4IHHA

Chasing acyl carrier protein through a catalytic cycle of lipid a production
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
337
structure length
337
Chain Sequence
HASIRLADLAQQLDAELHGDGDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAPSAVIDATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTIIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMRPITEPGVYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLERKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase
publication title Chasing acyl carrier protein through a catalytic cycle of lipid A production.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/lipid binding protein
total genus 120
structure length 337
sequence length 337
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.191: UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase.
pdb deposition date 2012-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF04613 LpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4ihhA02
3.40.1390.10 Alpha Beta 3-Layer(aba) Sandwich Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 MurE/MurF, N-terminal domain 4ihhA01
3R5BA 4QDIA 1G95A 3GVDA 2VHEA 2IU9A 2P2OA 3JQYA 4KQLA 1Z90A 2QIVX 1QQ0A 4E75A 3ZL8A 3SRTA 2TDTA 3NZ2A 4N69A 4EABA 5ADXU 3TV0A 4KPXA 3HJJA 3R8YA 3GUEA 1QRMA 4DCLA 1QRFA 2V0IA 1QREA 5L6SA 3FTTA 3OTMA 4EA9A 4M28A 4N6BA 3FOQA 2I5KA 2WLGA 1FWYA 3TIOA 4EAAA 4IHGA 3BSSA 1KRVA 4G3QA 2OI6A 1YP2A 3I3XA 5AFUU 1HV9A 3ZM5A 3R3IA 3FS8A 3MQGA 3P1BA 5E3PA 5L6VA 3VBPA 4R37A 1LXAA 1SSTA 4IHFA 4M98A 4ZIYA 1THJA 2WLEA 2XJAA 4G3SA 4M99A 3BXYA 4QF5A 3T57A 3BSWA 3P47A 4G87A 2WLFA 4HUSA 3FSYA 2RIJA 3ST8A 4AC3A 1KHRA 3OU9A 1OCXA 4MYOA 4ISXA 3TWDA 2OEGA 2Q4JA 3R3RA 1KQAA 4HZDA 4M9CA 4C12A 1MR7A 1HM0A 1S80A 3C8VA 4E1KA 4CVKA 3VBJA 5U2KA 3TDTA 4EQYA 1XATA 4M2AA 4CVLA 1YP3A 2XATA 3BFPA 4R7PA 1TDTA 3R5CA 3TK8A 5E3RA 1SSQA 3D8VA 4EGGA 3R5AA 1YP4A 2ICYA 3OTZA 3R0SA 1KK5A 1KK6A 2WLCA 1J2ZA 1KRRA 4FCEA 4M2BA 