4IJWA

Crystal structure of 11b-hsd1 double mutant (l262r, f278e) in complex with 3-[1-(4-chlorophenyl)cyclopropyl]-8-cyclopropyl[1,2,4]triazolo[4,3-a]pyridine
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
b'EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPCRKILEELYSTSYNMDR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Optimization of 1,2,4-Triazolopyridines as Inhibitors of Human 11 beta-Hydroxysteroid Dehydrogenase Type 1 (11 beta-HSD-1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 96
structure length 263
sequence length 263
chains with identical sequence B, D, E
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2012-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ijwA00
2FPIA 2Z1NA 2ZTLA 4J1NA 5G0VA 1V35A 3GPDG 3HB4X 1OZAA 2PH3A 1P74A 2ZCVA 3ADPA 1EUDA 2HO5A 4R5HA 1O95A 4NBTA 5IF3A 4WCFA 3I9MA 3FTPA 3KTDA 4XIJA 2X0RA 2HJSA 1NVMB 4NDNE 4PLYA 1VPDA 1E7RA 3BTOA 4E30A 3AM5A 3F6YA 1CWUA 2YDXA 4L4RA 4BO5A 4WLUA 3C24A 3RUDA 2EV9A 5ICSA 3KLMX 2NVUB 4BHTA 4CQMB 2C29D 3MJCA 3ZWXA 1NFQA 5DBIA 4K1LA 1IB6A 5EN4A 1PGQA 1PSDA 1T2CA 1NNUA 5TJ9A 3GZNA 2GRAA 2HMWA 1FK8A 4NZ9A 1CETA 2WM3A 2PV7A 5AYVA 2HK9A 2C2XA 4I9UA 4UULA 4AJ4A 3DFUA 2QX7A 5IXYA 2HRBA 5CPFA 1SNYA 4HXYA 4R1NA 1V0JA 3QVTA 5F1KA 1PU2A 3PGXA 3IP3A 2QRJA 3I23A 4RPJA 4PG8A 4FQ8A 2Z95A 5ER6A 3F1KA 2Y1FA 5TJHA 1EZ4A 2HMTA 2Y1OA 3ITKA 4B7CA 4Q3CA 2BH9A 3LQFA 3RUAA 2Q46A 1SMKA 4D79A 4FD3A 2JD2A 4CR7A 3INRA 2HAEA 2UUOA 4E4YA 2YZ7A 3DC2A 1LDGA 2B83A 5I7FA 4FFNA 3S1LA 3M2TA 3BMNB 1ENPA 1N1GA 3JQ9C 3DB2A 4FW8A 2EW2A 2EF1A 4CM4A 4YR9A 5A06A 2NTVA 4C7JA 2GLXA 2Z5LA 3FRJA 2BELA 2HK8A 2J3HA 4RVHA 5T8KC 4ZHSA 3GEGA 3FWNA 4CMCA 4ND4A 3BXXA 2C54A 4G81A 3NUGA 3ETEA 3PJFA 1DDOA 3DMYA 2GZ3A 4PLHA 3ZU3A 3ZZNA 1UZLA 1TEHA 5IDXA 1PGJA 2JJYA 1I2BA 4LCEA 1K6JA 4ALNA 4NBUA 2BRUA 4YWJA 1NPTO 4O6VA 4DC1A 4XQEA 5LDHA 1QLHA 4PGFA 1BRMA 3ZWPA 4OXNA 3H8VA 1VM6A 1PL6A 2OOSA 3CINA 3GGPA 5I9MA 1GU7A 3OSUA 4BNKA 1ADGA 4YJGA 4EJ0A 3HHPA 1LDYA 1X7GA 3E6AA 5KJFA 1YOVB 3JQGB 1M67A 3S2EA 1CF2O 3ABIA 4AJPA 4OAQA 3BMQA 1HE5A 1EDZA 1PGNA 3GFGA 1TA4A 3ZH2A 5HRUA 1NQ5A 1A5ZA 3PPIA 3FF4A 1XQ6A 1GCUA 3INTA 1E1LA 3Q0EA 3UN1A 4NIMA 1Y9EA 2Y66A 1R0KA 4IJWA 1CDOA 1X7HA 3H5AA 2PKQO 4WCFB 1N1EA 5KIAA 2ZTVA 4LMRA 2JHGA 3OEYA 2F00A 2OMEA 4CM9D 1HYHA 5BNIA 3VH2A 1EVZA 1PWXA 1H0KA 3NGXA 4NI5A 3OICA 2WE7A 4PN3A 4J43A 3H9QA 3JQ8A 5KTKA 3HDYA 4O0LA 3DTYA 3ZV4A 3B1JA 5JO0A 4G5HA 3IUPA 3KHUA 3MJVA 1ZW1A 1VKOA 3GZNB 1EMDA 3PTZA 4NFHA 5HS6A 4B3IA 4ZJUA 5DDIP 1KEUA 3WJAA 1DC3A 1HETA 3GG9A 3JQFA 4WECA 3WFIA 4RPLA 3K5PA 1LLCA 3DHEA 4M89A 2O3TA 3CH6A 4ZA2A 3ZHXA 1PJ3A 4P4NA 4FFRA 4R69A 3NT5A 4GX5A 2PA3A 1IPEA 2AG8A 4E2ZA 4N5MA 4BNUA 3WOHA 4FC7A 1UAYA 5K9ZA 3H3FA 3QLJA 4YACA 4AJKA 3PWKA 4QQRA 1WDMA 1EK6A 1LSSA 1LBEA 1IHXA 4AJIA 4CV3A 4NK5A 4BV8A 4BMNA 5AVOA 4YRDA 3O9ZA 1FXSA 3PFFA 3ZCXA 4BO8A 5KJ1A 3WGHA 1HE3A 1Z74A 1P1IA 2BFPA 2NVWA 1B3BA 4ZICA 5I8ZA 3FR7A 3VPFA 4CM4B 4W6ZA 4QECA 3H9GA 2AHRA 3DAFA 4LVCA 4Z0PA 3UXYA 3S2IA 1TT5A 3GAFA 1TXGA 5A9SA 3H5NA 1XLTA 5AXDA 2JKVA 4E2XA 1GYQA 4INAA 5JDCA 1G0OA 2IRWA 3EAGA 1GADO 4URFA 5CDGA 3CTMA 3OJ0A 4MP8A 5DP1A 1ISMA 1KETA 5FWNA 5B1YA 4BKOA 1GV0A 2VNAA 3ENNA 4R1SA 3DAPA 4LN1A 2XOXA 3VTZA 4BNTA 2X6TA 1KIFA 4UVIA 1UXGA 3FTNA 2C5AA 3QE3A 5A4DA 5EERA 4XIYA 2A92A 4J7CA 4BKRA 2BI8A 4CLEA 4NU5A 4IJUA 1KVUA 3KVOA 1B15A 1H6DA 3KYCA 3LU1A 4RVUA 2GASA 4YJGB 3GFBA 1EFLA 1VLLA 3RKUA 2FR0A 3H2SA 4BNLA 1DFGA 1F06A 2X5OA 1E7SA 1NBOA 1QXSA 3D4PA 3GLQA 4UEKA 4J3FA 5KJ6A 3BMQB 5ILOA 3GK3A 1QKIA 2X8LA 4DA9A 5DBGA 4AJHA 2VOJA 4NG5A 1PL8A 2E49A 3Q2KA 1E6UA 4G65A 1U2DA 4OXKA 1E6EA 1R4MA 3I52A 2FPGA 2OFPA 1NXQA 3PZBA 2R2GA 3KV3O 1LRJA 2POQX 3PEFA 4CMGA 4OSPA 1NWHA 5FYDA 4CR8A 3GUCA 4RF5A 3V8BA 2BF7A 3AW9A 1QV7A 3PHHA 4CMAA 5CAEA 1E3LA 3ZU4A 1LRLA 1DIAA 2V7PA 3DBLA 2OXIA 3RUHA 4FOSA 4MVJA 1UAGA 1U4OA 3BAZA 3HN2A 3U0BA 2DAPA 4IQGA 3JQ8B 2V6GA 3C1OA 1IL0A 4JLWA 3VZRA 1IZ9A 2FSSA 3RI3A 1PGOA 4ZRMA 1VI2A 1KY4A 2VOEA 1BHSA 1U1IA 1QR6A 4M49A 3OHSX 2DTEA 2CUKA 1EVJA 2YQ5A 3C7AA 3E03A 4ND3A 4YTEA 4DIBA 1C0LA 5A3JA 1ZEJA 1LC0A 1HDXA 1XEAA 1G1AA 2Y1CA 3PLNA 4H16A 4H7PA 3WGQA 4CM3A 5JFOA 3M1LA 1JVSA 1RPNA 3WQRA 3WGGA 3DFZA 3IMFA 2EG9A 3DZIA 3GZ4A 4DMLA 3TOZA 1D1SA 1QYDA 