4IHFA

Chasing acyl carrier protein through a catalytic cycle of lipid a production
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
336
structure length
336
Chain Sequence
b'SIRLADLAQQLDAELHGDGDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAPSAVIDATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTIIGNGVIIDNQCQIAANVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMRPITEPGVYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLERKVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase
publication title Chasing acyl carrier protein through a catalytic cycle of lipid A production.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/lipid binding protein
total genus 118
structure length 336
sequence length 336
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.191: UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase.
pdb deposition date 2012-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF04613 LpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4ihfA02
3.40.1390.10 Alpha Beta 3-Layer(aba) Sandwich Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 MurE/MurF, N-terminal domain 4ihfA01
3IGJA 2OI6A 2WLFA 3FWWA 3BRKX 1KQAA 1TDTA 1Z90A 3P47A 1KRRA 3R1WA 2W0VA 4R36A 1LXAA 5E3PA 4N27A 3C8VA 3R2WA 2QIVX 2FKOA 3BSYA 2JF2A 3KWDA 1E8CA 4HUSA 4IHHA 2V0IA 4CVKA 1SSMA 2Q4JA 3FOQA 1MR9A 1S80A 1QRLA 1MR7A 2QIAA 4KNXA 4M2AA 3ZM6A 3FSXA 4AA7A 2ICXA 3BSWA 4C12A 3DK5A 2JF3A 3ST8A 1G95A 3VBMA 5ADXV 1GG4A 3CJ8A 3R3RA 4N6BA 4EGGA 3MC4A 2GGQA 3R8YA 1KHRA 3JQYA 3V4EA 5L6SA 5DEMA 5F42A 5E3RA 2AM2A 3NZ2A 3BXYA 3SRTA 1KK5A 1SSQA 3MQHA 2V0KA 4EA7A 4BUBA 1V3WA 3GOSA 3ZM5A 3BFPA 3TV0A 2XJAA 3MQGA 1XHDA 4EQYA 4R37A 3I3AA 3R5CA 4EABA 4KNRA 2WLCA 3SPTA 4EA8A 4E79A 1YP4A 4M28A 3VBPA 4HZDA 3FS8A 5AFUU 4MYOA 4E1KA 4M98A 4ISXA 4E6UA 4G3SA 3FTTA 3IXCA 2OI7A 3TK8A 3KWEA 1KGQA 3D8VA 1HM0A 2P2OA 3ZL8A 1SSTA 1KRVA 1QREA 2AQ9A 3EG4A 4H7OA 3VBKA 2WLGA 2WLDA 4N6AA 1MRLA 1THJA 3FSCA 4E75A 