4II1A

Crystal structure of the zinc finger of zgpat
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
142
structure length
136
Chain Sequence
EELSGTKVSAPYYTLEYHNAMVVGTEEAGSAGVRVLYLYPTHKSLKPCPFFLEGKCRFKENCRFSHGQVVSLDELRPFQDPDLSSLQAGSACLAKHQDGLWHAARITDVDNGYYTVKFDSLLLREAVVEGDGILPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger CCCH-type with G patch domain-containing protein
publication title Crystal structure of the zinc finger of ZGPAT
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 26
structure length 136
sequence length 142
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18044 zf-CCCH_4 CCCH-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ii1A02
2.30.30.1190 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ii1A01
4N4GA 4IUTA 2PQWA 3QJ6A 2O4XA 1OZ3A 3S3OA 1KHCA 3OYHA 2B8AA 2BIVA 3MEVA 2BKDN 2R5MA 2X4YA 2G3RA 3OYGA 5M9OA 2EQUA 5J26A 2DAQA 2LCCA 2CKKA 2K3XA 4N4IA 5IAYA 3OYJA 2QQSA 4ZTFA 4OVAA 3P8DA 4II1A 4IUVA 2EQMA 3MP1A 3GOXA 4BE1A 5KH6A 1WJQA 4RG2A 4GY5A 3UT1A 5IN1A 3OMGA 2F5KA 4C5EA 3OMCA 3OYCA 3DLMA 3ASKA 2RO0A 3PMTA 4BDZA 2L89A 4A4EA 3FC3A 3PMIA 1N27A 4QVZA 3MEUA 2E5QA 4A4GA 3FEOA 2HQEA 3OS1A 4QQ6A 3OS2A 4IKFA 3H8ZA 5J39A 4CRIA 2RJFA 2XDPA 2RHIA 2RI3A 3OA6A 4E7JA 2MWPA 4E7IA 2GF7A 4FL6A 3E9GA 3PNWC 4BD3A 3LLRA 3MO8A 4HCZA 4E7KA 2X35A 3Q1JA 4QW2A 4L59A 3H6ZA 2BUDA 1XNIA 3OYFA 4B9XA 3M9QA 3EAEA 3PFSA 4ZTJA 2RJDA 3OS0A 3OYLA 4IUPA 2RHZA 4Z02A 5FRNA 3E9FA 2RJEA 4PLLA 3LGLA 3QKJA 3DB4A 3MEWA 2L3RA 2O4XB 2JZ2A 2R58A 5FROA 2XK0A 2EFIA 2RHYA 3L2WA 2P0KA 2EKOA 1WGSA 4QQGA 1H3ZA 3OB9A 3MP8A 3OYIA 2GFUA 4NS5A 1RI0A 4FU6A 2RHXA 3CEYA 2VYTA 4A4HA 2IG0A 2L8DA 3LGFA 2R5AA 2WACA 3QIIA 4C5IA 3OY9A 3QBYA 3OYAA 2HQXA 3NTIA 3OQ5A 3LX7A 3META 3OYKA 2M16A 3L2UA 4C5HA 1MHNA 3L2RA 2K3YA 3FDRA 3KUFA 5D6XA 3L2QA 2GFAA 4BDYA 4X34A 4BE0A 3FLGA 2YRVA 5D6YA 2NLUA 2X4WA 4A4FA 5KE2A 3SD4A 2JTFA 5KCOA 4E7HA 2RHUA 1OI1A 3L2VA 4B9WA 3LH0A 3ME9A 4QQDA 3MEAA 4BE2A 1SSFA 5C6SA 2RI5A 2RI2A 4IUUA 2FHDA 4C5GA 2LVMA 4EDUA 3OYBA 2EQKA 3L42A 3S6WA 4IURA 2X4XA 4PL6A 5KE3A 4E7LA 1WJRA 2DIQA 3OYMA 2MWOA 4N4HA 4IUQA 3OYEA 5FRMA 2M0OA 3OYNA 3NTHA 4PLIA 1G5VA 2E6NA 3C4SA 2RJCA 3BDLA 3ZEHA 2R57A 3O8VA 5D6WA 3S3NA 2LDMA 5C0MA 2M1HA 4LD6A 1OZ2A 5CIUA 3S3MA 4UC4A 2LRQA 3DB3A 2D9TA 1OYXA 1WJSA 4Q5WA 3LYIA 3MP6A 4BACA 2LTOA 5KCHA 2DIGA 2EQJA 3P8HA 3NTKA 3UWNA 2QQRA 3F70A 3OYDA
chains in the Genus database with same CATH superfamily
2L5QA 2X3WD 1VQLT 1YI2Q 1GRIA 2KRNA 3EGDB 2OTJA 3RBBB 3OYJA 2RB6A 1ZQ1A 2QXFA 2CP6A 4LUDA 1TS9A 1PNJA 1UTIA 4DBFA 3JCMP 2KYBA 5GJWB 1K76A 3JCMd 1O9SA 1QP2A 4GLMA 4M78D 4QVCA 1RAGB 2MOXA 1X69A 2K7AA 1G3TA 1Y96A 3U23A 5GMKh 2RH2A 1VYTA 2M02A 1D3BA 1W6XA 2CT4A 1DJ7B 3PVQA 1D09B 2A7YA 3M0RA 5I21A 4PLLA 1FMWA 3MEWA 1R8OB 2V26A 2XK0A 3C95A 3OBYA 4ATOA 1H3ZA 4NS5A 2KI7A 1WYXA 3LGFA 1UGQB 3OY9A 4M75C 3OYKA 2XD0A 4AT1B 2AZVA 2K4YA 5D7UA 2KT1A 3V8LA 3EG9A 4EIKA 3HSBA 2HMAA 2GNCA 2DM1A 1HXDA 1BI2A 3CCQT 1AZGB 2LVMA 1RAAB 1K4US 3JCMc 4KUDK 5LJ3j 3JCMe 2D8HA 1V76A 2DYBA 3CPWS 1YJNA 3RMSA 4B6MA 4JJDA 1WQWA 2K5IA 4Y92A 1B34A 2L0AA 3UDCA 1RI9A 1X43A 3CXCS 1K9MU 2HDAA 2A3LA 1E6GA 1KIKA 1LOJA 3I5SA 1QCFA 4R0KA 4BACA 2DIGA 2QGFB 2LT1A 3MHXA 4M77B 4ZGJB 1M9SA 3QJ6A 3QWYA 1JRIA 3OBWA 2GQIA 2QDYB 2X4YA 1ARKA 2LMJA 2IIMA 2E64A 2PVDB 4KULA 4M7DG 3M53A 2DD4A 5A0DA 5GAMj 5A0GA 3MP1A 4EMHA 2QASA 4PJJA 1VIEA 4TVRA 3V8JA 2L89A 1N27A 5GAMf 2JUFA 5LJ3g 1GCQA 1RAHB 3CMAT 2RHIA 5GAN3 1KD1C 5KYNA 3PNWC 3PE0A 4LDWA 1HJDA 2VUBA 4HCZA 4M7DF 1VQNT 1D0ZA 3H6ZA 1SEMA 4C0DC 3LGLA 3SWNB 4XAXB 2LJ3A 1U8RA 3RR6A 1K8AU 1UFFA 1PKTA 3GP8A 5GANh 1YI2T 1H8KA 1I0CA 3OQ5A 3LX7A 1BCMA 3RESA 5D6YA 5GAMg 3CBOA 1I81A 3CCLQ 4PJOG 1KC8C 4LDXA 3WVEB 2PU9B 5LJ5f 2HQHA 3M0TA 4JJBA 1GCPA 3SFMA 3JAME 1Q82C 2CGHA 2QK0A 1M1KU 1U1TA 2KGTA 3VKIA 2DILA 3ZFJA 2GQVA 5CIUA 4PFPA 2EAYA 4M7AA 1XQHA 2FRYA 3LYIA 4JS4A 1QVFP 2KNBB 3NTKA 3UWNA 2MI6A 4JJCA 4FYYB 5IHIA 5I2SA 2QAZA 2KE9A 2VGMA 3VS6A 2LCCA 4A63B 1K0SA 4GY5A 2MK5A 3OMGA 1YJWQ 2HBPA 4FW1A 1I5LA 2HQEA 1YCSB 2LNVA 4C8QC 4FYXB 4OMFB 4ZGDB 4OMOA 4E7KA 4XK8E 4Y28E 1ZA1B 2ECZA 3SEMA 1FXXA 2RJDA 5LJ3d 2KXDA 2K5LA 3GNGA 1SHFA 3CCJQ 1YIJA 2JNGA 4F7UB 3L2WA 2WSFE 4KGZB 2LCLA 1QCOA 1Q86C 3I9QA 2DZCA 2HL3A 2YHTA 1VQ5A 3GPLA 2COYA 4BDYA 4BE0A 2YRVA 3JCMh 1R77A 2JXBA 1KQSS 2J6FA 1WX6A 3MEAA 2RQVA 1VQ8Q 4RUGA 2MYSA 4IUUA 1VQ5T 2LJ0A 3S6WA 3FRNA 1U5SA 2GCXA 3EGXB 4C8QA 2JT4A 1ACMB 3CCUA 4M77G 5GMKi 5GAMd 4ELZC 3CMEQ 2ESWA 1YCYA 4EPCA 4X9CA 5ECAA 3X26B 2ZPIB 2D0NA 5C0MA 1ZSZB 2DD5A 3VJPA 4UC4A 1GBQA 4LDUA 3HRTA 3VUBA 5LJ3e 1RADB 4M78E 2EYQA 1KFZA 2F69A 3OS5A 4M77F 3CCLA 3EFRA 4OP0A 1WHJA 2HSEB 5GAN4 3JB9D 4AFZC 1HD3A 1QW1A 4LDVA 1NBEB 4E7ZA 5CQYA 4XU0A 3CCLT 1X6OA 2EYZA 2HEQA 3T9NA 1N8RU 4MMKA 1M3AA 1M90C 1SRLA 2FPEA 3J7AF 4PJNA 1TUGB 4IIOA 4M7AD 3TU4K 2JOYA 5CVIA 5GAMe 3LLRA 1VQ7Q 3JRZA 2NYSA 1EFNA 3AHUA 4KRTA 1VQPQ 1OPLA 1KD1R 3E9FA 2MPXC 4OGEA 1OU8A 5CKBA 3QJYA 2RF0A 2F5TX 4HKEA 2RHYA 1NPRA 2DYIA 1K1ZA 3MP8A 1NJIC 4WCIA 4J9BA 3UATA 1GFDA 1YWPA 1PCXA 2P4RA 5FWBA 2IVWA 1TH7A 2A37A 1BI0A 2OX7A 2DX1A 1UG1A 1M2VA 4ZNXA 2GFAA 1W2BS 4FW2A 2H3JA 2QTVA 1TUCA 4M78C 4BY6B 1VQ6Q 3ER0A 2EBPA 4GLKA 2FHDA 1PC0A 3ZL7C 2DEQA 2V1RA 3HFNA 1KC8R 2YSQA 2MWOA 4XTZA 5CQXA 3CCJA 1WDXA 2CH4A 1YHQQ 2Y90A 2LDMA 3RKXA 1Q82R 2QI2A 2DL4A 4M7DA 4Q5WA 2BTTA 5KCHA 3CCJT 2P0PA 1N6AA 1IO6A 3OYDA 2A36A 4Z8AA 2OTJQ 5AT1B 4IUTA 4PJOC 1VYUA 3IQLA 3JCMJ 3G4SA 4JRQA 1Q81U 2CH4W 2KYMA 1HK9A 2R5MA 2BE9B 2JMAA 3M0UA 5KYUA 5CO7A 1ZA2B 1QQJA 1KJWA 1G2BA 2PVGB 4N4IA 3CPWA 3CCVQ 2ZPFB 2QQSA 3G6EA 1AHJB 1X2QA 1PKSA 3P8DA 4II1A 3SB2A 4C8QD 4FM4B 3CXCA 1UHCA 3QO3A 1VQ8T 3DLMA 2GTJA 1U1SA 1I5OB 4KUIA 2QA4A 2YDLA 5FW9A 3CD6A 4F7UG 4QQ6A 2RD1A 1UJ0A 3CMET 4E7IA 4HT9A 4C0ZA 1X6GA 2KAFA 1AWJA 1YWOA 2K79A 1YJ9A 2CP5A 3ZBDA 2ZCFB 4PJOA 2OAUA 2KROA 2V8JA 2YUNA 1E6HA 1BKBA 4F7UF 3HP9A 2RHXA 3CEYA 2DJZA 4A4HA 2MAMA 1BB9A 1JXMA 4P5NA 3QBYA 2YT6A 1WQ7A 3RDVA 2NWMA 4OMPA 1OPKA 1CKAA 2O31A 4EMGA 3INZA 1CSKA 1PWTA 2JW4A 1Q86R 3LH0A 4OB2B 2LZ6B 4BB7A 2XDBA 1YJNQ 1KG1A 1UGSB 1G8XA 3FJPA 3FB9A 2M0YA 1WJRA 1VQPA 1UB4A 2YUOA 1K9AA 1VUBA 2EKHA 5HK0A 2E70A 4ANJA 4PFZA 2J6OA 4PLIA 2E6NA 1VQ7T 1BI3A 3HFOA 3RUXA 4PKCC 4A54A 4ELYC 1VQPT 4HT8A 2DE0X 1M3BA 1PRLC 3P8HA 2HL5C 3UPUA 2JMCA 2D1XA 4C0GA 9ATCB 1LJOA 3S3OA 4LN2A 2CP0A 2B8AA 2P0QA 4OMQA 3UA7A 1SSHA 3QHSA 4EMKB 3OW2S 1Y07A 1VQKA 5HK3A 5FLXE 4OVAA 3GOXA 4BI4A 5GAMh 5HY6A 4LXCA 2AKLA 1RABB 2HKNA 2KEAA 4KH0B 4BDZA 1AEYA 4DQ2A 4QVZA 1JBMA 1ABQA 4FCYA 1M1GA 4HCBA 4RTTA 1AOJA 2MWPA 1M90R 4M7DD 2DFUA 4GBQA 1VQMA 1YHQT 5KYWB 2BUDA 1UEBA 3QDRB 4ZTJA 3EAEA 4Z02A 