X4SB 3MX0A 1RU9H 2DD8H 2E9JA 3BWUF 1G6RH 3LNFA 4G3YL 4LAJH 3VWJC 3TGXA 3D85A 1UOLA 3D4CA 1LMKA 1OP3H 3GZPA 5TF1H 4U6YA 1A4BA 1WIOA 3HC2A 3MV9D 4L0PB 4HULB 5HDQL 3ARUA 1U8HA 1EHLL 4EQ2A 1ZCRA 2JH2A 1IC0A 5I1EL 4B9FA 3MREB 4DGIL 4NFDA 1H6EA 4ELME 2PLTA 1J1PL 3ZW3A 5LN8A 1CBVH 4F15B 2VLMD 4MQSB 1XSJA 1MW1A 3IRCA 4FQ2H 2E7DA 4YLBA 1G7HA 3H55A 4WEUD 3BRFA 2HX9A 2JCCA 1RZFL 4KH9A 3HUJF 3WLWC 4IBUA 2VMJA 4BSWA 4X5WB 4P4KC 3H7LA 3I9GL 1GC1H 3GPSA 4M7JL 3HC3L 4NUGH 1VESA 5I15H 3MZTA 4KY1L 4AW7A 2DWDA 1HC1A 1Q9OB 1CXKA 1A4AA 3MRDB 6FABL 1RZ7H 2HG5A 1UGKA 1M4KA 1P4BH 2YPLD 4G43A 1R0AL 4NX0A 3DXAD 1Q90A 3E2HC 1Q0XH 3GMOA 4UT7L 4N6RA 2L7QA 1ZK9A 2IEPA 5ISZB 1A4KB 5GZNA 4H40A 1AIFB 5I71B 4WU5A 5C2BL 5SWZB 4IRJD 2EIKB 2PUQT 4D7BA 2PPAA 1A6AA 4ZXBB 3LHPH 3SGJA 5JHDE 4QHPA 4U1NB 1KF9B 4M5TA 5JHMA 4NQSB 4AUUA 4OFPA 2WUCH 4AYID 1M56B 1Y0LA 3MRLB 2XV6B 4RIRA 3RVVD 3WEMA 3HC0B 1JPFA 1UATA 3AVEA 5D1QE 4F2FA 3VXNB 3RQ3A 3K2KA 4TL4A 1MRCH 2BW4A 3QO0A 4YGAB 4Z78B 4UILH 5KVDL 4PWIA 2VLKA 3QFDB 3ZVVA 4D7PA 1ACYH 2LFGA 3CN0A 3DJTA 1FL5A 1ULVA 5HTSA 1BVKB 2ZKXA 2EZ0D 1ZIBA 5EU7E 4AQ1A 4YX2H 5IUCA 2YFOA 4MQXD 4F57H 1GYVA 1I9IL 1AG6A 2J2ZB 3TO2B 1GTNA 2EP6A 3WHE1 5ICZB 5IQ9B 3GIZH 3FMGH 1QI5A 1U3HC 4O51B 1HFUA 2Q10A 4DOHB 1BFOB 1KACB 1AYOA 5ABDE 1UWYA 5I74B 5BRZA 1ZVSB 1FHNA 2UZXB 5CIPB 3U9UB 4I5BA 4YDKH 5CZVL 4AYDC 3HZKA 3DOIA 5C07B 3S8WA 3EDDA 3O45B 5C92A 1H6FA 2PETA 3P3UA 2IWKA 2ZG3A 2K45A 4L8SA 4ZT1A 2J1WA 5F6HI 2H41A 1X9RA 3MCKA 3QNXA 3VFNB 5IVXF 5I23A 1JNHB 5D93C 2Y1ZA 2OJZH 1FC1A 1G0DA 3ALXA 2OTUA 3CJJA 2D31A 3HN3A 2B1AL 5F7KC 5AKTA 1KXTB 4AYSA 2PTVA 3B7UX 5HPMA 4P59L 5E9AA 2VR4A 4AC4A 1HZLA 5DEFA 4V2BA 4YDIH 3R4RA 1WCQA 5D2NE 5G4MA 2OSLB 4IGBD 3RUGA 5TQ0L 1XGRA 1OE2A 4O02H 3QIUD 2OMVA 5CCKH 3OAYK 