4IHFA

Chasing acyl carrier protein through a catalytic cycle of lipid a production
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
336
structure length
336
Chain Sequence
SIRLADLAQQLDAELHGDGDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAPSAVIDATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTIIGNGVIIDNQCQIAANVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMRPITEPGVYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLERKVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase
publication title Chasing acyl carrier protein through a catalytic cycle of lipid A production.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/lipid binding protein
total genus 118
structure length 336
sequence length 336
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.191: UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase.
pdb deposition date 2012-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF04613 LpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4ihfA02
3.40.1390.10 Alpha Beta 3-Layer(aba) Sandwich Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 MurE/MurF, N-terminal domain 4ihfA01
2AQ9A 5ADXU 1KRUA 2P2OA 4C12A 5F42A 1KQAA 2V0JA 3ST8A 3C8VA 4EA8A 3FSBA 2Q4JA 1T3DA 3R0SA 1MR9A 1Z90A 2V0KA 3ZM6A 3R5DA 2JF2A 3EEVA 3HJJA 3I3AA 3FOQA 3OTZA 4M98A 5DEMA 3VBJA 2WTZA 3DHOA 4AAWA 3KWDA 1YP4A 2V0HA 3SPTA 4CVKA 2OI7A 3P1BA 2GGQA 4IHGA 1SSMA 4K6RA 2WLFA 4M99A 3V4EA 1OCXA 3OUPA 1G97A 3KWEA 2OEGA 4MYOA 4MZUA 3SRTA 1HM9A 2QIAA 4MFGA 4M2AA 3ECTA 5E3QA 2AM2A 1QRMA 1YP3A 2GGOA 3FSYA 1KK4A 1KK5A 3VNPA 3OW5A 2ICYA 1QRLA 2IC7A 4AA7A 1YP2A 4G87A 3DJ4A 3TDTA 2TDTA 3TK8A 3VBKA 3OTMA 1HV9A 3FSXA 3EG4A 2W0WA 2XATA 1HM0A 1G95A 4ISXA 5DG3A 3KWCA 3R8YA 4DCLA 2ICXA 2V0IA 1SSTA 2VHEA 3BSWA 1XATA 3TIOA 2OI5A 3BXYA 3FWWA 3VBNA 2WLDA 3BFPA 1KRVA 3CJ8A 2QIVX 3TV0A 2OI6A 2JF3A 4HUSA 3VBLA 3R3RA 1XHDA 1QRFA 1S80A 2VD4A 2V0LA 3R3IA 2WLGA 4IHHA 4N69A 3VBIA 3VBPA 5U2KA 1FWYA 3DK5A 