4II4B

The phenylacetyl-coa monooxygenase - mutant paaa e49q k68q - paac wild type subcomplex with benzoyl-coa
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
239
structure length
239
Chain Sequence
SNQLTAYTLRLGDNCLVLSQRLGEWCGHAPELEIDLALANIGLDLLGQARNFLSYAAELAGEGDEDTLAFTRDERQFSNLLLVEQPNGNFADTIARQYFIDAWHVALFTRLMESRDPQLAAISAKAIKEARYHLRFSRGWLERLGNGTDVSGQKMQQAINKLWRFTAELFDADEIDIALSEEGIAVDPRTLRAAWEAEVFAGINEATLNVPQEQAYRTGGKKGLHTEHLGPMLAEMQYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1,2-phenylacetyl-CoA epoxidase, subunit A
publication title Spatial Organization of Subunits within the Phenylacetyl-CoA Monooxygenase Complex
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 97
structure length 239
sequence length 239
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4ii4B00
2BJYA 3BVIA 3QHBA 1NF6A 5GOUA 3TA8A 1KRQA 3KXUA 3O7SA 4TOGA 5J9VA 3Q4OA 4PG0A 1VJXA 2JD60 4ZJKA 3EZ0A 3PW1A 1RCEA 4IWKA 4Z5SA 2HTNA 3KA3A 2ZA6A 5D8YA 5HJFA 2Y3QA 1IERA 4IWJA 3F39A 3HL1A 3QZ3A 5FFAA 3Q4QA 3FVBA 3BVFA 2FZFA 1NF4A 1VEIA 2V2LA 4DYXA 4RC7A 3Q4RA 4MJYA 3F37A 3GE4A 1VELA 3PZAA 4ISMA 3NP0X 2XKQA 2V2MA 1JYBA 5CZUA 1ZS3A 2Z5QA 3FSEA 4ZKWA 4EVCA 2X170 5GN8B 2VXXA 3BVKA 3Q4NA 2BKCA 3BT5A 3OJ5A 3SH6A 4ZLWA 5CMQA 2CLUA 4TOCA 3EZUA 4CMYV 3BVLA 2FL0A 3AK9A 2BK6A 3F35A 1LKPA 5K52A 3RBCA 3H7GA 2CHPA 5D8OA 4EVEA 3PWQC 3R2SA 5JKMG 2WTLA 2C2FA 2C2JA 3KA4A 5D8RA 5D8QA 2XJMA 5JKMA 5GU0X 2Z5PA 3VNXA 2XJNA 4MN9A 4CMYA 3FI6A 2ZG8X 4DYYA 2XJOA 2UX1A 4II4A 2GS4A 4IXKA 2D5KA 1DPSA 1HRSA 5IX6A 4MY7A 2CIHA 1BCFA 1JI5A 2GYDA 3PVYA 1IESA 4ZKHA 4ITTA 1YUZA 2G4HA 1LKMA 4ZMCA 1EUMA 4LQNA 3R2OA 4LYXA 3PVRA 4M35A 4CY9A 3RE7A 2OC5A 5FFCA 3AF9X 4KVSA 4LPJA 5K53A 3SIDA 2OH3A 3R2RA 1GWGA 4LQHA 3F34A 3KA8A 5D8PA 5JKLG 4ZKXA 1B71A 4OYNA 1Z6OA 5JKLA 3R2HA 4II4B 4XKUA 3E6SA 2JD80 1O9IA 2ZG7X 3PWQA 3O7RA 3IQ1A 1TK6A 2ZURX 3RD0A 4ITWA 2FHAA 2C2UA 3E1MA 3T9JA 3ISFA 5FFEA 1TKOA 3PVYB 4CVPA 3ERZA 4QUWA 2ZA8A 4M32A 3UOFA 4REUA 4ZTTA 1RCGA 3R2LA 1XZ3A 3PVRB 1JTSA 4DYUA 5J8SA 3F36A 1LB3A 1RYTA 3E1OA 5AXSA 1Z6OM 2XGWA 1SQ3A 3QVDA 3PWFA 4CYBA 2QF9A 4MUDA 4TO9A 3E6RA 3SHXA 3R2KA 3E1JA 1XZ1A 3PW1B 3R2MA 3F33A 2CF7A 1UVHA 1VLGA 2V2IA 4TW3A 3WVUA 1QGHA 1TKPA 2C6RA 2CN6A 1MFRA 5J93A 4RC7B 3AF7X 1NNQA 3AJPA 1FHAA 2FJCA 2HR5A 1Z4AA 1L8HA 1F30A 2V2PA 1R03A 2V2SA 4CYAA 1RCDA 4DI0A 1H96A 1VEQA 4MKUA 1J30A 2ZG9X 2V15A 2IU2A 4R42A 2IY4A 5HQOA 4LQJA 1UMNA 2RBDA 3ES3A 1RCCA 3SE1A 1JREA 5LG8A 1TJOA 5J8WA 3EGMA 3IS8A 3KA9A 4XKTA 4DE6A 3F32A 1QYBA 2YJJA 5FEJA 1YV1A 2IB0A 1LKOA 3E2CA 4ML5A 4TOHA 3OGHA 4ZL6A 4PGIA 4ERUA 3RGDA 4TOFA 5LS9A 1AEWA 2YW7A 3KX9A 2WLAA 5FFDA 5GU2X 3E1PA 1F33A 4PG1A 4A25A 3E1QA 2F7NA 2YJKA 3U90A 1JIGA 1S3QA 4TOAA 3AJQA 1YUXA 1MOJA 3PVTA 3WVWA 4LQVA 4TOEA 5HJHA 3QHCA 2BW1A 3BKNA 2CHIA 3IS7A 4CVTA 3E1NA 5JACA 5ERKA 3MPSA 4LPMA 2FKZA 4KVQA 4M33A 4CVRA 2CEIA 3WNWA 1NFVA 1DVBA 2V2NA 4U3GA 