4IHFA

Chasing acyl carrier protein through a catalytic cycle of lipid a production
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
336
structure length
336
Chain Sequence
SIRLADLAQQLDAELHGDGDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAPSAVIDATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTIIGNGVIIDNQCQIAANVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMRPITEPGVYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLERKVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Chasing acyl carrier protein through a catalytic cycle of lipid A production.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/lipid binding protein
molecule keywords UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase
total genus 118
structure length 336
sequence length 336
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.191: UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase.
pdb deposition date 2012-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF04613 LpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4ihfA02
3.40.1390.10 Alpha Beta 3-Layer(aba) Sandwich Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 MurE/MurF, N-terminal domain 4ihfA01
3SRTA 4H7OA 2ICYA 5AFUU 1FWYA 3IXCA 3TWDA 3ZM5A 3BFPA 4R37A 4EGGA 2AM2A 1KK4A 3FSCA 4C13A 2JF3A 1KK5A 2IUAA 4EABA 4N69A 4IHHA 2GGQA 3ST8A 2WLFA 3VBMA 4E79A 3FSYA 3EH0A 3VBIA 2QIVX 3FSBA 4M99A 1V3WA 4R7PA 3TK8A 3R2WA 3VBKA 4HCQA 3EG4A 5L6SA 2IU8A 3NZ2A 3D98A 1OCXA 4HURA 5U2KA 1G97A 4M9CA 2OI6A 4KPXA 4EA9A 4E6TA 1SSTA 2WTZA 4KQLA 3Q1XA 4M2BA 1KRUA 1HV9A 1KGQA 1QRLA 2OI5A 2W0WA 1G95A 4CVKA 4HUSA 3FOQA 2QIAA 1MRLA 4M98A 4N6BA 3TDTA 3BRKX 3FTTA 3D8VA 1LXAA 4FCEA 4K6RA 3I3XA 4G3SA 4QF5A 1J2ZA 5DEMA 2FKOA 3ECTA 1KRRA 1KK6A 4M28A 3PMOA 3HSQA 3DHOA 2OEGA 3TV0A 1T3DA 2W0VA 2TDTA 3OUPA 3P47A 2P2OA 4ISXA 4J09A 4HZCA 3DJ4A 4KPZA 2ICXA 3R8YA 3R5AA 3R0SA 3BSSA 2AQ9A 1Z90A 1XHDA 4AAWA 3I3AA 4AA7A 2V0HA 2AM1A 3VBJA 1KQAA 1QRGA 3HJJA 