4EAAA 2WTZA 1KGTA 4M9CA 3TWDA 1FXJA 3GUEA 3KWCA 1HM9A 1J2ZA 1QRGA 3HJJA 2V0JA 4N69A 4M99A 3R5DA 1HV9A 2ICYA 2IU9A 4CVLA 5DEPA 2VD4A 4IHFA 3VNPA 5U2KA 2OI5A 4MFGA 1KK4A 5AFUV 3VBLA 2V0HA 3D98A 3BSSA 2VHEA 4HURA 4G87A 2IU8A 3DHOA 3OU9A 3OTZA 2V0LA 4G3QA 2AM1A 3OUPA 4IHGA 3PMOA 2QKXA 3OW5A 4K6RA 2XATA 1KRUA 3OTMA 4KPZA 4MZUA 3VBNA 2GGOA 3R5BA 4AC3A 5E3QA 1QRMA 2I5KA 3T57A 3TIOA 4J18A 4M2BA 1QQ0A 2WLEA 4FCEA 2IC7A 3FSBA 1KK6A 1FWYA 3R3IA 1OCXA 4HZCA 3VBIA 4ZIYA 1QRFA 3P1BA 1T3DA 5DG3A 4EA9A 2W0WA 1G97A 4G3PA 3TDTA 3TISA 3FSYA 3I3XA 2IUAA 4QF5A 3DJ4A 2NPOA 4QDIA 3Q1XA 4KQLA 4AAWA 2OEFA 3R0SA 3R5AA 1HM8A 1YP2A 3ECTA 4KPXA 1YP3A 3VBJA 4C13A 4HCQA 3F1XA 4J09A 2RIJA 3GVDA 3HSQA 2OEGA 2TDTA 4E6TA 1XATA 4R7PA 1V67A 3EH0A 4DCLA 5ADXU 5L6VA 4CVMA 3EEVA
chains in the Genus database with same CATH superfamily
3IGJA 2OI6A 2WLFA 2IOJA 3FWWA 3BRKX 1KQAA 1TDTA 1Z90A 3P47A 3OH2A 1KRRA 3R1WA 2W0VA 4R36A 1LXAA 3WSFA 5E3PA 4N27A 3C8VA 3R2WA 2QIVX 2FKOA 3BSYA 2JF2A 3KWDA 1E8CA 1NMPA 4HUSA 4IHHA 2V0IA 4CVKA 3SUCA 1SSMA 2Q4JA 3FOQA 1MR9A 3GQ9A 1S80A 3GQAA 1QRLA 1MR7A 2QIAA 4KNXA 4M2AA 3ZM6A 3FSXA 4AA7A 3WSGA 2ICXA 3BSWA 4C12A 3DK5A 2JF3A 3ST8A 1G95A 3VBMA 5ADXV 1GG4A 3CJ8A 3WSIA 1KO7A 3R3RA 4N6BA 4EGGA 3MC4A 2GGQA 3R8YA 1KHRA 3JQYA 3V4EA 5L6SA 3WSEA 5DEMA 5F42A 5E3RA 2AM2A 3NZ2A 1M8NA 3BXYA 3SRTA 1KK5A 1SSQA 3MQHA 2V0KA 4EA7A 4BUBA 3L2BA 1V3WA 3GOSA 3ZM5A 3BFPA 3TV0A 2XJAA 3MQGA 1XHDA 4EQYA 4R37A 3I3AA 1L0SA 3R5CA 3EEQA 4EABA 4KNRA 2WLCA 3SPTA 4EA8A 4E79A 1YP4A 4M28A 3VBPA 4HZDA 3FS8A 5AFUU 4MYOA 4E1KA 4M98A 4ISXA 4E6UA 4G3SA 3FTTA 3IXCA 2OI7A 3TK8A 3KWEA 1KGQA 3D8VA 3OH3A 1HM0A 3OH1A 2P2OA 3ZL8A 1SSTA 3L31A 1KRVA 1QREA 2AQ9A 3EG4A 4H7OA 3VBKA 2WLGA 2WLDA 4N6AA 1MRLA 1THJA 3FSCA 4E75A 4EAAA 2WTZA 1KGTA 4M9CA 3TWDA 1FXJA 3GUEA 3KWCA 1HM9A 1J2ZA 1QRGA 3HJJA 2V0JA 4N69A 4M99A 1KNXA 3R5DA 1HV9A 2ICYA 2IU9A 4CVLA 5DEPA 2VD4A 4IHFA 3VNPA 5U2KA 2OI5A 4MFGA 1KK4A 5AFUV 3VBLA 2V0HA 3D98A 3BSSA 2VHEA 1Z2FA 4HURA 