4KQLA 4EAAA 4ZIYA 2WLCA 3FSCA 4J18A 3T57A 4C13A 4EGGA 4R36A 3EH0A 4N6AA 1QRGA 3D8VA 5AFUU 3BSSA 3R1WA 4N6BA 4E1KA 4CVLA 4IHFA 5ADXV 4HZDA 4KNXA 3R5AA 4N27A 4BUBA 4E6TA 3R2WA 1MRLA 4EABA 5E3PA 1HM8A 4QF5A 1SSQA 4QDIA 4M2BA 3TISA 4HURA 2OEFA 2AM1A 3MC4A 2FKOA 3GVDA 4H7OA 3FS8A 3HSQA 1V67A 4AC3A 3OU9A 2IU9A 4G3PA 3JQYA 4EQYA 3PMOA 2IU8A 3R5BA 3BRKX 3I3XA 1KHRA 5L6SA 3D98A 3MQGA 3MQHA 1KGQA 2RIJA 4E79A 5E3RA 1QQ0A 4KPZA 4R7PA 1V3WA 1LXAA 1KGTA 2I5KA 2XJAA 1THJA 1KRRA 2W0VA 3GOSA 3NZ2A 3IGJA 1QREA 1J2ZA 4G3SA 1TDTA 4HZCA 1MR7A 4M28A 2QKXA 4M9CA 4R37A 1KK6A 5L6VA 3ZL8A 3FTTA 2IUAA 5AFUV 4FCEA 4KPXA 1FXJA 3Q1XA 4G3QA 3TWDA 3ZM5A 3IXCA 3VBMA 1E8CA 4J09A 3P47A 4CVMA 4EA7A 4KNRA 2NPOA 1GG4A 5DEPA 3GUEA 3R5CA 4HCQA 4EA9A 4E75A 3F1XA 2WLEA 4E6UA 3BSYA
chains in the Genus database with same CATH superfamily
2AQ9A 5ADXU 1KRUA 2P2OA 4IWGA 4C12A 5F42A 1NMOA 1KQAA 2V0JA 3ST8A 3C8VA 4EA8A 3FSBA 2Q4JA 1T3DA 3R0SA 1MR9A 1Z90A 2V0KA 3ZM6A 3OH2A 3R5DA 2JF2A 3EEVA 3HJJA 3I3AA 3FOQA 3OTZA 4M98A 5DEMA 3VBJA 2WTZA 3WSDA 3DHOA 4AAWA 3WSHA 3KWDA 1YP4A 2V0HA 3SPTA 4CVKA 2OI7A 3P1BA 1KO7A 2GGQA 4IHGA 1SSMA 4K6RA 2WLFA 4M99A 3V4EA 1KNXA 3OH4A 1OCXA 3OUPA 1G97A 3KWEA 2OEGA 4MYOA 4MZUA 3SRTA 1HM9A 3GQAA 2QIAA 4MFGA 4M2AA 3ECTA 5E3QA 2AM2A 1QRMA 1YP3A 2GGOA 3FSYA 1KK4A 1KK5A 3VNPA 4IWMA 3OW5A 2ICYA 1QRLA 2IC7A 4AA7A 1YP2A 4G87A 3DJ4A 3TDTA 2TDTA 3TK8A 3VBKA 3OTMA 1HV9A 3FSXA 3EG4A 2W0WA 2XATA 1HM0A 1G95A 4ISXA 5DG3A 3KWCA 3R8YA 4DCLA 2ICXA 2V0IA 1SSTA 2VHEA 3BSWA 1XATA 3TIOA 2OI5A 3BXYA 3FWWA 3VBNA 2WLDA 3BFPA 3L2BA 1KRVA 3CJ8A 2QIVX 3TV0A 2OI6A 2JF3A 3WSEA 4HUSA 3SUCA 3VBLA 3R3RA 3WSFA 1XHDA 3OH1A 1QRFA 1S80A 1M8NA 2V0LA 2VD4A 2WLGA 3R3IA 4IHHA 3GQ8A 4N69A 3VBPA 5U2KA 1FWYA 3DK5A 4KQLA 4EAAA 4ZIYA 2WLCA 3FSCA 4J18A 3T57A 1EWWA 4C13A 4EGGA 4R36A 3EH0A 3WSGA 4N6AA 1QRGA 1L0SA 3D8VA 3EEQA 5AFUU 3BSSA 2IOJA 3R1WA 4N6BA 4E1KA 4CVLA 4IHFA 5ADXV 4HZDA 4KNXA 3R5AA 4N27A 4BUBA 3VBIA 4E6TA 3OH0A 3R2WA 1MRLA 4EABA 5E3PA 1HM8A 