3OTZA 4N27A 3GVDA 1QQ0A 1QRMA 3CJ8A 1KGTA 1KHRA 3OU9A 5L6VA 3ZL8A 3VNPA 3T57A 1S80A 3R3IA 3TIOA 2NPOA 2WLDA 4J18A 4ZIYA 3P1BA 1QREA 4E75A 2RIJA 2GGOA 4HZDA 3BSYA 3FWWA 4BUBA 2I5KA 2Q4JA 2WLGA 3IGJA 1HM8A 4EA7A 1TDTA 2XATA 3V4EA 3KWCA 1E8CA 2OI7A 5AFUV 1XATA 3BSWA 2JF2A 2V0LA 4E6UA 4M2AA 2QKXA 5F42A 1GG4A 3MQHA 3TISA 3OW5A 2OEFA 4EA8A 1KRVA 4E1KA 4QDIA 4KNRA 5E3PA 2VHEA 3DK5A 4MZUA 2IU9A 4C12A 3MC4A 1V67A 3GUEA 4KNXA 3ZM6A 1QRFA 1SSMA 2WLEA 1THJA 4G3PA 2XJAA 1SSQA 3FSXA 5ADXV 4CVMA 3SPTA 5DEPA 1HM9A 4CVLA 3JQYA 4G87A 1HM0A 3VBLA 1YP4A 3R5BA 4MYOA 5ADXU 4IHGA 2V0JA 3F1XA 3R5DA 2IC7A 4N6AA 3BXYA 2V0IA 3KWDA 2VD4A 2V0KA 3OTMA 3R5CA 4R36A 3VBPA 4G3QA 4DCLA 1FXJA 3C8VA 3VBNA 4EQYA 3R1WA 1YP2A 3MQGA 5E3QA 3R3RA 1YP3A 3GOSA 5DG3A 4IHFA 4EAAA 1MR7A 3EEVA 4MFGA 4AC3A 2WLCA 5E3RA 3FS8A 3KWEA 1MR9A
chains in the Genus database with same CATH superfamily
3SRTA 4H7OA 2ICYA 5AFUU 1FWYA 3IXCA 3OH3A 3TWDA 3BFPA 4R37A 4EGGA 2AM2A 3ZM5A 3GQ7A 1KK4A 3FSCA 3EEQA 4C13A 2JF3A 1KK5A 2IUAA 3SUCA 4EABA 4N69A 4IHHA 2GGQA 3ST8A 2WLFA 3VBMA 4E79A 3FSYA 3EH0A 3VBIA 2QIVX 3FSBA 4M99A 1V3WA 2FYWA 4R7PA 3TK8A 1L0SA 3R2WA 3VBKA 4HCQA 3EG4A 5L6SA 3WSEA 2IU8A 3NZ2A 3D98A 1OCXA 4HURA 5U2KA 1G97A 4M9CA 2OI6A 4KPXA 4EA9A 4E6TA 1SSTA 2WTZA 4KQLA 3Q1XA 4M2BA 1KRUA 1HV9A 1KGQA 1QRLA 2OI5A 2W0WA 1G95A 3GQAA 1KO7A 4CVKA 4HUSA 3FOQA 2QIAA 1MRLA 4M98A 4N6BA 3TDTA 3BRKX 3FTTA 3D8VA 1LXAA 4FCEA 4K6RA 1Z2FA 3I3XA 4G3SA 1KNXA 1J2ZA 5DEMA 2FKOA 3ECTA 4QF5A 1KRRA 1KK6A 4M28A 3PMOA 3HSQA 3OH0A 3DHOA 2OEGA 3TV0A 1T3DA 2W0VA 2TDTA 3OUPA 3P47A 2P2OA 3WSGA 4ISXA 4J09A 4HZCA 3DJ4A 4KPZA 2ICXA 3WSIA 3R8YA 3OH4A 3OH2A 3BSSA 3R0SA 2AQ9A 3R5AA 1Z90A 1XHDA 4AAWA 3I3AA 4AA7A 2V0HA 2AM1A 3VBJA 4IWMA 1NMPA 1KQAA 1QRGA 3HJJA 3OTZA 4N27A 3WSFA 3GVDA 1QQ0A 3OH1A 1QRMA 3CJ8A 3WSHA 1KGTA 1KHRA 3OU9A 5L6VA 3ZL8A 1EWWA 3VNPA 3T57A 1S80A 3R3IA 3TIOA 2NPOA 2WLDA 4J18A 4ZIYA 3GQ8A 1QREA 3P1BA 2RIJA 2GGOA 4E75A 4HZDA 3BSYA 3FWWA 4BUBA 2I5KA 2Q4JA 2WLGA 3IGJA 1HM8A 