4G87A 2IU8A 3DHOA 3OU9A 3OTZA 2V0LA 4G3QA 2AM1A 3OUPA 4IHGA 3PMOA 2QKXA 3OW5A 4K6RA 2XATA 1KRUA 3OTMA 4KPZA 4MZUA 3VBNA 3WSHA 2GGOA 3R5BA 4AC3A 1EWWA 5E3QA 1QRMA 2I5KA 3T57A 3TIOA 4J18A 4M2BA 1QQ0A 2WLEA 4FCEA 2IC7A 3FSBA 2YYBA 1KK6A 1FWYA 3R3IA 1OCXA 4HZCA 3VBIA 4ZIYA 1QRFA 3P1BA 1T3DA 5DG3A 4EA9A 2FYWA 4IWMA 2W0WA 3WSDA 1G97A 4G3PA 3OH4A 3TDTA 3TISA 3FSYA 3I3XA 2IUAA 1NMOA 4QF5A 3DJ4A 2NPOA 4QDIA 3Q1XA 4KQLA 4AAWA 2OEFA 3R0SA 3R5AA 1HM8A 1YP2A 3ECTA 4KPXA 1N4IA 1YP3A 3GQ7A 3VBJA 4C13A 4HCQA 3F1XA 4J09A 2RIJA 3GVDA 3HSQA 2OEGA 2TDTA 3OGZA 4E6TA 1XATA 3OH0A 3GQ8A 4R7PA 4IWGA 1V67A 3EH0A 4DCLA 5ADXU 5L6VA 4CVMA 3EEVA
chains in the Genus database with same CATH topology
3IGJA 2OI6A 2WLFA 3FWWA 3BRKX 1KQAA 1TDTA 1Z90A 3P47A 1KRRA 3R1WA 2W0VA 4R36A 1LXAA 5E3PA 4N27A 3C8VA 3R2WA 2QIVX 2FKOA 3BSYA 2JF2A 3KWDA 1E8CA 4HUSA 4IHHA 2V0IA 4CVKA 1SSMA 2Q4JA 3FOQA 1MR9A 1S80A 1QRLA 1MR7A 2QIAA 4KNXA 4M2AA 3ZM6A 3FSXA 4AA7A 2ICXA 3BSWA 4C12A 3DK5A 2JF3A 3ST8A 1G95A 3VBMA 5ADXV 1GG4A 3CJ8A 3R3RA 4N6BA 4EGGA 3MC4A 2GGQA 3R8YA 1KHRA 3JQYA 3V4EA 5L6SA 5DEMA 5F42A 5E3RA 2AM2A 3NZ2A 3BXYA 3SRTA 1KK5A 1SSQA 3MQHA 2V0KA 4EA7A 4BUBA 1V3WA 3GOSA 3ZM5A 3BFPA 3TV0A 2XJAA 3MQGA 1XHDA 4EQYA 4R37A 3I3AA 3R5CA 4EABA 4KNRA 2WLCA 3SPTA 4EA8A 4E79A 1YP4A 4M28A 3VBPA 4HZDA 3FS8A 5AFUU 4MYOA 4E1KA 4M98A 4ISXA 4E6UA 4G3SA 3FTTA 3IXCA 2OI7A 3TK8A 3KWEA 1KGQA 3D8VA 1HM0A 2P2OA 3ZL8A 1SSTA 1KRVA 1QREA 2AQ9A 3EG4A 4H7OA 3VBKA 2WLGA 2WLDA 4N6AA 1MRLA 1THJA 3FSCA 4E75A 4EAAA 2WTZA 1KGTA 4M9CA 3TWDA 1FXJA 3GUEA 3KWCA 1HM9A 1J2ZA 1QRGA 3HJJA 2V0JA 4N69A 4M99A 3R5DA 1HV9A 2ICYA 2IU9A 4CVLA 5DEPA 2VD4A 4IHFA 3VNPA 5U2KA 2OI5A 4MFGA 1KK4A 5AFUV 3VBLA 2V0HA 3D98A 3BSSA 2VHEA 4HURA 4G87A 2IU8A 3DHOA 3OU9A 3OTZA 2V0LA 4G3QA 2AM1A 3OUPA 4IHGA 3PMOA 2QKXA 3OW5A 4K6RA 2XATA 1KRUA 3OTMA 4KPZA 4MZUA 3VBNA 2GGOA 3R5BA 4AC3A 5E3QA 1QRMA 2I5KA 3T57A 3TIOA 4J18A 4M2BA 1QQ0A 2WLEA 4FCEA 2IC7A 3FSBA 1KK6A 1FWYA 3R3IA 1OCXA 4HZCA 3VBIA 4ZIYA 1QRFA 