4II4B

The phenylacetyl-coa monooxygenase - mutant paaa e49q k68q - paac wild type subcomplex with benzoyl-coa
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
239
structure length
239
Chain Sequence
b'SNQLTAYTLRLGDNCLVLSQRLGEWCGHAPELEIDLALANIGLDLLGQARNFLSYAAELAGEGDEDTLAFTRDERQFSNLLLVEQPNGNFADTIARQYFIDAWHVALFTRLMESRDPQLAAISAKAIKEARYHLRFSRGWLERLGNGTDVSGQKMQQAINKLWRFTAELFDADEIDIALSEEGIAVDPRTLRAAWEAEVFAGINEATLNVPQEQAYRTGGKKGLHTEHLGPMLAEMQYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1,2-phenylacetyl-CoA epoxidase, subunit A
publication title Spatial Organization of Subunits within the Phenylacetyl-CoA Monooxygenase Complex
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 97
structure length 239
sequence length 239
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4ii4B00
3E6SA 3PWQA 3O7SA 3T9JA 3H7GA 1L8IA 3F36A 3E1NA 4KVRA 3KX9A 1VEQA 3A9QA 2V2IA 4LQNA 4TO9A 1TK6A 1Z6OA 4TOBA 2QQYA 1JI5A 3UNOA 1MOJA 3BVIA 3VNXA 2CEIA 4ETRA 2C2FA 3ISFA 2IB0A 2BKCA 2ZG8X 3F39A 2ZA7A 3AK8A 3A68A 2FHAA 5GU0X 2BW1A 2CF7A 4EVBA 5I4JA 1RCIA 4CYAA 3FSEA 4MY7A 1BFRA 1TKOA 1O9RA 3BT5A 5JKMA 4P18A 4ZLWA 3ISEA 4LYUA 4Z5SA 1LKMA 1YV1A 1S3QA 2JD60 4DE6A 1ZUJA 2Z6MA 3KA6A 4IXKA 4KVSA 1VEIA 1Z6OM 4PG1A 5J8WA 3WVWA 4U3GA 2FJCA 2F7NA 2X170 3Q4QA 3R2LA 5D8OA 4XGSA 2ZA6A 2UX1A 5GU1X 1DPSA 3HL1A 2YW7A 5AXSA 3EGMA 3QHCA 4MJYA 1S2ZA 3KA8A 3E1MA 2V2MA 4ZL6A 1DVBA 3RGDA 2OC5A 4LPNA 4CMYA 3TA8A 5E2DA 2BK6A 1RCDA 4ISMA 3F38A 4ML5A 4II4B 3R2MA 3EZ0A 4II4A 2QF9A 5C6FA 4ZL5A 4ITWA 4TOFA 5LG8A 3KXUA 3R2KA 4TOCA 5D8PA 1J30A 3BVEA 3BKNA 4LQHA 4TODA 3OGHA 3AK9A 1EUMA 4XKSA 3GE4A 1GWGA 1KRQA 5FFDA 1QGHA 4ZJKA 2G4HA 1YUZA 3IQ1A 2V15A 5E1UA 2Z90A 3WVVA 2CHPA 1RCEA 1VELA 4DYXA 5J8SA 4DASA 4CVRA 5FFEA 1RYTA 2ZG7X 4REUA 4AM5A 2ZURX 3KA4A 4R42A 1S30A 2FG8A 4RC8A 3R2SA 1NF6A 2ZG9X 2BJYA 2IY4A 2YJJA 1IESA 4A25A 3F34A 3GVYA 4Y08A 3KA3A 2FKZA 5IX6A 3E2CA 1TKPA 4PGKA 4TW3A 2ITBA 2XGWA 1BCFA 1O9IA 4CMYV 1RCGA 4LQJA 1JTSA 2Z5PA 4DYUA 4ITTA 3PW8C 2Z5RA 3AF7X 5LS9A 1JI4A 2HR5A 3PWFA 5K53A 5HJHA 3KA9A 3E1JA 2FL0A 5GOUA 4XKUA 1VJXA 2Z5QA 5LG2A 3F35A 5D8QA 3R2RA 1TJOA 4PG0A 3BVKA 2GS4A 4CVSA 2FG4A 3PWQC 1BG7A 5GU3X 3E1LA 4AM2A 2WLAA 2PYBA 1R03A 2W0OA 1VLGA 1H96A 2YW6A 4CYBA 4EVEA 2JD80 3MPSA 1JIGA 3PW1B 1XZ1A 3GHQA 3NP0X 3AF9X 1NNQA 2JD70 1UVHA 2FZFA 5J9VA 3SHXA 2CIHA 3AJQA 3SIDA 2D5KA 4RC6B 4RC6A 2V2JA 1L8HA 3QZ3A 1JKVA 3EZUA 3O7RA 3PVYB 4MKUA 4ZKXA 2XKQA 2XJOA 4AM4A 2V2OA 4MUDA 1MFRA 3AJOA 4CY9A 2YJKA 4CVPA 3Q4NA 3QD8A 2VXXA 4PGIA 1B71A 4M33A 2CLBA 5JACA 3UOIA 4ISPA 3NP2X 4CVTA 3QB9A 1JYBA 1AEWA 4M34A 2IU2A 3UOFA 2HTNA 2FFXJ 3SE1A 2CLUA 4TOGA 4DZ0A 1DATA 5ERJA 4TOHA 4DYYA 4LYXA 3RD0A 4ZKWA 5LBHA 3RE7A 4ZTTA 5FFCA 4OYNA 4RC5B 2WLUA 4RC5A 4TOEA 1JREA 1QYBA 2C41A 4DI0A 2XJMA 4TOAA 1SOFA 2V2PA 4ZMCA 3OJ5A 5JKMG 4KVQA 5CZUA 1RCCA 1HRSA 5D8YA 4LQVA 3BVLA 2Y3QA 3WNWA 5JKLG 4LPJA 3BVFA 1JKUA 