2QTXA 1TWBA 3DB4A 1X75C 3TCJA 2EFIA 2ROLA 4NOYA 2L2PA 3CCVA 2OTJT 1I1JA 1MMNA 2FRWA 5IHKA 1R0BG 2IG0A 2WSCE 3QIIA 2D8JA 1MMGA 2HQXA 4M77A 4YTLA 1NJIR 3CCVT 2DVJA 4XU3A 5LJ5h 2JTFA 2K9GA 1RLPC 2FG0A 2JS2A 3KBGA 3JCMX 4RG8A 3GNFB 2C0OA 5A2QE 2PZ1A 3OYBA 4MDXA 4OGCA 3E2UA 1Y57A 1T0JA 1QWFA 2FZCB 3OYEA 2HCKA 3HHTB 1EIFA 1G3WA 4JRKA 2O01E 3UF4A 3S3NA 3CCRA 4PJOD 3A1PA 1WFWA 3S3MA 1JJ2P 1D0XA 2AT1B 4CC2A 1Y0MA 4XTWA 2KBTA 4C92B 1KQSA 4LDYA 4M7AE 1VQOA 3SWNA 2ZPEB 5IH2A 3CCSA 1GCQC 2GGRA 2E6ZA 1BI1A 2E3IA 4HA8A 4F14A 5IT9E 2DKGA 5LJ3f 2DF6A 4Z88A 4HCCA 4JJNK 3VS2A 3QUIA 2C0IA 3CCST 3G71A 2FPFA 2J06A 5IN1A 2F5KA 4J9EA 1YJNT 1X27A 4A4EA 3OS1A 4LE9A 4CRIA 3CPFA 2RI3A 3A8GB 3JCMV 1N5ZA 3MO8A 1OV3A 5I11A 1QKWA 1YIJQ 4HCKA 2VXFA 1H3HA 1YNZA 2E65A 2E3HA 1T3SA 3LWIA 2JZ2A 5FROA 4MDWA 1VQ5Q 2EKOA 1UGVA 1BK2A 2L3SA 1QKXA 3NHNA 3A8HB 1ZSGA 4JRPA 4J83A 4AFUC 3KUFA 4V2SA 1PM3A 2NLUA 3D7SB 4E7HA 2DMOA 3SD4A 1LVKA 2CT3A 2L3QA 3CCUQ 1MMDA 3ME9A 4QQDA 2KXCA 2XMFA 5C6SA 4M7AC 2LQ8A 1W1FA 2LQWA 2EW3A 2DL3A 5KE3A 2DIQA 3KXTA 2E1HA 4IUQA 2K2MA 3OYNA 4KT0E 3VS7A 4JRIA 3PVLA 2V8KA 1AWOA 4C8QE 2EJ9A 1J3TA 5GAN8 3CC4Q 3TREA 1RLQC 1FMVA 4RTVA 1S72A 4J6YA 1W2BA 2HD0A 2EYYA 1IGQA 1QMCA 2YUQA 1VQ9A 1FWZA 2JJ9A 1B34B 1N9RA 3FJ5A 4JLIA 2DTOA 4M77D 1MNDA 4N4GA 1ZSZC 2I0NA 2F2XA 2Y4YA 2XU8A 1WHGA 2H3EB 4KH1B 1LPLA 5DLQE 4MZMA 4NL3A 4J9HA 3EG1A 4JZ3A 4M75B 3M0QA 2RK1A 2DTHA 2LP5A 1N8RC 2RA2A 2CUDA 3GLXA 2YRDA 1YP5A 4FL6A 3CC2A 1W70A 2QG9B 2DZ9A 2JM8A 4J9GA 1X6BA 1UECA 1IHWA 5FRNA 1TU0B 2NUPB 2O4XB 4X1VA 3WXMB 1OQKA 1ZSZA 2COZA 3HRSA 2MF2A 1SPKA 4ZN1A 4KGVB 2WACA 1D1BA 1RAEB 4X9DA 2AKKA 4RTUA 2K3YA 1T0HA 1XOVA 1Q95G 3I35A 2FZKB 1UGRB 2RK2A 2O9SA 1QWEA 2JM9A 3CBMA 5CKDA 3EFSA 1HSQA 2X9HA 1AWXA 1K73C 4XU1A 4C92G 1JB0E 2X4XA 3OYMA 1WPYA 4Z89A 4AMCA 1XJWB 4E2FB 2WSEE 5AYFA 1YIJT 3ZEHA 3GIBA 1Q7YU 2E41A 3HTRA 2DETA 4DBQA 3G4SQ 2KSSA 3M54A 1FYNA 2PVOB 4XTYA 1QVGS 4C92F 8ATCB 2KY9A 1KD1U 2FB7A 1YBYA 4FT4A 2VKNA 4M7DE 3G6EQ 3PT9A 3A8OB 1EX4A 1RAFB 4OB1B 1VA7A 4J9CA 2IPOB 5J26A 1M8MA 1M2OA 2QA4Q 1Q81C 1NLOC 3TSWA 3CC7A 3CD6Q 3CCUT 2Z0WA 3QG1A 4M4ZA 1NYFA 3FIFA 2EQIA 3FC3A 1F1BB 3CC4A 1SG5A 3OS2A 2X51A 1IXDA 3H8ZA 3OA6A 3REAB 3CPWP 1YJ9Q 1KC8U 2VC8A 5CKEA 3CC4T 1T3LA 4B9XA 3RKYA 4MMLA 3EHRA 3OW2A 5KYYB 2W10A 1G3SA 3VYGA 1Q82U 1WHLA 3VS3A 4JLGA 2P0KA 1QVFA 1WIEA 1JXOA 2J7IA 1GFCA 2QEXA 3LW5E 1U06A 3NMZC 2VYTA 3HKSA 4C5IA 3AT1B 4PJOE 1ZUKA 3THKA 1RUWA 2X4JA 4X34A 1S1NA 3FLGA 2X4WA 1N9SA 3L2VA 1ZBJA 1KK7A 4BE2A 3JB9H 1E7OA 1YITQ 4M7DC 2FEIA 1D1CA 1MMAA 1ZBXA 2LCSA 3PTAA 1H641 3C4SA 4N0AA 3M4GA 4J5YA 2RJCA 3MJXA 4FIBA 4IIMA 3HPWA 3O8VA 2YUPA 3I56A 2BZYA 4R55A 3DB3A 1IREB 1WHHA 2HBWA 3CCMA 3MP6A 4M75G 2O9VA 1M5Q1 2FVUA 5LL6S 2E10A 4E7SA 1VQKQ 2FPDA 3E19A 2KRMA 3I55Q 4FYVB 2BKDN 3EH1A 2YXYA 4LUEA 2PTKA 3M0PA 2EGAA 4VUBA 1WLPB 4XTVA 1VQ4A 3X28B 2ENMA 1JJ2S 1AT1B 2O2OA 3QZ9B 4JZ4A 1MNEA 4M75F 5FU6C 3MKDA 4XQ3A 1G3YA 2EJGA 1VYVA 3PMIA 1Q86U 2DLPA 3MEUA 1VQMQ 1GXIE 3FEOA 2LJ1A 1QLYA 1WXUA 2CZ1B 1RAIB 2AIRB 2MMPA 1N8RR 3QDFA 4LNPA 4DBHA 3VRYA 3M9QA 2FO0A 1W4SA 4IUPA 3SHWA 3QYGB 3G4ST 4OB0B 1BCOA 3JSCA 3MPUB 2DK3A 2W0ZA 3EH2A 3G6ET 2PUKB 2BE7D 5GAOq 3OSVA 3BY7A 1V1CA 2PUOB 5GAOp 3JB9I 2QA4T 1NE8A 4QT7A 3EG0A 3CD6T 2XICA 5CK9A 2HZYA 5IXBA 5FU7B 4OMMA 2DNUA 4M77E 2KVQG 2DEUA 4FSXA 4EMKA 4C5GA 3EFOB 4KGXB 4IURA 1BIAA 3CCRQ 4HVUA 1IB8A 2M0OA 3JV3A 1YJ9T 2YLCA 1K73R 3DLLA 2HKQB 2XIDA 3H0IA 1VQOQ 1M90U 2NUTB 2VASA 3CCSQ 2ED0A 3EGDA 4OMLA 1LNXA 1TSFA 1UDLA 4BUGA 5KYWA 5CKHA 1Y71A 5EC7A 2CSQA 2QQBA 3GBQA 2PQWA 5LJ3h 3G71Q 2G3RA 5M9OA 2M51A 2ZAEA 3BW1A 1YITA 1O75A 2CZ6B 2K3XA 2EPDA 5IAYA 3TQ7P 4ZTFA 4XTUA 4IUVA 1PD1A 4MZTA 5A0LA 5GJVB 1KQSP 2EIFA 1NJIU 1K9MC 1VOMA 2JN0A 1Q81R 1YITT 2ZPBB 5I2MA 2E5QA 4Y91A 4M78B 2ZZDA 1ZUYA 2ZGWA 2XDPA 3M55A 1AWWA 3E9GA 3M5AA 1KQ1A 1M4ZA 1OX9A 2V8IA 3DKMA 4ESRA 4DBRA 3QXEB 3PFSA 4M77C 3OYLA 4DA4A 5L23A 3I55A 2BZXA 3BDUA 1QVFS 4FSSA 5DLOA 3BFMA 2DBMA 3V7CA 1VQKT 1Z9QA 3I55T 3CCEA 1JO8A 4C92A 3QZ5B 3L2UA 3FDRA 3H9NA 2EWNA 2X3XD 1VQLA 2NUZA 2E4HA 4O6JA 5KCOA 3VYHB 5IXFA 4C8QG 3EG2A 1TOVA 1VQMT 3KFVA 4PL6A 1K8AC 1NG2A 1A0NB 3RERA 3H0FA 5CCAA 3V8KA 4L6V5 2QYZA 3URGA 1S72Q 2KR3A 3SWNC 1MGQA 1D1AA 3VU3C 5KYXB 1G5VA 1PSFA 1VQ9Q 2M1HA 3TSZA 2ZPGB 3M56A 4C8QF 2KK4A 2ZPHB 2LTOA 2QQ9A 3NPFA 3QWXX 4A53A 4AG1C 2E5KA 4WF2A 1JU5C 4QKUA 1OX8A 2JS0A 3OYHA 1KSWA 2EQUA 2F1LA 2P4TA 4FT2A 3V7RA 4FYWB 2XI9A 2JVVA 2LT4A 1W2BP 1M1KC 3NGPA 3LWHA 1OULA 4F7UE 4RG2A 5IHNA 3EGUA 3PMTA 3OSSC 3CC2Q 4R56A 1SRMA 2K2VA 1B7TA 3CCRT 2VGNA 4BI3A 3CCQA 1QVGA 2GF7A 4BD3A 2VXEA 2CUBA 4DOVA 3R6OA 1EZZB 5DY9A 1VQOT 3VUZA 1WZOA 3A5ZB 3TEEA 3ULRB 4DOWA 4RKUE 2CP7A 4CI0C 3OYIA 4RCCA 3M0SA 2L8DA 3G71T 4J9IA 1NYGA 2LQNA 4C5HA 5GAOr 5GMKm 5GAOl 2EGCA 1PRMC 2LX9A 2RHUA 2DL8A 2DRMA 1I8FA 2ROTA 2CP2A 1Y96B 4D8KA 2JTEA 1D3BB 4M75A 2VB6A 5CAIA 4N4HA 4HXJA 5GAN5 2A0FB 4E47A 2C06A 7AT1B 1TUDA 2JTMA 2RM4A 3G7ZA 2HAXA 4LD6A 3CMAA 3E1SA 1WHKA 4JDSA 2D9TA 1OYXA 4L5GA 4F04B 1Q7YC 3M59A 4OB3B 3VRZA 2DO3A 2LX7A 1YFNA 4K11A 4C92D 1VQNA 3F70A 5CR2A 2NUPA 3A98A 3PIPA 2HSPA 3CC7Q 2O4XA 4M78G 2VVKA 1KHCA 3RMQA 3EG9B 4RTXA 1H92A 1WXTA 2OTLQ 2VWFA 2K5FA 2D0QB 2CKKA 2HNIA 1YI2A 1G83A 3QSUA 2DPPB 1UGPB 2J05A 3OYCA 4C0FA 3OMCA 3ASKA 4J9DA 3JCMW 2DL5A 1GBRA 2VV5A 5GMKj 4M78F 1K9MR 4PJLA 1S72T 3C0CA 2KQWA 3VS4A 5LJ5j 4F7UA 1VQ9T 3X20B 4O5VA 1ZUUA 4PNOA 2QEXQ 1JJ2A 3EG3A 3GF5A 2DJQA 3LH5A 3OB9A 1WHMA 4FU6A 1SKUB 1Y7XA 2BZ8A 4DEYA 2K57A 3L2RA 3TVTA 1PD0A 3EGXA 4A4FA 3OW2P 4PJOF 5FWCA 1PHTA 3M4YA 2RQTA 2RMOA 4AG2C 1VIFA 1LCKA 2RI5A 4QVDA 3CC2T 4EDUA 4JUVA 5HKCA 2EGEA 3VS5A 3I56Q 5FRMA 2CYZB 3NFCA 1BBZA 1YN8A 2CS7A 5LJ5g 3CCMQ 4JS5A 1OU9A 1K8AR 2KRSA 4OMNA 3OYYA 6AT1B 2LRQA 1KHIA 1IGUA 1WJSA 1C0MA 2DRKA 2Y4XA 3J80E 2DL7A 1U3OA 4ORZA 1VQ4Q 5KYYA 1BYMA 4HVVA 3RNJA 2FYKA 2BIVA 4BY6C 2ABLA 1Z9ZA 3UA6A 2F2VA 1NPPA 2KT8A 1X01A 2ATCB 2G6FX 4M75D 5GMKl 1WJQA 2B86A 2SEMA 1OEBA 2F2WA 3P8BB 1I4K1 2DXUA 8AT1B 1M1KR 4IKFA 2XHCA 3G1JA 5J39A 1AD5A 4J6WA 4A4KA 4C0DB 4M7AB 4MZPA 1KQ2A 4QW2A 1XNIA 3A8LB 1R0CB 2XDDA 2RHZA 4J7IA 2RJEA 3QKJA 2MCNA 1ZHIA 2R58A 2OTLA 1NLPC 2K6DA 4DEXA 5GANj 3VS0A 1UHFA 5I22A 3CQTA 3CC7T 1M27C 1NEBA 2CSIA 1PSEA 2DBKA 3WVDB 5GANf 2OTLT 3JCMb 3L2QA 4E6RA 1K0XA 1FMKA 1NM7A 1NZ9A 4ME7A 4N0AC 5KE2A 3CXCP 2YLBA 4J9FA 1OI1A 4B9WA 2ED1A 1D0YA 2RI2A 5GAOn 5GAN2 3L42A 1HYOA 3REBB 4NL2A 5FU7C 3NTHA 2SRCA 4XU2A 3I5RA 2EYWA 1IZ6A 2R57A 4J6XA 2CZ7B 4LD9K 4AFSC 1M8VA 1M3CA 2QEXT 1WNLA 1ZX6A 2E12A 2AZSA 2EQJA 2CREA 5LJ5d 5GANg 5CKFA 2EYXA 2PNIA 2GTOA 1XTDA 1Q7YR 1OZ3A 3VS1A 3PIOA 3MEVA 2CZ0B 3OYGA 2AK5A 3EHQA 5J3BA 4KBMB 3MCAB 2EQMA 2QQAA 5KH6A 2YRCA 4C8QB 3UT1A 4C5EA 2I2LA 4RTZA 2YWWA 1SHGA 2P84A 3I56T 1TXQA 1YJWA 3EFOA 1UUEA 3CCMT 2J6KA 4HVWA 2CP3A 2DXTA 2X35A 3Q1JA 4L59A 4RMOA 3OYFA 2XKOC 4AFQC 1UJYA 3HRUA 4D6WA 1K73U 1YJWT 2L3RA 4ZN3A 5GMKe 1QCNA 2H8HA 3BE3A 4F17A 2RNAA 3CCEQ 2RN8A 2FL7A 3R6NA 4WTOB 1WA7A 1WI7A 4QQGA 3PGGA 5GAN6 2NUTA 4EMKC 5LJ5e 2GFUA 1VQ4T 1VQLQ 1X2KA 2XG8D 2A08A 2EJFA 2QDLA 1QVPA 3META 1ZLMA 1FX7A 1MHNA 2FZGB 3RKWA 2K3BA 2DXCA 4XTXA 4C92E 2OAWA 1MV3A 1QP3A 2COWA 4J8OA 1SSFA 2LC4A 3JCMf 4CC4B 2KDSA 1ABOA 2EQKA 5EG2A 4PJMA 3VV0A 1VQ8A 2D6FA 1NEGA 1RL2A 2C0TA 1WXBA 2QGGA 4ZGEB 1BU1A 3JB9G 4M78A 1TTHB 1MV0B 3J81E 2DA9A 1RACB 3CMEA 4OF1A 4F16A 3JB9J 2M9UA 2QQRA 2DTIA 1IRXA 1OOTA 1M2VB 3L1AA 2DXBA 3V7SA 2LNHB 2AHJB 2DERA 3QPHA 3HL8A 1I07A 4M7AG 4RTWA 3JCMg 3JB9F 2DAQA 3A8MB 2RQUA 1PG5B 3O5ZA 4PK4A 5GANd 1B07A 1B3QA 4BE1A 4D8DA 5DM7R 3CCQQ 1SF9A 2L3PA 2RO0A 3X25B 1C6VX 4A4GA 3QYHB 2RJFA 4E7JA 2EVRA 4CC7A 4M7AF 4M7DB 1BIBA 5GAOm 2A28A 1CKBA 4C92C 2OI3A 1C1AA 3OS0A 2CDTA 5KYXA 3H41A 1VQ7A 2LQKA 3M57A 2V1QA 2O88A 1WGSA 2MIOA 1QVGP 5KYUB 3L2ZA 1RI0A 4JPBW 1TG0A 1V29B 2R5AA 5L8RE 3OYAA 2OJ2A 3H0HA 3NTIA 1GL5A 2M16A 4RTYA 3C94A 5D6XA 4RCBA 1IHVA 3N5BB 5GANe 5GAN7 2RQWA 4BI8B 4J7FA 2RQRA 1AVZC 4E7LA 2DVEA 1MUZA 3CBPA 3CMAQ 5FU6B 1VQ6A 3X24B 1JQQA 5HCKA 1UE9A 1P92A 3RIRA 4M75E 3BDLA 4PFOA 5D6WA 1VQNQ 2RPNA 3SDZA 4PJOB 2GBQA 1OZ2A 3JCMQ 3C12A 2KMTA 1VQ6T 3M58A 3CCET 1JEGA 1M30A 1M1FA 1YHQA 1AZEA 4CC3A
chains in the Genus database with same CATH topology
2FB7A 4IUTA 1YBYA 4FT4A 2L5QA 5CR2A 1VQLT 4M7DE 4PJOC 3PIPA 3PT9A 3JCMJ 3A8OB 2O4XA 4M78G 3G4SA 4JRQA 1KHCA 3RMQA 1Q81U 1HK9A 2R5MA 4OB1B 5CO7A 2K5FA 5J26A 2D0QB 2OTJA 1Q81C 2CKKA 2PVGB 4N4IA 3CPWA 3OYJA 2HNIA 2QQSA 2RB6A 2ZPFB 1ZQ1A 2QXFA 3G6EA 3CC7A 1AHJB 1YI2A 3P8DA 4II1A 3SB2A 4C8QD 3CCUT 3QSUA 2DPPB 1UGPB 3QG1A 4FM4B 3CXCA 3QO3A 3OYCA 4C0FA 3OMCA 1VQ8T 3DLMA 3FIFA 3ASKA 1U1SA 4KUIA 2QA4A 3JCMP 3FC3A 3JCMW 3JCMd 1O9SA 3CC4A 1QP2A 3CD6A 4M78D 4F7UG 3OS2A 4QQ6A 2VV5A 4QVCA 3H8ZA 5GMKj 4M78F 2RD1A 1G3TA 1Y96A 5GMKh 3OA6A 3CMET 4E7IA 2RH2A 1S72T 4HT9A 2KQWA 4C0ZA 1D3BA 5LJ5j 1KC8U 1DJ7B 4F7UA 1VQ9T 2VC8A 2KAFA 2A7YA 5CKEA 3CC4T 3X20B 4B9XA 4O5VA 5I21A 3RKYA 4MMLA 4PNOA 4PLLA 3OW2A 1YJ9A 3MEWA 1JJ2A 1R8OB 1G3SA 3VYGA 3GF5A 3ZBDA 2XK0A 3C95A 2ZCFB 3OBYA 1Q82U 4PJOA 2OAUA 2P0KA 4JLGA 1QVFA 4ATOA 1H3ZA 2V8JA 3OB9A 4F7UF 1BKBA 4NS5A 3HP9A 4FU6A 2QEXA 2RHXA 3CEYA 2DJZA 3LW5E 2VYTA 3HKSA 4A4HA 2MAMA 3LGFA 1UGQB 4P5NA 3OY9A 1Y7XA 4M75C 4C5IA 3QBYA 3OYKA 1WQ7A 4PJOE 2XD0A 2K57A 3OYDA 2K4YA 3L2RA 2X4JA 3V8LA 4EMGA 3INZA 4X34A 3FLGA 4A4FA 2X4WA 4PJOF 1N9SA 3HSBA 3M4YA 3L2VA 3LH0A 4OB2B 1VIFA 1HXDA 1BI2A 3CCQT 4BB7A 4BE2A 2XDBA 2RI5A 4C92F 4QVDA 3CC2T 1UGSB 2LVMA 3JB9H 4EDUA 1KG1A 4M7DC 3FJPA 3FB9A 4JUVA 3JCMc 4KUDK 1WJRA 1VQPA 1UB4A 5LJ3j 5HKCA 3JCMe 1VUBA 5HK0A 5FRMA 1ZBXA 2CYZB 2E70A 3PTAA 3NFCA 3CPWS 1YJNA 4JS5A 2CS7A 3RMSA 1H641 4PLIA 5LJ5g 1WQWA 2E6NA 2K5IA 3C4SA 3M4GA 4N0AA 1BI3A 1VQ7T 1B34A 4J5YA 2RJCA 3HFOA 3RUXA 3UDCA 4FIBA 3CXCS 3HPWA 3O8VA 1K9MU 4PKCC 3I56A 3OYYA 4A54A 4ELYC 2A3LA 1VQPT 4HT8A 4R55A 2LRQA 3DB3A 1KHIA 1LOJA 1WJSA 1IREB 3CCMA 3MP6A 4M75G 4BACA 1M5Q1 2DIGA 2FVUA 3P8HA 2Y4XA 3J80E 5LL6S 3UPUA 2E10A 2LT1A 4C0GA 3MHXA 4M77B 4ZGJB 1LJOA 3E19A 1M9SA 3QJ6A 3S3OA 1BYMA 2FYKA 3OBWA 1JRIA 2B8AA 2BIVA 2P0QA 2BKDN 2QDYB 2X4YA 4BY6C 4VUBA 1NPPA 2E64A 2PVDB 4KULA 1X01A 3QHSA 4M7DG 4XTVA 4EMKB 1Y07A 3OW2S 3M53A 1VQKA 5HK3A 1VQ4A 2DD4A 3X28B 5FLXE 5A0DA 1JJ2S 5GAMj 4OVAA 5A0GA 3QZ9B 3GOXA 4M75D 3MP1A 4BI4A 5GMKl 4EMHA 1WJQA 5GAMh 5HY6A 1VIEA 4M75F 5FU6C 4TVRA 4XQ3A 1KD1U 3V8JA 1G3YA 2L89A 4BDZA 2EJGA 4DQ2A 3PMIA 1Q86U 1N27A 1I4K1 2DXUA 3P8BB 4QVZA 5GAMf 1JBMA 3MEUA 2JUFA 1M1GA 1GXIE 3FEOA 5LJ3g 4HCBA 4IKFA 2XHCA 2CZ1B 5J39A 3CMAT 4J6WA 2RHIA 4A4KA 4C0DB 5GAN3 2MWPA 1KD1C 4M7AB 2MMPA 3PNWC 4MZPA 4LDWA 1KQ2A 4M7DD 2VUBA 4HCZA 4M7DF 1VQMA 1YHQT 4QW2A 1VQNT 3H6ZA 2BUDA 1XNIA 3A8LB 1UEBA 3QDRB 3M9QA 3EAEA 2XDDA 4ZTJA 1W4SA 2RHZA 4IUPA 4J7IA 4Z02A 2RJEA 2QTXA 4C0DC 3LGLA 3QKJA 3QYGB 3SWNB 3G4ST 3DB4A 4OB0B 4XAXB 1X75C 1U8RA 1K8AU 1ZHIA 3TCJA 2R58A 2OTLA 2EFIA 3JSCA 4NOYA 3GP8A 3CCVA 5GANj 2DK3A 2OTJT 3G6ET 5GANh 2PUKB 3CC7T 5GAOq 1YI2T 3OSVA 3BY7A 2IG0A 2WSCE 1PSEA 3QIIA 2HQXA 3WVDB 3OQ5A 3LX7A 2PUOB 5GANf 2OTLT 5GAOp 3JB9I 4M77A 3JCMb 3L2QA 2QA4T 4YTLA 1NZ9A 3RESA 3CCVT 4ME7A 1NE8A 4XU3A 5D6YA 3CBOA 4N0AC 5KE2A 5LJ5h 5GAMg 2JTFA 2XICA 2YLBA 1I81A 3CD6T 1OI1A 4PJOG 1KC8C 4B9WA 4LDXA 5CK9A 3KBGA 5FU7B 3WVEB 4RG8A 3JCMX 4M77E 2KVQG 2PU9B 3GNFB 4FSXA 5LJ5f 2RI2A 4C5GA 4EMKA 5GAOn 5A2QE 5GAN2 3OYBA 4OGCA 4MDXA 3L42A 4IURA 1BIAA 3SFMA 3JAME 1Q82C 3OYEA 2CGHA 4NL2A 2M0OA 3HHTB 5FU7C 1M1KU 1U1TA 3VKIA 3NTHA 1YJ9T 1EIFA 1G3WA 4XU2A 4JRKA 2YLCA 2O01E 4J6XA 1IZ6A 2R57A 3ZFJA 3DLLA 3CCRA 2CZ7B 3S3NA 2GQVA 2XIDA 4LD9K 4PJOD 3S3MA 5CIUA 1M8VA 2EAYA 1M90U 4M7AA 1XQHA 2QEXT 1WNLA 3LYIA 2E12A 1LNXA 4JS4A 2EQJA 4XTWA 4BUGA 3NTKA 3UWNA 2MI6A 5LJ5d 4C92B 1KQSA 5GANg 5CKHA 1Y71A 4LDYA 5CKFA 4M7AE 1VQOA 2QQBA 1XTDA 2PQWA 2ZPEB 3SWNA 3CCSA 1OZ3A 3PIOA 5I2SA 3MEVA 2CZ0B 2E6ZA 5LJ3h 3OYGA 2G3RA 1BI1A 5M9OA 2VGMA 4HA8A 5IT9E 3BW1A 1YITA 2LCCA 1O75A 2CZ6B 2K3XA 2DKGA 5J3BA 5IAYA 4KBMB 5LJ3f 3MCAB 4HCCA 4JJNK 3QUIA 4ZTFA 4XTUA 4IUVA 3CCST 2EQMA 2QQAA 4MZTA 5A0LA 5KH6A 4C8QB 3G71A 4GY5A 3UT1A 5IN1A 3OMGA 2F5KA 2EIFA 4C5EA 1NJIU 1K9MC 2I2LA 1YJNT 2HBPA 2JN0A 4A4EA 1YITT 1I5LA 2ZPBB 5I2MA 2E5QA 2HQEA 4Y91A 3OS1A 4M78B 2ZZDA 3I56T 2ZGWA 4CRIA 3CPFA 2XDPA 2LNVA 2RI3A 3M55A 4C8QC 4OMFB 3A8GB 1YJWA 3JCMV 3E9GA 3M5AA 3CCMT 4ZGDB 1KQ1A 1M4ZA 3MO8A 2DXTA 2V8IA 2X35A 4E7KA 3DKMA 4XK8E 4Y28E 3Q1JA 4L59A 3QXEB 4RMOA 2VXFA 1FXXA 3OYFA 2XKOC 3PFSA 2RJDA 2E65A 4M77C 3OYLA 4DA4A 5LJ3d 3HRUA 4D6WA 3I55A 1K73U 2K5LA 1YJWT 3BDUA 3GNGA 1QVFS 2L3RA 4ZN3A 5GMKe 3LWIA 2JZ2A 5DLOA 2FL7A 1YIJA 5FROA 3BFMA 4MDWA 3V7CA 2JNGA 4F7UB 2EKOA 4QQGA 3PGGA 3L2WA 5GAN6 4EMKC 5LJ5e 1VQKT 2GFUA 2WSFE 1VQ4T 2LCLA 2XG8D 3I55T 1Q86C 2EJFA 3A8HB 3CCEA 2DZCA 4C92A 1QVPA 3META 3QZ5B 4JRPA 2YHTA 1VQ5A 4J83A 1FX7A 1MHNA 3L2UA 3FDRA 3KUFA 4V2SA 3RKWA 2EWNA 3GPLA 4BDYA 4BE0A 2YRVA 1VQLA 2NLUA 3JCMh 4E7HA 3SD4A 4O6JA 5KCOA 2DXCA 4XTXA 3VYHB 4C92E 1KQSS 1QP3A 3ME9A 4QQDA 4C8QG 3MEAA 4J8OA 1SSFA 2LC4A 5C6SA 3JCMf 4M7AC 4IUUA 2KDSA 1VQ5T 2LQ8A 2EQKA 3S6WA 3FRNA 5EG2A 1VQMT 4PL6A 2GCXA 5KE3A 1K8AC 2DIQA 4C8QA 3KXTA 3CCUA 3RERA 3VV0A 4M77G 5GMKi 5CCAA 5GAMd 3V8KA 4ELZC 2E1HA 4IUQA 4L6V5 3URGA 1VQ8A 2D6FA 1RL2A 3OYNA 4KT0E 3SWNC 1MGQA 1YCYA 4JRIA 3VU3C 4EPCA 4ZGEB 4X9CA 1PSFA 1G5VA 2V8KA 4C8QE 2EJ9A 3X26B 3JB9G 5GAN8 4M78A 2ZPIB 3J81E 3TREA 5C0MA 2M1HA 2ZPGB 2DD5A 3VJPA 4UC4A 