3GQ9A 4QF5A 1SSQA 4QDIA 4M2BA 3TISA 4HURA 2OEFA 2AM1A 3MC4A 1NMPA 2FKOA 3GVDA 4H7OA 2YYBA 3FS8A 3GQ7A 3HSQA 3L31A 1V67A 4AC3A 3OU9A 1N4IA 2IU9A 4G3PA 3JQYA 4EQYA 3PMOA 3WSIA 2IU8A 3R5BA 3BRKX 3I3XA 1KHRA 5L6SA 3D98A 3MQGA 3MQHA 1KGQA 2RIJA 4E79A 5E3RA 1QQ0A 4KPZA 4R7PA 1V3WA 1LXAA 1KGTA 2I5KA 2XJAA 1THJA 1KRRA 2W0VA 3GOSA 3NZ2A 3IGJA 1QREA 1J2ZA 4G3SA 1TDTA 4HZCA 1MR7A 4M28A 2QKXA 4M9CA 4R37A 1KK6A 5L6VA 3ZL8A 3OGZA 3FTTA 2IUAA 5AFUV 4FCEA 4KPXA 1FXJA 3Q1XA 4G3QA 3TWDA 3ZM5A 3IXCA 3VBMA 1E8CA 3OH3A 3P47A 4J09A 4CVMA 4EA7A 4KNRA 2FYWA 2NPOA 1GG4A 5DEPA 3GUEA 3R5CA 4HCQA 4EA9A 4E75A 3F1XA 2WLEA 4E6UA 3BSYA 1Z2FA
chains in the Genus database with same CATH topology
2AQ9A 5ADXU 1KRUA 2P2OA 4C12A 5F42A 1KQAA 2V0JA 3ST8A 3C8VA 4EA8A 3FSBA 2Q4JA 1T3DA 3R0SA 1MR9A 1Z90A 2V0KA 3ZM6A 3R5DA 2JF2A 3EEVA 3HJJA 3I3AA 3FOQA 3OTZA 4M98A 5DEMA 3VBJA 2WTZA 3DHOA 4AAWA 3KWDA 1YP4A 2V0HA 3SPTA 4CVKA 2OI7A 3P1BA 2GGQA 4IHGA 1SSMA 4K6RA 2WLFA 4M99A 3V4EA 1OCXA 3OUPA 1G97A 3KWEA 2OEGA 4MYOA 4MZUA 3SRTA 1HM9A 2QIAA 4MFGA 4M2AA 3ECTA 5E3QA 2AM2A 1QRMA 1YP3A 2GGOA 3FSYA 1KK4A 1KK5A 3VNPA 3OW5A 2ICYA 1QRLA 2IC7A 4AA7A 1YP2A 4G87A 3DJ4A 3TDTA 2TDTA 3TK8A 3VBKA 3OTMA 1HV9A 3FSXA 3EG4A 2W0WA 2XATA 1HM0A 1G95A 4ISXA 5DG3A 3KWCA 3R8YA 4DCLA 2ICXA 2V0IA 1SSTA 2VHEA 3BSWA 1XATA 3TIOA 2OI5A 3BXYA 3FWWA 3VBNA 2WLDA 3BFPA 1KRVA 3CJ8A 2QIVX 3TV0A 2OI6A 2JF3A 4HUSA 3VBLA 3R3RA 1XHDA 1QRFA 1S80A 2VD4A 2V0LA 3R3IA 2WLGA 4IHHA 4N69A 3VBIA 3VBPA 5U2KA 1FWYA 3DK5A 4KQLA 4EAAA 4ZIYA 2WLCA 3FSCA 4J18A 3T57A 4C13A 4EGGA 4R36A 3EH0A 4N6AA 1QRGA 3D8VA 5AFUU 3BSSA 3R1WA 4N6BA 4E1KA 4CVLA 4IHFA 5ADXV 4HZDA 4KNXA 3R5AA 4N27A 4BUBA 4E6TA 3R2WA 1MRLA 4EABA 5E3PA 1HM8A 4QF5A 1SSQA 4QDIA 4M2BA 3TISA 4HURA 2OEFA 2AM1A 3MC4A 2FKOA 3GVDA 4H7OA 3FS8A 3HSQA 1V67A 4AC3A 3OU9A 2IU9A 4G3PA 3JQYA 4EQYA 3PMOA 2IU8A 3R5BA 3BRKX 3I3XA 1KHRA 5L6SA 3D98A 3MQGA 3MQHA 1KGQA 2RIJA 4E79A 5E3RA 1QQ0A 4KPZA 4R7PA 1V3WA 1LXAA 1KGTA 2I5KA 2XJAA 1THJA 1KRRA 