3F37A 2ZA8A 3QVDA 4RC7B 4RC7A 5GN8B 3E1QA 3Q4RA 5GN8A 4EVDA 2C6RA 3U90A 3AJPA 1Z4AA 1SQ3A 5CMRA 1YUXA 3NOZX 2V2NA 3E1PA 3IS8A 4QUWA 5JKLA 2GYQA 2VZBA 5HJFA 1UMNA 3RAVA 4YKHA 4IWJA 2V2SA 4EVCA 5HQOA 5CMQA 1NFVA 3FVBA 3R2OA 1LKPA 3IS7A 4DYZA 5D8RA 1F30A 3PVRB 3F33A 1ZS3A 2CN7A 3PVRA 2RBDA 2CHIA 3KWOA 1IERA 5ERKA 3ERZA 3PW1A 5FFAA 1FHAA 3ES3A 1JGCA 5FFBA 4ZKHA 5D8XA 1F33A 3AF8X 3Q4OA 3WVUA 1LB3A 1LKOA 2GYDA 3PVYA 1N1QA 3QHBA 4Z3BA 3SH6A 5D8SA 2VXIA 2WTLA 3R2HA 1OTKA 4M32A 3HIUA 5J93A 2OH3A 3PW8A 2CN6A 3FI6A 3RBCA 2V2RA 4XKTA 3F32A 4LPMA 4E6KA 1XZ3A 2XJNA 4MN9A 4ERUA 3PZAA 2C2JA 5GU2X 4IWKA 5K52A 5FEJA 3E1OA 3PVTB 3PVTA 4M35A 1NF4A 2C2UA 2V2LA 3E6RA
chains in the Genus database with same CATH superfamily
3VV9A 3E6SA 3PWQA 3O7SA 3T9JA 3H7GA 1L8IA 3F36A 3E1NA 4KVRA 3KX9A 1VEQA 3A9QA 4E40A 2V2IA 4LQNA 4TO9A 1TK6A 1Z6OA 4TOBA 2QQYA 1JI5A 3UNOA 1MOJA 3BVIA 3VNXA 2CEIA 4ETRA 2C2FA 3ISFA 2IB0A 2BKCA 2ZG8X 3F39A 2ZA7A 3AK8A 3A68A 2FHAA 5GU0X 2BW1A 2CF7A 4EVBA 2AR0A 5I4JA 1RCIA 4CYAA 3FSEA 4MY7A 1BFRA 1TKOA 1O9RA 3BT5A 5JKMA 4P18A 4ZLWA 3ISEA 4LYUA 4Z5SA 1LKMA 1YV1A 1S3QA 2JD60 4DE6A 1ZUJA 2Z6MA 3KA6A 4IXKA 4KVSA 1VEIA 1Z6OM 3C1YA 4PG1A 5J8WA 3LKDA 3WVWA 4U3GA 2FJCA 2F7NA 2X170 3Q4QA 3R2LA 5D8OA 4XGSA 2ZA6A 5JDOA 2UX1A 5GU1X 1DPSA 3HL1A 2YW7A 3DBYA 5AXSA 3EGMA 3QHCA 4MJYA 1S2ZA 3KA8A 3E1MA 2V2MA 4ZL6A 1DVBA 3C21A 3RGDA 2OC5A 4LPNA 4CMYA 3TA8A 5E2DA 2BK6A 1RCDA 4ISMA 3F38A 4ML5A 4II4B 3R2MA 3EZ0A 4II4A 2QF9A 3N6OA 5C6FA 4ZL5A 4ITWA 4TOFA 5LG8A 3KXUA 3R2KA 4TOCA 5D8PA 3GGZA 1J30A 3BVEA 3BKNA 4LQHA 4TODA 3OGHA 3AK9A 1EUMA 4XKSA 3GE4A 3JZAB 1GWGA 1KRQA 5FFDA 1QGHA 4ZJKA 2G4HA 1YUZA 3IQ1A 2V15A 5E1UA 2Z90A 3WVVA 2CHPA 5HU6D 1RCEA 1VELA 4DYXA 5J8SA 4DASA 4CVRA 3FRRA 5FFEA 1RYTA 2ZG7X 4REUA 4AM5A 2ZURX 3KA4A 4R42A 1S30A 2FG8A 4YXJA 3W54A 4RC8A 2WWXB 3R2SA 1NF6A 2ZG9X 4W4KB 2BJYA 2IY4A 2YJJA 1IESA 4A25A 3F34A 3GVYA 4Y08A 3KA3A 2FKZA 5IX6A 3E2CA 1TKPA 4PGKA 4TW3A 2ITBA 2XGWA 1BCFA 1O9IA 4CMYV 1RCGA 4LQJA 1JTSA 2Z5PA 4DYUA 4ITTA 3PW8C 2Z5RA 3AF7X 5LS9A 1JI4A 2HR5A 3PWFA 5K53A 5HJHA 3M6JA 3KA9A 3E1JA 2FL0A 3KHKA 5GOUA 4XKUA 1VJXA 2Z5QA 5LG2A 3F35A 5D8QA 3R2RA 1TJOA 4PG0A 3BVKA 2GS4A 4CVSA 2FG4A 3PWQC 4YVZA 1BG7A 5GU3X 3E1LA 4AM2A 2WLAA 2PYBA 1R03A 2W0OA 1VLGA 1H96A 2YW6A 4CYBA 2OKCA 4EVEA 2JD80 3MPSA 3L0MA 1JIGA 3PW1B 1XZ1A 3GHQA 3NP0X 3AF9X 1NNQA 2JD70 1UVHA 2FZFA 4KXRB 5J9VA 3V3KB 3SHXA 3UFBA 2CIHA 3AJQA 3SIDA 2D5KA 4RC6B 4RC6A 2V2JA 1L8HA 3QZ3A 1JKVA 3EZUA 3O7RA 3PVYB 4MKUA 4ZKXA 2XKQA 2XJOA 4AM4A 2V2OA 4MUDA 1MFRA 3AJOA 4CY9A 2YJKA 4CVPA 3Q4NA 3QD8A 2VXXA 4PGIA 1B71A 4M33A 2CLBA 3C23A 5JACA 3C1ZA 3UOIA 4ISPA 3NP2X 4CVTA 3QB9A 1JYBA 1AEWA 4M34A 4YXMA 2IU2A 3UOFA 2HTNA 2FFXJ 3SE1A 2CLUA 4TOGA 4WJG4 4DZ0A 3D19A 1DATA 5ERJA 4TOHA 4DYYA 4LYXA 3RD0A 4ZKWA 5LBHA 3RE7A 4ZTTA 5FFCA 4OYNA 2Y44A 4RC5B 2WLUA 4RC5A 4TOEA 1JREA 1QYBA 2C41A 4DI0A 2XJMA 4TOAA 1SOFA 2V2PA 