3M56A 3CMEA 4C8QF 1S72A 2KK4A 4J6YA 4LDUA 1W2BA 2HD0A 3HRTA 2ZPHB 4OF1A 3VUBA 5LJ3e 2LTOA 4M78E 2EYQA 2QQ9A 1VQ9A 1FWZA 2F69A 4A53A 2M9UA 2QQRA 3JB9J 4WF2A 2DTIA 1B34B 1N9RA 3OS5A 4JLIA 4M77D 2DTOA 4N4GA 3L1AA 2DXBA 4M77F 3V7SA 3EFRA 3CCLA 4OP0A 2Y4YA 2AHJB 2XU8A 3OYHA 3QPHA 5GAN4 3HL8A 3JB9D 4M7AG 1QW1A 3JCMg 4LDVA 2EQUA 3JB9F 2DAQA 2P4TA 4FT2A 3A8MB 3V7RA 2XI9A 2JVVA 2LT4A 1M1KC 5GANd 5DLQE 5CQYA 4XU0A 3LWHA 4MZMA 4NL3A 3CCLT 1X6OA 4BE1A 4F7UE 4M75B 4RG2A 5DM7R 3T9NA 1N8RU 3X25B 2RO0A 3PMTA 4MMKA 3OSSC 4R56A 1M90C 2RK1A 2DTHA 1N8RC 2RA2A 2K2VA 3J7AF 4A4GA 3CCRT 3QYHB 3GLXA 2VGNA 2RJFA 4BI3A 3CCQA 1QVGA 4E7JA 4M7AD 3TU4K 2JOYA 5CVIA 2GF7A 4FL6A 5GAMe 3CC2A 4M7AF 4BD3A 3LLRA 4M7DB 3JRZA 2DZ9A 2VXEA 1BIBA 5GAOm 4DOVA 3R6OA 4C92C 3AHUA 5DY9A 1VQOT 3VUZA 3OS0A 3A5ZB 3E9FA 3TEEA 5FRNA 4OGEA 1VQ7A 2O4XB 5CKBA 3QJYA 3WXMB 2LQKA 2F5TX 3M57A 4HKEA 2RHYA 4RKUE 1NPRA 4DOWA 1WGSA 4CI0C 3L2ZA 3MP8A 3OYIA 1NJIC 3HRSA 4RCCA 1RI0A 2MF2A 4ZN1A 1V29B 2L8DA 2R5AA 2WACA 5L8RE 3OYAA 3G71T 4X9DA 2IVWA 3NTIA 1TH7A 1BI0A 2M16A 4C5HA 3C94A 2K3YA 5GAOr 5D6XA 2GFAA 4RCBA 1W2BS 1XOVA 5GMKm 5GAOl 1UGRB 2LX9A 2RK2A 3N5BB 2RHUA 2H3JA 4M78C 3CBMA 5GANe 4BY6B 5GAN7 5CKDA 3EFSA 1I8FA 3ER0A 4BI8B 1Y96B 4GLKA 2FHDA 2DEQA 4J7FA 1D3BB 1K73C 4XU1A 4C92G 1JB0E 2X4XA 3HFNA 4E7LA 3OYMA 4M75A 1WPYA 2DVEA 5CAIA 2MWOA 3CBPA 4N4HA 5FU6B 1VQ6A 4XTZA 3X24B 5GAN5 5CQXA 3CCJA 2WSEE 4E47A 2C06A 1P92A 5AYFA 3RIRA 2JTMA 4M75E 2RM4A 1YIJT 3BDLA 3G7ZA 3ZEHA 5D6WA 3GIBA 2Y90A 3SDZA 2LDMA 3RKXA 1Q7YU 4LD6A 2HAXA 4PJOB 1OZ2A 3CMAA 3E1SA 2E41A 3JCMQ 3C12A 2KMTA 2QI2A 4JDSA 1VQ6T 2D9TA 1OYXA 4L5GA 4M7DA 1Q7YC 4Q5WA 2KSSA 3M59A 4OB3B 2DO3A 3M58A 5KCHA 2P0PA 3CCJT 3CCET 1M1FA 1N6AA 3M54A 4C92D 1YHQA 2PVOB 4XTYA 1QVGS 1VQNA 3F70A 2KY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N4G A;  4IUT A;  2PQW A;  3QJ6 A;  2O4X A;  1OZ3 A;  3S3O A;  1KHC A;  3OYH A;  2B8A A;  2BIV A;  3MEV A;  2BKD N;  2R5M A;  2X4Y A;  2G3R A;  3OYG A;  5M9O A;  2EQU A;  5J26 A;  2DAQ A;  2LCC A;  2CKK A;  2K3X A;  4N4I A;  5IAY A;  3OYJ A;  2QQS A;  4ZTF A;  4OVA A;  3P8D A;  4II1 A;  4IUV A;  2EQM A;  3MP1 A;  3GOX A;  4BE1 A;  5KH6 A;  1WJQ A;  4RG2 A;  4GY5 A;  3UT1 A;  5IN1 A;  3OMG A;  2F5K A;  4C5E A;  3OMC A;  3OYC A;  3DLM A;  3ASK A;  2RO0 A;  3PMT A;  4BDZ A;  2L89 A;  4A4E A;  3FC3 A;  3PMI A;  1N27 A;  4QVZ A;  3MEU A;  2E5Q A;  4A4G A;  3FEO A;  2HQE A;  3OS1 A;  4QQ6 A;  3OS2 A;  4IKF A;  3H8Z A;  5J39 A;  4CRI A;  2RJF A;  2XDP A;  2RHI A;  2RI3 A;  3OA6 A;  4E7J A;  2MWP A;  4E7I A;  2GF7 A;  4FL6 A;  3E9G A;  3PNW C;  4BD3 A;  3LLR A;  3MO8 A;  4HCZ A;  4E7K A;  2X35 A;  3Q1J A;  4QW2 A;  4L59 A;  3H6Z A;  2BUD A;  1XNI A;  3OYF A;  4B9X A;  3M9Q A;  3EAE A;  3PFS A;  4ZTJ A;  2RJD A;  3OS0 A;  3OYL A;  4IUP A;  2RHZ A;  4Z02 A;  5FRN A;  3E9F A;  2RJE A;  4PLL A;  3LGL A;  3QKJ A;  3DB4 A;  3MEW A;  2L3R A;  2O4X B;  2JZ2 A;  2R58 A;  5FRO A;  2XK0 A;  2EFI A;  2RHY A;  3L2W A;  2P0K A;  2EKO A;  1WGS A;  4QQG A;  1H3Z A;  3OB9 A;  3MP8 A;  3OYI A;  2GFU A;  4NS5 A;  1RI0 A;  4FU6 A;  2RHX A;  3CEY A;  2VYT A;  4A4H A;  2IG0 A;  2L8D A;  3LGF A;  2R5A A;  2WAC A;  3QII A;  4C5I A;  3OY9 A;  3QBY A;  3OYA A;  2HQX A;  3NTI A;  3OQ5 A;  3LX7 A;  3MET A;  3OYK A;  2M16 A;  3L2U A;  4C5H A;  1MHN A;  3L2R A;  2K3Y A;  3FDR A;  3KUF A;  5D6X A;  3L2Q A;  2GFA A;  4BDY A;  4X34 A;  4BE0 A;  3FLG A;  2YRV A;  5D6Y A;  2NLU A;  2X4W A;  4A4F A;  5KE2 A;  3SD4 A;  2JTF A;  5KCO A;  4E7H A;  2RHU A;  1OI1 A;  3L2V A;  4B9W A;  3LH0 A;  3ME9 A;  4QQD A;  3MEA A;  4BE2 A;  1SSF A;  5C6S A;  2RI5 A;  2RI2 A;  4IUU A;  2FHD A;  4C5G A;  2LVM A;  4EDU A;  3OYB A;  2EQK A;  3L42 A;  3S6W A;  4IUR A;  2X4X A;  4PL6 A;  5KE3 A;  4E7L A;  1WJR A;  2DIQ A;  3OYM A;  2MWO A;  4N4H A;  4IUQ A;  3OYE A;  5FRM A;  2M0O A;  3OYN A;  3NTH A;  4PLI A;  1G5V A;  2E6N A;  3C4S A;  2RJC A;  3BDL A;  3ZEH A;  2R57 A;  3O8V A;  5D6W A;  3S3N A;  2LDM A;  5C0M A;  2M1H A;  4LD6 A;  1OZ2 A;  5CIU A;  3S3M A;  4UC4 A;  2LRQ A;  3DB3 A;  2D9T A;  1OYX A;  1WJS A;  4Q5W A;  3LYI A;  3MP6 A;  4BAC A;  2LTO A;  5KCH A;  2DIG A;  2EQJ A;  3P8H A;  3NTK A;  3UWN A;  2QQR A;  3F70 A;  3OYD A; 
#chains in the Genus database with same CATH topology
 2L5Q A;  2X3W D;  1VQL T;  1YI2 Q;  1GRI A;  2KRN A;  3EGD B;  2OTJ A;  3RBB B;  3OYJ A;  2RB6 A;  1ZQ1 A;  2QXF A;  2CP6 A;  4LUD A;  1TS9 A;  1PNJ A;  1UTI A;  4DBF A;  3JCM P;  2KYB A;  5GJW B;  1K76 A;  3JCM d;  1O9S A;  1QP2 A;  4GLM A;  4M78 D;  4QVC A;  1RAG B;  2MOX A;  1X69 A;  2K7A A;  1G3T A;  1Y96 A;  3U23 A;  5GMK h;  2RH2 A;  1VYT A;  2M02 A;  1D3B A;  1W6X A;  2CT4 A;  1DJ7 B;  3PVQ A;  1D09 B;  2A7Y A;  3M0R A;  5I21 A;  4PLL A;  1FMW A;  3MEW A;  1R8O B;  2V26 A;  2XK0 A;  3C95 A;  3OBY A;  4ATO A;  1H3Z A;  4NS5 A;  2KI7 A;  1WYX A;  3LGF A;  1UGQ B;  3OY9 A;  4M75 C;  3OYK A;  2XD0 A;  4AT1 B;  2AZV A;  2K4Y A;  5D7U A;  2KT1 A;  3V8L A;  3EG9 A;  4EIK A;  3HSB A;  2HMA A;  2GNC A;  2DM1 A;  1HXD A;  1BI2 A;  3CCQ T;  1AZG B;  2LVM A;  1RAA B;  1K4U S;  3JCM c;  4KUD K;  5LJ3 j;  3JCM e;  2D8H A;  1V76 A;  2DYB A;  3CPW S;  1YJN A;  3RMS A;  4B6M A;  4JJD A;  1WQW A;  2K5I A;  4Y92 A;  1B34 A;  2L0A A;  3UDC A;  1RI9 A;  1X43 A;  3CXC S;  1K9M U;  2HDA A;  2A3L A;  1E6G A;  1KIK A;  1LOJ A;  3I5S A;  1QCF A;  4R0K A;  4BAC A;  2DIG A;  2QGF B;  2LT1 A;  3MHX A;  4M77 B;  4ZGJ B;  1M9S A;  3QJ6 A;  3QWY A;  1JRI A;  3OBW A;  2GQI A;  2QDY B;  2X4Y A;  1ARK A;  2LMJ A;  2IIM A;  2E64 A;  2PVD B;  4KUL A;  4M7D G;  3M53 A;  2DD4 A;  5A0D A;  5GAM j;  5A0G A;  3MP1 A;  4EMH A;  2QAS A;  4PJJ A;  1VIE A;  4TVR A;  3V8J A;  2L89 A;  1N27 A;  5GAM f;  2JUF A;  5LJ3 g;  1GCQ A;  1RAH B;  3CMA T;  2RHI A;  5GAN 3;  1KD1 C;  5KYN A;  3PNW C;  3PE0 A;  4LDW A;  1HJD A;  2VUB A;  4HCZ A;  4M7D F;  1VQN T;  1D0Z A;  3H6Z A;  1SEM A;  4C0D C;  3LGL A;  3SWN B;  4XAX B;  2LJ3 A;  1U8R A;  3RR6 A;  1K8A U;  1UFF A;  1PKT A;  3GP8 A;  5GAN h;  1YI2 T;  1H8K A;  1I0C A;  3OQ5 A;  3LX7 A;  1BCM A;  3RES A;  5D6Y A;  5GAM g;  3CBO A;  1I81 A;  3CCL Q;  4PJO G;  1KC8 C;  4LDX A;  3WVE B;  2PU9 B;  5LJ5 f;  2HQH A;  3M0T A;  4JJB A;  1GCP A;  3SFM A;  3JAM E;  1Q82 C;  2CGH A;  2QK0 A;  1M1K U;  1U1T A;  2KGT A;  3VKI A;  2DIL A;  3ZFJ A;  2GQV A;  5CIU A;  4PFP A;  2EAY A;  4M7A A;  1XQH A;  2FRY A;  3LYI A;  4JS4 A;  1QVF P;  2KNB B;  3NTK A;  3UWN A;  2MI6 A;  4JJC A;  4FYY B;  5IHI A;  5I2S A;  2QAZ A;  2KE9 A;  2VGM A;  3VS6 A;  2LCC A;  4A63 B;  1K0S A;  4GY5 A;  2MK5 A;  