5HDBF 1K2DA 4YIQA 4NIKB 1R3KB 1HH6B 2F7OA 4QRRE 1ZE3C 1Q9KB 5ADOL 2NR6A 3WFZA 1ZGLM 3MLTA 1T6WA 5E03A 1QO3B 1VENA 1E30A 1FFTB 3DX4A 2CNYA 3D0LA 3FU7B 1IQWH 2Y6TE 2Q87A 3WS3B 2X2JA 4XPGH 2XZCH 2Y23A 2Z93B 3LS5H 1RZKL 1NCAL 3Q9QA 3E6HB 3BXNB 5ACLA 3L9RA 2K78A 1KC5H 4MD5A 5JYMA 2ZXEB 1ND0B 4LVOB 2XQBH 4YXKH 1YEIH 1DBJH 3T0EA 3QXDB 2ZYRA 4UTAA 3RTLA 4ZMVA 3D69B 1BZOA 3LCYA 2KC0A 5H37G 5F0MB 2GJPA 1V54B 2OCFD 5HGAA 3KXFE 4XXCA 3GSRA 1MWAA 4PY8I 4AKPA 5I8OH 1D5MB 2QVFB 2WXJA 4XXWA 3NCFB 4EKXA 3K6SB 2BWDA 4XCYB 4KI5E 2ZTBA 3TZVB 2EQDA 2ZOUA 5C0GA 2W9DL 1YEEL 4OF6A 2VNCA 1R1CA 1CGVA 4GG6A 2FLBT 3LRGA 5DMJB 2V3FA 4F2MA 3LN4B 2K7PA 1I75A 4NP4L 4FA7B 2ATKA 4NQVB 3WKQA 1JZIA 1KGXA 4FTDA 1Z5LA 5FA4B 3K8MA 2OJEB 1KIUA 5BW7C 2BSBA 2WVSA 2HJLA 5C7ZA 2GTWB 3DVGA 3F7PC 4FQIL 4JPQA 2YQ3A 3LEVH 3O8XC 4W9IC 3ZYJA 3MPCA 2EDMA 4RRPA 3PWPD 3RDTA 5HYJA 1RZGB 4L1LA 1JV5B 5SX4I 1VFMA 5GGUB 3OPUA 1BM3L 2XBDA 3MO1A 5ENWA 1N68A 3TPKA 1T7WA 1TO5A 2R2EA 3QUGA 4JY5H 3LPPA 4LLWA 3EFFA 4IYKA 4S1DD 3EO9L 1BOGB 4Z7UE 3BN9D 3PWNA 3TEYA 4D9QD 1Z9SB 2DWXA 1PLCA 2LU4A 3PAYA 4R6UA 1CO1A 4IKJA 4KAQL 4FADA 3WJLA 2GY5A 1HH9A 1EANA 3F01A 3X3FL 1N7ML 2VDKB 2BHFA 2BSRA 4PRNA 4UTBL 5IK3A 4M8QB 2F53A 4XO8A 1AJ7H 3D4ZA 1CYWA 3B2UC 4TNVK 3TN0A 4KQ4L 4DVRL 3ROOA 4OF8A 5E00B 2CH8A 1FVCB 4GW4A 3GHEH 2R7EA 4P4RA 1QR1B 4LB8A 4MHHI 3QQDB 2R1XA 1HX0A 4XMLH 5FF6A 1RK1B 5EF2A 5KG9A 3BE1L 2R8SH 2HJKA 4WI0A 2Z35A 1JJUA 3MNDA 5CSZB 1QQDA 3TBTB 2DBLH 4YXHL 1MVUB 2D03H 5FUOL 4PRDB 4B95C 1J12A 2DIBA 3DI2B 5ALBL 1QBMH 3TBVA 4CSZA 4KKCD 3G5ZB 4Y9BA 1NAMA 1NA8A 4WEBL 3A5VA 4FI7A 4JY6A 2DKMA 4XB3A 4L3EA 5I6PA 1KDIA 4ONOA 5CJOL 4HK3J 4Q9RL 1OB0A 5ISZE 4FA6A 1U4FA 4EUPA 5SWZE 1MCBA 4RNRA 3W9DB 4AXWB 2ZUVA 1P7KA 1XT5A 1TU2B 4YJZL 1BQKA 3NJHA 1FC2D 