4ZMCA 3OJ5A 5JKMG 3FRSA 4KVQA 5CZUA 1RCCA 1HRSA 5D8YA 2Y3QA 3BVLA 4LQVA 3WNWA 5JKLG 4LPJA 3BVFA 3VVAA 2MGYA 1JKUA 3F37A 2ZA8A 3QVDA 4RC7B 4RC7A 3JZ9A 3E1QA 3Q4RA 5GN8B 5GN8A 4EVDA 4MXPA 2C6RA 3U90A 3AJPA 1Z4AA 1SQ3A 5CMRA 1YUXA 3NOZX 2V2NA 3E1PA 3IS8A 4QUWA 5JKLA 2GYQA 2VZBA 5HJFA 1UMNA 3RAVA 4YKHA 2N02A 4IWJA 2V2SA 4EVCA 2V8UA 5HQOA 5CMQA 1NFVA 3FVBA 3R2OA 1LKPA 3IS7A 4DYZA 5D8RA 1F30A 3PVRB 3F33A 1ZS3A 2CN7A 3PVRA 2V8TA 2RBDA 2CHIA 3KWOA 1IERA 5ERKA 3ERZA 3PW1A 5FFAA 1FHAA 5JDOB 3KDQA 3ES3A 1JGCA 2CWLA 4ZKHA 3GGYA 4W4LB 5FFBA 5D8XA 1F33A 3AF8X 3Q4OA 3WVUA 1LB3A 1LKOA 2GYDA 3PVYA 1N1QA 3QHBA 4Z3BA 3SH6A 5D8SA 2VXIA 2WTLA 3R2HA 1OTKA 4M32A 3HIUA 5J93A 2OH3A 3PW8A 2CN6A 3FI6A 3RBCA 2V2RA 4XKTA 3F32A 2G38B 4LPMA 4E6KA 4X0JA 1XZ3A 2XJNA 4MN9A 4ERUA 3PZAA 2C2JA 5GU2X 4IWKA 5K52A 5FEJA 3E1OA 3PVTB 3PVTA 4M35A 1NF4A 2C2UA 2V2LA 3E6RA
chains in the Genus database with same CATH topology
3VV9A 3E6SA 3PWQA 3O7SA 3T9JA 3H7GA 1L8IA 3F36A 3E1NA 4KVRA 3KX9A 1VEQA 3A9QA 4E40A 2V2IA 4LQNA 4TO9A 1TK6A 1Z6OA 4TOBA 2QQYA 1JI5A 3UNOA 1MOJA 3BVIA 3VNXA 2CEIA 4ETRA 2C2FA 3ISFA 2IB0A 2BKCA 2ZG8X 3F39A 2ZA7A 3AK8A 3A68A 2FHAA 5GU0X 2BW1A 2CF7A 4EVBA 2AR0A 5I4JA 1RCIA 4CYAA 3FSEA 4MY7A 1BFRA 1TKOA 1O9RA 3BT5A 5JKMA 4P18A 4ZLWA 3ISEA 4LYUA 4Z5SA 1LKMA 1YV1A 1S3QA 2JD60 4DE6A 1ZUJA 2Z6MA 3KA6A 4IXKA 4KVSA 1VEIA 1Z6OM 3C1YA 4PG1A 5J8WA 3LKDA 3WVWA 4U3GA 2FJCA 2F7NA 2X170 3Q4QA 3R2LA 5D8OA 4XGSA 2ZA6A 5JDOA 2UX1A 5GU1X 1DPSA 3HL1A 2YW7A 3DBYA 5AXSA 3EGMA 3QHCA 4MJYA 1S2ZA 3KA8A 3E1MA 2V2MA 4ZL6A 1DVBA 3C21A 3RGDA 2OC5A 4LPNA 4CMYA 3TA8A 5E2DA 2BK6A 1RCDA 4ISMA 3F38A 4ML5A 4II4B 3R2MA 3EZ0A 4II4A 2QF9A 3N6OA 5C6FA 4ZL5A 4ITWA 4TOFA 5LG8A 3KXUA 3R2KA 4TOCA 5D8PA 3GGZA 1J30A 3BVEA 3BKNA 4LQHA 4TODA 3OGHA 3AK9A 1EUMA 4XKSA 3GE4A 3JZAB 1GWGA 1KRQA 5FFDA 1QGHA 4ZJKA 2G4HA 1YUZA 3IQ1A 2V15A 5E1UA 2Z90A 3WVVA 2CHPA 5HU6D 1RCEA 1VELA 4DYXA 5J8SA 4DASA 4CVRA 3FRRA 5FFEA 1RYTA 2ZG7X 4REUA 4AM5A 2ZURX 3KA4A 4R42A 1S30A 2FG8A 4YXJA 3W54A 4RC8A 2WWXB 3R2SA 1NF6A 2ZG9X 4W4KB 2BJYA 2IY4A 2YJJA 1IESA 4A25A 3F34A 3GVYA 4Y08A 3KA3A 2FKZA 5IX6A 3E2CA 1TKPA 4PGKA 4TW3A 2ITBA 2XGWA 1BCFA 1O9IA 4CMYV 1RCGA 4LQJA 1JTSA 2Z5PA 4DYUA 4ITTA 3PW8C 2Z5RA 3AF7X 5LS9A 1JI4A 2HR5A 3PWFA 5K53A 5HJHA 3M6JA 3KA9A 3E1JA 2FL0A 3KHKA 5GOUA 4XKUA 1VJXA 2Z5QA 5LG2A 3F35A 5D8QA 3R2RA 1TJOA 4PG0A 3BVKA 2GS4A 4CVSA 2FG4A 3PWQC 4YVZA 1BG7A 5GU3X 3E1LA 4AM2A 2WLAA 2PYBA 1R03A 2W0OA 1VLGA 1H96A 2YW6A 4CYBA 2OKCA 4EVEA 2JD80 3MPSA 3L0MA 1JIGA 3PW1B 1XZ1A 3GHQA 3NP0X 3AF9X 1NNQA 2JD70 1UVHA 2FZFA 4KXRB 5J9VA 3V3KB 3SHXA 3UFBA 2CIHA 3AJQA 3SIDA 2D5KA 4RC6B 4RC6A 2V2JA 1L8HA 3QZ3A 1JKVA 3EZUA 3O7RA 3PVYB 4MKUA 4ZKXA 2XKQA 2XJOA 4AM4A 2V2OA 4MUDA 1MFRA 3AJOA 4CY9A 2YJKA 4CVPA 3Q4NA 3QD8A 2VXXA 4PGIA 1B71A 4M33A 2CLBA 3C23A 5JACA 3C1ZA 3UOIA 4ISPA 3NP2X 4CVTA 3QB9A 1JYBA 1AEWA 4M34A 4YXMA 2IU2A 3UOFA 2HTNA 2FFXJ 3SE1A 