2W0VA 3GOSA 3NZ2A 3IGJA 1QREA 1J2ZA 4G3SA 1TDTA 4HZCA 1MR7A 4M28A 2QKXA 4M9CA 4R37A 1KK6A 5L6VA 3ZL8A 3FTTA 2IUAA 5AFUV 4FCEA 4KPXA 1FXJA 3Q1XA 4G3QA 3TWDA 3ZM5A 3IXCA 3VBMA 1E8CA 4J09A 3P47A 4CVMA 4EA7A 4KNRA 2NPOA 1GG4A 5DEPA 3GUEA 3R5CA 4HCQA 4EA9A 4E75A 3F1XA 2WLEA 4E6UA 3BSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AQ9 A;  5ADX U;  1KRU A;  2P2O A;  4C12 A;  5F42 A;  1KQA A;  2V0J A;  3ST8 A;  3C8V A;  4EA8 A;  3FSB A;  2Q4J A;  1T3D A;  3R0S A;  1MR9 A;  1Z90 A;  2V0K A;  3ZM6 A;  3R5D A;  2JF2 A;  3EEV A;  3HJJ A;  3I3A A;  3FOQ A;  3OTZ A;  4M98 A;  5DEM A;  3VBJ A;  2WTZ A;  3DHO A;  4AAW A;  3KWD A;  1YP4 A;  2V0H A;  3SPT A;  4CVK A;  2OI7 A;  3P1B A;  2GGQ A;  4IHG A;  1SSM A;  4K6R A;  2WLF A;  4M99 A;  3V4E A;  1OCX A;  3OUP A;  1G97 A;  3KWE A;  2OEG A;  4MYO A;  4MZU A;  3SRT A;  1HM9 A;  2QIA A;  4MFG A;  4M2A A;  3ECT A;  5E3Q A;  2AM2 A;  1QRM A;  1YP3 A;  2GGO A;  3FSY A;  1KK4 A;  1KK5 A;  3VNP A;  3OW5 A;  2ICY A;  1QRL A;  2IC7 A;  4AA7 A;  1YP2 A;  4G87 A;  3DJ4 A;  3TDT A;  2TDT A;  3TK8 A;  3VBK A;  3OTM A;  1HV9 A;  3FSX A;  3EG4 A;  2W0W A;  2XAT A;  1HM0 A;  1G95 A;  4ISX A;  5DG3 A;  3KWC A;  3R8Y A;  4DCL A;  2ICX A;  2V0I A;  1SST A;  2VHE A;  3BSW A;  1XAT A;  3TIO A;  2OI5 A;  3BXY A;  3FWW A;  3VBN A;  2WLD A;  3BFP A;  1KRV A;  3CJ8 A;  2QIV X;  3TV0 A;  2OI6 A;  2JF3 A;  4HUS A;  3VBL A;  3R3R A;  1XHD A;  1QRF A;  1S80 A;  2VD4 A;  2V0L A;  3R3I A;  2WLG A;  4IHH A;  4N69 A;  3VBI A;  3VBP A;  5U2K A;  1FWY A;  3DK5 A;  4KQL A;  4EAA A;  4ZIY A;  2WLC A;  3FSC A;  4J18 A;  3T57 A;  4C13 A;  4EGG A;  4R36 A;  3EH0 A;  4N6A A;  1QRG A;  3D8V A;  5AFU U;  3BSS A;  3R1W A;  4N6B A;  4E1K A;  4CVL A;  4IHF A;  5ADX V;  4HZD A;  4KNX A;  3R5A A;  4N27 A;  4BUB A;  4E6T A;  3R2W A;  1MRL A;  4EAB A;  5E3P A;  1HM8 A;  4QF5 A;  1SSQ A;  4QDI A;  4M2B A;  3TIS A;  4HUR A;  2OEF A;  2AM1 A;  3MC4 A;  2FKO A;  3GVD A;  4H7O A;  3FS8 A;  3HSQ A;  1V67 A;  4AC3 A;  3OU9 A;  2IU9 A;  4G3P A;  3JQY A;  4EQY A;  3PMO A;  2IU8 A;  3R5B A;  3BRK X;  3I3X A;  1KHR A;  5L6S A;  3D98 A;  3MQG A;  3MQH A;  1KGQ A;  2RIJ A;  4E79 A;  5E3R A;  1QQ0 A;  4KPZ A;  4R7P A;  1V3W A;  1LXA A;  1KGT A;  2I5K A;  2XJA A;  1THJ A;  1KRR A;  2W0V A;  3GOS A;  3NZ2 A;  3IGJ A;  1QRE A;  1J2Z A;  4G3S A;  1TDT A;  4HZC A;  1MR7 A;  4M28 A;  2QKX A;  4M9C A;  4R37 A;  1KK6 A;  5L6V A;  3ZL8 A;  3FTT A;  2IUA A;  5AFU V;  4FCE A;  4KPX A;  1FXJ A;  3Q1X A;  4G3Q A;  3TWD A;  3ZM5 A;  3IXC A;  3VBM A;  1E8C A;  4J09 A;  3P47 A;  4CVM A;  4EA7 A;  4KNR A;  2NPO A;  1GG4 A;  5DEP A;  3GUE A;  3R5C A;  4HCQ A;  4EA9 A;  4E75 A;  3F1X A;  2WLE A;  4E6U A;  3BSY A; 
#chains in the Genus database with same CATH topology
 2AQ9 A;  5ADX U;  1KRU A;  2P2O A;  4IWG A;  4C12 A;  5F42 A;  1NMO A;  1KQA A;  2V0J A;  3ST8 A;  3C8V A;  4EA8 A;  3FSB A;  2Q4J A;  1T3D A;  3R0S A;  1MR9 A;  1Z90 A;  2V0K A;  3ZM6 A;  3OH2 A;  3R5D A;  2JF2 A;  3EEV A;  3HJJ A;  3I3A A;  3FOQ A;  3OTZ A;  4M98 A;  5DEM A;  3VBJ A;  2WTZ A;  3WSD A;  3DHO A;  4AAW A;  3WSH A;  3KWD A;  1YP4 A;  2V0H A;  3SPT A;  4CVK A;  2OI7 A;  3P1B A;  1KO7 A;  2GGQ A;  4IHG A;  1SSM A;  4K6R A;  2WLF A;  4M99 A;  3V4E A;  1KNX A;  3OH4 A;  1OCX A;  3OUP A;  1G97 A;  3KWE A;  2OEG A;  4MYO A;  4MZU A;  3SRT A;  1HM9 A;  3GQA A;  2QIA A;  4MFG A;  4M2A A;  3ECT A;  5E3Q A;  2AM2 A;  1QRM A;  1YP3 A;  2GGO A;  3FSY A;  1KK4 A;  1KK5 A;  3VNP A;  4IWM A;  3OW5 A;  2ICY A;  1QRL A;  2IC7 A;  4AA7 A;  1YP2 A;  4G87 A;  3DJ4 A;  3TDT A;  2TDT A;  3TK8 A;  3VBK A;  3OTM A;  1HV9 A;  3FSX A;  3EG4 A;  2W0W A;  2XAT A;  1HM0 A;  1G95 A;  4ISX A;  5DG3 A;  3KWC A;  3R8Y A;  4DCL A;  2ICX A;  2V0I A;  1SST A;  2VHE A;  3BSW A;  1XAT A;  3TIO A;  2OI5 A;  3BXY A;  3FWW A;  3VBN A;  2WLD A;  3BFP A;  3L2B A;  1KRV A;  3CJ8 A;  2QIV X;  3TV0 A;  2OI6 A;  2JF3 A;  3WSE A;  4HUS A;  3SUC A;  3VBL A;  3R3R A;  3WSF