3EG4A 4KPZA 4HZCA 2GGQA 4KNRA 1HM8A 3CJ8A 4J09A 3OW5A 2V0LA 3ECTA 3KWEA 2NPOA 2W0WA 3VBIA 1KGQA 1MR9A 2OI5A 3DK5A 3BRKX 1XHDA 3FWWA 2QKXA 1QRGA 3EH0A 3IGJA 5F42A 4EA7A 2FKOA 4AA7A 4KNXA 3D98A 4R36A 2V0KA 2W0VA 3FSXA 4BUBA 3VBMA 3VBKA 3EEVA 1GG4A 2V0JA 4J18A 2GGOA 3HSQA 1QRLA 2ICXA 2IUAA 4MZUA 4E6UA 3R1WA 4G3PA 3R5DA 1V3WA 2QIAA 1SSMA 3KWCA 4HURA 5ADXV 2OI7A 3R2WA 3PMOA 3VNPA 3VBLA 3FSBA 2JF2A 5DEPA 4C13A 3DJ4A 1KK4A 2AM2A 3TISA 4E79A 2OEFA 4N6AA 3F1XA 3GOSA 2IC7A 3MQHA 3Q1XA 4AAWA 4E6TA 1G97A 1HM9A 4H7OA 5E3QA 2VD4A 1E8CA 2WTZA 1T3DA 2WLDA 5AFUV 1V67A 1FXJA 3FSCA 3KWDA 3OUPA 2V0HA 2JF3A 4EA8A 1KRUA 3BSYA 3SPTA 5DEMA 3I3AA 4K6RA 4IHHA 3VBNA 1KGTA 3IXCA 2AQ9A 4MFGA 3ZM6A 2IU8A 3V4EA 3MC4A 3DHOA 4N27A 4CVMA 2AM1A 1MRLA 5DG3A 4HCQA
chains in the Genus database with same CATH superfamily
3R5BA 4QDIA 3WSEA 1G95A 3GVDA 2VHEA 4IWGA 2IU9A 2P2OA 3WSFA 3JQYA 4KQLA 1Z90A 2QIVX 1QQ0A 4E75A 3ZL8A 3SRTA 2TDTA 3NZ2A 4N69A 4EABA 5ADXU 3TV0A 4KPXA 3GQ8A 3HJJA 3R8YA 3GUEA 1QRMA 3L2BA 4DCLA 1QRFA 2V0IA 1QREA 5L6SA 1Z2FA 3FTTA 3OTMA 4M28A 4N6BA 3FOQA 4EA9A 3OH3A 2I5KA 2WLGA 1FWYA 3TIOA 4EAAA 4IHGA 3BSSA 1KRVA 4G3QA 2OI6A 1YP2A 3I3XA 5AFUU 1HV9A 3WSDA 3ZM5A 3R3IA 3FS8A 3MQGA 3P1BA 5E3PA 5L6VA 3VBPA 4R37A 1LXAA 1SSTA 4IHFA 4M98A 4ZIYA 1THJA 2WLEA 2XJAA 4G3SA 4M99A 3BXYA 4QF5A 3T57A 3BSWA 3P47A 4G87A 2WLFA 4HUSA 3FSYA 2RIJA 3ST8A 4AC3A 1KHRA 3OU9A 1OCXA 4MYOA 4ISXA 3TWDA 2OEGA 2Q4JA 3R3RA 1KQAA 4HZDA 4M9CA 4C12A 1MR7A 1HM0A 1S80A 3C8VA 4E1KA 4CVKA 3VBJA 5U2KA 3TDTA 4EQYA 1XATA 4M2AA 1NMPA 4CVLA 1YP3A 2XATA 3BFPA 4R7PA 1TDTA 3R5CA 3TK8A 5E3RA 1KO7A 1SSQA 3D8VA 4EGGA 3GQ7A 3R5AA 1YP4A 2ICYA 3OTZA 3R0SA 1KK5A 1KK6A 2WLCA 1J2ZA 1KRRA 4FCEA 4M2BA 3WSGA 3EG4A 4KPZA 4HZCA 2GGQA 1M8NA 3OH1A 4KNRA 3SUCA 2YYBA 1HM8A 3OH0A 3CJ8A 4J09A 3OGZA 3OW5A 1EWWA 2V0LA 3ECTA 3KWEA 2NPOA 2W0WA 3VBIA 1KGQA 1MR9A 2OI5A 3DK5A 3BRKX 1XHDA 3FWWA 2QKXA 1QRGA 3EH0A 3GQAA 3IGJA 5F42A 4IWMA 4EA7A 3OH2A 2FKOA 4AA7A 4KNXA 3D98A 4R36A 