The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
102
|
sequence length |
315
|
structure length |
305
|
Chain Sequence |
MRSIITQICNGVLHGQSYQSGSNDLDKGNSEIFASSLFVHLNEQGKEIKDSDDKIVIGYTKDGMAFQIVVAGFYGCERQAVFSFIDNYVLPLIDNFSLDLTRYPDSKKVTESLIHTIYSLRSKHAPLAEFTMSLCVTYQKDEQLFCAGFGIGDTGIAIKRNEGTIEQLVCHTEVDGFKDAFDNYSSANIDLVIERNSVFNTKVMPGDELVGYTYVPPMLEMTEKEFEVETKRIVRHLNLDPGNFDDKDPLFSQLLQVVKSKQKQLVEQAKETGQIQRFGDDFTVGRLVIPDQLLINQLRIHALSH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Hydrolase
|
molecule keywords |
Adenosine monophosphate-protein hydrolase SidD
|
publication title |
Structural Basis for Rab1 De-AMPylation by the Legionella pneumophila Effector SidD
pubmed doi rcsb |
source organism |
Legionella pneumophila
|
total genus |
102
|
structure length |
305
|
sequence length |
315
|
ec nomenclature |
ec
3.1.4.-: |
pdb deposition date | 2012-12-20 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 4-Layer Sandwich | Phosphatase 2c; domain 1 | Phosphatase 2c; domain 1 |
#chains in the Genus database with same CATH superfamily 4IIK A; 4IIP A; #chains in the Genus database with same CATH topology 1A6Q A; 1TXO A; 3PU9 A; 5F1M A; 3ZT9 A; 3F79 A; 4OIC B; 3FXM A; 3D8K A; 3W43 A; 2ISN A; 2JFS A; 4RAF A; 2J86 A; 4IIK A; 3FXK A; 3T91 A; 2XZV A; 4JND A; 3ZVU B; 3W41 A; 3NMV B; 3NMT B; 4RA2 A; 2JFT A; 3W44 A; 4WVO B; 4RAG A; 4IIP A; 3KE6 A; 3FXJ A; 2POM A; 2CM1 A; 3T9Q A; 5JO2 B; 2POP A; 4LA7 B; 3RNR A; 3JRQ A; 4LG5 B; 2I0O A; 3UJG B; 3FXO A; 5JO1 B; 5ITI A; 3N3C A; 2JFR A; 3EQ2 A; 4YZH A; 3ES2 A; 3UJK A; 3W40 A; 3QN1 B; 2J4O A; 4LGA B; 3FXL A; 4LGB B; 2V06 A; 3MQ3 A; 2J82 A; 4YZG A; 3W45 A; 3W42 A; 2IQ1 A; 3UJL B; 2PK0 A; 3NMN B; 2P8E A; 4DA1 A; 2I44 A; 2IRM A; 4DS8 B; 2PNQ A; 3KDJ B; 4N0G A; 5D2U A; 2Y09 A; 3KB3 B; 3RT0 A; #chains in the Genus database with same CATH homology 4IIK A; 4IIP A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...