3QA9A 5KOIA 4PG4A 2BI7A 3IQDB 5G2OA 2QYSA 1LI4A 4L73A 5IDQA 4OL9A 4QEDA 3WYBA 3L77A 4FJ1A 2JFGA 5L4NA 5G0WA 1D1TA 1YH3A 2EP5A 1UXHA 3I4FA 3Q1LA 4JBHA 3RC2A 1TB4A 5ADHA 3DEYX 3LC1O 1U5AA 4OHUA 3FD8A 3L4SO 1KVTA 4DUPA 2BHLA 1KY5A 3KXDA 1TT5B 3GRKA 5A9SB 5JY1A 3TPCA 2CVOA 4RLSA 3AUAA 4RF4A 3ZGYA 1KVSA 2X9GA 4WASA 3NT2A 3VAZA 4L76A 1O6ZA 1X1EA 3D0OA 4IDGA 5B12A 4DTIA 3BIOA 4FFOA 2FR1A 1YQDA 2C0CA 4J7UA 5JW6A 2VNSA 1HL3A 3WWYA 1LSUA 2NQ8A 1DLIA 4PLTA 3PDUA 4E3ZA 4BQPA 2NU8A 1U8FO 1U9JA 4XB2A 1Y8QA 1PZFA 5B37A 4Q3NA 2DPHA 2YV1A 2ZATA 5JMWA 3ONEA 1DHTA 3BMCA 2B69A 2WEKA 1PTJA 1WW8A 4OJNA 3NX4A 3EYWA 3KYCB 4IBOA 4YAJA 3WGZA 5IDWA 3WLEA 5B4UA 1PIWA 4IM7A 1JTVA 2YV3A 4FIZA 4W7IA 3CEAA 2PGDA 4CM5A 4CM9A 5ENDA 5L7YA 1XDWA 3U4DA 5IFLA 4M55A 1R4MB 1XWFA 1ML3A 4CV1A 2PD4A 1ZFNA 1LSJA 2AQIA 3H9JA 1XR3A 5A5EA 2Z1MA 1GQ2A 2DTXA 1GPJA 4GKVA 4NFSA 1SEPA 1AXEA 4U6SA 5A02A 3OJOA 5CEEA 1KERA 1A7AA 2QRKA 4N5LA 4Z0TA 3DBLB 2YYYA 4F45A 1SZJG 1HLPA 1XGKA 3GA0A 4OH1A 1UH5A 5KWEA 3UFXA 1C14A 1IULA 1J5PA 4GMFA 2HK7A 4D42A 3TFQA 1B14A 3N7UA 2CNBA 2UYYA 3PRJA 4F46A 2ZB8A 4BO1A 4RDIA 3I4CA 3U9LA 1YB4A 1M75A 1YE3A 3EVTA 4MVJP 1RYEA 3H9EO 3G49A 4ALJA 3NTQA 3SJUA 2YHIA 3O8QA 3LVFO 1X14A 2XPCA 3S8MA 1FDSA 2JHFA 4B3JA 2D3TA 2FRDA 4S3MA 1B8PA 1YGYA 2RCYA 3L9WA 5JDCC 1T24A 1J0XO 4BNZA 4UAGA 1P1HA 3ZN2A 3TN7A 3X2FA 4XX0A 5TF4A 3U4IA 1F14A 2HU2A 1N2SA 1T2FA 3OA0A 4IDEA 2BD0A 3GF4A 4ZRNA 3LF1A 2IXBA 2RHCA 4GQAA 1SAYA 2HKIA 1LNQA 4XEHA 5HM8A 3GY0A 3KM0A 1Y8RA 4BGEA 2J6IA 1LU9A 2J8ZA 1C1DA 2FPPA 4BMSA 2GD1O 1EBUA 4WOJA 2VT3A 2CVZA 5DCYA 2A9FA 2BFOA 3AOGA 4DL9A 3KEQA 4B7XA 4U6QA 1HDRA 3RCBA 1R15A 2C7VA 5ITWA 1VJTA 1E0DA 3CXRA 4CUKA 2B35A 4M54A 3JSAA 4NMHA 4MVJG 2HJRA 3RC7A 2CF6A 1T26A 4AJ2A 2AQ8A 5C7LO 4Q9NA 1RM4A 4DPMA 1E7YA 3TFOA 2GNAA 4TKMA 3JQ9A 2YV2A 4DBVO 1V3VA 1NQTA 4AVYA 4YT2A 1P33A 1DRVA 4IUYA 1D8AA 5FFFA 3V5NA 1Y8QB 1LDEA 1S7CA 3ZWBA 1C0KA 2OBNA 4BB5A 1PJLA 2ZTUA 5T8KA 4IPTA 1XYGA 5JAZA 3BMCB 4EUHA 1I10A 1Q7CA 4YA6A 2J5KA 3GVIA 3DZJA 5U1PA 3ONDA 3C85A 4E5KA 4EW6A 3FI9A 1DJQA 2ET6A 3F1LA 5ER9A 3CMCO 5EPOA 1PQPA 1U4SA 1DAPA 2PFGA 4M1QA 4U8GA 1WDKA 1GD1O 5JS6A 3DXFA 4KWHA 2IZZA 4LISA 1DC6A 1LDMA 5EESA 1Q7BA 5LDGA 5CDUA 1C0IA 2I99A 3EVNA 8ADHA 2I5PO 3GGGA 1N7HA 3PHGA 3LLVA 4W82A 5MDHA 1MA0A 1N8KA 1XA0A 4DWVA 1AE1A 3UW3A 3FR8A 2Q99A 5JO9A 4IGEA 1IY8A 9LDTA 2B0JA 5BT9A 2I6TA 1UXJA 3W4KA 2WWRA 3GEDA 3OIDA 3M1AA 5A9TA 1Y5RA 4MVJH 3PVZA 4MINA 2YQ4A 1MX3A 2VHWA 1IHYA 3WS7A 1Q0LA 1YJ8A 3BHMA 3ZHYA 5JYDA 1ISGA 3UGKA 4DIOA 2YHIB 3NV9A 2W90A 1DIGA 3O8QB 2BMAA 4K6CA 4OKIA 5L4LA 4WNIA 1HE4A 3I6IA 4GX0A 1JKIA 4N54A 2CFCA 1GZ6A 4YPOA 2O3RA 3NTRA 1X7DA 1BWSA 3JQ7A 4Q3EA 4QFDA 3PXXA 4PLPA 1YRLA 2HQ1A 1X1TA 2C7GA 2GUGA 3DO5A 1E7WA 1Q0QA 2ZJ0A 3ZWWA 2WJPA 1Y8RB 5KVVA 1C1DB 1ZSVA 4MOWA 1UZNA 3DZGA 1GL3A 1NHWA 4KOAA 3IL2A 4EITA 4U0KA 4DVJA 2G76A 5I9LA 2WYWA 4PIVA 1GUYA 3WNVA 3ETDA 4CMBA 3TF5A 3P2YA 4PG5A 2BLLA 4XYEA 1CJCA 5ITVA 1JAYA 4KMSA 1XCBA 1B3RA 1D3AA 3SC6A 2VHVA 1ISIA 1JKFA 3CZRA 3UCXA 3VPXA 1UUFA 4OKNA 1M76A 5EMHA 2YFQA 2YY7A 3JYNA 3FHLA 4ALMA 1PJSA 1NR7A 3GEMA 5H81A 4D45A 2PY6A 2G5CA 1SCUA 5F3RA 4ESOA 4JXKA 2VYVA 4CLDA 3U3XA 1LDBA 1P1KA 3E9QA 4UVHA 5TGDA 3WNQA 1EDOA 1LEHA 3I1JA 4KUHA 4UEOA 2B5VA 4P8RA 3OIGA 3TZCA 1XIVA 9LDBA 3GRPA 3H5RA 3ZWOA 1LLDA 1H9BA 4NFYA 4AJOA 3VH4A 2C2YA 2X7HA 4ALKA 1U3WA 2W8ZA 1QYXA 1ZXLA 3HNPA 3WFJA 4IXTA 1CQIA 2G17A 3VVCA 3AY7A 2PD6A 1P9LA 1ORRA 3TNLA 4UEJA 4FN4A 4YJFA 2ZCUA 4MKXA 2O2YA 4XYBA 4GWKA 3UH1A 4DQXA 4YXFA 2NSDA 1GFSA 3NAQA 1GZ3A 4FSHA 3GAZA 3KO8A 4P4GA 4L4XA 3RJ9A 3TOXA 2GPTA 1V9LA 5DZSA 4GX2A 1ZK0A 4XDZA 3RC1A 1I3MA 5IJZA 1YDWA 2AE1A 2PGLA 3RUCA 1N92A 5HTOA 1OAAA 5TC4A 1WP4A 1J6UA 4KWIA 3M6IA 5C37A 3PIIA 1BXGA 1U3TA 1EUZA 1YQGA 4WGGA 4PZCA 2QQ5A 4WEOA 5KVCA 3P2OA 3LT1A 5AXBA 2OL4A 3O38A 4WLFA 3NT4A 1NAHA 1R16A 4I5GA 4MVJD 1R6DA 1CRWG 1HXHA 3ICCA 3NYWA 4D0RA 1HT0A 5BR7A 2OHXA 5T67A 3DOCA 1R66A 3JD4A 4EUFA 4FGWA 5T57A 1BVUA 1O5IA 4WEQA 1L7DA 1EE2A 1MG0A 5B4VA 2NTNA 1A27A 3QWIA 4YYZA 1DRWA 5JCJA 3TWOA 3KSZO 1W8DA 3KB6A 3F4BA 4NQZA 3VKUA 5KCZA 1BXZA 4Y67A 4ZQHA 3TZQA 3NRCA 4BMVA 2D4AA 2O23A 2WTBA 3D3EA 1ZK4A 3JQ7B 3KBOA 4Q3DA 1QP8A 1YXMA 1ZUD1 5TT0A 3AU8A 4QO7A 2GYYA 3A28A 5IAAA 4UUPA 1PS8A 2Q1SA 1ZSYA 