2ITBA 4RC5A 1JKUA 3RAVA 3PW8C 4P18A 4RC8A 1RCIA 1JI4A 2CLBA 5E1UA 4RC6A 2PYBA 3ISEA 2V2OA 5D8SA 4EVDA 4LPNA 2Z90A 1JGCA 3AF8X 4Z3BA 5I4JA 1O9RA 4M34A 2QQYA 4AM4A 3NP2X 5FFBA 4Y08A 1DATA 4AM5A 2FFXJ 2CN7A 1L8IA 3AJOA 4YKHA 3PVTB 2GYQA 4DASA 5GU1X 2VXIA 3HIUA 3A68A 3WVVA 4CVSA 3BVEA 3QB9A 1OTKA 1S30A 5E2DA 4DYZA 5CMRA 4TODA 3QD8A 1BG7A 1BFRA 5GU3X 2WLUA 4TOBA 3UNOA 1JKVA 4ZL5A 5LBHA 1SOFA 2W0OA 4RC5B 4E6KA 5ERJA 1ZUJA 2V2JA 3GHQA 3KWOA 4RC6B 1N1QA 3AK8A 4AM2A 4EVBA 3E1LA 3NOZX 4DZ0A 2JD70 5D8XA 2VZBA 3A9QA 3UOIA 3KA6A 5LG2A 2V2RA 4KVRA 4PGKA 1S2ZA 4ISPA 5C6FA 4ETRA 2Z6MA 2FG4A 2YW6A 2ZA7A 4XKSA 3PW8A 2Z5RA 2FG8A 2C41A 4XGSA 3F38A 5GN8A 3GVYA 4LYUA
chains in the Genus database with same CATH superfamily
2BJYA 3BVIA 3QHBA 1NF6A 5GOUA 3TA8A 1KRQA 3KXUA 3O7SA 4TOGA 5J9VA 3Q4OA 4PG0A 1VJXA 2JD60 4ZJKA 3EZ0A 3PW1A 3L0MA 1RCEA 4IWKA 4Z5SA 2HTNA 3KA3A 2ZA6A 5D8YA 5HJFA 2Y3QA 1IERA 5JDOA 2OKCA 4IWJA 3F39A 3HL1A 3QZ3A 5FFAA 3Q4QA 3FVBA 3BVFA 2FZFA 1NF4A 1VEIA 2V2LA 4DYXA 4RC7A 3JZ9A 3Q4RA 4MJYA 4KXRB 3F37A 3GE4A 1VELA 3PZAA 4ISMA 3NP0X 2XKQA 2V2MA 1JYBA 3VV9A 5CZUA 1ZS3A 2Z5QA 3FSEA 4ZKWA 4EVCA 2X170 5GN8B 2VXXA 3BVKA 3Q4NA 2BKCA 3BT5A 3OJ5A 3M6JA 3SH6A 4ZLWA 5CMQA 2CLUA 4TOCA 3EZUA 4CMYV 3BVLA 2FL0A 3AK9A 2BK6A 3F35A 1LKPA 5K52A 3RBCA 3H7GA 2CHPA 3C21A 5D8OA 4EVEA 5HU6D 5JDOB 3PWQC 3R2SA 5JKMG 2WTLA 2C2FA 2C2JA 3KA4A 5D8RA 5D8QA 2XJMA 5JKMA 5GU0X 2Z5PA 3VNXA 2XJNA 4MN9A 4CMYA 3FI6A 3FRSA 3GGZA 2ZG8X 4DYYA 4W4KB 2XJOA 2UX1A 4II4A 2GS4A 4IXKA 2D5KA 1DPSA 1HRSA 5IX6A 4MY7A 2CIHA 2G38B 2CWLA 1BCFA 1JI5A 2GYDA 3PVYA 1IESA 4ZKHA 4ITTA 1YUZA 2G4HA 1LKMA 4ZMCA 1EUMA 4LQNA 3R2OA 4LYXA 3PVRA 4M35A 4CY9A 4X0JA 3RE7A 2OC5A 5FFCA 3AF9X 4KVSA 3C1YA 4LPJA 5K53A 3SIDA 2OH3A 3R2RA 4YVZA 1GWGA 4LQHA 3F34A 3KA8A 2V8TA 5D8PA 5JKLG 4ZKXA 1B71A 4OYNA 1Z6OA 5JKLA 3R2HA 4II4B 4XKUA 3E6SA 2JD80 3D19A 3C1ZA 1O9IA 2ZG7X 3PWQA 3O7RA 3IQ1A 1TK6A 2ZURX 3RD0A 4ITWA 2FHAA 2C2UA 3E1MA 3T9JA 3ISFA 5FFEA 1TKOA 3PVYB 4CVPA 3N6OA 3ERZA 4QUWA 2ZA8A 4M32A 3UOFA 4REUA 4ZTTA 1RCGA 3R2LA 1XZ3A 3PVRB 1JTSA 4DYUA 5J8SA 3F36A 1LB3A 3KDQA 1RYTA 3E1OA 5AXSA 1Z6OM 2XGWA 1SQ3A 3VVAA 3GGYA 3QVDA 3PWFA 4CYBA 2V8UA 2QF9A 4MUDA 4TO9A 3E6RA 3SHXA 3R2KA 3E1JA 1XZ1A 3PW1B 3R2MA 3F33A 2CF7A 1UVHA 1VLGA 2V2IA 4TW3A 3WVUA 1QGHA 1TKPA 2C6RA 2CN6A 1MFRA 5J93A 4RC7B 3AF7X 1NNQA 3AJPA 1FHAA 2FJCA 2HR5A 1Z4AA 1L8HA 1F30A 2V2PA 1R03A 2V2SA 4CYAA 1RCDA 4DI0A 1H96A 1VEQA 4MKUA 1J30A 2ZG9X 4YXMA 2V15A 2IU2A 2MGYA 4R42A 2IY4A 5HQOA 4LQJA 1UMNA 2RBDA 3ES3A 1RCCA 3SE1A 1JREA 5LG8A 1TJOA 5J8WA 3EGMA 3IS8A 3KA9A 4XKTA 4DE6A 3F32A 1QYBA 2YJJA 5FEJA 1YV1A 2IB0A 1LKOA 3E2CA 4ML5A 4TOHA 3OGHA 4ZL6A 3FRRA 4PGIA 4ERUA 3JZAB 3RGDA 4WJG4 4TOFA 5LS9A 1AEWA 2YW7A 3C23A 3KX9A 2WLAA 5FFDA 5GU2X 3E1PA 1F33A 4PG1A 4A25A 3E1QA 3W54A 2F7NA 3DBYA 2YJKA 3U90A 1JIGA 1S3QA 4TOAA 3AJQA 1YUXA 1MOJA 3PVTA 3WVWA 4LQVA 4TOEA 5HJHA 3QHCA 2BW1A 3BKNA 