3C2AH 2Y2WA 1YUKB 3DHJA 4Y4FB 4DGYL 1XQ4A 43C9A 2IGTA 1RJLB 15C8L 4MGXA 5F3HB 2OV0A 5E8PB 2OYLA 2G5BB 3FYEB 3LKOA 3KG5A 4QDGA 4PJBA 4NT6B 1TZOA 3QZBA 3GUTA 3GS4A 1RIUH 4WWOA 3L6FB 5KS9E 1P9MA 1P1ZB 3S34H 3KYAA 1G0YR 4OJAA 4OQ1A 2XHNA 4NN5B 1SQMA 4WNJA 3IJYB 3E7JA 4XE5B 5L2KE 3OB8A 4YQXL 1DBML 2YWYA 5JHAA 3VG9C 5IJKC 4L29B 5IF0A 1F1DA 4DW2L 4JRXD 1S7SB 3GIVA 2Q7AA 3TC9A 3SE3C 3TFBA 2DPKA 3F6IA 3FZUD 5A6MA 3Q9PA 5H94A 3RGVD 4MJ4A 4R2GD 3IJHB 4GOSA 1OARL 4F20A 1JMZA 1YNLH 2WYZA 4B27A 2EXWC 3NIFB 5C07E 1M53A 2BVPA 3EGDA 3LNHA 1QTYT 3HRZC 4P2QD 5GRJH 2IPUG 3GJFB 3UC2A 4GXUN 4DGWC 3GO1H 1UZ6E 4QRBA 2R1WA 2VSDA 2I60L 4X4YA 3KPOA 1QYGH 1QFHA 1J18A 5T3XD 3FKUS 1BZ7A 4A68A 4AZ8A 2YXWA 4KTEH 4PJ7A 1CPUA 3QG6A 2VRKA 1F4XL 4KBPA 3UJTH 4N25A 3OPZL 4FFVC 4PG2A 4Z7NE 2DM3A 1WWAX 5DZOA 1I8MB 1Q8MA 4J3OH 4XNQA 2MCPL 4YHLH 3BSGA 1GYWA 1NUFA 4CGTA 3D08A 1YPZE 3FUHA 3B5GA 5AVWB 3FHQA 3CLWA 1FYHB 4H8WC 4MCZB 3BP4B 4XHQA 4HETA 2P45B 3AWEA 4Y2LA 1JD7A 2CUAA 3HAEG 4QTFA 1HYRC 1B90A 3D07A 3IFLL 5LO7A 5K1VA 4L4TD 3LRHA 4H8HA 3MXWL 3S36H 4JGMA 5BMFL 4R5XA 1EHNA 1IVTA 4XMUA 2DI8A 1RJYB 4PRHD 1UFGA 1OIOA 1H8LA 3FH5A 3QDJA 3MODL 5E70A 3NIGB 3IJSB 4OD3L 3RJOA 2DV6A 1OW0A 3TU6A 1E3FA 3RWHA 4X6FA 4JHZA 2V2TB 4PJFB 4OD2A 3X14B 3WIIH 1FVEB 2AF2A 4HZLB 3GMQA 1K6QH 1L0QA 3U30C 3UJJH 1ILSA 2LV4A 3L1GA 5HI5C 4JG1L 5FKPA 5J12B 3T8MA 3MRJA 1Q9WA 2WQUA 3OR7A 3L1FA 1EV2E 3IJEB 3V4VL 1AD9B 4NC0B 5E99L 1BFVH 3ILQC 3TV3H 4LOFA 5BO1H 1YYLL 3E6FB 4KFZC 3MBWA 4LBEA 3VM5A 1NUNB 5LGHL 1HESA 2CBPA 5F7EH 2VC2H 2FJFA 3GLEA 2DY2A 1JZGA 1J9CT 1AY1H 3A0OA 1MEXL 5CU5A 4RMWA 4OCMC 3WNLA 1NFIB 5FYJH 4KK5D 4XGZB 2KZ1B 2FR4A 1F11B 1BX2B 2BY2A 4LCYB 4PUBL 4RH4A 3IGAA 1PZCA 3QEHB 2CRMA 4R83A 3W38A 4XH2A 3KCPB 4WSJA 3WTUA 3OGOE 3RURA 