2CLUA 4TOGA 4WJG4 4DZ0A 3D19A 1DATA 5ERJA 4TOHA 4DYYA 4LYXA 3RD0A 4ZKWA 5LBHA 3RE7A 4ZTTA 5FFCA 4OYNA 2Y44A 4RC5B 2WLUA 4RC5A 4TOEA 1JREA 1QYBA 2C41A 4DI0A 2XJMA 4TOAA 1SOFA 2V2PA 4ZMCA 3OJ5A 5JKMG 3FRSA 4KVQA 5CZUA 1RCCA 1HRSA 5D8YA 2Y3QA 3BVLA 4LQVA 3WNWA 5JKLG 4LPJA 3BVFA 3VVAA 2MGYA 1JKUA 3F37A 2ZA8A 3QVDA 4RC7B 4RC7A 3JZ9A 3E1QA 3Q4RA 5GN8B 5GN8A 4EVDA 4MXPA 2C6RA 3U90A 3AJPA 1Z4AA 1SQ3A 5CMRA 1YUXA 3NOZX 2V2NA 3E1PA 3IS8A 4QUWA 5JKLA 2GYQA 2VZBA 5HJFA 1UMNA 3RAVA 4YKHA 2N02A 4IWJA 2V2SA 4EVCA 2V8UA 5HQOA 5CMQA 1NFVA 3FVBA 3R2OA 1LKPA 3IS7A 4DYZA 5D8RA 1F30A 3PVRB 3F33A 1ZS3A 2CN7A 3PVRA 2V8TA 2RBDA 2CHIA 3KWOA 1IERA 5ERKA 3ERZA 3PW1A 5FFAA 1FHAA 5JDOB 3KDQA 3ES3A 1JGCA 2CWLA 4ZKHA 3GGYA 4W4LB 5FFBA 5D8XA 1F33A 3AF8X 3Q4OA 3WVUA 1LB3A 1LKOA 2GYDA 3PVYA 1N1QA 3QHBA 4Z3BA 3SH6A 5D8SA 2VXIA 2WTLA 3R2HA 1OTKA 4M32A 3HIUA 5J93A 2OH3A 3PW8A 2CN6A 3FI6A 3RBCA 2V2RA 4XKTA 3F32A 2G38B 4LPMA 4E6KA 4X0JA 1XZ3A 2XJNA 4MN9A 4ERUA 3PZAA 2C2JA 5GU2X 4IWKA 5K52A 5FEJA 3E1OA 3PVTB 3PVTA 4M35A 1NF4A 2C2UA 2V2LA 3E6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E6S A;  3PWQ A;  3O7S A;  3T9J A;  3H7G A;  1L8I A;  3F36 A;  3E1N A;  4KVR A;  3KX9 A;  1VEQ A;  3A9Q A;  2V2I A;  4LQN A;  4TO9 A;  1TK6 A;  1Z6O A;  4TOB A;  2QQY A;  1JI5 A;  3UNO A;  1MOJ A;  3BVI A;  3VNX A;  2CEI A;  4ETR A;  2C2F A;  3ISF A;  2IB0 A;  2BKC A;  2ZG8 X;  3F39 A;  2ZA7 A;  3AK8 A;  3A68 A;  2FHA A;  5GU0 X;  2BW1 A;  2CF7 A;  4EVB A;  5I4J A;  1RCI A;  4CYA A;  3FSE A;  4MY7 A;  1BFR A;  1TKO A;  1O9R A;  3BT5 A;  5JKM A;  4P18 A;  4ZLW A;  3ISE A;  4LYU A;  4Z5S A;  1LKM A;  1YV1 A;  1S3Q A;  2JD6 0;  4DE6 A;  1ZUJ A;  2Z6M A;  3KA6 A;  4IXK A;  4KVS A;  1VEI A;  1Z6O M;  4PG1 A;  5J8W A;  3WVW A;  4U3G A;  2FJC A;  2F7N A;  2X17 0;  3Q4Q A;  3R2L A;  5D8O A;  4XGS A;  2ZA6 A;  2UX1 A;  5GU1 X;  1DPS A;  3HL1 A;  2YW7 A;  5AXS A;  3EGM A;  3QHC A;  4MJY A;  1S2Z A;  3KA8 A;  3E1M A;  2V2M A;  4ZL6 A;  1DVB A;  3RGD A;  2OC5 A;  4LPN A;  4CMY A;  3TA8 A;  5E2D A;  2BK6 A;  1RCD A;  4ISM A;  3F38 A;  4ML5 A;  4II4 B;  3R2M A;  3EZ0 A;  4II4 A;  2QF9 A;  5C6F A;  4ZL5 A;  4ITW A;  4TOF A;  5LG8 A;  3KXU A;  3R2K A;  4TOC A;  5D8P A;  1J30 A;  3BVE A;  3BKN A;  4LQH A;  4TOD A;  3OGH A;  3AK9 A;  1EUM A;  4XKS A;  3GE4 A;  1GWG A;  1KRQ A;  5FFD A;  1QGH A;  4ZJK A;  2G4H A;  1YUZ A;  3IQ1 A;  2V15 A;  5E1U A;  2Z90 A;  3WVV A;  2CHP A;  1RCE A;  1VEL A;  4DYX A;  5J8S A;  4DAS A;  4CVR A;  5FFE A;  1RYT A;  2ZG7 X;  4REU A;  4AM5 A;  2ZUR X;  3KA4 A;  4R42 A;  1S30 A;  2FG8 A;  4RC8 A;  3R2S A;  1NF6 A;  2ZG9 X;  2BJY A;  2IY4 A;  2YJJ A;  1IES A;  4A25 A;  3F34 A;  3GVY A;  4Y08 A;  3KA3 A;  2FKZ A;  5IX6 A;  3E2C A;  1TKP A;  4PGK A;  4TW3 A;  2ITB A;  2XGW A;  1BCF A;  1O9I A;  4CMY V;  1RCG A;  4LQJ A;  1JTS A;  2Z5P A;  4DYU A;  4ITT A;  3PW8 C;  2Z5R A;  3AF7 X;  