3OMG A;  1YJW Q;  2HBP A;  4FW1 A;  1I5L A;  2HQE A;  1YCS B;  2LNV A;  4C8Q C;  4FYX B;  4OMF B;  4ZGD B;  4OMO A;  4E7K A;  4XK8 E;  4Y28 E;  1ZA1 B;  2ECZ A;  3SEM A;  1FXX A;  2RJD A;  5LJ3 d;  2KXD A;  2K5L A;  3GNG A;  1SHF A;  3CCJ Q;  1YIJ A;  2JNG A;  4F7U B;  3L2W A;  2WSF E;  4KGZ B;  2LCL A;  1QCO A;  1Q86 C;  3I9Q A;  2DZC A;  2HL3 A;  2YHT A;  1VQ5 A;  3GPL A;  2COY A;  4BDY A;  4BE0 A;  2YRV A;  3JCM h;  1R77 A;  2JXB A;  1KQS S;  2J6F A;  1WX6 A;  3MEA A;  2RQV A;  1VQ8 Q;  4RUG A;  2MYS A;  4IUU A;  1VQ5 T;  2LJ0 A;  3S6W A;  3FRN A;  1U5S A;  2GCX A;  3EGX B;  4C8Q A;  2JT4 A;  1ACM B;  3CCU A;  4M77 G;  5GMK i;  5GAM d;  4ELZ C;  3CME Q;  2ESW A;  1YCY A;  4EPC A;  4X9C A;  5ECA A;  3X26 B;  2ZPI B;  2D0N A;  5C0M A;  1ZSZ B;  2DD5 A;  3VJP A;  4UC4 A;  1GBQ A;  4LDU A;  3HRT A;  3VUB A;  5LJ3 e;  1RAD B;  4M78 E;  2EYQ A;  1KFZ A;  2F69 A;  3OS5 A;  4M77 F;  3CCL A;  3EFR A;  4OP0 A;  1WHJ A;  2HSE B;  5GAN 4;  3JB9 D;  4AFZ C;  1HD3 A;  1QW1 A;  4LDV A;  1NBE B;  4E7Z A;  5CQY A;  4XU0 A;  3CCL T;  1X6O A;  2EYZ A;  2HEQ A;  3T9N A;  1N8R U;  4MMK A;  1M3A A;  1M90 C;  1SRL A;  2FPE A;  3J7A F;  4PJN A;  1TUG B;  4IIO A;  4M7A D;  3TU4 K;  2JOY A;  5CVI A;  5GAM e;  3LLR A;  1VQ7 Q;  3JRZ A;  2NYS A;  1EFN A;  3AHU A;  4KRT A;  1VQP Q;  1OPL A;  1KD1 R;  3E9F A;  2MPX C;  4OGE A;  1OU8 A;  5CKB A;  3QJY A;  2RF0 A;  2F5T X;  4HKE A;  2RHY A;  1NPR A;  2DYI A;  1K1Z A;  3MP8 A;  1NJI C;  4WCI A;  4J9B A;  3UAT A;  1GFD A;  1YWP A;  1PCX A;  2P4R A;  5FWB A;  2IVW A;  1TH7 A;  2A37 A;  1BI0 A;  2OX7 A;  2DX1 A;  1UG1 A;  1M2V A;  4ZNX A;  2GFA A;  1W2B S;  4FW2 A;  2H3J A;  2QTV A;  1TUC A;  4M78 C;  4BY6 B;  1VQ6 Q;  3ER0 A;  2EBP A;  4GLK A;  2FHD A;  1PC0 A;  3ZL7 C;  2DEQ A;  2V1R A;  3HFN A;  1KC8 R;  2YSQ A;  2MWO A;  4XTZ A;  5CQX A;  3CCJ A;  1WDX A;  2CH4 A;  1YHQ Q;  2Y90 A;  2LDM A;  3RKX A;  1Q82 R;  2QI2 A;  2DL4 A;  4M7D A;  4Q5W A;  2BTT A;  5KCH A;  3CCJ T;  2P0P A;  1N6A A;  1IO6 A;  3OYD A;  2A36 A;  4Z8A A;  2OTJ Q;  5AT1 B;  4IUT A;  4PJO C;  1VYU A;  3IQL A;  3JCM J;  3G4S A;  4JRQ A;  1Q81 U;  2CH4 W;  2KYM A;  1HK9 A;  2R5M A;  2BE9 B;  2JMA A;  3M0U A;  5KYU A;  5CO7 A;  1ZA2 B;  1QQJ A;  1KJW A;  1G2B A;  2PVG B;  4N4I A;  3CPW A;  3CCV Q;  2ZPF B;  2QQS A;  3G6E A;  1AHJ B;  1X2Q A;  1PKS A;  3P8D A;  4II1 A;  3SB2 A;  4C8Q D;  4FM4 B;  3CXC A;  1UHC A;  3QO3 A;  1VQ8 T;  3DLM A;  2GTJ A;  1U1S A;  1I5O B;  4KUI A;  2QA4 A;  2YDL A;  5FW9 A;  3CD6 A;  4F7U G;  4QQ6 A;  2RD1 A;  1UJ0 A;  3CME T;  4E7I A;  4HT9 A;  4C0Z A;  1X6G A;  2KAF A;  1AWJ A;  1YWO A;  2K79 A;  1YJ9 A;  2CP5 A;  3ZBD A;  2ZCF B;  4PJO A;  2OAU A;  2KRO A;  2V8J A;  2YUN A;  1E6H A;  1BKB A;  4F7U F;  3HP9 A;  2RHX A;  3CEY A;  2DJZ A;  4A4H A;  2MAM A;  1BB9 A;  1JXM A;  4P5N A;  3QBY A;  2YT6 A;  1WQ7 A;  3RDV A;  2NWM A;  4OMP A;  1OPK A;  1CKA A;  2O31 A;  4EMG A;  3INZ A;  1CSK A;  1PWT A;  2JW4 A;  1Q86 R;  3LH0 A;  4OB2 B;  2LZ6 B;  4BB7 A;  2XDB A;  1YJN Q;  1KG1 A;  1UGS B;  1G8X A;  3FJP A;  3FB9 A;  2M0Y A;  1WJR A;  1VQP A;  1UB4 A;  2YUO A;  1K9A A;  1VUB A;  2EKH A;  5HK0 A;  2E70 A;  4ANJ A;  4PFZ A;  2J6O A;  4PLI A;  2E6N A;  1VQ7 T;  1BI3 A;  3HFO A;  3RUX A;  4PKC C;  4A54 A;  4ELY C;  1VQP T;  4HT8 A;  2DE0 X;  1M3B A;  1PRL C;  3P8H A;  2HL5 C;  3UPU A;  2JMC A;  2D1X A;  4C0G A;  9ATC B;  1LJO A;  3S3O A;  4LN2 A;  2CP0 A;  2B8A A;  2P0Q A;  4OMQ A;  3UA7 A;  1SSH A;  3QHS A;  4EMK B;  3OW2 S;  1Y07 A;  1VQK A;  5HK3 A;  5FLX E;  4OVA A;  3GOX A;  4BI4 A;  5GAM h;  5HY6 A;  4LXC A;  2AKL A;  1RAB B;  2HKN A;  2KEA A;  4KH0 B;  4BDZ A;  1AEY A;  4DQ2 A;  4QVZ A;  1JBM A;  1ABQ A;  4FCY A;  1M1G A;  4HCB A;  4RTT A;  1AOJ A;  2MWP A;  1M90 R;  4M7D D;  2DFU A;  4GBQ A;  1VQM A;  1YHQ T;  5KYW B;  2BUD A;  1UEB A;  3QDR B;  4ZTJ A;  3EAE A;  4Z02 A;  2QTX A;  1TWB A;  3DB4 A;  1X75 C;  3TCJ A;  2EFI A;  2ROL A;  4NOY A;  2L2P A;  3CCV A;  2OTJ T;  1I1J A;  1MMN A;  2FRW A;  5IHK A;  1R0B G;  2IG0 A;  2WSC E;  3QII A;  2D8J A;  1MMG A;  2HQX A;  4M77 A;  4YTL A;  1NJI R;  3CCV T;  2DVJ A;  4XU3 A;  5LJ5 h;  2JTF A;  2K9G A;  1RLP C;  2FG0 A;  2JS2 A;  3KBG A;  3JCM X;  4RG8 A;  3GNF B;  2C0O A;  5A2Q E;  2PZ1 A;  3OYB A;  4MDX A;  4OGC A;  3E2U A;  1Y57 A;  1T0J A;  1QWF A;  2FZC B;  3OYE A;  2HCK A;  3HHT B;  1EIF A;  1G3W A;  4JRK A;  2O01 E;  3UF4 A;  3S3N A;  3CCR A;  4PJO D;  3A1P A;  1WFW A;  3S3M A;  1JJ2 P;  1D0X A;  2AT1 B;  4CC2 A;  1Y0M A;  4XTW A;  2KBT A;  4C92 B;  1KQS A;  4LDY A;  4M7A E;  1VQO A;  3SWN A;  2ZPE B;  5IH2 A;  3CCS A;  1GCQ C;  2GGR A;  2E6Z A;  1BI1 A;  2E3I A;  4HA8 A;  4F14 A;  5IT9 E;  2DKG A;  5LJ3 f;  2DF6 A;  4Z88 A;  4HCC A;  4JJN K;  3VS2 A;  3QUI A;  2C0I A;  3CCS T;  3G71 A;  2FPF A;  2J06 A;  5IN1 A;  2F5K A;  4J9E A;  1YJN T;  1X27 A;  4A4E A;  3OS1 A;  4LE9 A;  4CRI A;  3CPF A;  2RI3 A;  3A8G B;  3JCM V;  1N5Z A;  3MO8 A;  1OV3 A;  5I11 A;  1QKW A;  1YIJ Q;  4HCK A;  2VXF A;  1H3H A;  1YNZ A;  2E65 A;  2E3H A;  1T3S A;  3LWI A;  2JZ2 A;  5FRO A;  4MDW A;  1VQ5 Q;  2EKO A;  1UGV A;  1BK2 A;  2L3S A;  1QKX A;  3NHN A;  3A8H B;  1ZSG A;  4JRP A;  4J83 A;  4AFU C;  3KUF A;  4V2S A;  1PM3 A;  2NLU A;  3D7S B;  4E7H A;  2DMO A;  3SD4 A;  1LVK A;  2CT3 A;  2L3Q A;  3CCU Q;  1MMD A;  3ME9 A;  4QQD A;  2KXC A;  2XMF A;  5C6S A;  4M7A C;  2LQ8 A;  1W1F A;  2LQW A;  2EW3 A;  2DL3 A;  5KE3 A;  2DIQ A;  3KXT A;  2E1H A;  4IUQ A;  2K2M A;  3OYN A;  4KT0 E;  3VS7 A;  4JRI A;  3PVL A;  2V8K A;  1AWO A;  4C8Q E;  2EJ9 A;  1J3T A;  5GAN 8;  3CC4 Q;  3TRE A;  1RLQ C;  1FMV A;  4RTV A;  1S72 A;  4J6Y A;  1W2B A;  2HD0 A;  2EYY A;  1IGQ A;  1QMC A;  2YUQ A;  1VQ9 A;  1FWZ A;  2JJ9 A;  1B34 B;  1N9R A;  3FJ5 A;  4JLI A;  2DTO A;  4M77 D;  1MND A;  4N4G A;  1ZSZ C;  2I0N A;  2F2X A;  2Y4Y A;  2XU8 A;  1WHG A;  2H3E B;  4KH1 B;  1LPL A;  5DLQ E;  4MZM A;  4NL3 A;  4J9H A;  3EG1 A;  4JZ3 A;  4M75 B;  3M0Q A;  2RK1 A;  2DTH A;  2LP5 A;  1N8R C;  2RA2 A;  2CUD A;  3GLX A;  2YRD A;  1YP5 A;  4FL6 A;  3CC2 A;  1W70 A;  2QG9 B;  2DZ9 A;  2JM8 A;  4J9G A;  1X6B A;  1UEC A;  1IHW A;  5FRN A;  1TU0 B;  2NUP B;  2O4X B;  4X1V A;  3WXM B;  1OQK A;  1ZSZ A;  2COZ A;  3HRS A;  2MF2 A;  1SPK A;  4ZN1 A;  4KGV B;  2WAC A;  1D1B A;  1RAE B;  4X9D A;  2AKK A;  4RTU A;  2K3Y A;  1T0H A;  1XOV A;  1Q95 G;  3I35 A;  2FZK B;  1UGR B;  2RK2 A;  2O9S A;  1QWE A;  2JM9 A;  3CBM A;  5CKD A;  3EFS A;  1HSQ A;  2X9H A;  1AWX A;  1K73 C;  4XU1 A;  4C92 G;  1JB0 E;  2X4X A;  3OYM A;  1WPY