3P1BA 1T3DA 5DG3A 4EA9A 2W0WA 1G97A 4G3PA 3TDTA 3TISA 3FSYA 3I3XA 2IUAA 4QF5A 3DJ4A 2NPOA 4QDIA 3Q1XA 4KQLA 4AAWA 2OEFA 3R0SA 3R5AA 1HM8A 1YP2A 3ECTA 4KPXA 1YP3A 3VBJA 4C13A 4HCQA 3F1XA 4J09A 2RIJA 3GVDA 3HSQA 2OEGA 2TDTA 4E6TA 1XATA 4R7PA 1V67A 3EH0A 4DCLA 5ADXU 5L6VA 4CVMA 3EEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IGJ A;  2OI6 A;  2WLF A;  3FWW A;  3BRK X;  1KQA A;  1TDT A;  1Z90 A;  3P47 A;  1KRR A;  3R1W A;  2W0V A;  4R36 A;  1LXA A;  5E3P A;  4N27 A;  3C8V A;  3R2W A;  2QIV X;  2FKO A;  3BSY A;  2JF2 A;  3KWD A;  1E8C A;  4HUS A;  4IHH A;  2V0I A;  4CVK A;  1SSM A;  2Q4J A;  3FOQ A;  1MR9 A;  1S80 A;  1QRL A;  1MR7 A;  2QIA A;  4KNX A;  4M2A A;  3ZM6 A;  3FSX A;  4AA7 A;  2ICX A;  3BSW A;  4C12 A;  3DK5 A;  2JF3 A;  3ST8 A;  1G95 A;  3VBM A;  5ADX V;  1GG4 A;  3CJ8 A;  3R3R A;  4N6B A;  4EGG A;  3MC4 A;  2GGQ A;  3R8Y A;  1KHR A;  3JQY A;  3V4E A;  5L6S A;  5DEM A;  5F42 A;  5E3R A;  2AM2 A;  3NZ2 A;  3BXY A;  3SRT A;  1KK5 A;  1SSQ A;  3MQH A;  2V0K A;  4EA7 A;  4BUB A;  1V3W A;  3GOS A;  3ZM5 A;  3BFP A;  3TV0 A;  2XJA A;  3MQG A;  1XHD A;  4EQY A;  4R37 A;  3I3A A;  3R5C A;  4EAB A;  4KNR A;  2WLC A;  3SPT A;  4EA8 A;  4E79 A;  1YP4 A;  4M28 A;  3VBP A;  4HZD A;  3FS8 A;  5AFU U;  4MYO A;  4E1K A;  4M98 A;  4ISX A;  4E6U A;  4G3S A;  3FTT A;  3IXC A;  2OI7 A;  3TK8 A;  3KWE A;  1KGQ A;  3D8V A;  1HM0 A;  2P2O A;  3ZL8 A;  1SST A;  1KRV A;  1QRE A;  2AQ9 A;  3EG4 A;  4H7O A;  3VBK A;  2WLG A;  2WLD A;  4N6A A;  1MRL A;  1THJ A;  3FSC A;  4E75 A;  4EAA A;  2WTZ A;  1KGT A;  4M9C A;  3TWD A;  1FXJ A;  3GUE A;  3KWC A;  1HM9 A;  1J2Z A;  1QRG A;  3HJJ A;  2V0J A;  4N69 A;  4M99 A;  3R5D A;  1HV9 A;  2ICY A;  2IU9 A;  4CVL A;  5DEP A;  2VD4 A;  4IHF A;  3VNP A;  5U2K A;  2OI5 A;  4MFG A;  1KK4 A;  5AFU V;  3VBL A;  2V0H A;  3D98 A;  3BSS A;  2VHE A;  4HUR A;  4G87 A;  2IU8 A;  3DHO A;  3OU9 A;  3OTZ A;  2V0L A;  4G3Q A;  2AM1 A;  3OUP A;  4IHG A;  3PMO A;  2QKX