5LS9 A;  1JI4 A;  2HR5 A;  3PWF A;  5K53 A;  5HJH A;  3KA9 A;  3E1J A;  2FL0 A;  5GOU A;  4XKU A;  1VJX A;  2Z5Q A;  5LG2 A;  3F35 A;  5D8Q A;  3R2R A;  1TJO A;  4PG0 A;  3BVK A;  2GS4 A;  4CVS A;  2FG4 A;  3PWQ C;  1BG7 A;  5GU3 X;  3E1L A;  4AM2 A;  2WLA A;  2PYB A;  1R03 A;  2W0O A;  1VLG A;  1H96 A;  2YW6 A;  4CYB A;  4EVE A;  2JD8 0;  3MPS A;  1JIG A;  3PW1 B;  1XZ1 A;  3GHQ A;  3NP0 X;  3AF9 X;  1NNQ A;  2JD7 0;  1UVH A;  2FZF A;  5J9V A;  3SHX A;  2CIH A;  3AJQ A;  3SID A;  2D5K A;  4RC6 B;  4RC6 A;  2V2J A;  1L8H A;  3QZ3 A;  1JKV A;  3EZU A;  3O7R A;  3PVY B;  4MKU A;  4ZKX A;  2XKQ A;  2XJO A;  4AM4 A;  2V2O A;  4MUD A;  1MFR A;  3AJO A;  4CY9 A;  2YJK A;  4CVP A;  3Q4N A;  3QD8 A;  2VXX A;  4PGI A;  1B71 A;  4M33 A;  2CLB A;  5JAC A;  3UOI A;  4ISP A;  3NP2 X;  4CVT A;  3QB9 A;  1JYB A;  1AEW A;  4M34 A;  2IU2 A;  3UOF A;  2HTN A;  2FFX J;  3SE1 A;  2CLU A;  4TOG A;  4DZ0 A;  1DAT A;  5ERJ A;  4TOH A;  4DYY A;  4LYX A;  3RD0 A;  4ZKW A;  5LBH A;  3RE7 A;  4ZTT A;  5FFC A;  4OYN A;  4RC5 B;  2WLU A;  4RC5 A;  4TOE A;  1JRE A;  1QYB A;  2C41 A;  4DI0 A;  2XJM A;  4TOA A;  1SOF A;  2V2P A;  4ZMC A;  3OJ5 A;  5JKM G;  4KVQ A;  5CZU A;  1RCC A;  1HRS A;  5D8Y A;  4LQV A;  3BVL A;  2Y3Q A;  3WNW A;  5JKL G;  4LPJ A;  3BVF A;  1JKU A;  3F37 A;  2ZA8 A;  3QVD A;  4RC7 B;  4RC7 A;  5GN8 B;  3E1Q A;  3Q4R A;  5GN8 A;  4EVD A;  2C6R A;  3U90 A;  3AJP A;  1Z4A A;  1SQ3 A;  5CMR A;  1YUX A;  3NOZ X;  2V2N A;  3E1P A;  3IS8 A;  4QUW A;  5JKL A;  2GYQ A;  2VZB A;  5HJF A;  1UMN A;  3RAV A;  4YKH A;  4IWJ A;  2V2S A;  4EVC A;  5HQO A;  5CMQ A;  1NFV A;  3FVB A;  3R2O A;  1LKP A;  3IS7 A;  4DYZ A;  5D8R A;  1F30 A;  3PVR B;  3F33 A;  1ZS3 A;  2CN7 A;  3PVR A;  2RBD A;  2CHI A;  3KWO A;  1IER A;  5ERK A;  3ERZ A;  3PW1 A;  5FFA A;  1FHA A;  3ES3 A;  1JGC A;  5FFB A;  4ZKH A;  5D8X A;  1F33 A;  3AF8 X;  3Q4O A;  3WVU A;  1LB3 A;  1LKO A;  2GYD A;  3PVY A;  1N1Q A;  3QHB A;  4Z3B A;  3SH6 A;  5D8S A;  2VXI A;  2WTL A;  3R2H A;  1OTK A;  4M32 A;  3HIU A;  5J93 A;  2OH3 A;  3PW8 A;  2CN6 A;  3FI6 A;  3RBC A;  2V2R A;  4XKT A;  3F32 A;  4LPM A;  4E6K A;  1XZ3 A;  2XJN A;  4MN9 A;  4ERU A;  3PZA A;  2C2J A;  5GU2 X;  4IWK A;  5K52 A;  5FEJ A;  3E1O A;  3PVT B;  3PVT A;  4M35 A;  1NF4 A;  2C2U A;  2V2L A;  3E6R A; 
#chains in the Genus database with same CATH topology
 3VV9 A;  3E6S A;  3PWQ A;  3O7S A;  3T9J A;  3H7G A;  1L8I A;  3F36 A;  3E1N A;  4KVR A;  3KX9 A;  1VEQ A;  3A9Q A;  4E40 A;  2V2I A;  4LQN A;  4TO9 A;  1TK6 A;  1Z6O A;  4TOB A;  2QQY A;  1JI5 A;  3UNO A;  1MOJ A;  3BVI A;  3VNX A;  2CEI A;  4ETR A;  2C2F A;  3ISF A;  2IB0 A;  2BKC A;  2ZG8 X;  3F39 A;  2ZA7 A;  3AK8 A;  3A68 A;  2FHA A;  5GU0 X;  2BW1 A;  2CF7 A;  4EVB A;  2AR0 A;  5I4J A;  1RCI A;  4CYA A;  3FSE A;  4MY7 A;  1BFR A;  1TKO A;  1O9R A;  3BT5 A;  5JKM A;  4P18 A;  4ZLW