4K6FA 3DZKA 1P0CA 2QYTA 4Z0HO 4GLLA 4WLOA 2C59A 4I9NA 2PH5A 3H4VA 5AOVA 4OSOA 1HDZA 2D1YA 5C7IO 4BNGA 4CM1A 4OYRA 5FEUA 3Q11A 4JN6B 2PZMA 4ND2A 1DRUA 2PNFA 4F6LA 4QO8A 1V6AA 2YHUA 2W2LA 3I9JA 3RQSA 2Y1DA 4MJLA 3ORFA 5L45A 3NKLA 5EL0A 4LRSB 1A4UA 1VL8A 3A9WA 1VSVA 3DL2A 3NEPX 5JY6A 4PRKA 3W6ZA 4Y8VA 4NJMA 1Z7BA 3ANNA 3MWDB 1AUPA 4GMGA 2DLDA 4RQTA 3TRIA 3JYLA 4GSKA 4BO2A 4BNVA 3CKYA 1DFHA 4HX5A 4LCJA 4R3WA 5TT1A 4RDHA 5TSDA 3UICA 2CMDA 1R0SA 1CQJA 4L75A 2IYPA 3EW7A 2JAHA 1FF9A 4R1TA 3G1TA 2JFHA 2ZYDA 3LSYA 4X54A 1A9ZA 1E1MA 3ANMA 5JPIA 3LYLA 5BSFA 4Y9DA 3ZI0A 2P5YA 2B36A 3OJEA 3GNQA 2WMDA 2UUPA 3HB5X 1IZ0A 1UR5A 1OC4A 3HSKA 4JQCA 1J4AA 4IDAA 4RF3A 2AE2A 4TKLA 4KQWA 4Q3BA 3KYBA 4NHEA 4OQZA 1ZMOA 4RPGA 2J5RA 3DOOA 3WYEA 4J1TA 3HUDA 3MJSA 3OFSA 4HBGA 1LJ8A 1GEEA 1XG5A 4MP3A 3GVHA 4YJFB 2C82A 3HE3A 4HNHA 3DZFA 4XGIA 1B8UA 4J91A 5CHEA 3T7EA 5BSEA 2VUUA 5L9AA 3F5QA 2OBYA 3PHJA 3W1VA 5IN4A 2W2KA 1FDTA 3O03A 1K5HA 1P45A 2VN8A 4D44A 1A7KA 1BXGB 2I76A 4Z3KA 3IJPA 2XF8A 4BNIA 2BFAA 1PR9A 4HFNA 4B4VA 3QWBA 4CV0A 1J49A 1ZKMA 2Y1EA 3VC7A 4P38A 3HG7A 3PLRA 4I8XA 5GZ1A 1PJBA 3UCFA 5A9RA 5KNLA 1MV8A 2UV8A 1QYCA 4IDCA 1XQ1A 3U5TA 3OQ6A 2B5WA 4ZU3A 5BSGA 3RU9A 4KTVE 1SBYA 2RH8A 4GGPA 4FCCA 3ROQA 4MO2A 1UDAA 4BNMA 5GZ6A 3VDQA 3K73O 5A5FA 2PKRA 3ZNOA 3V2GA 3OM9A 4RO0A 4XB1A 1P1JA 4ILKA 5EQFA 3RUIA 4BO0A 5CG1A 5G0SA 1WZIA 5IXSA 4Z9XA 5GY7A 2VUTA 3AU9A 1T25A 3LC7O 1LQUA 4GKBA 2GCGA 3N58A 3FBTA 4HP8A 4OOFA 2O3UA 1LXCA 1HZZA 1UJMA 3INGA 4UUMA 4E13A 5ICMA 1WAMA 4JX8A 3G0OA 4U5QA 1RWBA 1R0LA 2FP4A 4TZTA 4PZDA 3R0IA 4MKZA 4XRRA 4N18A 1NPDA 5TNXA 1ISHA 5J23A 2CSUA 3HFGA 3WGOA 1T2DA 3RUFA 4F6CA 1E5QA 1DO8A 1DIRA 2JCYA 3GUYA 1H94A 4L8VA 4UUNA 4NJMB 1P31A 2X0NA 3UHAA 2NLOA 1YO6A 1LC3A 5TQVA 1O0SA 3PWZA 4BO4A 3OA2A 3GHHA 3LZ6A 1BVRA 3WR5A 3QWFA 1YL7A 3B1FA 2LDBA 3E1KA 3K6JA 1O8CA 3WB9A 5KVSA 5L3ZA 3ULKA 3T4XA 4ZN6A 1NVGA 1PS0A 2X22A 4QTZA 3DAGA 1GAEO 1R12A 5JXWA 2DBVO 1JWAB 3WQQA 3EZLA 4DLBA 2E82A 2WSBA 5CG2A 3KLPX 1DXYA 2YW9A 4XQGA 2VHYA 3SLKA 3RJ5A 4E33A 1BDMA 1SC6A 4WK6A 4ZGWA 4WLEA 1L1FA 4E5MA 4ND5A 4PZEA 2D0IA 2HSDA 4BO7A 3QHAA 3VHRA 2EGGA 3MJ4A 1U2GA 4PG7A 1XU9A 4PVDA 1TT7A 2PZLA 1H2HA 3WMXA 4M8SA 4DYVA 3JD3A 4Y6PA 3G79A 1KEWA 3MOIA 2VYNA 4RPKA 3HQ4O 3OETA 2W2KB 3CE6A 1PJ4A 2W4QA 2CDBA 3PHLA 4NPCA 3L6OO 4NU6A 5JSFA 2VWHA 3H3JA 1NPYA 3LLSA 1IYZA 5JMPA 3FPCA 3RKRA 4FJ0A 1V8BA 3OMLA 4YAEA 1I2ZA 4L74A 4E0BA 3E9MA 4JROA 3VZPA 5I7VA 4AJJA 1Z6ZA 4DXHA 1G0NA 4R9RA 4AL4A 1EVIA 2G82A 2AQKA 4QSMA 5THKA 4MVJF 3WLFA 1BG6A 4NBWA 1ULUA 1EFKA 3IKVA 2Y68A 2I3AA 2Y0CA 3OP4A 1V3TA 3R3SA 1U7HA 2G1UA 2HDHA 4I5DA 5CDYA 4E5NA 4DMMA 2GN8A 1A4IA 4IMRA 4K26A 4Z9FA 1T4BA 2VRBA 4CL8A 4EJ6A 4HFMA 1O94A 4WJZA 4TROA 5KJEA 3K31A 4J0EA 3WMWA 3X2EA 4WLNA 1WLYA 3PIDA 2NTJA 3RFXA 1CEQA 1T1RA 5T64A 1ONPA 3EY4A 4RZIA 4E5YA 6ADHA 1D7OA 1BMDA 4Q39A 5U9CA 2HRZA 4II3A 2B4RO 3C7CB 3JQBA 1C0PA 1Q2XA 2B4TO 4RZHA 1H5QA 2A35A 3NDRA 4GLOA 1VKNA 2Y93A 4YRBA 1LSOA 1H6AA 1W6UA 3D1LA 4HUJA 1E6WA 4BO6A 4I9HA 3JTMA 4YT4A 1HYEA 1QRRA 3LDHA 4CUJA 1HRDA 3EGOA 3WGIA 1LLQA 3K8ZA 4JGBA 2EHDA 2BGLA 1EEHA 1JVBA 1VJ1A 3QVXA 4IZIA 3G3EA 2JFFA 2NADA 2Q50A 4L0QA 1ZJZA 2HMUA 2B37A 1PWZA 1ZO8A 3V1UA 1NAIA 1ZK2A 2VYVD 2NUAA 5G4KA 4TRNA 3MOGA 2ZB4A 2RIRA 3DBRA 5EIOA 1NHGA 2DUUA 2OORA 1M66A 3K2EA 4XKJA 1GR0A 1UZMA 4GGOA 5COQA 3TZHA 4WOKA 1YWGO 6LDHA 2V6FA 2IEBA 3MWEB 2CD9A 1WMAA 4XZ3A 1RM0A 1GYRA 3K96A 3A4VA 5JAIA 3LT2A 5C5IA 1TVEA 1H6BA 4MIYA 4XQCA 4CL3A 3QSGA 4RL6A 3WWZA 1RKXA 1KYQA 1T1SA 3I83A 3ZW9A 1NVTA 2R00C 2GN4A 3U4CA 3DDNA 1DIHA 2XXJA 2ZQYA 3M2PA 4RCVA 4W9NC 4ZQBA 1GCOA 3VH3A 5G0TA 3GVXA 5AXAA 4NBRA 1HZJA 2ZYAA 4PCVA 1E3EA 4FBGA 4BOYA 3KOUA 2CVQA 4BL5A 2WDZA 4OIMA 4CLXA 3JQAD 4IGFA 2V6BA 3LF2A 3GR6A 4D3DA 3EDMA 1YQXA 1JDJA 1U28A 3JQEA 5DN9A 3L6DA 1JLLA 3PYLA 3FNGA 2Q2QA 2D5CA 1ZJYA 4DREA 1HEUA 1HDYA 1BSVA 4DQUA 3AOEA 1OC2A 4RV9A 3HWRA 2I66A 1YDEA 1ONOA 4DYDA 4AJ1A 2DU8A 3JQCA 2Q45A 1OOEA 5TS3A 4W7HA 4I5EA 4PLFA 1T4DA 1ZK1A 5TRTA 1T2EA 4B7UA 4E12A 5CEJA 4IIVA 3VTFA 1JU9A 1MXHA 2DC1A 2BGKA 4CLRA 3PDJA 5JCJD 1ARZA 5L7WA 1K2WA 5GMOA 1GYPA 3V1TC 1ZVMA 5L51A 4GSLA 4J2HA 2CDCA 3I5MA 4MVJM 3CIFA 3AFMA 1E1KA 3DWFA 4G2NA 4O1MA 1XU7A 1N9GA 5ENVA 2ZK7A 3IIEA 4GWGA 1ISJA 4NR0A 2WE8A 3ZU2A 3RVDA 