A;  3OW5 A;  4K6R A;  2XAT A;  1KRU A;  3OTM A;  4KPZ A;  4MZU A;  3VBN A;  2GGO A;  3R5B A;  4AC3 A;  5E3Q A;  1QRM A;  2I5K A;  3T57 A;  3TIO A;  4J18 A;  4M2B A;  1QQ0 A;  2WLE A;  4FCE A;  2IC7 A;  3FSB A;  1KK6 A;  1FWY A;  3R3I A;  1OCX A;  4HZC A;  3VBI A;  4ZIY A;  1QRF A;  3P1B A;  1T3D A;  5DG3 A;  4EA9 A;  2W0W A;  1G97 A;  4G3P A;  3TDT A;  3TIS A;  3FSY A;  3I3X A;  2IUA A;  4QF5 A;  3DJ4 A;  2NPO A;  4QDI A;  3Q1X A;  4KQL A;  4AAW A;  2OEF A;  3R0S A;  3R5A A;  1HM8 A;  1YP2 A;  3ECT A;  4KPX A;  1YP3 A;  3VBJ A;  4C13 A;  4HCQ A;  3F1X A;  4J09 A;  2RIJ A;  3GVD A;  3HSQ A;  2OEG A;  2TDT A;  4E6T A;  1XAT A;  4R7P A;  1V67 A;  3EH0 A;  4DCL A;  5ADX U;  5L6V A;  4CVM A;  3EEV A; 
#chains in the Genus database with same CATH topology
 3IGJ A;  2OI6 A;  2WLF A;  2IOJ A;  3FWW A;  3BRK X;  1KQA A;  1TDT A;  1Z90 A;  3P47 A;  3OH2 A;  1KRR A;  3R1W A;  2W0V A;  4R36 A;  1LXA A;  3WSF A;  5E3P A;  4N27 A;  3C8V A;  3R2W A;  2QIV X;  2FKO A;  3BSY A;  2JF2 A;  3KWD A;  1E8C A;  1NMP A;  4HUS A;  4IHH A;  2V0I A;  4CVK A;  3SUC A;  1SSM A;  2Q4J A;  3FOQ A;  1MR9 A;  3GQ9 A;  1S80 A;  3GQA A;  1QRL A;  1MR7 A;  2QIA A;  4KNX A;  4M2A A;  3ZM6 A;  3FSX A;  4AA7 A;  3WSG A;  2ICX A;  3BSW A;  4C12 A;  3DK5 A;  2JF3 A;  3ST8 A;  1G95 A;  3VBM A;  5ADX V;  1GG4 A;  3CJ8 A;  3WSI A;  1KO7 A;  3R3R A;  4N6B A;  4EGG A;  3MC4 A;  2GGQ A;  3R8Y A;  1KHR A;  3JQY A;  3V4E A;  5L6S A;  3WSE A;  5DEM A;  5F42 A;  5E3R A;  2AM2 A;  3NZ2 A;  1M8N A;  3BXY A;  3SRT A;  1KK5 A;  1SSQ A;  3MQH A;  2V0K A;  4EA7 A;  4BUB A;  3L2B A;  1V3W A;  3GOS A;  3ZM5 A;  3BFP A;  3TV0 A;  2XJA A;  3MQG A;  1XHD A;  4EQY A;  4R37 A;  3I3A A;  1L0S A;  3R5C A;  3EEQ A;  4EAB A;  4KNR A;  2WLC A;  3SPT A;  4EA8 A;  4E79 A;  1YP4 A;  4M28 A;  3VBP A;  4HZD A;  3FS8 A;  5AFU U;  4MYO A;  4E1K A;  4M98 A;  4ISX A;  4E6U A;  4G3S A;  3FTT A;  3IXC A;  2OI7 A;  3TK8 A;  3KWE A;  1KGQ A;  3D8V A;  3OH3 A;  