2V0KA 3EEQA 3WSIA 2W0VA 3FSXA 4BUBA 3VBMA 3VBKA 3EEVA 2FYWA 1GG4A 2V0JA 3GQ9A 4J18A 3WSHA 2GGOA 3HSQA 1QRLA 2ICXA 2IUAA 4MZUA 4E6UA 3R1WA 4G3PA 3R5DA 3OH4A 1KNXA 1V3WA 2QIAA 1SSMA 3KWCA 4HURA 5ADXV 2OI7A 3R2WA 3PMOA 3VNPA 1N4IA 3VBLA 3FSBA 1NMOA 2JF2A 5DEPA 4C13A 3DJ4A 1KK4A 2AM2A 3TISA 4E79A 2OEFA 4N6AA 3F1XA 3GOSA 2IC7A 3MQHA 3Q1XA 4AAWA 4E6TA 1G97A 1HM9A 4H7OA 5E3QA 2VD4A 1E8CA 2WTZA 1T3DA 2WLDA 5AFUV 1V67A 1FXJA 3FSCA 3KWDA 3OUPA 2V0HA 2JF3A 2IOJA 4EA8A 3L31A 1KRUA 3BSYA 1L0SA 3SPTA 5DEMA 3I3AA 4K6RA 4IHHA 3VBNA 1KGTA 3IXCA 2AQ9A 4MFGA 3ZM6A 2IU8A 3V4EA 3MC4A 3DHOA 4N27A 4CVMA 2AM1A 1MRLA 5DG3A 4HCQA
chains in the Genus database with same CATH topology
3R5BA 4QDIA 1G95A 3GVDA 2VHEA 2IU9A 2P2OA 3JQYA 4KQLA 1Z90A 2QIVX 1QQ0A 4E75A 3ZL8A 3SRTA 2TDTA 3NZ2A 4N69A 4EABA 5ADXU 3TV0A 4KPXA 3HJJA 3R8YA 3GUEA 1QRMA 4DCLA 1QRFA 2V0IA 1QREA 5L6SA 3FTTA 3OTMA 4EA9A 4M28A 4N6BA 3FOQA 2I5KA 2WLGA 1FWYA 3TIOA 4EAAA 4IHGA 3BSSA 1KRVA 4G3QA 2OI6A 1YP2A 3I3XA 5AFUU 1HV9A 3ZM5A 3R3IA 3FS8A 3MQGA 3P1BA 5E3PA 5L6VA 3VBPA 4R37A 1LXAA 1SSTA 4IHFA 4M98A 4ZIYA 1THJA 2WLEA 2XJAA 4G3SA 4M99A 3BXYA 4QF5A 3T57A 3BSWA 3P47A 4G87A 2WLFA 4HUSA 3FSYA 2RIJA 3ST8A 4AC3A 1KHRA 3OU9A 1OCXA 4MYOA 4ISXA 3TWDA 2OEGA 2Q4JA 3R3RA 1KQAA 4HZDA 4M9CA 4C12A 1MR7A 1HM0A 1S80A 3C8VA 4E1KA 4CVKA 3VBJA 5U2KA 3TDTA 4EQYA 1XATA 4M2AA 4CVLA 1YP3A 2XATA 3BFPA 4R7PA 1TDTA 3R5CA 3TK8A 5E3RA 1SSQA 3D8VA 4EGGA 3R5AA 1YP4A 2ICYA 3OTZA 3R0SA 1KK5A 1KK6A 2WLCA 1J2ZA 1KRRA 4FCEA 4M2BA 3EG4A 4KPZA 4HZCA 2GGQA 4KNRA 1HM8A 3CJ8A 4J09A 3OW5A 2V0LA 3ECTA 3KWEA 2NPOA 2W0WA 3VBIA 1KGQA 1MR9A 2OI5A 3DK5A 3BRKX 1XHDA 3FWWA 2QKXA 1QRGA 3EH0A 3IGJA 5F42A 4EA7A 2FKOA 4AA7A 4KNXA 3D98A 4R36A 2V0KA 2W0VA 3FSXA 4BUBA 3VBMA 3VBKA 3EEVA 1GG4A 2V0JA 4J18A 2GGOA 3HSQA 1QRLA 2ICXA 2IUAA 4MZUA 4E6UA 3R1WA 4G3PA 3R5DA 1V3WA 2QIAA 1SSMA 3KWCA 4HURA 5ADXV 2OI7A 3R2WA 3PMOA 3VNPA 3VBLA 3FSBA 2JF2A 5DEPA 4C13A 3DJ4A 1KK4A 2AM2A 3TISA 4E79A 2OEFA 4N6AA 3F1XA 3GOSA 