4XA8A 5DCWA 1DIBA 5IZCA 1UDCA 4UUOA 5L40A 1DSSG 3CUKA 1QSGA 3OJLA 2ZQZA 1VE9A 2FOIA 3PJDA 2GN6A 4BS9A 4BB6A 2P5UA 4JP2A 3PI7A 4PLVA 1I32A 3IS3A 1E3SA 2W2LD 1LTHR 3UVEA 3D7LA 2NNLD 4D41A 3H65A 3CPSA 2PK3A 1OFGA 5T5QA 1A9YA 1UXIA 1QG6A 4AICA 5JCXA 1YB5A 2P2SA 2J3JA 2D2IA 3KETA 2WD8A 4LSMA 4K28A 3RSHA 1HSZA 2CF5A 3HFSA 3MTJA 4CM6A 1MFPA 2IEDA 3VPSA 1EQ2A 4J1SA 4MKRA 1NR1A 4YAGA 1ZZEA 5G4KB 3H6KA 4PG6A 3DBRB 4ZQGA 1IPFA 2YDYA 4MVJI 2AEFA 2AW5A 4DPKA 4BIIA 2H6EA 1IUKA 1DAOA 3GC6A 4XDYA 4C7KA 1HF3A 1Y1PA 3P5SA 4UVGA 4PLCA 3ZV6A 5LC1A 3IJRA 2GO1A 3DHYA 2NU9A 4XD2A 3WQSB 3VZQA 2EWMA 3C8MA 2NV6A 3MEQA 3IC5A 3UOGA 4JP3A 4FPXA 4HFJA 5B4TA 2E6UX 5A05A 2VCYA 1KOLA 2PD3A 1P0FA 1FDUA 4BNHA 2P4QA 3RUEA 3ZU5A 1ZXBA 1WPQA 2X9VA 5CEFA 1P3DA 3I9LA 1B16A 3C1AA 1HE2A 4CLHA 1S6YA 2FZEA 3DTTA 1X15A 3GNTA 4D3FA 3DR3A 4O59O 1E5LA 1JKJA 3COSA 4WE3A 1YONA 4GI2A 3EUWA 3D64A 4B4UA 1NWCA 3GMSA 3RBXA 1I2CA 4R54A 5BNTA 1PL7A 3AI1A 4B4WA 4HY3A 1V3UA 4XWYA 1LDNA 1PQUA 2HLPA 3JQBC 1GY8A 4JK3A 1WXDA 2AEJA 3PK0A 4RLHA 4TMFA 3WSVA 3SEFA 3WSWA 1YJQA 3RD5A 4NK4A 1RM3A 4P22A 3QQPA 4IXWA 7MDHA 3F9IA 2Y05A 3U49A 5FI5A 2Q1UA 4BGIA 4XYLA 1ZH8A 4BGVA 3BTSA 2VZ9A 3Q2IA 4CLRB 2GDZA 2FZWA 3Q6IA 4PRLA 1IOLA 2Q3EA 4CMEA 1WZEA 4EBFA 5BQFA 1K6XA 4CMIA 1ZSNA 3ITDA 2H63A 4TVBA 1Y81A 3TSCA 1U7TA 4II2A 3W8EA 1KC1A 3QP9A 3ZWAA 3WG9A 2RH4A 2ZB3A 1BW9A 1TI7A 3RAJA 1B26A 3VVBA 4OMUA 3AM4A 4JBIA 1KC3A 5G4LA 1N9GB 1DEHA 4AJNA 2EIHA 4BQRA 3GH3A 2P9EA 3HZZA 1XELA 4YB8A 2NWQA 3GDFA 4IJVA 2OP1A 1RM5A 4KDEA 1LA2A 1RYDA 5KVQA 1HDCA 1R4NA 3QWHA 3HJAA 4MVJE 1PJCA 3KUXA 3ZHZA 3UF0A 3VPHA 2GERA 4A7PA 4P4LA 4C4OA 1YBVA 2GF2A 4XGNA 1QLJA 1ADCA 4E5PA 4XGKA 2A94A 4EEXA 1P1FA 1DLJA 5TIIA 3SVTA 4J7XA 3WIEA 1Z73A 4ZQFA 3VKVA 1Y7TA 1JA9A 5JDIA 1MXFA 4QX6A 4ROSA 4TVOA 4RORA 4A26A 2DM6A 1VSUA 3OQBA 2JL1A 2ZIZA 4FJ2A 1E3JA 3OIFA 3DMTA 3UAGA 4J9VA 1CYDA 4TZKA 1F0YA 5F1OA 1PEDA 5JYEA 1BGVA 2ZB7A 3AOEC 3GN1A 3C1TA 3P7MA 4WCDA 4CLOA 1QMGA 5HWSA 2RAFA 4WKGA 5C7OO 2OP0A 3AY3A 5COBA 1YL5A 2PWZA 4M86A 4H3VA 3WIDA 1RJWA 4FFLA 1GQYA 3JQAA 4LW8A 4W99A 5JC1A 5EJ2A 4N7RA 1LX6A 4RQUA 4CMKA 3H9UA 3STHA 1GEGA 3C7DB 3W4IA 8LDHA 3FBGA 1GPDG 4IDBA 4R9SA 4RVDA 1GUZA 1UDBA 4ALIA 3WJ7A 5DOVA 4OO3A 3GHYA 2VYND 1ZEMA 1UXKA 2NM0A 2ZKLA 1P1RA 1NP3A 4XCVA 5LCXA 3EC7A 3V2UA 4IY1A 3E82A 3E5MA 1DOHA 4CODB 4ZQEA 3L4BC 4YAIA 4WLVA 3GT0A 2YUTA 4AJEA 4EEZA 2W98A 1KS9A 5IZCC 2VHXA 1YBMA 2OGUA 2YJZA 1FJHA 3AK4A 4RVFA 1GDHA 4U0JA 1OMOA 3DBVO 1I3NA 1H2BA 1ENYA 3PJGA 4E2YA 4O63O 1F8GA 2DBZA 5I9NA 3FWZA 2VRCA 4YVFA 2I3GA 4BO3A 4HWKA 4CMIB 1E3WA 4MIEA 2J3IA 4EJMA 3FSRA 1SB8A 4A10A 3T4EA 2D59A 2X0JA 5THQA 2O7QA 3PGJA 3RC9A 5L7TA 4Y6SA 4D46A 1BW9B 3VZSA 4PLWA 5K6AC 4BUCA 2TMDA 4YJHA 3W8DA 4JIGA 1WNTA 3QW2A 1FDVA 3RFVA 3QVOA 4FOOA 4IJKA 4R4JA 3MJEA 2H9IA 3PYXA 2EGHA 4BNFA 4TRJA 2O50A 2OO5A 3S55A 3DBHA 2E4AA 3IAHA 1I24A 2X5KO 3JYOA 3KSDO 3S2GA 4B8ZA 1R4NB 3BTUA 3GMDA 3F47A 4GX1A 2V65A 3ON5A 2EJVA 4IQ8A 3SXPA 4BKQA 4FS3A 3C3XA 3KRTA 4MP6A 2Q4BA 3DHNA 5IZ4A 2X58A 5A1TA 3BHJA 2P68A 2NU7A 2CZCA 4FFPA 5I7EA 1I5RA 2LDXA 3JCZA 4Z3DA 4LMPA 3HADA 3R6DA 4B3HA 4MIOA 5FF9A 4L4SA 3JQ6A 2O3JA 2DPGA 4TWRA 1KVRA 1ZBQA 3TZ6A 1NFRA 2AQHA 2IZ0A 3ZNPA 2RHRA 2X4GA 1ZCJA 3WTBA 4CLOB 5IDYA 1PS9A 4RVSA 3U4HA 4A27A 4A73A 1PJQA 3GDGA 3JYPA 3JQAB 3NJ8A 3ZDFA 1LUAA 3HDHA 1DC4A 1XSEA 3PZRA 4IQ0A 4KP7A 3EMKA 3GG2A 2QZ9A 1NM5A 2P91A 3Q9NA 3L07A 2PZKA 3E48A 2GSDA 4CMEC 2HCTA 4RGBA 1Z75A 4I08A 2RBEA 4JBGA 1EK5A 5HA5A 3I9OA 4E2WA 1PZGA 1U5CA 4XQ9A 3NGLA 4Y6RA 3DOJA 4XR4A 3ADOA 5C3MA 3PYMA 2G0TA 4R01A 4EZBA 2CDAA 1ZK3A 5F5NA 3OBBA 1E7QA 1HSOA 4IMPA 1ULSA 1NQAO 2R00A 3ZV5A 1U8XX 2QRLA 3KYDA 2DFVA 1JN0A 1C3VA 4W9NA 3B20A 5JC8A 1UP7A 1AGNA 2QZZA 3QJ5A 2B4QA 2FR8A 3ZHBA 1F12A 3D5TA 4WPGA 5KKAA 3TQHA 3ZWVA 3PWSA 4IZHA 5ILGA 4BNNA 3B6ZA 3T7CA 2DQ4A 1K0UA 2VWPA 1O9BA 3SJ7A 1SEVA 4IS3A 4MDHA 4TRMA 3A06A 3D4OA 4DLLA 1HDOA 3HDJA 2X86A 4ITUA 3QRWA 3IDSA 4AG3A 1E3WB 1PQWA 3BHIA 2Y99A 1UP4A 3KZVA 3PP8A 4S1VA 5EQDA 1FMCA 2AEMA 3EK2A 1PGPA 1WWKA 3O26A 1TLTA 4Z9YA 2D8AA 3OECA 3ROPA 3JYQA 3K9QO 4YCAA 5JE8A 3QVSA 2O4CA 1PJ2A 1KEPA 2EJWA 4YJHB 5JDIC 1KBZA 3PFWO 4CUZA 1H6CA 5L95A 4DQVA 4E31A 1DB3A 1M6WA 3KEOA 2VQ3A 3DMTC 5TLSA 1Q1NA 3LT4A 1K6IA 3VH1A 2VT2A 4R1UA 4YEDA 