3KGTA 4EN3C 1T22B 1TKWB 5F9JB 3DBXA 1WA2X 1S78D 4BQBA 4ZFOA 2YARA 4IU2A 1MIEH 3RWGB 1KJ2H 2EKJA 4WI7A 4CJ0A 1WCBA 2OMZA 2VISA 2FO4B 1CGXA 1XH0A 2V17H 3NEXA 4Z7QE 4FFYA 5I2IB 1SBSL 4C56D 3VFRA 2WO4A 2FT7A 3CVIH 3L3OA 3INUL 3QIBB 3B56A 1D3CA 3VB8A 3ZTDC 4XC3H 3P3SA 1OD7A 4LEXL 4OGXH 5M94B 5IVZA 2AXFB 1BIHA 4Y4KA 4U1GC 3UTPE 4NQCB 4APQC 1E8WA 4PYHA 4BK5C 2HJFB 4QO1A 4JPKH 3G6DL 3GSNH 2J25A 2JJTC 4HFUH 4UQIM 3WFBL 3AG1B 4JFYB 3WEXB 5EIVA 1EEZA 3SE8L 2YEZB 1CDCA 1W0YT 4PJ5D 5J11B 2VZSA 4LCCC 1HSAB 3GSQA 2F19H 2Q3XA 5I5RA 2NY2D 1JWUB 3MRKA 1CFNA 3O3AA 3KJ6L 1LTXA 3CFQA 1FFNB 1S4IA 2J8UB 2ZSVA 3HNVH 1KYOK 2QMKA 3F84A 1IUZA 4H1LG 4ONGL 4WTXA 5E51A 1GAFL 3GLZA 2NXYD 3BQVA 3Q48A 4NJ9L 3UFIA 3RY5A 4JFEB 4CAGA 3LPOA 4IBLT 3SDAA 3MJ9H 3KR3H 3H85A 4JN2B 4W4NA 4X8JA 1E6JL 3F12B 4EQ3A 1WSST 2VLJA 3BT2L 3LRLA 1R5VB 1FL3B 1QASA 3FAWA 4U3SA 2X2YA 3LZNA 1B4LA 2E7CA 4OCXH 1D5XB 5BS0B 3L7FA 3ZR6A 4JM2D 4GPVA 3GXPA 1WC7A 3Q1EA 5J13C 3GSXB 4Y1AD 3AS2A 1JGEA 5L88H 2X4QA 1QEWA 4H88H 3ATBA 4W93A 1SXZA 3UG5A 4TSCH 2PYEB 5DQJB 3DUSA 1CL7I 3FTSA 3GSUA 1VZHA 2WXGA 1AS7A 2YD5A 4MCYB 5JOFA 3VXPA 3CLFH 3FNKA 2OMYA 5DQDL 1BQLH 3AMKA 3GSWA 4YSOA 1O6SB 2E9WA 4R4BB 2BX5A 2W94A 3TVMC 4YHZL 3G9AB 4ATWA 1XXFC 1H3VA 3DTUB 3IMWA 1AANA 5E6IB 5IT2H 3JWDH 4JO1L 3KYMB 5F1NA 1LEIB 5AKSA 4JZOA 1T1WB 1OALA 4KK8D 4P5KB 4PVMA 5DVNA 2YD3A 4GMSH 4R4ND 4P2AA 4HJJL 2YPLA 1FWXA 2DIJA 1I9JL 1FG2B 3DXAA 4RZKA 1CFSB 1F4WH 1KJ2B 3SGEI 3T2NL 3RWJB 3ARXA 3I02A 3QZWA 4KRNA 1D6VH 3FT4A 5CP3H 2W95A 4IRJA 5I1AA 3KNBA 1G4MA 3O6FA 3DWTA 5D1ZC 2MOGA 3LB6C 4N0UB 1J0ZA 4WFFE 4OCSH 4P05A 1OE3A 1RUAL 2E7LA 1SJXA 1JGUH 3CK0L 4GSDH 4WW2C 1MVYA 4K5PA 3NOIA 5DHXB 2LQRA 1KN4L 4Z9KB 3V4PB 1KELL 1KZYA 1PD0A 4OR1A 5C0CE 1T7YA 2PMZA 4I88A 2JSFA 5L8LB 1L9SA 