A;  3ISE A;  4LYU A;  4Z5S A;  1LKM A;  1YV1 A;  1S3Q A;  2JD6 0;  4DE6 A;  1ZUJ A;  2Z6M A;  3KA6 A;  4IXK A;  4KVS A;  1VEI A;  1Z6O M;  3C1Y A;  4PG1 A;  5J8W A;  3LKD A;  3WVW A;  4U3G A;  2FJC A;  2F7N A;  2X17 0;  3Q4Q A;  3R2L A;  5D8O A;  4XGS A;  2ZA6 A;  5JDO A;  2UX1 A;  5GU1 X;  1DPS A;  3HL1 A;  2YW7 A;  3DBY A;  5AXS A;  3EGM A;  3QHC A;  4MJY A;  1S2Z A;  3KA8 A;  3E1M A;  2V2M A;  4ZL6 A;  1DVB A;  3C21 A;  3RGD A;  2OC5 A;  4LPN A;  4CMY A;  3TA8 A;  5E2D A;  2BK6 A;  1RCD A;  4ISM A;  3F38 A;  4ML5 A;  4II4 B;  3R2M A;  3EZ0 A;  4II4 A;  2QF9 A;  3N6O A;  5C6F A;  4ZL5 A;  4ITW A;  4TOF A;  5LG8 A;  3KXU A;  3R2K A;  4TOC A;  5D8P A;  3GGZ A;  1J30 A;  3BVE A;  3BKN A;  4LQH A;  4TOD A;  3OGH A;  3AK9 A;  1EUM A;  4XKS A;  3GE4 A;  3JZA B;  1GWG A;  1KRQ A;  5FFD A;  1QGH A;  4ZJK A;  2G4H A;  1YUZ A;  3IQ1 A;  2V15 A;  5E1U A;  2Z90 A;  3WVV A;  2CHP A;  5HU6 D;  1RCE A;  1VEL A;  4DYX A;  5J8S A;  4DAS A;  4CVR A;  3FRR A;  5FFE A;  1RYT A;  2ZG7 X;  4REU A;  4AM5 A;  2ZUR X;  3KA4 A;  4R42 A;  1S30 A;  2FG8 A;  4YXJ A;  3W54 A;  4RC8 A;  2WWX B;  3R2S A;  1NF6 A;  2ZG9 X;  4W4K B;  2BJY A;  2IY4 A;  2YJJ A;  1IES A;  4A25 A;  3F34 A;  3GVY A;  4Y08 A;  3KA3 A;  2FKZ A;  5IX6 A;  3E2C A;  1TKP A;  4PGK A;  4TW3 A;  2ITB A;  2XGW A;  1BCF A;  1O9I A;  4CMY V;  1RCG A;  4LQJ A;  1JTS A;  2Z5P A;  4DYU A;  4ITT A;  3PW8 C;  2Z5R A;  3AF7 X;  5LS9 A;  1JI4 A;  2HR5 A;  3PWF A;  5K53 A;  5HJH A;  3M6J A;  3KA9 A;  3E1J A;  2FL0 A;  3KHK A;  5GOU A;  4XKU A;  1VJX A;  2Z5Q A;  5LG2 A;  3F35 A;  5D8Q A;  3R2R A;  1TJO A;  4PG0 A;  3BVK A;  2GS4 A;  4CVS A;  2FG4 A;  3PWQ C;  4YVZ A;  1BG7 A;  5GU3 X;  3E1L A;  4AM2 A;  2WLA A;  2PYB A;  1R03 A;  2W0O A;  1VLG A;  1H96 A;  2YW6 A;  4CYB A;  2OKC A;  4EVE A;  2JD8 0;  3MPS A;  3L0M A;  1JIG A;  3PW1 B;  1XZ1 A;  3GHQ A;  3NP0 X;  3AF9 X;  1NNQ A;  2JD7 0;  1UVH A;  2FZF A;  4KXR B;  5J9V A;  3V3K B;  3SHX A;  3UFB A;  2CIH A;  3AJQ A;  3SID A;  2D5K A;  4RC6 B;  4RC6 A;  2V2J A;  1L8H A;  3QZ3 A;  1JKV A;  3EZU A;  3O7R A;  3PVY B;  4MKU A;  4ZKX A;  2XKQ A;  2XJO A;  4AM4 A;  2V2O A;  4MUD A;  1MFR A;  3AJO A;  4CY9 A;  2YJK A;  4CVP A;  3Q4N A;  3QD8 A;  2VXX A;  4PGI A;  1B71 A;  4M33 A;  2CLB A;  3C23 A;  5JAC A;  3C1Z A;  3UOI A;  4ISP A;  3NP2 X;  4CVT A;  3QB9 A;  1JYB A;  1AEW A;  4M34 A;  4YXM A;  2IU2 A;  3UOF A;  2HTN A;  2FFX J;  3SE1 A;  2CLU A;  4TOG A;  4WJG 4;  4DZ0 A;  3D19 A;  1DAT A;  5ERJ A;  4TOH A;  4DYY A;  4LYX A;  3RD0 A;  4ZKW A;  5LBH A;  3RE7 A;  4ZTT A;  5FFC A;  4OYN A;  2Y44 A;  4RC5 B;  2WLU A;  4RC5 A;  4TOE A;  1JRE A;  1QYB A;  2C41 A;  4DI0 A;  2XJM A;  4TOA A;  1SOF A;  2V2P A;  4ZMC A;  3OJ5 A;  5JKM G;  3FRS A;  4KVQ A;  5CZU A;  1RCC A;  1HRS A;  5D8Y A;  2Y3Q A;  3BVL A;  4LQV A;  3WNW A;  5JKL G;  4LPJ A;  3BVF A;  3VVA A;  2MGY A;  