4BNJA 4E21A 2DBRA 2FMUA 1W0CA 3DBHB 4HKTA 3G1UA 2WD7A 1I36A 2GZ2A 3G17A 1I30A 4KUEA 2EKPA 1ID1A 2C20A 4KUGA 5CDSA 2Y0DA 2EXXA 1CIVA 1Z82A 4J4HA 4XYGA 5DULA 4RJTA 4ONEA 4R3NA 3TL3A 3SC4A 4BNWA 4RVGA 3WICA 2AXQA 4UREA 4H15A 2NQTA 3AI3A 3BA1A 4TQGA 4M87A 4TSKA 3I6QA 3F5SA 3K30A 4WCFC 4DGSA 4GL4A 3FNFA 4J9UE 1EE9A 5EINA 1ZIDA 2VTDA 4HV4A 1PZHA 2IDZA 1GQQA 1PR3A 1G6KA 3W8FA 3ZWMA 3KSUA 4I5FA 1UP6A 4PFJA 3NTOA 5JNLA 4N5NA 4FFMA 4CQLA 3JD1A 4HADA 4XYMA 4ZVVA 2OZPA 4NBVA 3E8XA 1DPGA 4J1QA 3ROMA 4CMHA 4R41A 4I1IA 4EGFA 1E3IA 3ZV3A 2X1HA 4J49A 2UAGA 1ADFA 2Y67A 1EBFA 2O2SA 1A71A 3UKOA 3AFNA 3W4JA 3E18A 2P4HX 3P19A 1PX0A 4EUEA 3WGYA 1ADBA 1ZMTA 4JCOA 3BMOA 1GV1A 1N5DA 5I7SA 2IZ1A 3RU7A 2J5QA 3GN2A 4OM8A 3RFTA 4KDFA 4CJXA 1EQUA 1GUFA 1XKQA 3EHEA 1FDWA 4OXYA 4CQMD 1YBAA 3KYDB 4NNJA 1VL0A 1VJ0A 3RBVA 3JQDA 2P9CA 1Y9AA 3D4NA 4JNKA 2NVBA 1MGOA 5JAQA 2D5AA 1YVEI 1LRKA 1R37A 4QFCA 3JV7A 5KKCA 4IDFA 5JLAA 1YL6A 3L0DA 4CM8A 4YDRA 2GGSA 2JCVA 3I9KA 3PHIA 3NJ4A 3TZKA 2O7SA 1M6HA 3B70A 3BZUA 4PVCA 5CPBA 1X0VA 3E9NA 5A3VA 2Q1WA 1Q0HA 4JJFA 1MP0A 1ZNQO 4L9RA 2BGMA 5CDTA 1ENOA 1MUUA 1VL6A 5DT9A 4XJSA 5DBFA 4YT8A 4YT5A 3AM3A 1SB9A 3QIVA 4GVLA 1P77A 3PJEA 1L7EA 3F3SA 3GNSA 2VUSA 1ONNA 3PQEA 4YBZA 5L53A 3GVPA 3ETGA 1M2WA 2BKAA 2FWMX 3IUSA 3JD0A 3IOYA 4YAKA 2WD7B 1SPXA 2FY8A 3LC2O 4CR6A 1OI7A 1E92A 2PGJA 3GQVA 5U4QA 2EW8A 4UVEA 1D4FA 4D43A 2DUWA 1VC2A 1QV6A 4R51A 4TRRA 5KJCA 4J4TA 1NQOA 3MJTA 1KEVA 4F3YA 3BTVA 2X5JO 3QWAA 4LK3A 3LK7A 5JBIA 3PQDA 3D5QA 1I33A 4FR5A 2IXAA 2WYUA 3AUUA 2Q2VA 5G0UA 5JAMA 4J0FA 2HMVA 2XAAA 1AN9A 4YQZA 1LLUA 1NYTA 2Q4EA 1PJTA 3D3WA 4ALLA 4HFRA 2VTEA 1BDBA 4GBJA 4RPHA 4EDFA 3DQPA 5IG2A 3OJFA 3GOHA 4CQLB 4XJTA 4IS2A 1HYGA 2VWGA 3JD2A 5HBRA 4R68A 2UDPA 1Y6JA 2GN9A 4FC6A 3IKTA 2PKQP 1XHLA 3K2BA 4A2CA 1AXGA 4HNGA 3WTCA 3JQFC 2PZJA 2FN7A 3ST7A 4DRYA 2ILTA 3HDQA 2Q49A 1MLDA 2EEZA 2OUIA 2AMFA 1AHHA 4XR9A 4ND1A 1C1XA 3FNHA 3Q3CA 5BNFA 3RROA 3FN4A 4AFNA 5AQ1A 3MTGA 1DHRA 1K3TA 1NASA 1WDLA 4XRGA 2ZTMA 1WVGA 3ASVA 3BMOB 2O3QA 3R3JA 3ASUA 2HUNA 5AXCA 2HMSA 2JD1A 4J4BA 4QT0A 4BVAA 3H7AA 2P9GA 4IIUA 5H82A 3TJRA 2Q2WA 4D7AA 1HWYA 4J90A 4BGUA 4DPLA 2GZ1A 2JD0A 3AY6A 3AJRA 4PLGA 1E77A 4O5OA 4A03A 5I8WA 4QXMA 5K0ZA 2IODA 4YRAA 3ICPA 1YB1A 1HDGO 3GDOA 5DNAA 5HS4A 1BTOA 3MCVA 1QORA 4A0SA 4B4OA 1SO8A 2IE0A 4W4TA 3ZNNA 4DBZA 2O3SA 4DC0A 2YFHA 4J6FA 4CM8B 3L9XA 1SOVA 4BNYA 2ZYGA 3HN7A 1VRWA 1I0ZA 3L4BA 4Z6KA 2VRCD 3AUTA 3ZWYA 5A04A 1I3KA 3U09A 4WNCA 5DF1A 1QYVA 2DKNA 5F5LA 1ISFA 4KQXA 2EKQA 3I3OA 4WUVA 2QW8A 2I9PA 3F46A 1WMBA 4U7WA 4RF2A 4ID9A 4B8WA 3Q9UA 3DZBA 2C07A 5H83A 2DFDA 3WBBA 1B2LA 3RBZA 3VDRA 1K89A 2J3KA 4A5OA 5DCUA 5DP2A 4KZPA 4LRTB 2O4UX 1HTBA 2O48X 1B7GO 3K92A 1MC5A 2AA3A 4GPD1 1I01A 4J16A 1NFFA 2PR2A 3IP1A 5K6AA 1H9AA 4BNXA 1ENZA 1A72A 1YKFA 4Y98A 2DVMA 5GZ3A 3A1NA 2E48A 4CM7A 1Z7EA 3V1YA 4R16A 4D3SA 1Y5MA 1YS4A 3I9NA 1X13A 3WXBA 1JAXA 1U3UA 2EKLA 1I3LA 7ADHA 3SX2A 2UVDA 3UUWA 2FSVA 2SCUA 2V6MA 4BO9A 3RASA 4DIFA 2X0IA 3W6UA 1U3VA 3D3WB 4Q3AA 1Q7GA 1DC5A 2Y1GA 4BV9A 3WYCA 3N74A 3GPIA 4CMJA 4UVDA 3WBFA 4AJLA 2AG5A 1HKUA 1E1NA 4NJOA 4R5MA 1JW9B 4ZD6A 3BYZA 2H5LA 1MC4A 4EYEA 3NDJA 3OH8A 5L4SA 3AI2A 3QVWA 4MPDA 4FB5A 1P44A 2NU6A 3OF2A 3RIHA 1W73A 4IDDA 2C5EA 2EERA 2DT5A 1SOWA 3UCEA 1KVQA 3ENKA 2I67A 2NVUA 2F1KA 2Y0EA 4CQMA 1C1XB 5ES3A 3SBOA 2H1SA 1AHIA 5DOZA 1MG5A 2ZJ1A 1B0AA 1O89A 3S2FA 4JJIA 1OBFO 2A4KA 1H93A 4LSWA 3ROKA 3WDSA 3CSDA 3SLGA 1JWBB 3GGOA 2E37A 4GVXA 2PTGA 5IN5A 1F8FA 3WGTA 2QHXA 3OQ1A 1Z45A 5T6BA 3VOSA 4OGWA 2JAPA 3AUSA 1B8VA 4YJDA 3H2ZA 5TX7A 4E32A 2EP7A 3TDKA 1T2AA 1NX6A 3ZNQA 3FNEA 2XXBA 1JQBA 2DBQA 3AWDA 5A03A 3CZMA 1F17A 1NTOA 1E7MA 2DTDA 1CERA 1MFZA 3VPGA 2IYOA 3R1IA 3F4LA 1PZEA 4K9DA 3BMNA 3CMMA 3RWBA 2X23A 3MZ0A 2R6JA 2BFMA 5MGBA 3QY9A 2VZ0A 4IINA 2VWQA 1GZ4A 2GR9A 3B1KA 3OEWA 5BSHA 4BKPA 3EZYA 1HLDA 4OOEA 4BKUA 4OQYA 1DBVO 2TMGA 2NACA 2WYVA 3FPLA 3O4RA 1W4ZA 4LGVA 4J2OA 1GTMA 3DZHA 5CP8A 3A14A 4JJGA 5FI3A 1DJNA 3PQFA 1MB4A 3ANLA 4DLAA 4FGSA 4LVUA 3ONFA 4KTTE 3TL2A 1LQTA 4YQYA 3ZWCA 3LT0A 5F21A 3FCOA 1BXKA 3L6EA 4GAEA 4GH5A 4FDAA 3U62A 1IE3A 2I65A 2QG4A 3NDIA 3V2HA 4D0SA 2QIOA 1DFIA 4B79A 1EUCA 2JCXA 4E6PA 3ZWNA 2PLAA 5COAA 1I8TA 1N7GA 1EVYA 3QV1A 2VZ8A 1X0XA 4EI2A 4CV2A 3GVCA 4NH4A 4PLZA 1YOVA 3ZW8A 3DONA 3WX0A 5CFZA 3JQGA 4CPDA 1QYWA 2FHSA 2VHZA 3E5RA 2X9NA 5F1PA 2Q1TA 4QUKA 2CY0A