A;  1XHD A;  3OH1 A;  1QRF A;  1S80 A;  1M8N A;  2V0L A;  2VD4 A;  2WLG A;  3R3I A;  4IHH A;  3GQ8 A;  4N69 A;  3VBP A;  5U2K A;  1FWY A;  3DK5 A;  4KQL A;  4EAA A;  4ZIY A;  2WLC A;  3FSC A;  4J18 A;  3T57 A;  1EWW A;  4C13 A;  4EGG A;  4R36 A;  3EH0 A;  3WSG A;  4N6A A;  1QRG A;  1L0S A;  3D8V A;  3EEQ A;  5AFU U;  3BSS A;  2IOJ A;  3R1W A;  4N6B A;  4E1K A;  4CVL A;  4IHF A;  5ADX V;  4HZD A;  4KNX A;  3R5A A;  4N27 A;  4BUB A;  3VBI A;  4E6T A;  3OH0 A;  3R2W A;  1MRL A;  4EAB A;  5E3P A;  1HM8 A;  3GQ9 A;  4QF5 A;  1SSQ A;  4QDI A;  4M2B A;  3TIS A;  4HUR A;  2OEF A;  2AM1 A;  3MC4 A;  1NMP A;  2FKO A;  3GVD A;  4H7O A;  2YYB A;  3FS8 A;  3GQ7 A;  3HSQ A;  3L31 A;  1V67 A;  4AC3 A;  3OU9 A;  1N4I A;  2IU9 A;  4G3P A;  3JQY A;  4EQY A;  3PMO A;  3WSI A;  2IU8 A;  3R5B A;  3BRK X;  3I3X A;  1KHR A;  5L6S A;  3D98 A;  3MQG A;  3MQH A;  1KGQ A;  2RIJ A;  4E79 A;  5E3R A;  1QQ0 A;  4KPZ A;  4R7P A;  1V3W A;  1LXA A;  1KGT A;  2I5K A;  2XJA A;  1THJ A;  1KRR A;  2W0V A;  3GOS A;  3NZ2 A;  3IGJ A;  1QRE A;  1J2Z A;  4G3S A;  1TDT A;  4HZC A;  1MR7 A;  4M28 A;  2QKX A;  4M9C A;  4R37 A;  1KK6 A;  5L6V A;  3ZL8 A;  3OGZ A;  3FTT A;  2IUA A;  5AFU V;  4FCE A;  4KPX A;  1FXJ A;  3Q1X A;  4G3Q A;  3TWD A;  3ZM5 A;  3IXC A;  3VBM A;  1E8C A;  3OH3 A;  3P47 A;  4J09 A;  4CVM A;  4EA7 A;  4KNR A;  2FYW A;  2NPO A;  1GG4 A;  5DEP A;  3GUE A;  3R5C A;  4HCQ A;  4EA9 A;  4E75 A;  3F1X A;  2WLE A;  4E6U A;  3BSY A;  1Z2F A; 
#chains in the Genus database with same CATH homology
 2AQ9 A;  5ADX U;  1KRU A;  2P2O A;  4C12 A;  5F42 A;  1KQA A;  2V0J A;  3ST8 A;  3C8V A;  4EA8 A;  3FSB A;  2Q4J A;  1T3D A;  3R0S A;  1MR9 A;  1Z90 A;  2V0K A;  3ZM6 A;  3R5D A;  2JF2 A;  3EEV A;  3HJJ A;  3I3A A;  3FOQ A;  3OTZ A;  4M98 A;  5DEM A;  3VBJ A;  2WTZ A;  3DHO A;  4AAW A;  3KWD A;  1YP4 A;  2V0H A;  3SPT A;  4CVK A;  2OI7 A;  3P1B A;  2GGQ A;  4IHG A;  1SSM A;  4K6R A;  2WLF A;  4M99 A;  3V4E A;  1OCX A;  