2CHIA 3IS7A 4CVTA 3E1NA 5JACA 5ERKA 3MPSA 4LPMA 2FKZA 3V3KB 4KVQA 4M33A 4CVRA 2CEIA 3WNWA 1NFVA 3KHKA 1DVBA 2V2NA 4U3GA 2ITBA 4RC5A 1JKUA 3RAVA 3PW8C 4P18A 4RC8A 1RCIA 1JI4A 2CLBA 2AR0A 5E1UA 4RC6A 2PYBA 3ISEA 2V2OA 5D8SA 4EVDA 4LPNA 2Z90A 1JGCA 3AF8X 4Z3BA 5I4JA 1O9RA 4M34A 2QQYA 4AM4A 3NP2X 5FFBA 2WWXB 1DATA 4Y08A 4AM5A 2FFXJ 2CN7A 1L8IA 3AJOA 4YKHA 3PVTB 2GYQA 4DASA 5GU1X 4W4LB 2VXIA 3HIUA 3A68A 3WVVA 4CVSA 3BVEA 3QB9A 1OTKA 1S30A 5E2DA 3UFBA 4DYZA 5CMRA 4TODA 3QD8A 4MXPA 1BG7A 1BFRA 5GU3X 2WLUA 4TOBA 3UNOA 1JKVA 2N02A 4E40A 4ZL5A 5LBHA 1SOFA 2W0OA 4RC5B 4E6KA 5ERJA 1ZUJA 2V2JA 3GHQA 3KWOA 4RC6B 1N1QA 3AK8A 2Y44A 4AM2A 4EVBA 3NOZX 3E1LA 4DZ0A 2JD70 3LKDA 5D8XA 2VZBA 3A9QA 3UOIA 3KA6A 5LG2A 2V2RA 4KVRA 4PGKA 1S2ZA 4ISPA 5C6FA 4ETRA 2Z6MA 2FG4A 2YW6A 2ZA7A 4YXJA 4XKSA 3PW8A 2Z5RA 2FG8A 2C41A 4XGSA 3F38A 5GN8A 3GVYA 4LYUA
chains in the Genus database with same CATH topology
2BJYA 3BVIA 3QHBA 1NF6A 5GOUA 3TA8A 1KRQA 3KXUA 3O7SA 4TOGA 5J9VA 3Q4OA 4PG0A 1VJXA 2JD60 4ZJKA 3EZ0A 3PW1A 3L0MA 1RCEA 4IWKA 4Z5SA 2HTNA 3KA3A 2ZA6A 5D8YA 5HJFA 2Y3QA 1IERA 5JDOA 2OKCA 4IWJA 3F39A 3HL1A 3QZ3A 5FFAA 3Q4QA 3FVBA 3BVFA 2FZFA 1NF4A 1VEIA 2V2LA 4DYXA 4RC7A 3JZ9A 3Q4RA 4MJYA 4KXRB 3F37A 3GE4A 1VELA 3PZAA 4ISMA 3NP0X 2XKQA 2V2MA 1JYBA 3VV9A 5CZUA 1ZS3A 2Z5QA 3FSEA 4ZKWA 4EVCA 2X170 5GN8B 2VXXA 3BVKA 3Q4NA 2BKCA 3BT5A 3OJ5A 3M6JA 3SH6A 4ZLWA 5CMQA 2CLUA 4TOCA 3EZUA 4CMYV 3BVLA 2FL0A 3AK9A 2BK6A 3F35A 1LKPA 5K52A 3RBCA 3H7GA 2CHPA 3C21A 5D8OA 4EVEA 5HU6D 5JDOB 3PWQC 3R2SA 5JKMG 2WTLA 2C2FA 2C2JA 3KA4A 5D8RA 5D8QA 2XJMA 5JKMA 5GU0X 2Z5PA 3VNXA 2XJNA 4MN9A 4CMYA 3FI6A 3FRSA 3GGZA 2ZG8X 4DYYA 4W4KB 2XJOA 2UX1A 4II4A 2GS4A 4IXKA 2D5KA 1DPSA 1HRSA 5IX6A 4MY7A 2CIHA 2G38B 2CWLA 1BCFA 1JI5A 2GYDA 3PVYA 1IESA 4ZKHA 4ITTA 1YUZA 2G4HA 1LKMA 4ZMCA 1EUMA 4LQNA 3R2OA 4LYXA 3PVRA 4M35A 4CY9A 4X0JA 3RE7A 2OC5A 5FFCA 3AF9X 4KVSA 3C1YA 4LPJA 5K53A 3SIDA 2OH3A 3R2RA 4YVZA 1GWGA 4LQHA 3F34A 3KA8A 2V8TA 5D8PA 5JKLG 4ZKXA 1B71A 4OYNA 1Z6OA 5JKLA 3R2HA 4II4B 4XKUA 3E6SA 2JD80 3D19A 3C1ZA 1O9IA 2ZG7X 3PWQA 3O7RA 3IQ1A 1TK6A 2ZURX 3RD0A 4ITWA 2FHAA 2C2UA 3E1MA 3T9JA 3ISFA 5FFEA 1TKOA 3PVYB 4CVPA 3N6OA 3ERZA 4QUWA 2ZA8A 4M32A 3UOFA 4REUA 4ZTTA 1RCGA 3R2LA 1XZ3A 3PVRB 1JTSA 4DYUA 5J8SA 3F36A 1LB3A 3KDQA 1RYTA 3E1OA 5AXSA 1Z6OM 2XGWA 1SQ3A 3VVAA 3GGYA 3QVDA 3PWFA 4CYBA 2V8UA 2QF9A 4MUDA 4TO9A 3E6RA 3SHXA 3R2KA 3E1JA 1XZ1A 3PW1B 3R2MA 3F33A 2CF7A 1UVHA 1VLGA 2V2IA 4TW3A 3WVUA 1QGHA 1TKPA 2C6RA 2CN6A 1MFRA 5J93A 4RC7B 3AF7X 1NNQA 3AJPA 1FHAA 2FJCA 2HR5A 1Z4AA 1L8HA 1F30A 2V2PA 1R03A 2V2SA 4CYAA 1RCDA 4DI0A 1H96A 1VEQA 4MKUA 1J30A 2ZG9X 4YXMA 2V15A 2IU2A 2MGYA 4R42A 2IY4A 5HQOA 4LQJA 1UMNA 2RBDA 3ES3A 1RCCA 3SE1A 1JREA 5LG8A 1TJOA 5J8WA 3EGMA 3IS8A 3KA9A 4XKTA 4DE6A 3F32A 1QYBA 2YJJA 5FEJA 1YV1A 2IB0A 1LKOA 3E2CA 4ML5A 4TOHA 3OGHA 4ZL6A 3FRRA 4PGIA 4ERUA 3JZAB 3RGDA 4WJG4 4TOFA 5LS9A 