chains in the Genus database with same CATH superfamily
2FPIA 2ZTLA 4LJYA 5G0VA 3HB4X 1FNMA 1OZAA 1ZD2P 2PH3A 5JRZA 4UW9A 1P74A 1ZAKA 3KJEA 4W6QA 3IT3A 4K03A 2BYTA 4L4ZA 3CLSD 3NDPA 1MW8X 1T0IA 3OPNA 5K2OA 2IHTA 1YTUA 4H27A 4WCFA 5CBPB 4XIJA 1MN6A 1Q95A 2HJSA 3L8MA 3NAGA 5DNEA 1QFXA 2FEAA 3VNUA 2DETA 3OQVA 4GMHA 1JBEA 1NZJA 1Z0UA 3CT4A 4JNCA 4RH0A 1CWUA 1SHTX 4L4RA 4B3DA 2F64A 4QZVA 5KKNB 4DR1B 4LF9B 1K4MA 2HF9A 5LBTA 3KLMX 3FKSA 3MJCA 3ICQB 2W5UA 1XP8A 3AO0B 3I58A 3VZCA 3ZU6A 4RJJA 4KBGA 4AW9A 3QE4A 1NNUA 5KWIA 1DAMA 2QRMA 4NSNA 1KH3A 4KWCA 1KYIA 2FPMA 5J5CA 3GZNA 4UHHA 3PUHA 4HAZA 1FK8A 1XLWA 3KG2A 1CETA 2I54A 5DHUA 4DCTA 4LZAA 4R9VA 5ALUA 3V32A 5JASA 2EP8A 2HK9A 3VR4D 1J21A 5IXYA 1C8BA 3IQFA 5DM2A 4R1NA 2QE6A 4RSHA 1D0IA 4GO1A 1NLYA 2PYDA 1O3YA 1FP4A 1PU2A 3PGXA 4QXQA 4ZEVA 4HDSA 3GLKA 3B6KA 3KUKA 2WD9A 2BJWA 2P9BA 5JUWA 1EE1A 1AKQA 1VSTA 5GJVC 4RPJA 3KQNA 2BGNA 5LD2B 3R2JA 5ER6A 3F1KA 5FH9A 3GJ5A 2EL9A 2NUTB 3I2HA 5J59A 3URKA 4RD1A 1PLJA 2YOFA 4OA5A 3PFKA 1JSXA 1L7OA 3H19A 3MIIA 4J16C 2Q46A 5CYGA 5L3QA 1VRVA 4J7AA 5DO9A 4D79A 5JOQA 5A3SA 1PFVA 2HAEA 3LOPA 1T6XA 3T5CA 3UOAB 3AL3A 3DC2A 4DLWA 1A5AB 1ENPA 3N05A 5JR3A 1Z4LA 2BMWA 5HQ3B 4GYKA 4CTJA 4CWAA 2WF7A 2MT9A 4AZ0B 1A69A 4FW8A 4MB2A 4O4JA 1G9SA 3EQ8A 4R2MA 1FBNA 2NTVA 4C7JA 5F4ZA 4CG3A 1OR8A 2FSVC 2YX1A 4C7MA 2FVYA 5AW9A 5IBCA 1W5BA 3SQMA 3NAMA 1W581 2BELA 5KNBD 2J45A 1BZYA 3KELA 3MERA 3DG9A 3Q8KA 1IY2A 1CJKC 5T8KC 3WXMA 1MB2A 2GA9A 4QU8A 3IR5A 1LF0A 1O5TA 4A2PA 4ZHSA 3BXXA 1DG1G 1FFEA 1Q3HA 1VL1A 2ZIAA 3MWJA 3RPEA 3ZJYA 2IOHA 4G0YA 3NUGA 4U6NA 2LW7A 4MO9A 2EHJA 4NCAA 3PJFA 2C9BA 1DDOA 4R8LA 4RHFA 2Z9BA 2WTXA 1TEHA 3E7DA 1VHQA 3IEVA 2RG1A 3DWGA 2JJYA 3DAOA 4GPIB 4LCEA 3KWJA 2PSSA 3DD5A 2VDMB 4O1HA 3SIWA 2DHCA 5EXTA 1VIYA 3M6VA 5LUBA 1QLHA 4PGFA 2FZLA 3GL9A 4IXDA 4ISBA 1FXWF 3WLMA 5E8JA 3ZWPA 1EHYA 1KIAA 5DHRA 1PL6A 2D2FA 2BCEA 3TVTA 1IATA 3GGPA 5KCZA 5ALVA 4BNKA 2ECQA 3EGDA 3RE1A 4EJ0A 1E9VA 2HHCA 2XQFA 4XVQA 4MYRA 3E6AA 3MJFA 3UT5A 4JB8A 5BVGA 1T8PA 5C1DA 3SVLA 1KSHA 3H42B 3F78A 2CLEB 2ZSAA 1AT1A 2JHPA 4LKOA 4ND7A 2FPIB 4PNZA 1G16A 1Z28A 3BZWA 3ZH2A 1E9DA 5HRUA 2O0JA 4M9RA 1DOAA 3DLCA 3FF4A 1W36D 3GIDA 2FXIA 3INTA 5HPYB 3FVVA 5KYVA 3RAGA 2Y66A 1IUPA 1CDOA 4WCFB 3TINA 2PKQO 1L9XA 5KIAA 2X40A 3I45A 5FUMA 1CUEA 1OWMA 2GM3A 5LD2C 1W47A 4EKIA 5ALZA 1SXHA 1NP6A 3EJWA 4CM9D 3KJHA 3VH2A 1V48A 1PWXA 2CLIB 2X7XA 3LP8A 1EQAA 1H0KA 3RVOA 4F60A 4JOCA 4EWLA 2X2FA 4M1ZA 4NI5A 2WE7A 1K0FA 1SOUA 2PGXA 3H9QA 1TMOA 1QIDA 2X3UA 3ZV4A 3K09C 3B1JA 4JVNA 3KHUA 3LHKA 2O19A 3GZNB 1VKOA 2BISA 1A2BA 4ROTA 3KJFA 4AYTA 4BMZA 1IN8A 1T8TA 3Q3VA 3VUFA 2OVFA 3DVQX 1HETA 3VR5D 3GG9A 5HM6A 3DCYA 5FBHA 3MFQA 4RPLA 4PC6A 3W05A 4B6JA 1LLCA 1Z7YA 3R5SA 4NBNA 4JSRA 5DNWA 2CXUA 5C51B 3PUVA 4K9QA 4ZA2A 4G5XA 4COKA 3HXLA 3LCVB 1Z88A 1SVUA 1VLMA 2ZR7A 1FP4B 4R69A 5ED0A 4UASA 3OUUA 4HDSB 4LJ4A 5HUQA 4GQIA 2DOKA 1O54A 4XOIA 1FQOA 3QNMA 1QCCA 4MQ4A 5TPZA 3WOHA 4FC7A 4FYPA 4BNUA 3H3FA 4M3NA 5I5GA 1RQXA 4YP0A 2QF7A 3LUHA 3Q98A 5LUAA 3V4PB 1EK6A 3MTQA 1OLUA 4TN5A 5E4FA 2HN9A 3S7ZA 5GWXA 4DLVA 1QJ4A 5L3QB 3FLMA 4YRDA 4ZEMA 3O9ZA 3PFFA 4RAQA 4AKTA 4BO8A 2OLKA 3SX4A 4ZYVA 4OQMA 2BDUA 1GA1A 3ND7A 2J5XA 5I9SA 2RHMA 1Y3DE 2DERA 5I8ZA 3TXAA 3FR7A 2P67A 3VPFA 4O4JB 4K3UA 4PFSA 2X41A 4QECA 5JS7A 1HM5A 1FFHA 2IZ5A 2Q5JA 3H9GA 4B9AA 4BFUA 3DAFA 4Z0PA 3UXYA 2OHHA 2J30A 1TT5A 4KPEC 1TXGA 1HT2E 2R7MA 3DXYA 5AJHA 3H5NA 4LNAA 3F98A 2EZ4A 1IHPA 1LNZA 2FNAA 3M7IA 4E2XA 4R0MA 4PRZA 5BURA 8ATCA 1BHJA 1POXA 2IRWA 1I4LD 4R2XA 3TNDA 5LP6A 4YCNA 1N2JA 4ZDWA 1QTRA 5CDGA 1AKTA 2R6AA 2Q41A 1WD5A 1ZM2A 5DP1A 4XVCA 3AZQA 4KXMA 1EXWA 3RVSA 3IAM6 4ZYUA 1DJPA 4XIIA 3VNQA 2QUJA 5B1YA 3A4IA 1SVMA 2H1CA 4BKOA 4YNBA 3O91A 1GV0A 3O4VA 2F43A 1GNVA 1O08A 1EWRA 1K27A 1SUAA 2FWIA 4WADA 1NJ6A 4DJTA 3UBTA 1KIFA 4UVIA 4UPDA 1UXGA 1KZGB 4JLDA 1DADA 2HF7A 5EERA 2G36A 3VSDA 4J7CA 1DXOA 3DT6A 3GU3A 4DMRA 4O33A 3KVOA 2WUWE 4AY5A 3CB4A 4RVUA 3EGDB 1M2KA 3RKUA 2QLTA 1W4CA 3SKYA 3UT5B 4F9TA 5BV7A 2ZUTA 5JI2E 5BVGB 4BNLA 2FP3A 3L0YA 2X5OA 4KVGA 5D3MA 1X80A 1IK6A 1QHEA 5IH3A 4J3FA 1I6MA 1TYCA 5KJ6A 1T5IA 1M8GA 4H35A 3NWEA 4DA9A 1T9GS 3E23A 