1HM0 A;  3OH1 A;  2P2O A;  3ZL8 A;  1SST A;  3L31 A;  1KRV A;  1QRE A;  2AQ9 A;  3EG4 A;  4H7O A;  3VBK A;  2WLG A;  2WLD A;  4N6A A;  1MRL A;  1THJ A;  3FSC A;  4E75 A;  4EAA A;  2WTZ A;  1KGT A;  4M9C A;  3TWD A;  1FXJ A;  3GUE A;  3KWC A;  1HM9 A;  1J2Z A;  1QRG A;  3HJJ A;  2V0J A;  4N69 A;  4M99 A;  1KNX A;  3R5D A;  1HV9 A;  2ICY A;  2IU9 A;  4CVL A;  5DEP A;  2VD4 A;  4IHF A;  3VNP A;  5U2K A;  2OI5 A;  4MFG A;  1KK4 A;  5AFU V;  3VBL A;  2V0H A;  3D98 A;  3BSS A;  2VHE A;  1Z2F A;  4HUR A;  4G87 A;  2IU8 A;  3DHO A;  3OU9 A;  3OTZ A;  2V0L A;  4G3Q A;  2AM1 A;  3OUP A;  4IHG A;  3PMO A;  2QKX A;  3OW5 A;  4K6R A;  2XAT A;  1KRU A;  3OTM A;  4KPZ A;  4MZU A;  3VBN A;  3WSH A;  2GGO A;  3R5B A;  4AC3 A;  1EWW A;  5E3Q A;  1QRM A;  2I5K A;  3T57 A;  3TIO A;  4J18 A;  4M2B A;  1QQ0 A;  2WLE A;  4FCE A;  2IC7 A;  3FSB A;  2YYB A;  1KK6 A;  1FWY A;  3R3I A;  1OCX A;  4HZC A;  3VBI A;  4ZIY A;  1QRF A;  3P1B A;  1T3D A;  5DG3 A;  4EA9 A;  2FYW A;  4IWM A;  2W0W A;  3WSD A;  1G97 A;  4G3P A;  3OH4 A;  3TDT A;  3TIS A;  3FSY A;  3I3X A;  2IUA A;  1NMO A;  4QF5 A;  3DJ4 A;  2NPO A;  4QDI A;  3Q1X A;  4KQL A;  4AAW A;  2OEF A;  3R0S A;  3R5A A;  1HM8 A;  1YP2 A;  3ECT A;  4KPX A;  1N4I A;  1YP3 A;  3GQ7 A;  3VBJ A;  4C13 A;  4HCQ A;  3F1X A;  4J09 A;  2RIJ A;  3GVD A;  3HSQ A;  2OEG A;  2TDT A;  3OGZ A;  4E6T A;  1XAT A;  3OH0 A;  3GQ8 A;  4R7P A;  4IWG A;  1V67 A;  3EH0 A;  4DCL A;  5ADX U;  5L6V A;  4CVM A;  3EEV A; 
#chains in the Genus database with same CATH homology
 3IGJ A;  2OI6 A;  2WLF A;  3FWW A;  3BRK X;  1KQA A;  1TDT A;  1Z90 A;  3P47 A;  1KRR A;  3R1W A;  2W0V A;  4R36 A;  1LXA A;  5E3P A;  4N27 A;  3C8V A;  3R2W A;  2QIV X;  2FKO A;  3BSY A;  2JF2 A;  3KWD A;  1E8C A;  4HUS A;  4IHH A;  2V0I A;  4CVK A;  1SSM A;  2Q4J A;  3FOQ A;  1MR9 A;  1S80 A;  1QRL A;  1MR7 A;  2QIA A;  4KNX A;  4M2A A;  3ZM6 A;  3FSX A;  4AA7 A;  2ICX A;  3BSW A;  4C12 A;  3DK5 A;  2JF3 A;  3ST8 A;  