1AEWA 2YW7A 3C23A 3KX9A 2WLAA 5FFDA 5GU2X 3E1PA 1F33A 4PG1A 4A25A 3E1QA 3W54A 2F7NA 3DBYA 2YJKA 3U90A 1JIGA 1S3QA 4TOAA 3AJQA 1YUXA 1MOJA 3PVTA 3WVWA 4LQVA 4TOEA 5HJHA 3QHCA 2BW1A 3BKNA 2CHIA 3IS7A 4CVTA 3E1NA 5JACA 5ERKA 3MPSA 4LPMA 2FKZA 3V3KB 4KVQA 4M33A 4CVRA 2CEIA 3WNWA 1NFVA 3KHKA 1DVBA 2V2NA 4U3GA 2ITBA 4RC5A 1JKUA 3RAVA 3PW8C 4P18A 4RC8A 1RCIA 1JI4A 2CLBA 2AR0A 5E1UA 4RC6A 2PYBA 3ISEA 2V2OA 5D8SA 4EVDA 4LPNA 2Z90A 1JGCA 3AF8X 4Z3BA 5I4JA 1O9RA 4M34A 2QQYA 4AM4A 3NP2X 5FFBA 2WWXB 1DATA 4Y08A 4AM5A 2FFXJ 2CN7A 1L8IA 3AJOA 4YKHA 3PVTB 2GYQA 4DASA 5GU1X 4W4LB 2VXIA 3HIUA 3A68A 3WVVA 4CVSA 3BVEA 3QB9A 1OTKA 1S30A 5E2DA 3UFBA 4DYZA 5CMRA 4TODA 3QD8A 4MXPA 1BG7A 1BFRA 5GU3X 2WLUA 4TOBA 3UNOA 1JKVA 2N02A 4E40A 4ZL5A 5LBHA 1SOFA 2W0OA 4RC5B 4E6KA 5ERJA 1ZUJA 2V2JA 3GHQA 3KWOA 4RC6B 1N1QA 3AK8A 2Y44A 4AM2A 4EVBA 3NOZX 3E1LA 4DZ0A 2JD70 3LKDA 5D8XA 2VZBA 3A9QA 3UOIA 3KA6A 5LG2A 2V2RA 4KVRA 4PGKA 1S2ZA 4ISPA 5C6FA 4ETRA 2Z6MA 2FG4A 2YW6A 2ZA7A 4YXJA 4XKSA 3PW8A 2Z5RA 2FG8A 2C41A 4XGSA 3F38A 5GN8A 3GVYA 4LYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BJY A;  3BVI A;  3QHB A;  1NF6 A;  5GOU A;  3TA8 A;  1KRQ A;  3KXU A;  3O7S A;  4TOG A;  5J9V A;  3Q4O A;  4PG0 A;  1VJX A;  2JD6 0;  4ZJK A;  3EZ0 A;  3PW1 A;  1RCE A;  4IWK A;  4Z5S A;  2HTN A;  3KA3 A;  2ZA6 A;  5D8Y A;  5HJF A;  2Y3Q A;  1IER A;  4IWJ A;  3F39 A;  3HL1 A;  3QZ3 A;  5FFA A;  3Q4Q A;  3FVB A;  3BVF A;  2FZF A;  1NF4 A;  1VEI A;  2V2L A;  4DYX A;  4RC7 A;  3Q4R A;  4MJY A;  3F37 A;  3GE4 A;  1VEL A;  3PZA A;  4ISM A;  3NP0 X;  2XKQ A;  2V2M A;  1JYB A;  5CZU A;  1ZS3 A;  2Z5Q A;  3FSE A;  4ZKW A;  4EVC A;  2X17 0;  5GN8 B;  2VXX A;  3BVK A;  3Q4N A;  2BKC A;  3BT5 A;  3OJ5 A;  3SH6 A;  4ZLW A;  5CMQ A;  2CLU A;  4TOC A;  3EZU A;  4CMY V;  3BVL A;  2FL0 A;  3AK9 A;  2BK6 A;  3F35 A;  1LKP A;  5K52 A;  3RBC A;  3H7G A;  2CHP A;  5D8O A;  4EVE A;  3PWQ C;  3R2S A;  5JKM G;  2WTL A;  2C2F A;  2C2J A;  3KA4 A;  5D8R A;  5D8Q A;  2XJM A;  5JKM A;  5GU0 X;  2Z5P A;  3VNX A;  2XJN A;  4MN9 A;  4CMY A;  3FI6 A;  2ZG8 X;  4DYY A;  2XJO A;  2UX1 A;  4II4 A;  2GS4 A;  4IXK A;  2D5K A;  1DPS A;  1HRS A;  5IX6 A;  4MY7 A;  2CIH A;  1BCF A;  1JI5 A;  2GYD A;  3PVY A;  1IES A;  4ZKH A;  4ITT A;  1YUZ A;  2G4H A;  1LKM A;  4ZMC A;  1EUM A;  4LQN A;  3R2O A;  4LYX A;  3PVR A;  4M35 A;  4CY9 A;  3RE7 A;  2OC5 A;  5FFC A;  3AF9 X;  4KVS A;  4LPJ A;  5K53 A;  3SID A;  2OH3 A;  3R2R A;  1GWG A;  4LQH A;  3F34 A;  3KA8 A;  5D8P A;  5JKL G;  4ZKX A;  1B71 A;  4OYN A;  1Z6O A;  5JKL A;  3R2H A;  4II4 B;  4XKU A;  3E6S A;  2JD8 0;  1O9I A;  2ZG7 X;  3PWQ A;  3O7R A;  3IQ1 A;  1TK6 A;  2ZUR X;  3RD0 A;  4ITW A;  2FHA A;  2C2U A;  3E1M A;  3T9J A;  3ISF A;  5FFE A;  1TKO A;  3PVY B;  4CVP A;  3ERZ A;  4QUW A;  2ZA8 A;  4M32 A;  3UOF A;  4REU A;  4ZTT A;  1RCG A;  3R2L A;  1XZ3 A;  3PVR B;  1JTS A;  