4NHOA 1M83A 2BOVA 1PL8A 1UCFA 4ACAA 3CWQA 1KTVA 2V0CA 1R4MA 3I6ZA 1AGPA 1R6BX 1A9QA 1XA3A 2D2EA 2YZMA 1NXQA 4DMGA 1OILA 4ECAA 2GFQA 1S2OA 2IHVA 5GIOE 4RYDA 2DZDA 3KV3O 4XWTA 2M6RA 2ZI5A 5I45A 4F6RA 3GUUA 4AU1A 4OSPA 4V0LA 4JLSA 3P2EA 3KJQA 2HYDA 3AYXB 1T3SA 4NZOA 3V8BA 3PHHA 2IYNA 4CMAA 4ABYA 5CAEA 4LQ4A 1QFYA 3DBLA 1ICEA 2O1EA 4J0HA 4UHFA 2P3QA 4X1OA 3RUHA 3USCS 4MVJA 5EKDA 1L7QA 3EXHA 2VRWA 4DR2B 3EPPA 3BAZA 3HN2A 4PY2A 4BLTA 4J0IA 1RQLA 1OFVA 4IQGA 5IKXA 4JLWA 1IL0A 3LLUA 1S8OA 3VZRA 1W76A 4H7EA 4U4AA 4ZI2A 2VZLA 3DLBA 4ZRMA 4K40A 1VI2A 2P41A 2WI8A 4DR3B 4YC7A 4IIGA 1U1IA 3DAHA 1Z18A 4N6GA 1FDRA 4HQ0A 2JIOA 1QR6A 4M49A 2GOYA 1KZYC 2QI9F 3PR3A 2YQ5A 1EVJA 4GE3A 4LMBA 3QYPA 4ND3A 1C0LA 3PCXA 1JHVA 2F3UA 3GZJA 3P9CA 3L6UA 1UPXA 3UHJA 3BDVA 1IBSA 5FBQB 2ZITA 1PYDA 4DM3A 3CLUC 1NVBA 4UATA 2HJWA 3E8MA 3DFZA 4KU4A 1J99A 2EG9A 3DZIA 4YFVA 4DMLA 3KKZA 1J0BA 1QAQA 1E2DA 3DBOB 3WAJA 1F6DA 2HPZA 2JFNA 2GM4A 5FCDA 5FUBA 1Y9ZA 2PUTA 2CL6X 1SIOA 1U7DA 1OLUB 1ZJWA 2QJTA 2HSGA 5K3OA 1DAHA 1C29B 1DWOA 3NIBA 2GSWA 3QTLA 3GCGA 2G9ZA 3WYBA 1CULC 1RQRA 2JFGA 3E61A 1E99A 2D74A 1N2GA 1CVIA 2FE4A 3ED1A 4NYJQ 4EY6A 1F7VA 4JV5B 1YH3A 2V5AA 1BFDA 4AKGA 3V9AA 1U5AA 3BWEA 4OHUA 2QU7A 3FYCA 3L4SO 4PAQA 1KVTA 2EDCA 3U5ZB 1ESMA 3O0TA 2A9OA 4DUPA 1R0CA 2IEGA 1Z4JA 3IIMA 5IX8A 2H0AA 2Y1WA 3C4JA 5EGNA 3KXDA 1TT5B 4KQGA 5EVJA 2XMRA 2Z6QA 5GONF 4LRWA 3ZCPA 5BXQC 5LP6B 4TS4A 1OXSC 3JW8A 5FP0A 4L95C 2X9GA 3WZMA 3WP1B 4KLRA 1UFQA 4QICA 2CW5A 3AJEA 4L76A 1O6ZA 4JA0A 4IDGA 3RRMA 4URXR 4DTIA 1YQDA 5JW6A 1DT3A 3GJ3A 1BWPA 2VNSA 3W90A 1QGOA 2JGFA 2C4HA 5F73A 2F43B 2FJPA 5I9BA 1QB8A 3WWYA 3VHXA 4PLTA 4E3ZA 4BIMA 5LR6A 1U8FO 4EMSA 3IVRA 2ZRNA 1AZWA 2IYVA 3L93A 4N82A 1FSPA 1R00A 1SXJA 4UPEA 3I28A 5A2GA 1TJ3A 2FUG1 5DPMA 2NW6A 4AO7A 1Y98A 2ZATA 4F06A 3OZIA 3LIIA 4I4TF 1DHTA 4P81A 2B69A 4F21A 2CMHA 5AVSA 1N6PA 1RAFA 3MC1A 1U2SA 4YAJA 3ZG6A 1M0WA 1QKJA 5FRDA 3U19A 1EM8A 4WOBA 1RP7A 2KQUA 4F5YA 4UFOA 1I4TD 5IDWA 5B4UA 4IM7A 3F8TA 4ENSA 5D3MB 5EJIA 4ER5A 1U8UA 2EWWA 4UOZA 1X80B 2OCPA 5DM70 3FI0A 5JAPA 3E0QA 2PGDA 3GCDA 3U4DA 1E5XA 1XDWA 3KVVA 4KGDA 2IHYA 1R4MB 2BFBA 2JC3A 1M34E 3JPYA 1Z0FA 1U2PA 4CV1A 2PD4A 1ZFNA 2AQIA 1XR3A 3R8CA 3UPDA 4JELA 2V7QA 3I1YA 2ZRJA 4HRVA 1UF9A 3K8OE 4NMXB 5K8VA 4N65A 4F6RB 3LUPA 1R9NA 5GJBA 4NFSA 2ACWA 3MLEA 1M5RA 5B6IA 5B12A 1U0BB 4YJKA 1USUA 5CAEB 3GA7A 3F9RA 3DBLB 3O1LA 2IPAB 5DMHA 4AJ9A 3TUZC 2FCAA 1GGMA 1CHNA 2QN9A 4OH1A 1UH5A 3EXHB 2BR3A 3PNLA 1J5PA 2QUAA 4OPMA 2WTEA 4ZOQI 1B14A 3VU1A 4DHEA 3VGPA 1FCJA 1S8NA 4CCSA 2AXPA 3AESA 1ECCA 4QGAA 5E6SA 5KYUA 4B45A 5DCLA 1L5FA 2B99A 4OJMX 5ELMA 4U7PB 3U9LA 3MD9A 1YB4A 1M75A 4MVJP 1QHFA 3H9EO 1WZCA 4PN7A 1IJFA 1ZS9A 3O8QA 2IHKA 3K2IA 3LVFO 2EYUA 3OPQA 2XPCA 4P4SA 1FDSA 1CR2A 1R9JA 4RMJA 1KYXA 2FRDA 3K0CC 2DT8A 4BNZA 4XIFA 2VHTA 5F9MA 5LP6C 1NF8A 3EIXA 3TN7A 2IYQA 2XE8A 1UODA 4LHYA 1FFDA 1L5LA 1MABA 5E9QA 1N2SA 1NUSA 3Q5GA 2CJWA 3FMGA 3HBNA 4EG4A 1MJHA 2V7TA 3GF4A 4IDEA 4JUBA 2NMVA 1UFVA 4ZRNA 3REOA 2ISCA 2ZYRA 3ZY5A 2K7FA 2Y9MB 4PU0A 3L0ZA 4EHLA 3A6GA 1LNQA 1GFWA 3B1XA 3GY0A 3HGTA 1TZ2A 4XEHA 3V6MA 1W0JD 5CFOA 2J8ZA 2P40A 3IA2A 4OBWA 2FPPA 1AQJA 1NA5A 3VDNB 1UJ2A 4DA0A 1WMDA 4YV0A 3ZDQA 1KHHA 3P45A 3RIMA 1JNYA 4I1YA 1GPBA 1P60A 2P6OA 4H0CA 1H5UA 3K05A 1DC8A 2VP4A 1Y7LA 3OOHA 4KMRA 4DL9A 2ADMA 1U3CA 4U6QA 1JQ3A 1O6FA 2RHWA 5FB3A 2A86A 5ITWA 3O7WA 4MAFA 3OY7A 4PZ0A 1AVTA 2HJRA 3IUJA 4DEXA 3ETNA 2MMCA 1K7XB 5AM5A 3AKCA 3B3FA 1C4OA 3T5AA 4DW8A 4R9NA 4F7DA 5KREA 3GO4A 3ISVA 4Q48A 5HSGA 2V55B 2PKXA 2YN0A 5C7LO 4HAIA 3CLUD 3C14C 4PCUA 5HK8A 3BD7A 2WB4A 3QYAA 1U2QA 4HRXA 3KEGA 3TFOA 3JQ9A 3LOUA 1G8FA 1XF1A 5KYGA 1YB2A 4M0KA 4BWFB 2ETXA 4DBVO 2FWBA 2QTHA 4GRIA 4GPTA 1WCYA 2PKWA 3VHXB 1FX1A 1DRVA 4IHJA 3QMWA 2ID4A 5BSVA 3E27A 2ZYWX 3MFYA 2I4LA 3OLQA 5FFFA 4EIWA 1SXJB 1LDEA 1S7CA 4Q1DA 1C0KA 4AKEA 1ODCA 1RJ9A 4CNBA 2BFFA 3AB7A 1PJLA 4IPTA 5LN1A 4EUHA 3EXHC 1ZHFA 2BSAA 2AGVA 2J5KA 3N7AA 3WHKA 1EM8B 4BRUA 3SYRA 3VYUB 2VPYA 5HJ7A 3ONDA 1UEXC 1IN6A 3TE7A 1X8JA 2F62A 1T1IA 2JVKA 3KALA 2ICAA 1DJQA 3FI9A 4TS1A 3SBXA 5CTJA 1P7VA 2G80A 4RDXA 3CH4B 2PFGA 4IUDS 2FE1A 3OG9A 1NBMD 2JJ8A 5K0CA 3C16C 3S81A 5A5DA 1YQQA 5HNKA 3EC1A 4G9GA 3TO5A 2BFBB 3DE6X 3HCOA 1HC7A 1UK8A 2FCRA 1A4RA 1LDMA 