1JKU A;  3F37 A;  2ZA8 A;  3QVD A;  4RC7 B;  4RC7 A;  3JZ9 A;  3E1Q A;  3Q4R A;  5GN8 B;  5GN8 A;  4EVD A;  4MXP A;  2C6R A;  3U90 A;  3AJP A;  1Z4A A;  1SQ3 A;  5CMR A;  1YUX A;  3NOZ X;  2V2N A;  3E1P A;  3IS8 A;  4QUW A;  5JKL A;  2GYQ A;  2VZB A;  5HJF A;  1UMN A;  3RAV A;  4YKH A;  2N02 A;  4IWJ A;  2V2S A;  4EVC A;  2V8U A;  5HQO A;  5CMQ A;  1NFV A;  3FVB A;  3R2O A;  1LKP A;  3IS7 A;  4DYZ A;  5D8R A;  1F30 A;  3PVR B;  3F33 A;  1ZS3 A;  2CN7 A;  3PVR A;  2V8T A;  2RBD A;  2CHI A;  3KWO A;  1IER A;  5ERK A;  3ERZ A;  3PW1 A;  5FFA A;  1FHA A;  5JDO B;  3KDQ A;  3ES3 A;  1JGC A;  2CWL A;  4ZKH A;  3GGY A;  4W4L B;  5FFB A;  5D8X A;  1F33 A;  3AF8 X;  3Q4O A;  3WVU A;  1LB3 A;  1LKO A;  2GYD A;  3PVY A;  1N1Q A;  3QHB A;  4Z3B A;  3SH6 A;  5D8S A;  2VXI A;  2WTL A;  3R2H A;  1OTK A;  4M32 A;  3HIU A;  5J93 A;  2OH3 A;  3PW8 A;  2CN6 A;  3FI6 A;  3RBC A;  2V2R A;  4XKT A;  3F32 A;  2G38 B;  4LPM A;  4E6K A;  4X0J A;  1XZ3 A;  2XJN A;  4MN9 A;  4ERU A;  3PZA A;  2C2J A;  5GU2 X;  4IWK A;  5K52 A;  5FEJ A;  3E1O A;  3PVT B;  3PVT A;  4M35 A;  1NF4 A;  2C2U A;  2V2L A;  3E6R A; 
#chains in the Genus database with same CATH homology
 3VV9 A;  3E6S A;  3PWQ A;  3O7S A;  3T9J A;  3H7G A;  1L8I A;  3F36 A;  3E1N A;  4KVR A;  3KX9 A;  1VEQ A;  3A9Q A;  4E40 A;  2V2I A;  4LQN A;  4TO9 A;  1TK6 A;  1Z6O A;  4TOB A;  2QQY A;  1JI5 A;  3UNO A;  1MOJ A;  3BVI A;  3VNX A;  2CEI A;  4ETR A;  2C2F A;  3ISF A;  2IB0 A;  2BKC A;  2ZG8 X;  3F39 A;  2ZA7 A;  3AK8 A;  3A68 A;  2FHA A;  5GU0 X;  2BW1 A;  2CF7 A;  4EVB A;  2AR0 A;  5I4J A;  1RCI A;  4CYA A;  3FSE A;  4MY7 A;  1BFR A;  1TKO A;  1O9R A;  3BT5 A;  5JKM A;  4P18 A;  4ZLW A;  3ISE A;  4LYU A;  4Z5S A;  1LKM A;  1YV1 A;  1S3Q A;  2JD6 0;  4DE6 A;  1ZUJ A;  2Z6M A;  3KA6 A;  4IXK A;  4KVS A;  1VEI A;  1Z6O M;  3C1Y A;  4PG1 A;  5J8W A;  3LKD A;  3WVW A;  4U3G A;  2FJC A;  2F7N A;  2X17 0;  3Q4Q A;  3R2L A;  5D8O A;  4XGS A;  2ZA6 A;  5JDO A;  2UX1 A;  5GU1 X;  1DPS A;  3HL1 A;  2YW7 A;  3DBY A;  5AXS A;  3EGM A;  3QHC A;  4MJY A;  1S2Z A;  3KA8 A;  3E1M A;  2V2M A;  4ZL6 A;  1DVB A;  3C21 A;  3RGD A;  2OC5 A;  4LPN A;  4CMY A;  3TA8 A;  5E2D A;  2BK6 A;  1RCD A;  4ISM A;  3F38 A;  4ML5 A;  4II4 B;  3R2M A;  3EZ0 A;  4II4 A;  2QF9 A;  3N6O A;  5C6F A;  4ZL5 A;  4ITW A;  4TOF A;  5LG8 A;  3KXU A;  3R2K A;  4TOC A;  5D8P A;  3GGZ A;  1J30 A;  3BVE A;  3BKN A;  4LQH A;  4TOD A;  3OGH A;  3AK9 A;  1EUM A;  4XKS A;  3GE4 A;  3JZA B;  1GWG A;  1KRQ A;  5FFD A;  1QGH A;  4ZJK A;  2G4H A;  1YUZ A;  3IQ1 A;  2V15 A;  5E1U A;  2Z90 A;  3WVV A;  2CHP A;  5HU6 D;  1RCE A;  1VEL A;  4DYX A;  5J8S A;  4DAS A;  4CVR A;  3FRR A;  5FFE A;  1RYT A;  2ZG7 X;  4REU A;  4AM5 A;  2ZUR X;  3KA4 A;  4R42 A;  1S30 A;  2FG8 A;  4YXJ A;  3W54 A;  4RC8 A;  2WWX B;  3R2S A;  1NF6 A;  2ZG9 X;  4W4K B;  2BJY A;  2IY4 A;  2YJJ A;  