2IC7A 3MQHA 3Q1XA 4AAWA 4E6TA 1G97A 1HM9A 4H7OA 5E3QA 2VD4A 1E8CA 2WTZA 1T3DA 2WLDA 5AFUV 1V67A 1FXJA 3FSCA 3KWDA 3OUPA 2V0HA 2JF3A 4EA8A 1KRUA 3BSYA 3SPTA 5DEMA 3I3AA 4K6RA 4IHHA 3VBNA 1KGTA 3IXCA 2AQ9A 4MFGA 3ZM6A 2IU8A 3V4EA 3MC4A 3DHOA 4N27A 4CVMA 2AM1A 1MRLA 5DG3A 4HCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R5B A;  4QDI A;  1G95 A;  3GVD A;  2VHE A;  2IU9 A;  2P2O A;  3JQY A;  4KQL A;  1Z90 A;  2QIV X;  1QQ0 A;  4E75 A;  3ZL8 A;  3SRT A;  2TDT A;  3NZ2 A;  4N69 A;  4EAB A;  5ADX U;  3TV0 A;  4KPX A;  3HJJ A;  3R8Y A;  3GUE A;  1QRM A;  4DCL A;  1QRF A;  2V0I A;  1QRE A;  5L6S A;  3FTT A;  3OTM A;  4EA9 A;  4M28 A;  4N6B A;  3FOQ A;  2I5K A;  2WLG A;  1FWY A;  3TIO A;  4EAA A;  4IHG A;  3BSS A;  1KRV A;  4G3Q A;  2OI6 A;  1YP2 A;  3I3X A;  5AFU U;  1HV9 A;  3ZM5 A;  3R3I A;  3FS8 A;  3MQG A;  3P1B A;  5E3P A;  5L6V A;  3VBP A;  4R37 A;  1LXA A;  1SST A;  4IHF A;  4M98 A;  4ZIY A;  1THJ A;  2WLE A;  2XJA A;  4G3S A;  4M99 A;  3BXY A;  4QF5 A;  3T57 A;  3BSW A;  3P47 A;  4G87 A;  2WLF A;  4HUS A;  3FSY A;  2RIJ A;  3ST8 A;  4AC3 A;  1KHR A;  3OU9 A;  1OCX A;  4MYO A;  4ISX A;  3TWD A;  2OEG A;  2Q4J A;  3R3R A;  1KQA A;  4HZD A;  4M9C A;  4C12 A;  1MR7 A;  1HM0 A;  1S80 A;  3C8V A;  4E1K A;  4CVK A;  3VBJ A;  5U2K A;  3TDT A;  4EQY A;  1XAT A;  4M2A A;  4CVL A;  1YP3 A;  2XAT A;  3BFP A;  4R7P A;  1TDT A;  3R5C A;  3TK8 A;  5E3R A;  1SSQ A;  3D8V A;  4EGG A;  3R5A A;  1YP4 A;  2ICY A;  3OTZ A;  3R0S A;  1KK5 A;  1KK6 A;  2WLC A;  1J2Z A;  1KRR A;  4FCE A;  4M2B A;  3EG4 A;  4KPZ A;  4HZC A;  2GGQ A;  4KNR A;  1HM8 A;  3CJ8 A;  4J09 A;  3OW5 A;  2V0L A;  3ECT A;  3KWE A;  2NPO A;  2W0W A;  3VBI A;  1KGQ A;  1MR9 A;  2OI5 A;  3DK5 A;  3BRK X;  1XHD A;  3FWW A;  2QKX A;  1QRG A;  3EH0 A;  3IGJ A;  5F42 A;  4EA7 A;  2FKO A;  4AA7 A;  4KNX A;  3D98 A;  4R36 A;  2V0K A;  2W0V A;  3FSX A;  4BUB A;  3VBM A;  3VBK A;  3EEV A;  1GG4 A;  2V0J A;  4J18 A;  2GGO A;  3HSQ A;  1QRL