5DFWH 1FA4A 4HSQA 1OTTC 2AEPL 4XXDA 2HMIC 2MNUA 2I9TA 2HT3D 3T8XA 2GEQA 1EAPB 2FX9H 1J0IA 1E67A 2WN2A 3EAKA 2VR7A 3DK2A 2IWEA 4FC3E 1J05A 1XCWA 2E86A 4DAGL 1FYTD 3OJDA 1MFCL 2DMBA 3VXUE 3VI3F 5BXFB 3K2UH 1PFOA 3K4DA 4XB7A 1Y6MR 2CPCA 3WMPA 2B3IA 1AO7D 3NCJL 3BFQG 3NIGE 1YEGH 1IILE 2WPGA 3UDWA 4AUJA 5IMLB 2IH3A 3NBNA 1TZHB 3FHEA 3RX7A 4O2CA 4Z95L 5C3TA 1JHTB 1YEJH 4G71B 1QPPA 2NZ9D 4HCRA 4ATTA 4HXAH 1KB5A 3R7QA 5FO8A 5INCA 4CW1A 2D3NA 1IQDA 2QSTA 2C3VA 3QYCA 1GYAA 3WOVA 2NQ3A 3JBG7 1DVQA 3CDZA 3QNFA 1EEUA 1FIGL 4NEHB 3D6GA 1S7VB 1JHLH 3KWUA 2K4AA 1MHPL 2VDPB 2O61B 5C0RL 5EEYA 4P46D 2QVKA 3JWNH 3NACL 1NMAH 4JY4A 1K3IA 3MU3A 3U2JA 2M83A 2QVMA 3GYRA 3QIUA 3LD8C 2P8MA 5FOBB 5G4NA 1ZT7B 3BN3B 4PRPB 4QRUB 5C71A 2J5WA 4PN6A 4ZW6A 2CSPA 2X38A 4CKQA 4HBCH 2X6MA 2LVCA 4HEME 4OLZH 3FN0L 4HPOL 2D3LA 4ZX6A 2OAAA 1L0YA 4PP2A 1VLXA 1QZ1A 4A04A 5C0EB 2ZUYA 4R26L 1ZEAH 4H26B 4LSPH 4QYAA 3C5ZA 1MFUA 3VM7A 4HLEA 2WBJA 4JKWA 1KBGL 1T03H 4FQ1L 5CD3A 4KXCA 4WENB 3AREC 4M7KH 1E4JA 3BH4A 3GB7A 3NIFF 2F74B 3G6AB 1SLVA 4G9FB 5F8RC 4DP1X 4GIPD 2CNZA 2DRUA 4PJ8B 1GJWA 2A9DA 5DQ9A 4JJOA 4P2YA 4NQCE 1EFXD 2OYKA 1V7MH 1UWXK 2HP4A 3WNKA 1TEGA 1BXUA 1BHGA 3P9MB 4LARH 3MRIB 1GOGA 1L5GB 1NLBL 4LOUC 3BPLB 4JW3A 4O00A 2EXYC 3RWCA 2WBWB 1AGBA 3CFEB 1IGCH 1R46A 2B16A 3DV4B 2G9HB 1AZBA 2J5LC 1A1NA 4R4FL 5F6IB 4KO5A 4MRBA 1OHQA 2J21A 4WW2F 4YHMH 4BRJA 5CJ5A 1SZNA 3W11C 3WN5A 4JRWA 1FO0H 4FRWA 3WFDL 2VDQH 2XTJB 1J0YA 4ZNEA 4KROD 4PS3A 2HYMA 4WHDA 3CFNA 1YJDH 1OZTG 2J20A 3X1GA 2BSTA 3G3LA 3UYPA 3PHQA 2MTPA 3L3HA 4NNXA 3ZHFA 4P23B 4FLOA 7FABH 5IMKB 4M6MH 3FQRA 3S35L 2BVOB 3KVPA 4PJFF 3OKMA 1RZJL 5TE4L 2J71A 1NBZA 5TDOB 5BV7C 4UM9B 2AI0H 1RULH 4AOFA 4FNTA 2C7UB 3GI8L 3IN0A 3O6MH 3WJJC 5C8JB 3V0VA 4DUXA 4F9PA 1GGCL 4BFIA