4EA7A 1M8NA 4IWGA 1TDTA 2XATA 3GQ9A 3KWCA 3V4EA 1E8CA 2OI7A 5AFUV 1XATA 3BSWA 2JF2A 2V0LA 4E6UA 4M2AA 2QKXA 5F42A 1GG4A 3MQHA 3TISA 3OW5A 2OEFA 4EA8A 1KRVA 4E1KA 4QDIA 4KNRA 5E3PA 2VHEA 3DK5A 4MZUA 2IU9A 3WSDA 4C12A 3MC4A 1V67A 3GUEA 4KNXA 3ZM6A 1QRFA 1SSMA 2WLEA 1THJA 4G3PA 2XJAA 1SSQA 3FSXA 5ADXV 4CVMA 3SPTA 5DEPA 1HM9A 4CVLA 3JQYA 4G87A 1HM0A 3VBLA 1YP4A 3R5BA 4MYOA 5ADXU 4IHGA 3OGZA 2V0JA 3F1XA 3R5DA 2IC7A 4N6AA 1NMOA 3BXYA 2V0IA 3KWDA 2VD4A 2V0KA 3OTMA 2IOJA 3R5CA 4R36A 3VBPA 4G3QA 4DCLA 1FXJA 3C8VA 3VBNA 2YYBA 4EQYA 3R1WA 3L31A 1YP2A 3MQGA 5E3QA 3R3RA 1YP3A 3GOSA 5DG3A 4IHFA 4EAAA 1MR7A 3EEVA 4MFGA 4AC3A 2WLCA 5E3RA 3FS8A 3KWEA 3L2BA 1MR9A 1N4IA
chains in the Genus database with same CATH topology
3SRTA 4H7OA 2ICYA 5AFUU 1FWYA 3IXCA 3TWDA 3ZM5A 3BFPA 4R37A 4EGGA 2AM2A 1KK4A 3FSCA 4C13A 2JF3A 1KK5A 2IUAA 4EABA 4N69A 4IHHA 2GGQA 3ST8A 2WLFA 3VBMA 4E79A 3FSYA 3EH0A 3VBIA 2QIVX 3FSBA 4M99A 1V3WA 4R7PA 3TK8A 3R2WA 3VBKA 4HCQA 3EG4A 5L6SA 2IU8A 3NZ2A 3D98A 1OCXA 4HURA 5U2KA 1G97A 4M9CA 2OI6A 4KPXA 4EA9A 4E6TA 1SSTA 2WTZA 4KQLA 3Q1XA 4M2BA 1KRUA 1HV9A 1KGQA 1QRLA 2OI5A 2W0WA 1G95A 4CVKA 4HUSA 3FOQA 2QIAA 1MRLA 4M98A 4N6BA 3TDTA 3BRKX 3FTTA 3D8VA 1LXAA 4FCEA 4K6RA 3I3XA 4G3SA 4QF5A 1J2ZA 5DEMA 2FKOA 3ECTA 1KRRA 1KK6A 4M28A 3PMOA 3HSQA 3DHOA 2OEGA 3TV0A 1T3DA 2W0VA 2TDTA 3OUPA 3P47A 2P2OA 4ISXA 4J09A 4HZCA 3DJ4A 4KPZA 2ICXA 3R8YA 3R5AA 3R0SA 3BSSA 2AQ9A 1Z90A 1XHDA 4AAWA 3I3AA 4AA7A 2V0HA 2AM1A 3VBJA 1KQAA 1QRGA 3HJJA 3OTZA 4N27A 3GVDA 1QQ0A 1QRMA 3CJ8A 1KGTA 1KHRA 3OU9A 5L6VA 3ZL8A 3VNPA 3T57A 1S80A 3R3IA 3TIOA 2NPOA 2WLDA 4J18A 4ZIYA 3P1BA 1QREA 4E75A 2RIJA 2GGOA 4HZDA 3BSYA 3FWWA 4BUBA 2I5KA 2Q4JA 2WLGA 3IGJA 1HM8A 4EA7A 1TDTA 2XATA 3V4EA 3KWCA 1E8CA 2OI7A 5AFUV 1XATA 3BSWA 2JF2A 2V0LA 4E6UA 4M2AA 2QKXA 5F42A 1GG4A 3MQHA 3TISA 3OW5A 2OEFA 4EA8A 1KRVA 4E1KA 4QDIA 4KNRA 5E3PA 2VHEA 3DK5A 4MZUA 2IU9A 4C12A 3MC4A 1V67A 3GUEA 4KNXA 3ZM6A 1QRFA 1SSMA 2WLEA 1THJA 4G3PA 2XJAA 1SSQA 3FSXA 5ADXV 4CVMA 