1IES A;  4A25 A;  3F34 A;  3GVY A;  4Y08 A;  3KA3 A;  2FKZ A;  5IX6 A;  3E2C A;  1TKP A;  4PGK A;  4TW3 A;  2ITB A;  2XGW A;  1BCF A;  1O9I A;  4CMY V;  1RCG A;  4LQJ A;  1JTS A;  2Z5P A;  4DYU A;  4ITT A;  3PW8 C;  2Z5R A;  3AF7 X;  5LS9 A;  1JI4 A;  2HR5 A;  3PWF A;  5K53 A;  5HJH A;  3M6J A;  3KA9 A;  3E1J A;  2FL0 A;  3KHK A;  5GOU A;  4XKU A;  1VJX A;  2Z5Q A;  5LG2 A;  3F35 A;  5D8Q A;  3R2R A;  1TJO A;  4PG0 A;  3BVK A;  2GS4 A;  4CVS A;  2FG4 A;  3PWQ C;  4YVZ A;  1BG7 A;  5GU3 X;  3E1L A;  4AM2 A;  2WLA A;  2PYB A;  1R03 A;  2W0O A;  1VLG A;  1H96 A;  2YW6 A;  4CYB A;  2OKC A;  4EVE A;  2JD8 0;  3MPS A;  3L0M A;  1JIG A;  3PW1 B;  1XZ1 A;  3GHQ A;  3NP0 X;  3AF9 X;  1NNQ A;  2JD7 0;  1UVH A;  2FZF A;  4KXR B;  5J9V A;  3V3K B;  3SHX A;  3UFB A;  2CIH A;  3AJQ A;  3SID A;  2D5K A;  4RC6 B;  4RC6 A;  2V2J A;  1L8H A;  3QZ3 A;  1JKV A;  3EZU A;  3O7R A;  3PVY B;  4MKU A;  4ZKX A;  2XKQ A;  2XJO A;  4AM4 A;  2V2O A;  4MUD A;  1MFR A;  3AJO A;  4CY9 A;  2YJK A;  4CVP A;  3Q4N A;  3QD8 A;  2VXX A;  4PGI A;  1B71 A;  4M33 A;  2CLB A;  3C23 A;  5JAC A;  3C1Z A;  3UOI A;  4ISP A;  3NP2 X;  4CVT A;  3QB9 A;  1JYB A;  1AEW A;  4M34 A;  4YXM A;  2IU2 A;  3UOF A;  2HTN A;  2FFX J;  3SE1 A;  2CLU A;  4TOG A;  4WJG 4;  4DZ0 A;  3D19 A;  1DAT A;  5ERJ A;  4TOH A;  4DYY A;  4LYX A;  3RD0 A;  4ZKW A;  5LBH A;  3RE7 A;  4ZTT A;  5FFC A;  4OYN A;  2Y44 A;  4RC5 B;  2WLU A;  4RC5 A;  4TOE A;  1JRE A;  1QYB A;  2C41 A;  4DI0 A;  2XJM A;  4TOA A;  1SOF A;  2V2P A;  4ZMC A;  3OJ5 A;  5JKM G;  3FRS A;  4KVQ A;  5CZU A;  1RCC A;  1HRS A;  5D8Y A;  2Y3Q A;  3BVL A;  4LQV A;  3WNW A;  5JKL G;  4LPJ A;  3BVF A;  3VVA A;  2MGY A;  1JKU A;  3F37 A;  2ZA8 A;  3QVD A;  4RC7 B;  4RC7 A;  3JZ9 A;  3E1Q A;  3Q4R A;  5GN8 B;  5GN8 A;  4EVD A;  4MXP A;  2C6R A;  3U90 A;  3AJP A;  1Z4A A;  1SQ3 A;  5CMR A;  1YUX A;  3NOZ X;  2V2N A;  3E1P A;  3IS8 A;  4QUW A;  5JKL A;  2GYQ A;  2VZB A;  5HJF A;  1UMN A;  3RAV A;  4YKH A;  2N02 A;  4IWJ A;  2V2S A;  4EVC A;  2V8U A;  5HQO A;  5CMQ A;  1NFV A;  3FVB A;  3R2O A;  1LKP A;  3IS7 A;  4DYZ A;  5D8R A;  1F30 A;  3PVR B;  3F33 A;  1ZS3 A;  2CN7 A;  3PVR A;  2V8T A;  2RBD A;  2CHI A;  3KWO A;  1IER A;  5ERK A;  3ERZ A;  3PW1 A;  5FFA A;  1FHA A;  5JDO B;  3KDQ A;  3ES3 A;  1JGC A;  2CWL A;  4ZKH A;  3GGY A;  4W4L B;  5FFB A;  5D8X A;  1F33 A;  3AF8 X;  3Q4O A;  3WVU A;  1LB3 A;  1LKO A;  2GYD A;  3PVY A;  1N1Q A;  3QHB A;  4Z3B A;  3SH6 A;  5D8S A;  2VXI A;  2WTL A;  3R2H A;  1OTK A;  4M32 A;  3HIU A;  5J93 A;  2OH3 A;  3PW8 A;  2CN6 A;  3FI6 A;  3RBC A;  2V2R A;  4XKT A;  3F32 A;  2G38 B;  4LPM A;  4E6K A;  4X0J A;  1XZ3 A;  2XJN A;  4MN9 A;  4ERU A;  3PZA A;  2C2J A;  5GU2 X;  4IWK A;  5K52 A;  5FEJ A;  3E1O A;  3PVT B;  3PVT A;  4M35 A;  1NF4 A;  2C2U A;  2V2L A;  3E6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...