A;  4Z89 A;  4AMC A;  1XJW B;  4E2F B;  2WSE E;  5AYF A;  1YIJ T;  3ZEH A;  3GIB A;  1Q7Y U;  2E41 A;  3HTR A;  2DET A;  4DBQ A;  3G4S Q;  2KSS A;  3M54 A;  1FYN A;  2PVO B;  4XTY A;  1QVG S;  4C92 F;  8ATC B;  2KY9 A;  1KD1 U;  2FB7 A;  1YBY A;  4FT4 A;  2VKN A;  4M7D E;  3G6E Q;  3PT9 A;  3A8O B;  1EX4 A;  1RAF B;  4OB1 B;  1VA7 A;  4J9C A;  2IPO B;  5J26 A;  1M8M A;  1M2O A;  2QA4 Q;  1Q81 C;  1NLO C;  3TSW A;  3CC7 A;  3CD6 Q;  3CCU T;  2Z0W A;  3QG1 A;  4M4Z A;  1NYF A;  3FIF A;  2EQI A;  3FC3 A;  1F1B B;  3CC4 A;  1SG5 A;  3OS2 A;  2X51 A;  1IXD A;  3H8Z A;  3OA6 A;  3REA B;  3CPW P;  1YJ9 Q;  1KC8 U;  2VC8 A;  5CKE A;  3CC4 T;  1T3L A;  4B9X A;  3RKY A;  4MML A;  3EHR A;  3OW2 A;  5KYY B;  2W10 A;  1G3S A;  3VYG A;  1Q82 U;  1WHL A;  3VS3 A;  4JLG A;  2P0K A;  1QVF A;  1WIE A;  1JXO A;  2J7I A;  1GFC A;  2QEX A;  3LW5 E;  1U06 A;  3NMZ C;  2VYT A;  3HKS A;  4C5I A;  3AT1 B;  4PJO E;  1ZUK A;  3THK A;  1RUW A;  2X4J A;  4X34 A;  1S1N A;  3FLG A;  2X4W A;  1N9S A;  3L2V A;  1ZBJ A;  1KK7 A;  4BE2 A;  3JB9 H;  1E7O A;  1YIT Q;  4M7D C;  2FEI A;  1D1C A;  1MMA A;  1ZBX A;  2LCS A;  3PTA A;  1H64 1;  3C4S A;  4N0A A;  3M4G A;  4J5Y A;  2RJC A;  3MJX A;  4FIB A;  4IIM A;  3HPW A;  3O8V A;  2YUP A;  3I56 A;  2BZY A;  4R55 A;  3DB3 A;  1IRE B;  1WHH A;  2HBW A;  3CCM A;  3MP6 A;  4M75 G;  2O9V A;  1M5Q 1;  2FVU A;  5LL6 S;  2E10 A;  4E7S A;  1VQK Q;  2FPD A;  3E19 A;  2KRM A;  3I55 Q;  4FYV B;  2BKD N;  3EH1 A;  2YXY A;  4LUE A;  2PTK A;  3M0P A;  2EGA A;  4VUB A;  1WLP B;  4XTV A;  1VQ4 A;  3X28 B;  2ENM A;  1JJ2 S;  1AT1 B;  2O2O A;  3QZ9 B;  4JZ4 A;  1MNE A;  4M75 F;  5FU6 C;  3MKD A;  4XQ3 A;  1G3Y A;  2EJG A;  1VYV A;  3PMI A;  1Q86 U;  2DLP A;  3MEU A;  1VQM Q;  1GXI E;  3FEO A;  2LJ1 A;  1QLY A;  1WXU A;  2CZ1 B;  1RAI B;  2AIR B;  2MMP A;  1N8R R;  3QDF A;  4LNP A;  4DBH A;  3VRY A;  3M9Q A;  2FO0 A;  1W4S A;  4IUP A;  3SHW A;  3QYG B;  3G4S T;  4OB0 B;  1BCO A;  3JSC A;  3MPU B;  2DK3 A;  2W0Z A;  3EH2 A;  3G6E T;  2PUK B;  2BE7 D;  5GAO q;  3OSV A;  3BY7 A;  1V1C A;  2PUO B;  5GAO p;  3JB9 I;  2QA4 T;  1NE8 A;  4QT7 A;  3EG0 A;  3CD6 T;  2XIC A;  5CK9 A;  2HZY A;  5IXB A;  5FU7 B;  4OMM A;  2DNU A;  4M77 E;  2KVQ G;  2DEU A;  4FSX A;  4EMK A;  4C5G A;  3EFO B;  4KGX B;  4IUR A;  1BIA A;  3CCR Q;  4HVU A;  1IB8 A;  2M0O A;  3JV3 A;  1YJ9 T;  2YLC A;  1K73 R;  3DLL A;  2HKQ B;  2XID A;  3H0I A;  1VQO Q;  1M90 U;  2NUT B;  2VAS A;  3CCS Q;  2ED0 A;  3EGD A;  4OML A;  1LNX A;  1TSF A;  1UDL A;  4BUG A;  5KYW A;  5CKH A;  1Y71 A;  5EC7 A;  2CSQ A;  2QQB A;  3GBQ A;  2PQW A;  5LJ3 h;  3G71 Q;  2G3R A;  5M9O A;  2M51 A;  2ZAE A;  3BW1 A;  1YIT A;  1O75 A;  2CZ6 B;  2K3X A;  2EPD A;  5IAY A;  3TQ7 P;  4ZTF A;  4XTU A;  4IUV A;  1PD1 A;  4MZT A;  5A0L A;  5GJV B;  1KQS P;  2EIF A;  1NJI U;  1K9M C;  1VOM A;  2JN0 A;  1Q81 R;  1YIT T;  2ZPB B;  5I2M A;  2E5Q A;  4Y91 A;  4M78 B;  2ZZD A;  1ZUY A;  2ZGW A;  2XDP A;  3M55 A;  1AWW A;  3E9G A;  3M5A A;  1KQ1 A;  1M4Z A;  1OX9 A;  2V8I A;  3DKM A;  4ESR A;  4DBR A;  3QXE B;  3PFS A;  4M77 C;  3OYL A;  4DA4 A;  5L23 A;  3I55 A;  2BZX A;  3BDU A;  1QVF S;  4FSS A;  5DLO A;  3BFM A;  2DBM A;  3V7C A;  1VQK T;  1Z9Q A;  3I55 T;  3CCE A;  1JO8 A;  4C92 A;  3QZ5 B;  3L2U A;  3FDR A;  3H9N A;  2EWN A;  2X3X D;  1VQL A;  2NUZ A;  2E4H A;  4O6J A;  5KCO A;  3VYH B;  5IXF A;  4C8Q G;  3EG2 A;  1TOV A;  1VQM T;  3KFV A;  4PL6 A;  1K8A C;  1NG2 A;  1A0N B;  3RER A;  3H0F A;  5CCA A;  3V8K A;  4L6V 5;  2QYZ A;  3URG A;  1S72 Q;  2KR3 A;  3SWN C;  1MGQ A;  1D1A A;  3VU3 C;  5KYX B;  1G5V A;  1PSF A;  1VQ9 Q;  2M1H A;  3TSZ A;  2ZPG B;  3M56 A;  4C8Q F;  2KK4 A;  2ZPH B;  2LTO A;  2QQ9 A;  3NPF A;  3QWX X;  4A53 A;  4AG1 C;  2E5K A;  4WF2 A;  1JU5 C;  4QKU A;  1OX8 A;  2JS0 A;  3OYH A;  1KSW A;  2EQU A;  2F1L A;  2P4T A;  4FT2 A;  3V7R A;  4FYW B;  2XI9 A;  2JVV A;  2LT4 A;  1W2B P;  1M1K C;  3NGP A;  3LWH A;  1OUL A;  4F7U E;  4RG2 A;  5IHN A;  3EGU A;  3PMT A;  3OSS C;  3CC2 Q;  4R56 A;  1SRM A;  2K2V A;  1B7T A;  3CCR T;  2VGN A;  4BI3 A;  3CCQ A;  1QVG A;  2GF7 A;  4BD3 A;  2VXE A;  2CUB A;  4DOV A;  3R6O A;  1EZZ B;  5DY9 A;  1VQO T;  3VUZ A;  1WZO A;  3A5Z B;  3TEE A;  3ULR B;  4DOW A;  4RKU E;  2CP7 A;  4CI0 C;  3OYI A;  4RCC A;  3M0S A;  2L8D A;  3G71 T;  4J9I A;  1NYG A;  2LQN A;  4C5H A;  5GAO r;  5GMK m;  5GAO l;  2EGC A;  1PRM C;  2LX9 A;  2RHU A;  2DL8 A;  2DRM A;  1I8F A;  2ROT A;  2CP2 A;  1Y96 B;  4D8K A;  2JTE A;  1D3B B;  4M75 A;  2VB6 A;  5CAI A;  4N4H A;  4HXJ A;  5GAN 5;  2A0F B;  4E47 A;  2C06 A;  7AT1 B;  1TUD A;  2JTM A;  2RM4 A;  3G7Z A;  2HAX A;  4LD6 A;  3CMA A;  3E1S A;  1WHK A;  4JDS A;  2D9T A;  1OYX A;  4L5G A;  4F04 B;  1Q7Y C;  3M59 A;  4OB3 B;  3VRZ A;  2DO3 A;  2LX7 A;  1YFN A;  4K11 A;  4C92 D;  1VQN A;  3F70 A;  5CR2 A;  2NUP A;  3A98 A;  3PIP A;  2HSP A;  3CC7 Q;  2O4X A;  4M78 G;  2VVK A;  1KHC A;  3RMQ A;  3EG9 B;  4RTX A;  1H92 A;  1WXT A;  2OTL Q;  2VWF A;  2K5F A;  2D0Q B;  2CKK A;  2HNI A;  1YI2 A;  1G83 A;  3QSU A;  2DPP B;  1UGP B;  2J05 A;  3OYC A;  4C0F A;  3OMC A;  3ASK A;  4J9D A;  3JCM W;  2DL5 A;  1GBR A;  2VV5 A;  5GMK j;  4M78 F;  1K9M R;  4PJL A;  1S72 T;  3C0C A;  2KQW A;  3VS4 A;  5LJ5 j;  4F7U A;  1VQ9 T;  3X20 B;  4O5V A;  1ZUU A;  4PNO A;  2QEX Q;  1JJ2 A;  3EG3 A;  3GF5 A;  2DJQ A;  3LH5 A;  3OB9 A;  1WHM A;  4FU6 A;  1SKU B;  1Y7X A;  2BZ8 A;  4DEY A;  2K57 A;  3L2R A;  3TVT A;  1PD0 A;  3EGX A;  4A4F A;  3OW2 P;  4PJO F;  5FWC A;  1PHT A;  3M4Y A;  2RQT A;  2RMO A;  4AG2 C;  1VIF A;  1LCK A;  2RI5 A;  4QVD A;  3CC2 T;  4EDU A;  4JUV A;  5HKC A;  2EGE A;  3VS5 A;  3I56 Q;  5FRM A;  2CYZ B;  3NFC A;  1BBZ A;  1YN8 A;  2CS7 A;  5LJ5 g;  3CCM Q;  4JS5 A;  1OU9 A;  1K8A R;  2KRS A;  4OMN A;  3OYY A;  6AT1 B;  2LRQ A;  1KHI A;  1IGU A;  1WJS A;  1C0M A;  2DRK A;  2Y4X A;  3J80 E;  2DL7 A;  1U3O A;  4ORZ A;  1VQ4 Q;  5KYY A;  1BYM A;  4HVV A;  3RNJ A;  2FYK A;  2BIV A;  4BY6 C;  2ABL A;  1Z9Z A;  3UA6 A;  2F2V A;  1NPP A;  2KT8 A;  1X01 A;  2ATC B;  2G6F X;  4M75 D;  5GMK l;  1WJQ A;  2B86 A;  2SEM A;  1OEB A;  2F2W A;  3P8B B;  1I4K 1;  2DXU A;  8AT1 B;  1M1K R;  4IKF A;  2XHC A;  3G1J A;  5J39 A;  1AD5 A;  4J6W A;  4A4K A;  4C0D B;  4M7A B;  4MZP A;  1KQ2 A;  4QW2 A;  1XNI A;  3A8L B;  1R0C B;  2XDD A;  2RHZ A;  4J7I A;  2RJE A;  3QKJ A;  2MCN A;  1ZHI A;  2R58 A;  2OTL A;  1NLP C;  2K6D A;  4DEX A;  5GAN j;  3VS0 A;  1UHF A;  5I22 A;  3CQT A;  3CC7 T;  1M27 C;  1NEB A;  2CSI A;  1PSE A;  2DBK A;  3WVD B;  5GAN f;  2OTL T;  3JCM