A;  2ICX A;  2IUA A;  4MZU A;  4E6U A;  3R1W A;  4G3P A;  3R5D A;  1V3W A;  2QIA A;  1SSM A;  3KWC A;  4HUR A;  5ADX V;  2OI7 A;  3R2W A;  3PMO A;  3VNP A;  3VBL A;  3FSB A;  2JF2 A;  5DEP A;  4C13 A;  3DJ4 A;  1KK4 A;  2AM2 A;  3TIS A;  4E79 A;  2OEF A;  4N6A A;  3F1X A;  3GOS A;  2IC7 A;  3MQH A;  3Q1X A;  4AAW A;  4E6T A;  1G97 A;  1HM9 A;  4H7O A;  5E3Q A;  2VD4 A;  1E8C A;  2WTZ A;  1T3D A;  2WLD A;  5AFU V;  1V67 A;  1FXJ A;  3FSC A;  3KWD A;  3OUP A;  2V0H A;  2JF3 A;  4EA8 A;  1KRU A;  3BSY A;  3SPT A;  5DEM A;  3I3A A;  4K6R A;  4IHH A;  3VBN A;  1KGT A;  3IXC A;  2AQ9 A;  4MFG A;  3ZM6 A;  2IU8 A;  3V4E A;  3MC4 A;  3DHO A;  4N27 A;  4CVM A;  2AM1 A;  1MRL A;  5DG3 A;  4HCQ A; 
#chains in the Genus database with same CATH topology
 3R5B A;  4QDI A;  3WSE A;  1G95 A;  3GVD A;  2VHE A;  4IWG A;  2IU9 A;  2P2O A;  3WSF A;  3JQY A;  4KQL A;  1Z90 A;  2QIV X;  1QQ0 A;  4E75 A;  3ZL8 A;  3SRT A;  2TDT A;  3NZ2 A;  4N69 A;  4EAB A;  5ADX U;  3TV0 A;  4KPX A;  3GQ8 A;  3HJJ A;  3R8Y A;  3GUE A;  1QRM A;  3L2B A;  4DCL A;  1QRF A;  2V0I A;  1QRE A;  5L6S A;  1Z2F A;  3FTT A;  3OTM A;  4M28 A;  4N6B A;  3FOQ A;  4EA9 A;  3OH3 A;  2I5K A;  2WLG A;  1FWY A;  3TIO A;  4EAA A;  4IHG A;  3BSS A;  1KRV A;  4G3Q A;  2OI6 A;  1YP2 A;  3I3X A;  5AFU U;  1HV9 A;  3WSD A;  3ZM5 A;  3R3I A;  3FS8 A;  3MQG A;  3P1B A;  5E3P A;  5L6V A;  3VBP A;  4R37 A;  1LXA A;  1SST A;  4IHF A;  4M98 A;  4ZIY A;  1THJ A;  2WLE A;  2XJA A;  4G3S A;  4M99 A;  3BXY A;  4QF5 A;  3T57 A;  3BSW A;  3P47 A;  4G87 A;  2WLF A;  4HUS A;  3FSY A;  2RIJ A;  3ST8 A;  4AC3 A;  1KHR A;  3OU9 A;  1OCX A;  4MYO A;  4ISX A;  3TWD A;  2OEG A;  2Q4J A;  3R3R A;  1KQA A;  4HZD A;  4M9C A;  4C12 A;  1MR7 A;  1HM0 A;  1S80 A;  3C8V A;  4E1K A;  4CVK A;  3VBJ A;  5U2K A;  3TDT A;  4EQY A;  1XAT A;  4M2A A;  1NMP A;  4CVL A;  1YP3 A;  2XAT A;  3BFP A;  4R7P A;  1TDT A;  3R5C A;  3TK8 A;  5E3R A;  1KO7 A;  1SSQ A;  3D8V A;  4EGG A;  