4DYU A;  5J8S A;  3F36 A;  1LB3 A;  1RYT A;  3E1O A;  5AXS A;  1Z6O M;  2XGW A;  1SQ3 A;  3QVD A;  3PWF A;  4CYB A;  2QF9 A;  4MUD A;  4TO9 A;  3E6R A;  3SHX A;  3R2K A;  3E1J A;  1XZ1 A;  3PW1 B;  3R2M A;  3F33 A;  2CF7 A;  1UVH A;  1VLG A;  2V2I A;  4TW3 A;  3WVU A;  1QGH A;  1TKP A;  2C6R A;  2CN6 A;  1MFR A;  5J93 A;  4RC7 B;  3AF7 X;  1NNQ A;  3AJP A;  1FHA A;  2FJC A;  2HR5 A;  1Z4A A;  1L8H A;  1F30 A;  2V2P A;  1R03 A;  2V2S A;  4CYA A;  1RCD A;  4DI0 A;  1H96 A;  1VEQ A;  4MKU A;  1J30 A;  2ZG9 X;  2V15 A;  2IU2 A;  4R42 A;  2IY4 A;  5HQO A;  4LQJ A;  1UMN A;  2RBD A;  3ES3 A;  1RCC A;  3SE1 A;  1JRE A;  5LG8 A;  1TJO A;  5J8W A;  3EGM A;  3IS8 A;  3KA9 A;  4XKT A;  4DE6 A;  3F32 A;  1QYB A;  2YJJ A;  5FEJ A;  1YV1 A;  2IB0 A;  1LKO A;  3E2C A;  4ML5 A;  4TOH A;  3OGH A;  4ZL6 A;  4PGI A;  4ERU A;  3RGD A;  4TOF A;  5LS9 A;  1AEW A;  2YW7 A;  3KX9 A;  2WLA A;  5FFD A;  5GU2 X;  3E1P A;  1F33 A;  4PG1 A;  4A25 A;  3E1Q A;  2F7N A;  2YJK A;  3U90 A;  1JIG A;  1S3Q A;  4TOA A;  3AJQ A;  1YUX A;  1MOJ A;  3PVT A;  3WVW A;  4LQV A;  4TOE A;  5HJH A;  3QHC A;  2BW1 A;  3BKN A;  2CHI A;  3IS7 A;  4CVT A;  3E1N A;  5JAC A;  5ERK A;  3MPS A;  4LPM A;  2FKZ A;  4KVQ A;  4M33 A;  4CVR A;  2CEI A;  3WNW A;  1NFV A;  1DVB A;  2V2N A;  4U3G A;  2ITB A;  4RC5 A;  1JKU A;  3RAV A;  3PW8 C;  4P18 A;  4RC8 A;  1RCI A;  1JI4 A;  2CLB A;  5E1U A;  4RC6 A;  2PYB A;  3ISE A;  2V2O A;  5D8S A;  4EVD A;  4LPN A;  2Z90 A;  1JGC A;  3AF8 X;  4Z3B A;  5I4J A;  1O9R A;  4M34 A;  2QQY A;  4AM4 A;  3NP2 X;  5FFB A;  4Y08 A;  1DAT A;  4AM5 A;  2FFX J;  2CN7 A;  1L8I A;  3AJO A;  4YKH A;  3PVT B;  2GYQ A;  4DAS A;  5GU1 X;  2VXI A;  3HIU A;  3A68 A;  3WVV A;  4CVS A;  3BVE A;  3QB9 A;  1OTK A;  1S30 A;  5E2D A;  4DYZ A;  5CMR A;  4TOD A;  3QD8 A;  1BG7 A;  1BFR A;  5GU3 X;  2WLU A;  4TOB A;  3UNO A;  1JKV A;  4ZL5 A;  5LBH A;  1SOF A;  2W0O A;  4RC5 B;  4E6K A;  5ERJ A;  1ZUJ A;  2V2J A;  3GHQ A;  3KWO A;  4RC6 B;  1N1Q A;  3AK8 A;  4AM2 A;  4EVB A;  3E1L A;  3NOZ X;  4DZ0 A;  2JD7 0;  5D8X A;  2VZB A;  3A9Q A;  3UOI A;  3KA6 A;  5LG2 A;  2V2R A;  4KVR A;  4PGK A;  1S2Z A;  4ISP A;  5C6F A;  4ETR A;  2Z6M A;  2FG4 A;  2YW6 A;  2ZA7 A;  4XKS A;  3PW8 A;  2Z5R A;  2FG8 A;  2C41 A;  4XGS A;  3F38 A;  5GN8 A;  3GVY A;  4LYU A; 
#chains in the Genus database with same CATH topology
 2BJY A;  3BVI A;  3QHB A;  1NF6 A;  5GOU A;  3TA8 A;  1KRQ A;  3KXU A;  3O7S A;  4TOG A;  5J9V A;  3Q4O A;  4PG0 A;  1VJX A;  2JD6 0;  4ZJK A;  3EZ0 A;  3PW1 A;  3L0M A;  1RCE A;  4IWK A;  4Z5S A;  2HTN A;  3KA3 A;  2ZA6 A;  5D8Y A;  5HJF A;  2Y3Q A;  1IER A;  5JDO A;  2OKC A;  4IWJ A;  3F39 A;  3HL1 A;  3QZ3 A;  5FFA A;  3Q4Q A;  3FVB A;  3BVF A;  2FZF A;  1NF4 A;  1VEI A;  2V2L A;  4DYX A;  4RC7 A;  3JZ9 A;  3Q4R A;  4MJY A;  4KXR B;  3F37 A;  3GE4 A;  1VEL A;  3PZA A;  4ISM A;  3NP0 