b;  3L2Q A;  4E6R A;  1K0X A;  1FMK A;  1NM7 A;  1NZ9 A;  4ME7 A;  4N0A C;  5KE2 A;  3CXC P;  2YLB A;  4J9F A;  1OI1 A;  4B9W A;  2ED1 A;  1D0Y A;  2RI2 A;  5GAO n;  5GAN 2;  3L42 A;  1HYO A;  3REB B;  4NL2 A;  5FU7 C;  3NTH A;  2SRC A;  4XU2 A;  3I5R A;  2EYW A;  1IZ6 A;  2R57 A;  4J6X A;  2CZ7 B;  4LD9 K;  4AFS C;  1M8V A;  1M3C A;  2QEX T;  1WNL A;  1ZX6 A;  2E12 A;  2AZS A;  2EQJ A;  2CRE A;  5LJ5 d;  5GAN g;  5CKF A;  2EYX A;  2PNI A;  2GTO A;  1XTD A;  1Q7Y R;  1OZ3 A;  3VS1 A;  3PIO A;  3MEV A;  2CZ0 B;  3OYG A;  2AK5 A;  3EHQ A;  5J3B A;  4KBM B;  3MCA B;  2EQM A;  2QQA A;  5KH6 A;  2YRC A;  4C8Q B;  3UT1 A;  4C5E A;  2I2L A;  4RTZ A;  2YWW A;  1SHG A;  2P84 A;  3I56 T;  1TXQ A;  1YJW A;  3EFO A;  1UUE A;  3CCM T;  2J6K A;  4HVW A;  2CP3 A;  2DXT A;  2X35 A;  3Q1J A;  4L59 A;  4RMO A;  3OYF A;  2XKO C;  4AFQ C;  1UJY A;  3HRU A;  4D6W A;  1K73 U;  1YJW T;  2L3R A;  4ZN3 A;  5GMK e;  1QCN A;  2H8H A;  3BE3 A;  4F17 A;  2RNA A;  3CCE Q;  2RN8 A;  2FL7 A;  3R6N A;  4WTO B;  1WA7 A;  1WI7 A;  4QQG A;  3PGG A;  5GAN 6;  2NUT A;  4EMK C;  5LJ5 e;  2GFU A;  1VQ4 T;  1VQL Q;  1X2K A;  2XG8 D;  2A08 A;  2EJF A;  2QDL A;  1QVP A;  3MET A;  1ZLM A;  1FX7 A;  1MHN A;  2FZG B;  3RKW A;  2K3B A;  2DXC A;  4XTX A;  4C92 E;  2OAW A;  1MV3 A;  1QP3 A;  2COW A;  4J8O A;  1SSF A;  2LC4 A;  3JCM f;  4CC4 B;  2KDS A;  1ABO A;  2EQK A;  5EG2 A;  4PJM A;  3VV0 A;  1VQ8 A;  2D6F A;  1NEG A;  1RL2 A;  2C0T A;  1WXB A;  2QGG A;  4ZGE B;  1BU1 A;  3JB9 G;  4M78 A;  1TTH B;  1MV0 B;  3J81 E;  2DA9 A;  1RAC B;  3CME A;  4OF1 A;  4F16 A;  3JB9 J;  2M9U A;  2QQR A;  2DTI A;  1IRX A;  1OOT A;  1M2V B;  3L1A A;  2DXB A;  3V7S A;  2LNH B;  2AHJ B;  2DER A;  3QPH A;  3HL8 A;  1I07 A;  4M7A G;  4RTW A;  3JCM g;  3JB9 F;  2DAQ A;  3A8M B;  2RQU A;  1PG5 B;  3O5Z A;  4PK4 A;  5GAN d;  1B07 A;  1B3Q A;  4BE1 A;  4D8D A;  5DM7 R;  3CCQ Q;  1SF9 A;  2L3P A;  2RO0 A;  3X25 B;  1C6V X;  4A4G A;  3QYH B;  2RJF A;  4E7J A;  2EVR A;  4CC7 A;  4M7A F;  4M7D B;  1BIB A;  5GAO m;  2A28 A;  1CKB A;  4C92 C;  2OI3 A;  1C1A A;  3OS0 A;  2CDT A;  5KYX A;  3H41 A;  1VQ7 A;  2LQK A;  3M57 A;  2V1Q A;  2O88 A;  1WGS A;  2MIO A;  1QVG P;  5KYU B;  3L2Z A;  1RI0 A;  4JPB W;  1TG0 A;  1V29 B;  2R5A A;  5L8R E;  3OYA A;  2OJ2 A;  3H0H A;  3NTI A;  1GL5 A;  2M16 A;  4RTY A;  3C94 A;  5D6X A;  4RCB A;  1IHV A;  3N5B B;  5GAN e;  5GAN 7;  2RQW A;  4BI8 B;  4J7F A;  2RQR A;  1AVZ C;  4E7L A;  2DVE A;  1MUZ A;  3CBP A;  3CMA Q;  5FU6 B;  1VQ6 A;  3X24 B;  1JQQ A;  5HCK A;  1UE9 A;  1P92 A;  3RIR A;  4M75 E;  3BDL A;  4PFO A;  5D6W A;  1VQN Q;  2RPN A;  3SDZ A;  4PJO B;  2GBQ A;  1OZ2 A;  3JCM Q;  3C12 A;  2KMT A;  1VQ6 T;  3M58 A;  3CCE T;  1JEG A;  1M30 A;  1M1F A;  1YHQ A;  1AZE A;  4CC3 A; 
#chains in the Genus database with same CATH homology
 2FB7 A;  4IUT A;  1YBY A;  4FT4 A;  2L5Q A;  5CR2 A;  1VQL T;  4M7D E;  4PJO C;  3PIP A;  3PT9 A;  3JCM J;  3A8O B;  2O4X A;  4M78 G;  3G4S A;  4JRQ A;  1KHC A;  3RMQ A;  1Q81 U;  1HK9 A;  2R5M A;  4OB1 B;  5CO7 A;  2K5F A;  5J26 A;  2D0Q B;  2OTJ A;  1Q81 C;  2CKK A;  2PVG B;  4N4I A;  3CPW A;  3OYJ A;  2HNI A;  2QQS A;  2RB6 A;  2ZPF B;  1ZQ1 A;  2QXF A;  3G6E A;  3CC7 A;  1AHJ B;  1YI2 A;  3P8D A;  4II1 A;  3SB2 A;  4C8Q D;  3CCU T;  3QSU A;  2DPP B;  1UGP B;  3QG1 A;  4FM4 B;  3CXC A;  3QO3 A;  3OYC A;  4C0F A;  3OMC A;  1VQ8 T;  3DLM A;  3FIF A;  3ASK A;  1U1S A;  4KUI A;  2QA4 A;  3JCM P;  3FC3 A;  3JCM W;  3JCM d;  1O9S A;  3CC4 A;  1QP2 A;  3CD6 A;  4M78 D;  4F7U G;  3OS2 A;  4QQ6 A;  2VV5 A;  4QVC A;  3H8Z A;  5GMK j;  4M78 F;  2RD1 A;  1G3T A;  1Y96 A;  5GMK h;  3OA6 A;  3CME T;  4E7I A;  2RH2 A;  1S72 T;  4HT9 A;  2KQW A;  4C0Z A;  1D3B A;  5LJ5 j;  1KC8 U;  1DJ7 B;  4F7U A;  1VQ9 T;  2VC8 A;  2KAF A;  2A7Y A;  5CKE A;  3CC4 T;  3X20 B;  4B9X A;  4O5V A;  5I21 A;  3RKY A;  4MML A;  4PNO A;  4PLL A;  3OW2 A;  1YJ9 A;  3MEW A;  1JJ2 A;  1R8O B;  1G3S A;  3VYG A;  3GF5 A;  3ZBD A;  2XK0 A;  3C95 A;  2ZCF B;  3OBY A;  1Q82 U;  4PJO A;  2OAU A;  2P0K A;  4JLG A;  1QVF A;  4ATO A;  1H3Z A;  2V8J A;  3OB9 A;  4F7U F;  1BKB A;  4NS5 A;  3HP9 A;  4FU6 A;  2QEX A;  2RHX A;  3CEY A;  2DJZ A;  3LW5 E;  2VYT A;  3HKS A;  4A4H A;  2MAM A;  3LGF A;  1UGQ B;  4P5N A;  3OY9 A;  1Y7X A;  4M75 C;  4C5I A;  3QBY A;  3OYK A;  1WQ7 A;  4PJO E;  2XD0 A;  2K57 A;  3OYD A;  2K4Y A;  3L2R A;  2X4J A;  3V8L A;  4EMG A;  3INZ A;  4X34 A;  3FLG A;  4A4F A;  2X4W A;  4PJO F;  1N9S A;  3HSB A;  3M4Y A;  3L2V A;  3LH0 A;  4OB2 B;  1VIF A;  1HXD A;  1BI2 A;  3CCQ T;  4BB7 A;  4BE2 A;  2XDB A;  2RI5 A;  4C92 F;  4QVD A;  3CC2 T;  1UGS B;  2LVM A;  3JB9 H;  4EDU A;  1KG1 A;  4M7D C;  3FJP A;  3FB9 A;  4JUV A;  3JCM c;  4KUD K;  1WJR A;  1VQP A;  1UB4 A;  5LJ3 j;  5HKC A;  3JCM e;  1VUB A;  5HK0 A;  5FRM A;  1ZBX A;  2CYZ B;  2E70 A;  3PTA A;  3NFC A;  3CPW S;  1YJN A;  4JS5 A;  2CS7 A;  3RMS A;  1H64 1;  4PLI A;  5LJ5 g;  1WQW A;  2E6N A;  2K5I A;  3C4S A;  3M4G A;  4N0A A;  1BI3 A;  1VQ7 T;  1B34 A;  4J5Y A;  2RJC A;  3HFO A;  3RUX A;  3UDC A;  4FIB A;  3CXC S;  3HPW A;  3O8V A;  1K9M U;  4PKC C;  3I56 A;  3OYY A;  4A54 A;  4ELY C;  2A3L A;  1VQP T;  4HT8 A;  4R55 A;  2LRQ A;  3DB3 A;  1KHI A;  1LOJ A;  1WJS A;  1IRE B;  3CCM A;  3MP6 A;  4M75 G;  4BAC A;  1M5Q 1;  2DIG A;  2FVU A;  3P8H A;  2Y4X A;  3J80 E;  5LL6 S;  3UPU A;  2E10 A;  2LT1 A;  4C0G A;  3MHX A;  4M77 B;  4ZGJ B;  1LJO A;  3E19 A;  1M9S A;  3QJ6 A;  3S3O A;  1BYM A;  2FYK A;  3OBW A;  1JRI A;  2B8A A;  2BIV A;  2P0Q A;  2BKD N;  2QDY B;  2X4Y A;  4BY6 C;  4VUB A;  1NPP A;  2E64 A;  2PVD B;  4KUL A;  1X01 A;  3QHS A;  4M7D G;  4XTV A;  4EMK B;  1Y07 A;  3OW2 S;  3M53 A;  1VQK A;  5HK3 A;  1VQ4 A;  2DD4 A;  3X28 B;  5FLX E;  5A0D A;  1JJ2 S;  5GAM j;  4OVA A;  5A0G A;  3QZ9 B;  3GOX A;  4M75 D;  3MP1 A;  4BI4 A;  5GMK l;  4EMH A;  1WJQ A;  5GAM h;  5HY6 A;  1VIE A;  4M75 F;  5FU6 C;  4TVR A;  4XQ3 A;  1KD1 U;  3V8J A;  1G3Y A;  2L89 A;  4BDZ A;  2EJG A;  4DQ2 A;  3PMI A;  1Q86 U;  1N27 A;  1I4K 1;  2DXU A;  3P8B B;  4QVZ A;  5GAM f;  1JBM A;  3MEU A;  2JUF A;  1M1G A;  1GXI E;  3FEO A;  5LJ3 g;  4HCB A;  4IKF A;  2XHC A;  2CZ1 B;  5J39 A;  3CMA T;  4J6W A;  2RHI A;  4A4K A;  4C0D B;  5GAN 3;  2MWP A;  1KD1 C;  4M7A B;  2MMP A;  3PNW C;  4MZP A;  4LDW A;  1KQ2 A;  4M7D D;  2VUB A;  4HCZ A;  4M7D F;  1VQM A;  1YHQ T;  4QW2 A;  1VQN T;  3H6Z A;  2BUD A;  1XNI A;  3A8L B;  1UEB A;  3QDR B;  3M9Q A;  3EAE A;  2XDD A;  4ZTJ A;  1W4S A;  2RHZ A;  4IUP A;  4J7I A;  4Z02 A;  2RJE A;  2QTX A;  