4IIKA

Legionella pneumophila effector
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
314
structure length
303
Chain Sequence
b'MRSIITQICNGVLHGQSYQSGSNDLDKGNSEIFASSLFVHLNEQGKEIKDSDDKIVIGYTKDGMAFQIVVDGFYGCERQAVFSFIDNYVLPLIDNFSLDLTRYPDSKKVTESLIHTIYSLRSKHAPLAEFTMSLCVTYQKDEQLFCAGFGIGDTGIAIKRNEGTIEQLVCHTEVDGFKDAFDNYSSANIDLVIERNSVFNTKVMPGDELVGYTYVPPMLEMTEKEFEVEKRIVRHLNLDPGNFDDKDPLFSQLLQVVKSKQKQLVEQAKETGQIQRFGDDFTVGRLVIPDQLLINQLRIHALS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine monophosphate-protein hydrolase SidD
publication title Structural Basis for Rab1 De-AMPylation by the Legionella pneumophila Effector SidD
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 98
structure length 303
sequence length 314
ec nomenclature ec 3.1.4.-:
pdb deposition date 2012-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.40.20 Alpha Beta 4-Layer Sandwich Phosphatase 2c; domain 1 Phosphatase 2c; domain 1 4iikA00
4IIPA 4IIKA
chains in the Genus database with same CATH superfamily
3D8KA 3W40A 2I0OA 3W42A 2JFRA 3EQ2A 3ZT9A 3FXKA 4N0GA 2ISNA 3KDJB 3FXOA 4LG5B 2IQ1A 4RAGA 2J4OA 3ES2A 2CM1A 3NMNB 2POPA 3T9QA 4RAFA 4LA7B 3ZVUB 3UJLB 4LGBB 3T91A 3W44A 1A6QA 3FXLA 2P8EA 3FXJA 4RA2A 2XZVA 5ITIA 3NMTB 3KE6A 4LGAB 2J86A 3UJGB 4DA1A 2Y09A 3UJKA 3FXMA 4JNDA 1TXOA 3JRQA 5F1MA 4IIPA 3NMVB 3QN1B 4YZHA 3W41A 2V06A 3F79A 2PNQA 3N3CA 3RNRA 3RT0A 2JFSA 5D2UA 4YZGA 3KB3B 2J82A 4IIKA 2IRMA 2PK0A 5JO1B 2I44A 5JO2B 4DS8B 2JFTA 3MQ3A 4OICB 4WVOB 3W43A 3W45A 2POMA 3PU9A
chains in the Genus database with same CATH topology
4IIPA 4IIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IIP A;  4IIK A; 
#chains in the Genus database with same CATH topology
 3D8K A;  3W40 A;  2I0O A;  3W42 A;  2JFR A;  3EQ2 A;  3ZT9 A;  3FXK A;  4N0G A;  2ISN A;  3KDJ B;  3FXO A;  4LG5 B;  2IQ1 A;  4RAG A;  2J4O A;  3ES2 A;  2CM1 A;  3NMN B;  2POP A;  3T9Q A;  4RAF A;  4LA7 B;  3ZVU B;  3UJL B;  4LGB B;  3T91 A;  3W44 A;  1A6Q A;  3FXL A;  2P8E A;  3FXJ A;  4RA2 A;  2XZV A;  5ITI A;  3NMT B;  3KE6 A;  4LGA B;  2J86 A;  3UJG B;  4DA1 A;  2Y09 A;  3UJK A;  3FXM A;  4JND A;  1TXO A;  3JRQ A;  5F1M A;  4IIP A;  3NMV B;  3QN1 B;  4YZH A;  3W41 A;  2V06 A;  3F79 A;  2PNQ A;  3N3C A;  3RNR A;  3RT0 A;  2JFS A;  5D2U A;  4YZG A;  3KB3 B;  2J82 A;  4IIK A;  2IRM A;  2PK0 A;  5JO1 B;  2I44 A;  5JO2 B;  4DS8 B;  2JFT A;  3MQ3 A;  4OIC B;  4WVO B;  3W43 A;  3W45 A;  2POM A;  3PU9 A; 
#chains in the Genus database with same CATH homology
 4IIP A;  4IIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...