X;  2XKQ A;  2V2M A;  1JYB A;  3VV9 A;  5CZU A;  1ZS3 A;  2Z5Q A;  3FSE A;  4ZKW A;  4EVC A;  2X17 0;  5GN8 B;  2VXX A;  3BVK A;  3Q4N A;  2BKC A;  3BT5 A;  3OJ5 A;  3M6J A;  3SH6 A;  4ZLW A;  5CMQ A;  2CLU A;  4TOC A;  3EZU A;  4CMY V;  3BVL A;  2FL0 A;  3AK9 A;  2BK6 A;  3F35 A;  1LKP A;  5K52 A;  3RBC A;  3H7G A;  2CHP A;  3C21 A;  5D8O A;  4EVE A;  5HU6 D;  5JDO B;  3PWQ C;  3R2S A;  5JKM G;  2WTL A;  2C2F A;  2C2J A;  3KA4 A;  5D8R A;  5D8Q A;  2XJM A;  5JKM A;  5GU0 X;  2Z5P A;  3VNX A;  2XJN A;  4MN9 A;  4CMY A;  3FI6 A;  3FRS A;  3GGZ A;  2ZG8 X;  4DYY A;  4W4K B;  2XJO A;  2UX1 A;  4II4 A;  2GS4 A;  4IXK A;  2D5K A;  1DPS A;  1HRS A;  5IX6 A;  4MY7 A;  2CIH A;  2G38 B;  2CWL A;  1BCF A;  1JI5 A;  2GYD A;  3PVY A;  1IES A;  4ZKH A;  4ITT A;  1YUZ A;  2G4H A;  1LKM A;  4ZMC A;  1EUM A;  4LQN A;  3R2O A;  4LYX A;  3PVR A;  4M35 A;  4CY9 A;  4X0J A;  3RE7 A;  2OC5 A;  5FFC A;  3AF9 X;  4KVS A;  3C1Y A;  4LPJ A;  5K53 A;  3SID A;  2OH3 A;  3R2R A;  4YVZ A;  1GWG A;  4LQH A;  3F34 A;  3KA8 A;  2V8T A;  5D8P A;  5JKL G;  4ZKX A;  1B71 A;  4OYN A;  1Z6O A;  5JKL A;  3R2H A;  4II4 B;  4XKU A;  3E6S A;  2JD8 0;  3D19 A;  3C1Z A;  1O9I A;  2ZG7 X;  3PWQ A;  3O7R A;  3IQ1 A;  1TK6 A;  2ZUR X;  3RD0 A;  4ITW A;  2FHA A;  2C2U A;  3E1M A;  3T9J A;  3ISF A;  5FFE A;  1TKO A;  3PVY B;  4CVP A;  3N6O A;  3ERZ A;  4QUW A;  2ZA8 A;  4M32 A;  3UOF A;  4REU A;  4ZTT A;  1RCG A;  3R2L A;  1XZ3 A;  3PVR B;  1JTS A;  4DYU A;  5J8S A;  3F36 A;  1LB3 A;  3KDQ A;  1RYT A;  3E1O A;  5AXS A;  1Z6O M;  2XGW A;  1SQ3 A;  3VVA A;  3GGY A;  3QVD A;  3PWF A;  4CYB A;  2V8U A;  2QF9 A;  4MUD A;  4TO9 A;  3E6R A;  3SHX A;  3R2K A;  3E1J A;  1XZ1 A;  3PW1 B;  3R2M A;  3F33 A;  2CF7 A;  1UVH A;  1VLG A;  2V2I A;  4TW3 A;  3WVU A;  1QGH A;  1TKP A;  2C6R A;  2CN6 A;  1MFR A;  5J93 A;  4RC7 B;  3AF7 X;  1NNQ A;  3AJP A;  1FHA A;  2FJC A;  2HR5 A;  1Z4A A;  1L8H A;  1F30 A;  2V2P A;  1R03 A;  2V2S A;  4CYA A;  1RCD A;  4DI0 A;  1H96 A;  1VEQ A;  4MKU A;  1J30 A;  2ZG9 X;  4YXM A;  2V15 A;  2IU2 A;  2MGY A;  4R42 A;  2IY4 A;  5HQO A;  4LQJ A;  1UMN A;  2RBD A;  3ES3 A;  1RCC A;  3SE1 A;  1JRE A;  5LG8 A;  1TJO A;  5J8W A;  3EGM A;  3IS8 A;  3KA9 A;  4XKT A;  4DE6 A;  3F32 A;  1QYB A;  2YJJ A;  5FEJ A;  1YV1 A;  2IB0 A;  1LKO A;  3E2C A;  4ML5 A;  4TOH A;  3OGH A;  4ZL6 A;  3FRR A;  4PGI A;  4ERU A;  3JZA B;  3RGD A;  4WJG 4;  4TOF A;  5LS9 A;  1AEW A;  2YW7 A;  3C23 A;  3KX9 A;  2WLA A;  5FFD A;  5GU2 X;  3E1P A;  1F33 A;  4PG1 A;  4A25 A;  3E1Q A;  3W54 A;  2F7N A;  3DBY A;  2YJK A;  3U90 A;  1JIG A;  1S3Q A;  4TOA A;  3AJQ A;  1YUX A;  1MOJ A;  3PVT A;  3WVW A;  4LQV A;  4TOE A;  5HJH A;  3QHC A;  2BW1 A;  3BKN A;  2CHI A;  3IS7 A;  4CVT A;  3E1N A;  5JAC A;  5ERK A;  3MPS A;  4LPM A;  2FKZ A;  3V3K B;  4KVQ A;  4M33 A;  4CVR A;  2CEI A;  3WNW A;  1NFV A;  3KHK A;  1DVB