1G95 A;  3VBM A;  5ADX V;  1GG4 A;  3CJ8 A;  3R3R A;  4N6B A;  4EGG A;  3MC4 A;  2GGQ A;  3R8Y A;  1KHR A;  3JQY A;  3V4E A;  5L6S A;  5DEM A;  5F42 A;  5E3R A;  2AM2 A;  3NZ2 A;  3BXY A;  3SRT A;  1KK5 A;  1SSQ A;  3MQH A;  2V0K A;  4EA7 A;  4BUB A;  1V3W A;  3GOS A;  3ZM5 A;  3BFP A;  3TV0 A;  2XJA A;  3MQG A;  1XHD A;  4EQY A;  4R37 A;  3I3A A;  3R5C A;  4EAB A;  4KNR A;  2WLC A;  3SPT A;  4EA8 A;  4E79 A;  1YP4 A;  4M28 A;  3VBP A;  4HZD A;  3FS8 A;  5AFU U;  4MYO A;  4E1K A;  4M98 A;  4ISX A;  4E6U A;  4G3S A;  3FTT A;  3IXC A;  2OI7 A;  3TK8 A;  3KWE A;  1KGQ A;  3D8V A;  1HM0 A;  2P2O A;  3ZL8 A;  1SST A;  1KRV A;  1QRE A;  2AQ9 A;  3EG4 A;  4H7O A;  3VBK A;  2WLG A;  2WLD A;  4N6A A;  1MRL A;  1THJ A;  3FSC A;  4E75 A;  4EAA A;  2WTZ A;  1KGT A;  4M9C A;  3TWD A;  1FXJ A;  3GUE A;  3KWC A;  1HM9 A;  1J2Z A;  1QRG A;  3HJJ A;  2V0J A;  4N69 A;  4M99 A;  3R5D A;  1HV9 A;  2ICY A;  2IU9 A;  4CVL A;  5DEP A;  2VD4 A;  4IHF A;  3VNP A;  5U2K A;  2OI5 A;  4MFG A;  1KK4 A;  5AFU V;  3VBL A;  2V0H A;  3D98 A;  3BSS A;  2VHE A;  4HUR A;  4G87 A;  2IU8 A;  3DHO A;  3OU9 A;  3OTZ A;  2V0L A;  4G3Q A;  2AM1 A;  3OUP A;  4IHG A;  3PMO A;  2QKX A;  3OW5 A;  4K6R A;  2XAT A;  1KRU A;  3OTM A;  4KPZ A;  4MZU A;  3VBN A;  2GGO A;  3R5B A;  4AC3 A;  5E3Q A;  1QRM A;  2I5K A;  3T57 A;  3TIO A;  4J18 A;  4M2B A;  1QQ0 A;  2WLE A;  4FCE A;  2IC7 A;  3FSB A;  1KK6 A;  1FWY A;  3R3I A;  1OCX A;  4HZC A;  3VBI A;  4ZIY A;  1QRF A;  3P1B A;  1T3D A;  5DG3 A;  4EA9 A;  2W0W A;  1G97 A;  4G3P A;  3TDT A;  3TIS A;  3FSY A;  3I3X A;  2IUA A;  4QF5 A;  3DJ4 A;  2NPO A;  4QDI A;  3Q1X A;  4KQL A;  4AAW A;  2OEF A;  3R0S A;  3R5A A;  1HM8 A;  1YP2 A;  3ECT A;  4KPX A;  1YP3 A;  3VBJ A;  4C13 A;  4HCQ A;  3F1X A;  4J09 A;  2RIJ A;  3GVD A;  3HSQ A;  2OEG A;  2TDT A;  4E6T A;  1XAT A;  4R7P A;  1V67 A;  3EH0 A;  4DCL A;  5ADX U;  5L6V A;  4CVM A;  3EEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...