3SPTA 5DEPA 1HM9A 4CVLA 3JQYA 4G87A 1HM0A 3VBLA 1YP4A 3R5BA 4MYOA 5ADXU 4IHGA 2V0JA 3F1XA 3R5DA 2IC7A 4N6AA 3BXYA 2V0IA 3KWDA 2VD4A 2V0KA 3OTMA 3R5CA 4R36A 3VBPA 4G3QA 4DCLA 1FXJA 3C8VA 3VBNA 4EQYA 3R1WA 1YP2A 3MQGA 5E3QA 3R3RA 1YP3A 3GOSA 5DG3A 4IHFA 4EAAA 1MR7A 3EEVA 4MFGA 4AC3A 2WLCA 5E3RA 3FS8A 3KWEA 1MR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SRT A;  4H7O A;  2ICY A;  5AFU U;  1FWY A;  3IXC A;  3TWD A;  3ZM5 A;  3BFP A;  4R37 A;  4EGG A;  2AM2 A;  1KK4 A;  3FSC A;  4C13 A;  2JF3 A;  1KK5 A;  2IUA A;  4EAB A;  4N69 A;  4IHH A;  2GGQ A;  3ST8 A;  2WLF A;  3VBM A;  4E79 A;  3FSY A;  3EH0 A;  3VBI A;  2QIV X;  3FSB A;  4M99 A;  1V3W A;  4R7P A;  3TK8 A;  3R2W A;  3VBK A;  4HCQ A;  3EG4 A;  5L6S A;  2IU8 A;  3NZ2 A;  3D98 A;  1OCX A;  4HUR A;  5U2K A;  1G97 A;  4M9C A;  2OI6 A;  4KPX A;  4EA9 A;  4E6T A;  1SST A;  2WTZ A;  4KQL A;  3Q1X A;  4M2B A;  1KRU A;  1HV9 A;  1KGQ A;  1QRL A;  2OI5 A;  2W0W A;  1G95 A;  4CVK A;  4HUS A;  3FOQ A;  2QIA A;  1MRL A;  4M98 A;  4N6B A;  3TDT A;  3BRK X;  3FTT A;  3D8V A;  1LXA A;  4FCE A;  4K6R A;  3I3X A;  4G3S A;  4QF5 A;  1J2Z A;  5DEM A;  2FKO A;  3ECT A;  1KRR A;  1KK6 A;  4M28 A;  3PMO A;  3HSQ A;  3DHO A;  2OEG A;  3TV0 A;  1T3D A;  2W0V A;  2TDT A;  3OUP A;  3P47 A;  2P2O A;  4ISX A;  4J09 A;  4HZC A;  3DJ4 A;  4KPZ A;  2ICX A;  3R8Y A;  3R5A A;  3R0S A;  3BSS A;  2AQ9 A;  1Z90 A;  1XHD A;  4AAW A;  3I3A A;  4AA7 A;  2V0H A;  2AM1 A;  3VBJ A;  1KQA A;  1QRG A;  3HJJ A;  3OTZ A;  4N27 A;  3GVD A;  1QQ0 A;  1QRM A;  3CJ8 A;  1KGT A;  1KHR A;  3OU9 A;  5L6V A;  3ZL8 A;  3VNP A;  3T57 A;  1S80 A;  3R3I A;  3TIO A;  2NPO A;  2WLD A;  4J18 A;  4ZIY A;  3P1B A;  1QRE A;  4E75 A;  2RIJ A;  2GGO A;  4HZD A;  3BSY A;  3FWW A;  4BUB A;  2I5K A;  2Q4J A;  2WLG A;  3IGJ A;  1HM8 A;  4EA7 A;  1TDT A;  2XAT A;  3V4E A;  3KWC A;  1E8C A;  2OI7 A;  5AFU V;  1XAT A;  3BSW A;  2JF2 A;  2V0L A;  4E6U A;  4M2A A;  2QKX A;  5F42 A;  1GG4 A;  3MQH A;  