A;  2V2N A;  4U3G A;  2ITB A;  4RC5 A;  1JKU A;  3RAV A;  3PW8 C;  4P18 A;  4RC8 A;  1RCI A;  1JI4 A;  2CLB A;  2AR0 A;  5E1U A;  4RC6 A;  2PYB A;  3ISE A;  2V2O A;  5D8S A;  4EVD A;  4LPN A;  2Z90 A;  1JGC A;  3AF8 X;  4Z3B A;  5I4J A;  1O9R A;  4M34 A;  2QQY A;  4AM4 A;  3NP2 X;  5FFB A;  2WWX B;  1DAT A;  4Y08 A;  4AM5 A;  2FFX J;  2CN7 A;  1L8I A;  3AJO A;  4YKH A;  3PVT B;  2GYQ A;  4DAS A;  5GU1 X;  4W4L B;  2VXI A;  3HIU A;  3A68 A;  3WVV A;  4CVS A;  3BVE A;  3QB9 A;  1OTK A;  1S30 A;  5E2D A;  3UFB A;  4DYZ A;  5CMR A;  4TOD A;  3QD8 A;  4MXP A;  1BG7 A;  1BFR A;  5GU3 X;  2WLU A;  4TOB A;  3UNO A;  1JKV A;  2N02 A;  4E40 A;  4ZL5 A;  5LBH A;  1SOF A;  2W0O A;  4RC5 B;  4E6K A;  5ERJ A;  1ZUJ A;  2V2J A;  3GHQ A;  3KWO A;  4RC6 B;  1N1Q A;  3AK8 A;  2Y44 A;  4AM2 A;  4EVB A;  3NOZ X;  3E1L A;  4DZ0 A;  2JD7 0;  3LKD A;  5D8X A;  2VZB A;  3A9Q A;  3UOI A;  3KA6 A;  5LG2 A;  2V2R A;  4KVR A;  4PGK A;  1S2Z A;  4ISP A;  5C6F A;  4ETR A;  2Z6M A;  2FG4 A;  2YW6 A;  2ZA7 A;  4YXJ A;  4XKS A;  3PW8 A;  2Z5R A;  2FG8 A;  2C41 A;  4XGS A;  3F38 A;  5GN8 A;  3GVY A;  4LYU A; 
#chains in the Genus database with same CATH homology
 2BJY A;  3BVI A;  3QHB A;  1NF6 A;  5GOU A;  3TA8 A;  1KRQ A;  3KXU A;  3O7S A;  4TOG A;  5J9V A;  3Q4O A;  4PG0 A;  1VJX A;  2JD6 0;  4ZJK A;  3EZ0 A;  3PW1 A;  3L0M A;  1RCE A;  4IWK A;  4Z5S A;  2HTN A;  3KA3 A;  2ZA6 A;  5D8Y A;  5HJF A;  2Y3Q A;  1IER A;  5JDO A;  2OKC A;  4IWJ A;  3F39 A;  3HL1 A;  3QZ3 A;  5FFA A;  3Q4Q A;  3FVB A;  3BVF A;  2FZF A;  1NF4 A;  1VEI A;  2V2L A;  4DYX A;  4RC7 A;  3JZ9 A;  3Q4R A;  4MJY A;  4KXR B;  3F37 A;  3GE4 A;  1VEL A;  3PZA A;  4ISM A;  3NP0 X;  2XKQ A;  2V2M A;  1JYB A;  3VV9 A;  5CZU A;  1ZS3 A;  2Z5Q A;  3FSE A;  4ZKW A;  4EVC A;  2X17 0;  5GN8 B;  2VXX A;  3BVK A;  3Q4N A;  2BKC A;  3BT5 A;  3OJ5 A;  3M6J A;  3SH6 A;  4ZLW A;  5CMQ A;  2CLU A;  4TOC A;  3EZU A;  4CMY V;  3BVL A;  2FL0 A;  3AK9 A;  2BK6 A;  3F35 A;  1LKP A;  5K52 A;  3RBC A;  3H7G A;  2CHP A;  3C21 A;  5D8O A;  4EVE A;  5HU6 D;  5JDO B;  3PWQ C;  3R2S A;  5JKM G;  2WTL A;  2C2F A;  2C2J A;  3KA4 A;  5D8R A;  5D8Q A;  2XJM A;  5JKM A;  5GU0 X;  2Z5P A;  3VNX A;  2XJN A;  4MN9 A;  4CMY A;  3FI6 A;  3FRS A;  3GGZ A;  2ZG8 X;  4DYY A;  4W4K B;  2XJO A;  2UX1 A;  4II4 A;  2GS4 A;  4IXK A;  2D5K A;  1DPS A;  1HRS A;  5IX6 A;  4MY7 A;  2CIH A;  2G38 B;  2CWL A;  1BCF A;  1JI5 A;  2GYD A;  3PVY A;  1IES A;  4ZKH A;  4ITT A;  1YUZ A;  2G4H A;  1LKM A;  4ZMC A;  1EUM A;  4LQN A;  3R2O A;  4LYX A;  3PVR A;  4M35 A;  4CY9 A;  4X0J A;  3RE7 A;  2OC5 A;  5FFC A;  3AF9 X;  4KVS A;  3C1Y A;  4LPJ A;  5K53 A;  3SID A;  2OH3 A;  3R2R A;  4YVZ A;  1GWG A;  4LQH A;  3F34 A;  3KA8 A;  2V8T A;  5D8P A;  5JKL G;  4ZKX A;  1B71 A;  4OYN A;  1Z6O A;  5JKL A;  3R2H A;  4II4 B;  4XKU A;  3E6S A;  2JD8 0;  3D19 A;  3C1Z A;  