4IIPA

Legionella pneumophila effector
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
315
structure length
305
Chain Sequence
b'MRSIITQICNGVLHGQSYQSGSNDLDKGNSEIFASSLFVHLNEQGKEIKDSDDKIVIGYTKDGMAFQIVVAGFYGCERQAVFSFIDNYVLPLIDNFSLDLTRYPDSKKVTESLIHTIYSLRSKHAPLAEFTMSLCVTYQKDEQLFCAGFGIGDTGIAIKRNEGTIEQLVCHTEVDGFKDAFDNYSSANIDLVIERNSVFNTKVMPGDELVGYTYVPPMLEMTEKEFEVETKRIVRHLNLDPGNFDDKDPLFSQLLQVVKSKQKQLVEQAKETGQIQRFGDDFTVGRLVIPDQLLINQLRIHALSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine monophosphate-protein hydrolase SidD
publication title Structural Basis for Rab1 De-AMPylation by the Legionella pneumophila Effector SidD
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 102
structure length 305
sequence length 315
ec nomenclature ec 3.1.4.-:
pdb deposition date 2012-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.40.20 Alpha Beta 4-Layer Sandwich Phosphatase 2c; domain 1 Phosphatase 2c; domain 1 4iipA00
4IIKA 4IIPA
chains in the Genus database with same CATH superfamily
4LGAB 1A6QA 4LA7B 2ISNA 3FXOA 3W42A 3NMTB 3W43A 3MQ3A 2POMA 2P8EA 4WVOB 3T9QA 2JFTA 4LG5B 3N3CA 4N0GA 3W40A 5D2UA 3NMVB 2J86A 4RAFA 2CM1A 3KE6A 3W41A 4RAGA 3D8KA 2I0OA 2POPA 2V06A 3UJKA 4YZGA 3W44A 4LGBB 3FXKA 4DS8B 1TXOA 3KB3B 2XZVA 3KDJB 2J4OA 3ES2A 3RT0A 5F1MA 3ZT9A 4DA1A 2J82A 2IRMA 3QN1B 3UJGB 2JFSA 3UJLB 2Y09A 2PNQA 4IIKA 3EQ2A 5ITIA 5JO2B 3NMNB 4YZHA 3W45A 3FXLA 2PK0A 2I44A 3PU9A 4JNDA 3F79A 5JO1B 3FXJA 3RNRA 3T91A 3FXMA 3ZVUB 4IIPA 3JRQA 2IQ1A 2JFRA 4OICB 4RA2A
chains in the Genus database with same CATH topology
4IIKA 4IIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IIK A;  4IIP A; 
#chains in the Genus database with same CATH topology
 4LGA B;  1A6Q A;  4LA7 B;  2ISN A;  3FXO A;  3W42 A;  3NMT B;  3W43 A;  3MQ3 A;  2POM A;  2P8E A;  4WVO B;  3T9Q A;  2JFT A;  4LG5 B;  3N3C A;  4N0G A;  3W40 A;  5D2U A;  3NMV B;  2J86 A;  4RAF A;  2CM1 A;  3KE6 A;  3W41 A;  4RAG A;  3D8K A;  2I0O A;  2POP A;  2V06 A;  3UJK A;  4YZG A;  3W44 A;  4LGB B;  3FXK A;  4DS8 B;  1TXO A;  3KB3 B;  2XZV A;  3KDJ B;  2J4O A;  3ES2 A;  3RT0 A;  5F1M A;  3ZT9 A;  4DA1 A;  2J82 A;  2IRM A;  3QN1 B;  3UJG B;  2JFS A;  3UJL B;  2Y09 A;  2PNQ A;  4IIK A;  3EQ2 A;  5ITI A;  5JO2 B;  3NMN B;  4YZH A;  3W45 A;  3FXL A;  2PK0 A;  2I44 A;  3PU9 A;  4JND A;  3F79 A;  5JO1 B;  3FXJ A;  3RNR A;  3T91 A;  3FXM A;  3ZVU B;  4IIP A;  3JRQ A;  2IQ1 A;  2JFR A;  4OIC B;  4RA2 A; 
#chains in the Genus database with same CATH homology
 4IIK A;  4IIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...