3TIS A;  3OW5 A;  2OEF A;  4EA8 A;  1KRV A;  4E1K A;  4QDI A;  4KNR A;  5E3P A;  2VHE A;  3DK5 A;  4MZU A;  2IU9 A;  4C12 A;  3MC4 A;  1V67 A;  3GUE A;  4KNX A;  3ZM6 A;  1QRF A;  1SSM A;  2WLE A;  1THJ A;  4G3P A;  2XJA A;  1SSQ A;  3FSX A;  5ADX V;  4CVM A;  3SPT A;  5DEP A;  1HM9 A;  4CVL A;  3JQY A;  4G87 A;  1HM0 A;  3VBL A;  1YP4 A;  3R5B A;  4MYO A;  5ADX U;  4IHG A;  2V0J A;  3F1X A;  3R5D A;  2IC7 A;  4N6A A;  3BXY A;  2V0I A;  3KWD A;  2VD4 A;  2V0K A;  3OTM A;  3R5C A;  4R36 A;  3VBP A;  4G3Q A;  4DCL A;  1FXJ A;  3C8V A;  3VBN A;  4EQY A;  3R1W A;  1YP2 A;  3MQG A;  5E3Q A;  3R3R A;  1YP3 A;  3GOS A;  5DG3 A;  4IHF A;  4EAA A;  1MR7 A;  3EEV A;  4MFG A;  4AC3 A;  2WLC A;  5E3R A;  3FS8 A;  3KWE A;  1MR9 A; 
#chains in the Genus database with same CATH topology
 3SRT A;  4H7O A;  2ICY A;  5AFU U;  1FWY A;  3IXC A;  3OH3 A;  3TWD A;  3BFP A;  4R37 A;  4EGG A;  2AM2 A;  3ZM5 A;  3GQ7 A;  1KK4 A;  3FSC A;  3EEQ A;  4C13 A;  2JF3 A;  1KK5 A;  2IUA A;  3SUC A;  4EAB A;  4N69 A;  4IHH A;  2GGQ A;  3ST8 A;  2WLF A;  3VBM A;  4E79 A;  3FSY A;  3EH0 A;  3VBI A;  2QIV X;  3FSB A;  4M99 A;  1V3W A;  2FYW A;  4R7P A;  3TK8 A;  1L0S A;  3R2W A;  3VBK A;  4HCQ A;  3EG4 A;  5L6S A;  3WSE A;  2IU8 A;  3NZ2 A;  3D98 A;  1OCX A;  4HUR A;  5U2K A;  1G97 A;  4M9C A;  2OI6 A;  4KPX A;  4EA9 A;  4E6T A;  1SST A;  2WTZ A;  4KQL A;  3Q1X A;  4M2B A;  1KRU A;  1HV9 A;  1KGQ A;  1QRL A;  2OI5 A;  2W0W A;  1G95 A;  3GQA A;  1KO7 A;  4CVK A;  4HUS A;  3FOQ A;  2QIA A;  1MRL A;  4M98 A;  4N6B A;  3TDT A;  3BRK X;  3FTT A;  3D8V A;  1LXA A;  4FCE A;  4K6R A;  1Z2F A;  3I3X A;  4G3S A;  1KNX A;  1J2Z A;  5DEM A;  2FKO A;  3ECT A;  4QF5 A;  1KRR A;  1KK6 A;  4M28 A;  3PMO A;  3HSQ A;  3OH0 A;  3DHO A;  2OEG A;  3TV0 A;  1T3D A;  2W0V A;  2TDT A;  3OUP A;  3P47 A;  2P2O A;  3WSG A;  4ISX A;  4J09 A;  4HZC A;  3DJ4 A;  4KPZ A;  2ICX A;  3WSI A;  3R8Y A;  3OH4 A;  3OH2 A;  3BSS A;  3R0S A;  2AQ9 A;  3R5A A;  1Z90 