3GQ7 A;  3R5A A;  1YP4 A;  2ICY A;  3OTZ A;  3R0S A;  1KK5 A;  1KK6 A;  2WLC A;  1J2Z A;  1KRR A;  4FCE A;  4M2B A;  3WSG A;  3EG4 A;  4KPZ A;  4HZC A;  2GGQ A;  1M8N A;  3OH1 A;  4KNR A;  3SUC A;  2YYB A;  1HM8 A;  3OH0 A;  3CJ8 A;  4J09 A;  3OGZ A;  3OW5 A;  1EWW A;  2V0L A;  3ECT A;  3KWE A;  2NPO A;  2W0W A;  3VBI A;  1KGQ A;  1MR9 A;  2OI5 A;  3DK5 A;  3BRK X;  1XHD A;  3FWW A;  2QKX A;  1QRG A;  3EH0 A;  3GQA A;  3IGJ A;  5F42 A;  4IWM A;  4EA7 A;  3OH2 A;  2FKO A;  4AA7 A;  4KNX A;  3D98 A;  4R36 A;  2V0K A;  3EEQ A;  3WSI A;  2W0V A;  3FSX A;  4BUB A;  3VBM A;  3VBK A;  3EEV A;  2FYW A;  1GG4 A;  2V0J A;  3GQ9 A;  4J18 A;  3WSH A;  2GGO A;  3HSQ A;  1QRL A;  2ICX A;  2IUA A;  4MZU A;  4E6U A;  3R1W A;  4G3P A;  3R5D A;  3OH4 A;  1KNX A;  1V3W A;  2QIA A;  1SSM A;  3KWC A;  4HUR A;  5ADX V;  2OI7 A;  3R2W A;  3PMO A;  3VNP A;  1N4I A;  3VBL A;  3FSB A;  1NMO A;  2JF2 A;  5DEP A;  4C13 A;  3DJ4 A;  1KK4 A;  2AM2 A;  3TIS A;  4E79 A;  2OEF A;  4N6A A;  3F1X A;  3GOS A;  2IC7 A;  3MQH A;  3Q1X A;  4AAW A;  4E6T A;  1G97 A;  1HM9 A;  4H7O A;  5E3Q A;  2VD4 A;  1E8C A;  2WTZ A;  1T3D A;  2WLD A;  5AFU V;  1V67 A;  1FXJ A;  3FSC A;  3KWD A;  3OUP A;  2V0H A;  2JF3 A;  2IOJ A;  4EA8 A;  3L31 A;  1KRU A;  3BSY A;  1L0S A;  3SPT A;  5DEM A;  3I3A A;  4K6R A;  4IHH A;  3VBN A;  1KGT A;  3IXC A;  2AQ9 A;  4MFG A;  3ZM6 A;  2IU8 A;  3V4E A;  3MC4 A;  3DHO A;  4N27 A;  4CVM A;  2AM1 A;  1MRL A;  5DG3 A;  4HCQ A; 
#chains in the Genus database with same CATH homology
 3R5B A;  4QDI A;  1G95 A;  3GVD A;  2VHE A;  2IU9 A;  2P2O A;  3JQY A;  4KQL A;  1Z90 A;  2QIV X;  1QQ0 A;  4E75 A;  3ZL8 A;  3SRT A;  2TDT A;  3NZ2 A;  4N69 A;  4EAB A;  5ADX U;  3TV0 A;  4KPX A;  3HJJ A;  3R8Y A;  3GUE A;  1QRM A;  4DCL A;  1QRF A;  2V0I A;  1QRE A;  5L6S A;  3FTT A;  3OTM A;  4EA9 A;  4M28 A;  4N6B A;  3FOQ A;  2I5K A;  2WLG A;  1FWY A;  3TIO A;  4EAA A;  4IHG A;  3BSS A;  1KRV A;  4G3Q A;  2OI6 A;  