3OUP A;  1G97 A;  3KWE A;  2OEG A;  4MYO A;  4MZU A;  3SRT A;  1HM9 A;  2QIA A;  4MFG A;  4M2A A;  3ECT A;  5E3Q A;  2AM2 A;  1QRM A;  1YP3 A;  2GGO A;  3FSY A;  1KK4 A;  1KK5 A;  3VNP A;  3OW5 A;  2ICY A;  1QRL A;  2IC7 A;  4AA7 A;  1YP2 A;  4G87 A;  3DJ4 A;  3TDT A;  2TDT A;  3TK8 A;  3VBK A;  3OTM A;  1HV9 A;  3FSX A;  3EG4 A;  2W0W A;  2XAT A;  1HM0 A;  1G95 A;  4ISX A;  5DG3 A;  3KWC A;  3R8Y A;  4DCL A;  2ICX A;  2V0I A;  1SST A;  2VHE A;  3BSW A;  1XAT A;  3TIO A;  2OI5 A;  3BXY A;  3FWW A;  3VBN A;  2WLD A;  3BFP A;  1KRV A;  3CJ8 A;  2QIV X;  3TV0 A;  2OI6 A;  2JF3 A;  4HUS A;  3VBL A;  3R3R A;  1XHD A;  1QRF A;  1S80 A;  2VD4 A;  2V0L A;  3R3I A;  2WLG A;  4IHH A;  4N69 A;  3VBI A;  3VBP A;  5U2K A;  1FWY A;  3DK5 A;  4KQL A;  4EAA A;  4ZIY A;  2WLC A;  3FSC A;  4J18 A;  3T57 A;  4C13 A;  4EGG A;  4R36 A;  3EH0 A;  4N6A A;  1QRG A;  3D8V A;  5AFU U;  3BSS A;  3R1W A;  4N6B A;  4E1K A;  4CVL A;  4IHF A;  5ADX V;  4HZD A;  4KNX A;  3R5A A;  4N27 A;  4BUB A;  4E6T A;  3R2W A;  1MRL A;  4EAB A;  5E3P A;  1HM8 A;  4QF5 A;  1SSQ A;  4QDI A;  4M2B A;  3TIS A;  4HUR A;  2OEF A;  2AM1 A;  3MC4 A;  2FKO A;  3GVD A;  4H7O A;  3FS8 A;  3HSQ A;  1V67 A;  4AC3 A;  3OU9 A;  2IU9 A;  4G3P A;  3JQY A;  4EQY A;  3PMO A;  2IU8 A;  3R5B A;  3BRK X;  3I3X A;  1KHR A;  5L6S A;  3D98 A;  3MQG A;  3MQH A;  1KGQ A;  2RIJ A;  4E79 A;  5E3R A;  1QQ0 A;  4KPZ A;  4R7P A;  1V3W A;  1LXA A;  1KGT A;  2I5K A;  2XJA A;  1THJ A;  1KRR A;  2W0V A;  3GOS A;  3NZ2 A;  3IGJ A;  1QRE A;  1J2Z A;  4G3S A;  1TDT A;  4HZC A;  1MR7 A;  4M28 A;  2QKX A;  4M9C A;  4R37 A;  1KK6 A;  5L6V A;  3ZL8 A;  3FTT A;  2IUA A;  5AFU V;  4FCE A;  4KPX A;  1FXJ A;  3Q1X A;  4G3Q A;  3TWD A;  3ZM5 A;  3IXC A;  3VBM A;  1E8C A;  4J09 A;  3P47 A;  4CVM A;  4EA7 A;  4KNR A;  2NPO A;  1GG4 A;  5DEP A;  3GUE A;  3R5C A;  4HCQ A;  4EA9 A;  4E75 A;  3F1X A;  2WLE A;  4E6U A;  3BSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...