A;  1XHD A;  4AAW A;  3I3A A;  4AA7 A;  2V0H A;  2AM1 A;  3VBJ A;  4IWM A;  1NMP A;  1KQA A;  1QRG A;  3HJJ A;  3OTZ A;  4N27 A;  3WSF A;  3GVD A;  1QQ0 A;  3OH1 A;  1QRM A;  3CJ8 A;  3WSH A;  1KGT A;  1KHR A;  3OU9 A;  5L6V A;  3ZL8 A;  1EWW A;  3VNP A;  3T57 A;  1S80 A;  3R3I A;  3TIO A;  2NPO A;  2WLD A;  4J18 A;  4ZIY A;  3GQ8 A;  1QRE A;  3P1B A;  2RIJ A;  2GGO A;  4E75 A;  4HZD A;  3BSY A;  3FWW A;  4BUB A;  2I5K A;  2Q4J A;  2WLG A;  3IGJ A;  1HM8 A;  4EA7 A;  1M8N A;  4IWG A;  1TDT A;  2XAT A;  3GQ9 A;  3KWC A;  3V4E A;  1E8C A;  2OI7 A;  5AFU V;  1XAT A;  3BSW A;  2JF2 A;  2V0L A;  4E6U A;  4M2A A;  2QKX A;  5F42 A;  1GG4 A;  3MQH A;  3TIS A;  3OW5 A;  2OEF A;  4EA8 A;  1KRV A;  4E1K A;  4QDI A;  4KNR A;  5E3P A;  2VHE A;  3DK5 A;  4MZU A;  2IU9 A;  3WSD A;  4C12 A;  3MC4 A;  1V67 A;  3GUE A;  4KNX A;  3ZM6 A;  1QRF A;  1SSM A;  2WLE A;  1THJ A;  4G3P A;  2XJA A;  1SSQ A;  3FSX A;  5ADX V;  4CVM A;  3SPT A;  5DEP A;  1HM9 A;  4CVL A;  3JQY A;  4G87 A;  1HM0 A;  3VBL A;  1YP4 A;  3R5B A;  4MYO A;  5ADX U;  4IHG A;  3OGZ A;  2V0J A;  3F1X A;  3R5D A;  2IC7 A;  4N6A A;  1NMO A;  3BXY A;  2V0I A;  3KWD A;  2VD4 A;  2V0K A;  3OTM A;  2IOJ A;  3R5C A;  4R36 A;  3VBP A;  4G3Q A;  4DCL A;  1FXJ A;  3C8V A;  3VBN A;  2YYB A;  4EQY A;  3R1W A;  3L31 A;  1YP2 A;  3MQG A;  5E3Q A;  3R3R A;  1YP3 A;  3GOS A;  5DG3 A;  4IHF A;  4EAA A;  1MR7 A;  3EEV A;  4MFG A;  4AC3 A;  2WLC A;  5E3R A;  3FS8 A;  3KWE A;  3L2B A;  1MR9 A;  1N4I A; 
#chains in the Genus database with same CATH homology
 3SRT A;  4H7O A;  2ICY A;  5AFU U;  1FWY A;  3IXC A;  3TWD A;  3ZM5 A;  3BFP A;  4R37 A;  4EGG A;  2AM2 A;  1KK4 A;  3FSC A;  4C13 A;  2JF3 A;  1KK5 A;  2IUA A;  4EAB A;  4N69 A;  4IHH A;  2GGQ A;  3ST8 A;  2WLF A;  3VBM A;  4E79 A;  3FSY A;  3EH0 A;  3VBI A;  2QIV X;  3FSB A;  4M99 A;  1V3W A;  4R7P A;  3TK8 A;  3R2W A;  3VBK A;  4HCQ A;  3EG4 A;  5L6S A;  2IU8 A;  3NZ2 A;  3D98 A;  1OCX A;  4HUR A;  5U2K A;  