1YP2 A;  3I3X A;  5AFU U;  1HV9 A;  3ZM5 A;  3R3I A;  3FS8 A;  3MQG A;  3P1B A;  5E3P A;  5L6V A;  3VBP A;  4R37 A;  1LXA A;  1SST A;  4IHF A;  4M98 A;  4ZIY A;  1THJ A;  2WLE A;  2XJA A;  4G3S A;  4M99 A;  3BXY A;  4QF5 A;  3T57 A;  3BSW A;  3P47 A;  4G87 A;  2WLF A;  4HUS A;  3FSY A;  2RIJ A;  3ST8 A;  4AC3 A;  1KHR A;  3OU9 A;  1OCX A;  4MYO A;  4ISX A;  3TWD A;  2OEG A;  2Q4J A;  3R3R A;  1KQA A;  4HZD A;  4M9C A;  4C12 A;  1MR7 A;  1HM0 A;  1S80 A;  3C8V A;  4E1K A;  4CVK A;  3VBJ A;  5U2K A;  3TDT A;  4EQY A;  1XAT A;  4M2A A;  4CVL A;  1YP3 A;  2XAT A;  3BFP A;  4R7P A;  1TDT A;  3R5C A;  3TK8 A;  5E3R A;  1SSQ A;  3D8V A;  4EGG A;  3R5A A;  1YP4 A;  2ICY A;  3OTZ A;  3R0S A;  1KK5 A;  1KK6 A;  2WLC A;  1J2Z A;  1KRR A;  4FCE A;  4M2B A;  3EG4 A;  4KPZ A;  4HZC A;  2GGQ A;  4KNR A;  1HM8 A;  3CJ8 A;  4J09 A;  3OW5 A;  2V0L A;  3ECT A;  3KWE A;  2NPO A;  2W0W A;  3VBI A;  1KGQ A;  1MR9 A;  2OI5 A;  3DK5 A;  3BRK X;  1XHD A;  3FWW A;  2QKX A;  1QRG A;  3EH0 A;  3IGJ A;  5F42 A;  4EA7 A;  2FKO A;  4AA7 A;  4KNX A;  3D98 A;  4R36 A;  2V0K A;  2W0V A;  3FSX A;  4BUB A;  3VBM A;  3VBK A;  3EEV A;  1GG4 A;  2V0J A;  4J18 A;  2GGO A;  3HSQ A;  1QRL A;  2ICX A;  2IUA A;  4MZU A;  4E6U A;  3R1W A;  4G3P A;  3R5D A;  1V3W A;  2QIA A;  1SSM A;  3KWC A;  4HUR A;  5ADX V;  2OI7 A;  3R2W A;  3PMO A;  3VNP A;  3VBL A;  3FSB A;  2JF2 A;  5DEP A;  4C13 A;  3DJ4 A;  1KK4 A;  2AM2 A;  3TIS A;  4E79 A;  2OEF A;  4N6A A;  3F1X A;  3GOS A;  2IC7 A;  3MQH A;  3Q1X A;  4AAW A;  4E6T A;  1G97 A;  1HM9 A;  4H7O A;  5E3Q A;  2VD4 A;  1E8C A;  2WTZ A;  1T3D A;  2WLD A;  5AFU V;  1V67 A;  1FXJ A;  3FSC A;  3KWD A;  3OUP A;  2V0H A;  2JF3 A;  4EA8 A;  1KRU A;  3BSY A;  3SPT A;  5DEM A;  3I3A A;  4K6R A;  4IHH A;  3VBN A;  1KGT A;  3IXC A;  2AQ9 A;  4MFG A;  3ZM6 A;  2IU8 A;  3V4E A;  3MC4 A;  3DHO A;  4N27 A;  4CVM A;  2AM1 A;  1MRL A;  5DG3 A;  4HCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...