1O9I A;  2ZG7 X;  3PWQ A;  3O7R A;  3IQ1 A;  1TK6 A;  2ZUR X;  3RD0 A;  4ITW A;  2FHA A;  2C2U A;  3E1M A;  3T9J A;  3ISF A;  5FFE A;  1TKO A;  3PVY B;  4CVP A;  3N6O A;  3ERZ A;  4QUW A;  2ZA8 A;  4M32 A;  3UOF A;  4REU A;  4ZTT A;  1RCG A;  3R2L A;  1XZ3 A;  3PVR B;  1JTS A;  4DYU A;  5J8S A;  3F36 A;  1LB3 A;  3KDQ A;  1RYT A;  3E1O A;  5AXS A;  1Z6O M;  2XGW A;  1SQ3 A;  3VVA A;  3GGY A;  3QVD A;  3PWF A;  4CYB A;  2V8U A;  2QF9 A;  4MUD A;  4TO9 A;  3E6R A;  3SHX A;  3R2K A;  3E1J A;  1XZ1 A;  3PW1 B;  3R2M A;  3F33 A;  2CF7 A;  1UVH A;  1VLG A;  2V2I A;  4TW3 A;  3WVU A;  1QGH A;  1TKP A;  2C6R A;  2CN6 A;  1MFR A;  5J93 A;  4RC7 B;  3AF7 X;  1NNQ A;  3AJP A;  1FHA A;  2FJC A;  2HR5 A;  1Z4A A;  1L8H A;  1F30 A;  2V2P A;  1R03 A;  2V2S A;  4CYA A;  1RCD A;  4DI0 A;  1H96 A;  1VEQ A;  4MKU A;  1J30 A;  2ZG9 X;  4YXM A;  2V15 A;  2IU2 A;  2MGY A;  4R42 A;  2IY4 A;  5HQO A;  4LQJ A;  1UMN A;  2RBD A;  3ES3 A;  1RCC A;  3SE1 A;  1JRE A;  5LG8 A;  1TJO A;  5J8W A;  3EGM A;  3IS8 A;  3KA9 A;  4XKT A;  4DE6 A;  3F32 A;  1QYB A;  2YJJ A;  5FEJ A;  1YV1 A;  2IB0 A;  1LKO A;  3E2C A;  4ML5 A;  4TOH A;  3OGH A;  4ZL6 A;  3FRR A;  4PGI A;  4ERU A;  3JZA B;  3RGD A;  4WJG 4;  4TOF A;  5LS9 A;  1AEW A;  2YW7 A;  3C23 A;  3KX9 A;  2WLA A;  5FFD A;  5GU2 X;  3E1P A;  1F33 A;  4PG1 A;  4A25 A;  3E1Q A;  3W54 A;  2F7N A;  3DBY A;  2YJK A;  3U90 A;  1JIG A;  1S3Q A;  4TOA A;  3AJQ A;  1YUX A;  1MOJ A;  3PVT A;  3WVW A;  4LQV A;  4TOE A;  5HJH A;  3QHC A;  2BW1 A;  3BKN A;  2CHI A;  3IS7 A;  4CVT A;  3E1N A;  5JAC A;  5ERK A;  3MPS A;  4LPM A;  2FKZ A;  3V3K B;  4KVQ A;  4M33 A;  4CVR A;  2CEI A;  3WNW A;  1NFV A;  3KHK A;  1DVB A;  2V2N A;  4U3G A;  2ITB A;  4RC5 A;  1JKU A;  3RAV A;  3PW8 C;  4P18 A;  4RC8 A;  1RCI A;  1JI4 A;  2CLB A;  2AR0 A;  5E1U A;  4RC6 A;  2PYB A;  3ISE A;  2V2O A;  5D8S A;  4EVD A;  4LPN A;  2Z90 A;  1JGC A;  3AF8 X;  4Z3B A;  5I4J A;  1O9R A;  4M34 A;  2QQY A;  4AM4 A;  3NP2 X;  5FFB A;  2WWX B;  1DAT A;  4Y08 A;  4AM5 A;  2FFX J;  2CN7 A;  1L8I A;  3AJO A;  4YKH A;  3PVT B;  2GYQ A;  4DAS A;  5GU1 X;  4W4L B;  2VXI A;  3HIU A;  3A68 A;  3WVV A;  4CVS A;  3BVE A;  3QB9 A;  1OTK A;  1S30 A;  5E2D A;  3UFB A;  4DYZ A;  5CMR A;  4TOD A;  3QD8 A;  4MXP A;  1BG7 A;  1BFR A;  5GU3 X;  2WLU A;  4TOB A;  3UNO A;  1JKV A;  2N02 A;  4E40 A;  4ZL5 A;  5LBH A;  1SOF A;  2W0O A;  4RC5 B;  4E6K A;  5ERJ A;  1ZUJ A;  2V2J A;  3GHQ A;  3KWO A;  4RC6 B;  1N1Q A;  3AK8 A;  2Y44 A;  4AM2 A;  4EVB A;  3NOZ X;  3E1L A;  4DZ0 A;  2JD7 0;  3LKD A;  5D8X A;  2VZB A;  3A9Q A;  3UOI A;  3KA6 A;  5LG2 A;  2V2R A;  4KVR A;  4PGK A;  1S2Z A;  4ISP A;  5C6F A;  4ETR A;  2Z6M A;  2FG4 A;  2YW6 A;  2ZA7 A;  4YXJ A;  4XKS A;  3PW8 A;  2Z5R A;  2FG8 A;  2C41 A;  4XGS A;  3F38 A;  5GN8 A;  3GVY A;  4LYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...