1G97 A;  4M9C A;  2OI6 A;  4KPX A;  4EA9 A;  4E6T A;  1SST A;  2WTZ A;  4KQL A;  3Q1X A;  4M2B A;  1KRU A;  1HV9 A;  1KGQ A;  1QRL A;  2OI5 A;  2W0W A;  1G95 A;  4CVK A;  4HUS A;  3FOQ A;  2QIA A;  1MRL A;  4M98 A;  4N6B A;  3TDT A;  3BRK X;  3FTT A;  3D8V A;  1LXA A;  4FCE A;  4K6R A;  3I3X A;  4G3S A;  4QF5 A;  1J2Z A;  5DEM A;  2FKO A;  3ECT A;  1KRR A;  1KK6 A;  4M28 A;  3PMO A;  3HSQ A;  3DHO A;  2OEG A;  3TV0 A;  1T3D A;  2W0V A;  2TDT A;  3OUP A;  3P47 A;  2P2O A;  4ISX A;  4J09 A;  4HZC A;  3DJ4 A;  4KPZ A;  2ICX A;  3R8Y A;  3R5A A;  3R0S A;  3BSS A;  2AQ9 A;  1Z90 A;  1XHD A;  4AAW A;  3I3A A;  4AA7 A;  2V0H A;  2AM1 A;  3VBJ A;  1KQA A;  1QRG A;  3HJJ A;  3OTZ A;  4N27 A;  3GVD A;  1QQ0 A;  1QRM A;  3CJ8 A;  1KGT A;  1KHR A;  3OU9 A;  5L6V A;  3ZL8 A;  3VNP A;  3T57 A;  1S80 A;  3R3I A;  3TIO A;  2NPO A;  2WLD A;  4J18 A;  4ZIY A;  3P1B A;  1QRE A;  4E75 A;  2RIJ A;  2GGO A;  4HZD A;  3BSY A;  3FWW A;  4BUB A;  2I5K A;  2Q4J A;  2WLG A;  3IGJ A;  1HM8 A;  4EA7 A;  1TDT A;  2XAT A;  3V4E A;  3KWC A;  1E8C A;  2OI7 A;  5AFU V;  1XAT A;  3BSW A;  2JF2 A;  2V0L A;  4E6U A;  4M2A A;  2QKX A;  5F42 A;  1GG4 A;  3MQH A;  3TIS A;  3OW5 A;  2OEF A;  4EA8 A;  1KRV A;  4E1K A;  4QDI A;  4KNR A;  5E3P A;  2VHE A;  3DK5 A;  4MZU A;  2IU9 A;  4C12 A;  3MC4 A;  1V67 A;  3GUE A;  4KNX A;  3ZM6 A;  1QRF A;  1SSM A;  2WLE A;  1THJ A;  4G3P A;  2XJA A;  1SSQ A;  3FSX A;  5ADX V;  4CVM A;  3SPT A;  5DEP A;  1HM9 A;  4CVL A;  3JQY A;  4G87 A;  1HM0 A;  3VBL A;  1YP4 A;  3R5B A;  4MYO A;  5ADX U;  4IHG A;  2V0J A;  3F1X A;  3R5D A;  2IC7 A;  4N6A A;  3BXY A;  2V0I A;  3KWD A;  2VD4 A;  2V0K A;  3OTM A;  3R5C A;  4R36 A;  3VBP A;  4G3Q A;  4DCL A;  1FXJ A;  3C8V A;  3VBN A;  4EQY A;  3R1W A;  1YP2 A;  3MQG A;  5E3Q A;  3R3R A;  1YP3 A;  3GOS A;  5DG3 A;  4IHF A;  4EAA A;  1MR7 A;  3EEV A;  4MFG A;  4AC3 A;  2WLC A;  5E3R A;  3FS8 A;  3KWE A;  1MR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...