4C0D C;  3LGL A;  3QKJ A;  3QYG B;  3SWN B;  3G4S T;  3DB4 A;  4OB0 B;  4XAX B;  1X75 C;  1U8R A;  1K8A U;  1ZHI A;  3TCJ A;  2R58 A;  2OTL A;  2EFI A;  3JSC A;  4NOY A;  3GP8 A;  3CCV A;  5GAN j;  2DK3 A;  2OTJ T;  3G6E T;  5GAN h;  2PUK B;  3CC7 T;  5GAO q;  1YI2 T;  3OSV A;  3BY7 A;  2IG0 A;  2WSC E;  1PSE A;  3QII A;  2HQX A;  3WVD B;  3OQ5 A;  3LX7 A;  2PUO B;  5GAN f;  2OTL T;  5GAO p;  3JB9 I;  4M77 A;  3JCM b;  3L2Q A;  2QA4 T;  4YTL A;  1NZ9 A;  3RES A;  3CCV T;  4ME7 A;  1NE8 A;  4XU3 A;  5D6Y A;  3CBO A;  4N0A C;  5KE2 A;  5LJ5 h;  5GAM g;  2JTF A;  2XIC A;  2YLB A;  1I81 A;  3CD6 T;  1OI1 A;  4PJO G;  1KC8 C;  4B9W A;  4LDX A;  5CK9 A;  3KBG A;  5FU7 B;  3WVE B;  4RG8 A;  3JCM X;  4M77 E;  2KVQ G;  2PU9 B;  3GNF B;  4FSX A;  5LJ5 f;  2RI2 A;  4C5G A;  4EMK A;  5GAO n;  5A2Q E;  5GAN 2;  3OYB A;  4OGC A;  4MDX A;  3L42 A;  4IUR A;  1BIA A;  3SFM A;  3JAM E;  1Q82 C;  3OYE A;  2CGH A;  4NL2 A;  2M0O A;  3HHT B;  5FU7 C;  1M1K U;  1U1T A;  3VKI A;  3NTH A;  1YJ9 T;  1EIF A;  1G3W A;  4XU2 A;  4JRK A;  2YLC A;  2O01 E;  4J6X A;  1IZ6 A;  2R57 A;  3ZFJ A;  3DLL A;  3CCR A;  2CZ7 B;  3S3N A;  2GQV A;  2XID A;  4LD9 K;  4PJO D;  3S3M A;  5CIU A;  1M8V A;  2EAY A;  1M90 U;  4M7A A;  1XQH A;  2QEX T;  1WNL A;  3LYI A;  2E12 A;  1LNX A;  4JS4 A;  2EQJ A;  4XTW A;  4BUG A;  3NTK A;  3UWN A;  2MI6 A;  5LJ5 d;  4C92 B;  1KQS A;  5GAN g;  5CKH A;  1Y71 A;  4LDY A;  5CKF A;  4M7A E;  1VQO A;  2QQB A;  1XTD A;  2PQW A;  2ZPE B;  3SWN A;  3CCS A;  1OZ3 A;  3PIO A;  5I2S A;  3MEV A;  2CZ0 B;  2E6Z A;  5LJ3 h;  3OYG A;  2G3R A;  1BI1 A;  5M9O A;  2VGM A;  4HA8 A;  5IT9 E;  3BW1 A;  1YIT A;  2LCC A;  1O75 A;  2CZ6 B;  2K3X A;  2DKG A;  5J3B A;  5IAY A;  4KBM B;  5LJ3 f;  3MCA B;  4HCC A;  4JJN K;  3QUI A;  4ZTF A;  4XTU A;  4IUV A;  3CCS T;  2EQM A;  2QQA A;  4MZT A;  5A0L A;  5KH6 A;  4C8Q B;  3G71 A;  4GY5 A;  3UT1 A;  5IN1 A;  3OMG A;  2F5K A;  2EIF A;  4C5E A;  1NJI U;  1K9M C;  2I2L A;  1YJN T;  2HBP A;  2JN0 A;  4A4E A;  1YIT T;  1I5L A;  2ZPB B;  5I2M A;  2E5Q A;  2HQE A;  4Y91 A;  3OS1 A;  4M78 B;  2ZZD A;  3I56 T;  2ZGW A;  4CRI A;  3CPF A;  2XDP A;  2LNV A;  2RI3 A;  3M55 A;  4C8Q C;  4OMF B;  3A8G B;  1YJW A;  3JCM V;  3E9G A;  3M5A A;  3CCM T;  4ZGD B;  1KQ1 A;  1M4Z A;  3MO8 A;  2DXT A;  2V8I A;  2X35 A;  4E7K A;  3DKM A;  4XK8 E;  4Y28 E;  3Q1J A;  4L59 A;  3QXE B;  4RMO A;  2VXF A;  1FXX A;  3OYF A;  2XKO C;  3PFS A;  2RJD A;  2E65 A;  4M77 C;  3OYL A;  4DA4 A;  5LJ3 d;  3HRU A;  4D6W A;  3I55 A;  1K73 U;  2K5L A;  1YJW T;  3BDU A;  3GNG A;  1QVF S;  2L3R A;  4ZN3 A;  5GMK e;  3LWI A;  2JZ2 A;  5DLO A;  2FL7 A;  1YIJ A;  5FRO A;  3BFM A;  4MDW A;  3V7C A;  2JNG A;  4F7U B;  2EKO A;  4QQG A;  3PGG A;  3L2W A;  5GAN 6;  4EMK C;  5LJ5 e;  1VQK T;  2GFU A;  2WSF E;  1VQ4 T;  2LCL A;  2XG8 D;  3I55 T;  1Q86 C;  2EJF A;  3A8H B;  3CCE A;  2DZC A;  4C92 A;  1QVP A;  3MET A;  3QZ5 B;  4JRP A;  2YHT A;  1VQ5 A;  4J83 A;  1FX7 A;  1MHN A;  3L2U A;  3FDR A;  3KUF A;  4V2S A;  3RKW A;  2EWN A;  3GPL A;  4BDY A;  4BE0 A;  2YRV A;  1VQL A;  2NLU A;  3JCM h;  4E7H A;  3SD4 A;  4O6J A;  5KCO A;  2DXC A;  4XTX A;  3VYH B;  4C92 E;  1KQS S;  1QP3 A;  3ME9 A;  4QQD A;  4C8Q G;  3MEA A;  4J8O A;  1SSF A;  2LC4 A;  5C6S A;  3JCM f;  4M7A C;  4IUU A;  2KDS A;  1VQ5 T;  2LQ8 A;  2EQK A;  3S6W A;  3FRN A;  5EG2 A;  1VQM T;  4PL6 A;  2GCX A;  5KE3 A;  1K8A C;  2DIQ A;  4C8Q A;  3KXT A;  3CCU A;  3RER A;  3VV0 A;  4M77 G;  5GMK i;  5CCA A;  5GAM d;  3V8K A;  4ELZ C;  2E1H A;  4IUQ A;  4L6V 5;  3URG A;  1VQ8 A;  2D6F A;  1RL2 A;  3OYN A;  4KT0 E;  3SWN C;  1MGQ A;  1YCY A;  4JRI A;  3VU3 C;  4EPC A;  4ZGE B;  4X9C A;  1PSF A;  1G5V A;  2V8K A;  4C8Q E;  2EJ9 A;  3X26 B;  3JB9 G;  5GAN 8;  4M78 A;  2ZPI B;  3J81 E;  3TRE A;  5C0M A;  2M1H A;  2ZPG B;  2DD5 A;  3VJP A;  4UC4 A;  3M56 A;  3CME A;  4C8Q F;  1S72 A;  2KK4 A;  4J6Y A;  4LDU A;  1W2B A;  2HD0 A;  3HRT A;  2ZPH B;  4OF1 A;  3VUB A;  5LJ3 e;  2LTO A;  4M78 E;  2EYQ A;  2QQ9 A;  1VQ9 A;  1FWZ A;  2F69 A;  4A53 A;  2M9U A;  2QQR A;  3JB9 J;  4WF2 A;  2DTI A;  1B34 B;  1N9R A;  3OS5 A;  4JLI A;  4M77 D;  2DTO A;  4N4G A;  3L1A A;  2DXB A;  4M77 F;  3V7S A;  3EFR A;  3CCL A;  4OP0 A;  2Y4Y A;  2AHJ B;  2XU8 A;  3OYH A;  3QPH A;  5GAN 4;  3HL8 A;  3JB9 D;  4M7A G;  1QW1 A;  3JCM g;  4LDV A;  2EQU A;  3JB9 F;  2DAQ A;  2P4T A;  4FT2 A;  3A8M B;  3V7R A;  2XI9 A;  2JVV A;  2LT4 A;  1M1K C;  5GAN d;  5DLQ E;  5CQY A;  4XU0 A;  3LWH A;  4MZM A;  4NL3 A;  3CCL T;  1X6O A;  4BE1 A;  4F7U E;  4M75 B;  4RG2 A;  5DM7 R;  3T9N A;  1N8R U;  3X25 B;  2RO0 A;  3PMT A;  4MMK A;  3OSS C;  4R56 A;  1M90 C;  2RK1 A;  2DTH A;  1N8R C;  2RA2 A;  2K2V A;  3J7A F;  4A4G A;  3CCR T;  3QYH B;  3GLX A;  2VGN A;  2RJF A;  4BI3 A;  3CCQ A;  1QVG A;  4E7J A;  4M7A D;  3TU4 K;  2JOY A;  5CVI A;  2GF7 A;  4FL6 A;  5GAM e;  3CC2 A;  4M7A F;  4BD3 A;  3LLR A;  4M7D B;  3JRZ A;  2DZ9 A;  2VXE A;  1BIB A;  5GAO m;  4DOV A;  3R6O A;  4C92 C;  3AHU A;  5DY9 A;  1VQO T;  3VUZ A;  3OS0 A;  3A5Z B;  3E9F A;  3TEE A;  5FRN A;  4OGE A;  1VQ7 A;  2O4X B;  5CKB A;  3QJY A;  3WXM B;  2LQK A;  2F5T X;  3M57 A;  4HKE A;  2RHY A;  4RKU E;  1NPR A;  4DOW A;  1WGS A;  4CI0 C;  3L2Z A;  3MP8 A;  3OYI A;  1NJI C;  3HRS A;  4RCC A;  1RI0 A;  2MF2 A;  4ZN1 A;  1V29 B;  2L8D A;  2R5A A;  2WAC A;  5L8R E;  3OYA A;  3G71 T;  4X9D A;  2IVW A;  3NTI A;  1TH7 A;  1BI0 A;  2M16 A;  4C5H A;  3C94 A;  2K3Y A;  5GAO r;  5D6X A;  2GFA A;  4RCB A;  1W2B S;  1XOV A;  5GMK m;  5GAO l;  1UGR B;  2LX9 A;  2RK2 A;  3N5B B;  2RHU A;  2H3J A;  4M78 C;  3CBM A;  5GAN e;  4BY6 B;  5GAN 7;  5CKD A;  3EFS A;  1I8F A;  3ER0 A;  4BI8 B;  1Y96 B;  4GLK A;  2FHD A;  2DEQ A;  4J7F A;  1D3B B;  1K73 C;  4XU1 A;  4C92 G;  1JB0 E;  2X4X A;  3HFN A;  4E7L A;  3OYM A;  4M75 A;  1WPY A;  2DVE A;  5CAI A;  2MWO A;  3CBP A;  4N4H A;  5FU6 B;  1VQ6 A;  4XTZ A;  3X24 B;  5GAN 5;  5CQX A;  3CCJ A;  2WSE E;  4E47 A;  2C06 A;  1P92 A;  5AYF A;  3RIR A;  2JTM A;  4M75 E;  2RM4 A;  1YIJ T;  3BDL A;  3G7Z A;  3ZEH A;  5D6W A;  3GIB A;  2Y90 A;  3SDZ A;  2LDM A;  3RKX A;  1Q7Y U;  4LD6 A;  2HAX A;  4PJO B;  1OZ2 A;  3CMA A;  3E1S A;  2E41 A;  3JCM Q;  3C12 A;  2KMT A;  2QI2 A;  4JDS A;  1VQ6 T;  2D9T A;  1OYX A;  4L5G A;  4M7D A;  1Q7Y C;  4Q5W A;  2KSS A;  3M59 A;  4OB3 B;  2DO3 A;  3M58 A;  5KCH A;  2P0P A;  3CCJ T;  3CCE T;  1M1F A;  1N6A A;  3M54 A;  4C92 D;  1YHQ A;  2PVO B;  4XTY A;  1QVG S;  1VQN A;  3F70 A;  2KY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...