1NJ2A 1R6UA 2OZVA 1RPTA 1M1ZA 3KQOA 2Y4NA 3LZCA 5EESA 3RYFA 4YI3A 1C0IA 3UMFA 3F97A 3GGGA 1N7HA 4BRZA 4EF6A 4EH1A 3N2LA 1MA0A 1N8KA 4YXWA 1BS9A 1IBKB 2FA9A 3UW3A 3AP2A 1JJFA 1JNXX 1II9A 1R0BA 1RVDA 2P2YA 3KR0A 3P0EA 3E8SA 3SK0A 3YASA 2CKMA 5KDDA 4YPVA 9LDTA 5HYVA 1JG3A 2RONA 4BBZA 5BMOA 1F9AA 1JJIA 2FG7C 2QQGA 1UPFA 5AI0A 1CR0A 2I6TA 2LTAA 2F6RA 2GX6A 2XTMA 3K9LA 3O74A 3U44A 3TR5A 1M54A 4PHGA 3DMRA 5JD4A 4MW0A 4CU5A 1P73A 2EKZA 3OIDA 1WDTA 2OQIA 3M1AA 1Y5RA 3AESB 2C58A 2GM5A 2GI4A 3PVZA 1H3NA 4PZ9A 2CEKA 4MINA 4N1AA 3VR4H 1AKRA 1IHYA 1HORA 1I9CA 3R3YA 5A0FA 1JE1A 3ECAA 1DTEA 3D4LA 3E2IA 4DDMA 3HJHA 3GMIA 3KIPA 3IQXA 3IA7A 1UM8A 1DIGA 3O8QB 1NKSA 4EFMA 1GGNA 1V8ZA 4OKIA 2BMEA 4P4SB 4I1UA 4GX0A 4UQPA 5L4LA 1YA6A 5ADUS 3JX9A 4A6PA 3BCSA 4PGAA 2AJ8A 3I42A 4YMWA 3NTRA 1HH4A 1SXGA 3V4SA 3JQ7A 4Q3EA 4QFDA 1IXZA 2IYSA 3LCCA 2J07A 3T7RA 4UNRA 1U0TA 1I6KA 1LCIA 3L8ZA 2CJWB 5FO0A 1H8HA 3QI2A 5KTPA 1DJMA 3D59A 1Z0IA 1E7WA 4L15A 4GOOD 4LWOA 5CDFE 3K7EA 4P2GA 2QROA 3GH1A 2FW8A 4R2LA 5KVVA 3KFXA 2FPPB 4UM9D 3IH5A 5EJEA 2H00A 1XTRA 3DZGA 1J0DA 5A4JA 1SXJC 3FRHA 2DEUA 2ZXEA 2B4AA 2PRYA 4R2KA 1RJFA 4EITA 2GEFA 3ZJUA 2G76A 2WYWA 2VPQA 3D7RA 4PIVA 2GYUA 2G25A 1P2SA 1JHUA 1JKMA 4MIKA 5KNBH 1MX5A 2BLLA 4IX1A 1C3EA 4QXRA 1TCAA 1Z8HA 3QY0A 4BTEA 2OTCA 3UCXA 1CUZA 3IR7A 1A5SB 2JFUA 4OKNA 5I3ZA 1CXZA 4A82A 5INTA 2ENWA 2K2WA 5JFTA 4ALMA 1PJSA 4M37A 1NMSA 4MVWA 4ED9A 4BP8A 1CUVA 3L7NA 4D45A 2YWBA 3S0JA 2WA2A 1SCIA 2AX4A 2PY6A 2G5CA 5E1DA 1OU4A 1SD2A 4TQ9A 4LQCA 3GPCA 3W5DA 4I0WB 2PJRA 3I9V1 1X87A 4IHJB 5C0OE 1QWOA 2ACKA 2E6KA 4KUHA 2B5VA 4P8RA 3WJ1A 4OHFA 4L85A 2Y8EA 1RJ9B 2BFFB 1WU8A 3GRPA 1V43A 4PPNA 1ZOIA 4Y2QA 2RGXA 1LLDA 3A9VA 5LQUA 2OGWA 1D0SA 4M0LA 4XVRA 4PGHA 3IP6A 2DR0A 1RRKA 4JKIA 1AX9A 2W8ZA 1QYXA 2I7XA 2GD2A 5JU6A 1X7YA 2G17A 3SZOA 1WV0A 3EGEA 3GBVA 5D7NA 1G19A 1P9LA 3ECCA 3TNLA 4FN4A 5FTMA 2RGGA 2Z5FA 3UH1A 4DQXA 3HJGA 1A96A 2LWIA 3M9XA 1GFSA 1AJEA 4MW2A 2BKLA 4FSHA 3GAZA 3K9GA 3KO8A 4QHSA 4RZ2A 2C95A 2VQSA 1UBUS 4GX2A 1ZK0A 4XDZA 3RYFB 4YV1A 2PUCA 3RUCA 1DBRA 1N92A 2H0QA 4LNUA 3C87A 1WP9A 4IX9A 2QPLA 2FSIA 4EPRA 1WP4A 5KEIA 3K1TA 4KWIA 5DXAA 3M6IA 4HXFB 4L27A 4MQLA 1TAUA 4BLUA 3PIIA 4D56A 1PNOA 3PQ8A 2WNHA 1U3TA 4WGGA 2BUBA 4PZCA 4KX3A 2I34A 2G3YA 5KVCA 3BD9A 2PHZA 5AXBA 1TK2A 1GGVA 2PBZA 3KWFA 4NOKA 1MO3A 1UOOA 3T7IA 4I5GA 4PYRA 2J7PD 4MVJD 3U44B 3AB8A 3NYWA 1HXHA 2D5BA 4TTTS 3VR5H 621PA 5T67A 1QTIA 2R7LA 3HXOA 1J20A 2ZDHA 3I53A 1O5IA 2J9ZB 1GFZA 1TZJA 2OESA 1XK6A 4PO3X 4RH3A 4ZRDA 6CHYA 3ILYA 3C6XA 2OFOA 5FA6A 4ZPXA 1SY7A 1DRWA 1TGYA 2G88A 4H17A 1OI2A 2G8LA 3F4BA 4K9RA 2VJKA 5DHTA 2ZDGA 2O2IA 3VKUA 1KPGA 4DYHA 4YMLA 3GFVA 1EYZA 2WTBA 3HVJA 4FHCA 2GZSA 2B21A 3RADC 4J0JA 4YRGA 5KCMA 5EE3A 1NJ1A 3JQ7B 3KBOA 1G5QA 1QP8A 2DUNA 2P75A 1SZDA 3QU7A 4RIIA 4WK2B 3AU8A 4CRWB 1N2IA 4QO7A 3DOFA 3HS3A 2Y76A 3IP7A 3ABOB 2HADA 3BEOA 3PT5A 4UUPA 4YP5A 4C6SA 4ENWA 2KWIA 2CUZA 4K6FA 1Y0BA 3RAFC 4RDCA 4Z0HO 1BKYA 1FFWA 4WK4B 3HI6A 1FJ2A 4BZPA 4GLLA 3CNHA 3F8SA 4KEAA 4QWWA 2WKQA 2D1YA 2MSKA 1O94D 4LZJA 1UPBA 4OQDA 4BNGA 5JCOA 1FXUA 2P6MA 4JN6B 2FFJA 2R62A 1CZKA 1ZA1A 2RJOA 3HBJA 3BGOS 4DQ0A 5C18A 4M1KA 3LK6A 3QVUA 2XY4A 4M1SA 2JIBA 4DWWA 5L45A 1UMBA 3NKLA 5EL0A 1KL7A 1PNRA 4KAJA 1A4UA 3A9WA 1VSVA 3PQ2A 1L7NA 4U7DA 2XTZA 5J58A 4O4JF 3IRUA 2BE7A 4TTVA 1J22A 4I81A 4Y8VA 3I8SA 4GMGA 4YLYA 1AUPA 2CVFA 4FYWA 5MGNA 5EHZA 1NXSA 1OU0A 1KFKB 1S8FA 3H99A 5F4BA 1TZCA 2ODAA 4WFQA 4BNVA 2YMLA 4DY6A 2VQFB 2ISSD 1MMFB 1GSOA 3PBKA 1GCGA 4HYEA 3SC2A 1KRHA 3NG1A 4I1VA 7MHTA 2IYPA 3KT0A 1Q1QA 3F5MA 2GBFA 3LSYA 2C83A 1PJAA 2ZYDA 3F3MA 5MF6A 3P0HA 3ANMA 2J0EA 1H69A 3LDFA 4HZIA 4BFSA 1BE6A 5BUQA 2IIPA 1V96A 1EGAA 1DXQA 4X3PA 3ZI0A 4CETA 3TOSA 1UBSB 4G97A 3NFYA 1BOOA 1SXJD 2UUPA 4LNHA 1H1TA 1NLMA 1CY6A 1NURA 2HWXA 1T6BY 3GWGA 2L69A 3HSKA 3LPDA 3H5VA 4OY3A 1Z37A 1X9HA 2XUGA 3IPAA 4WWHA 3ID6C 2ANCA 2HCFA 2AZMA 1YJ5A 2Q3BA 4URUR 4K2HA 2VP3A 1NW7A 1Q1BA 4KI7A 4Y1FA 5B2ZA 1X7YB 1WOMA 3MJSA 5HMLA 4C7XA 1LJ8A 3M6XA 3BSWA 4FBMA 2XZDA 1WTCA 5CA0A 1JB9A 3GVHA 1GG9A 4HNHA 4A8PA 4KQ1A 2PLRA 4C0AC 1BKSB 3DZFA 3EB9A 4M4SA 4QUBA 3KQLA 1IXYA 5D87A 4DR6B 2VQDA 3I64A 1YNSA 1U81A 1Q5PA 2JI4A 2PFSA 3F5QA 4Q7EA 2MSEB 5AESA 3QXCA 4LNUB 1XRRA 1EAMA 1FDTA 3ZDAA 2CFRA 3DJFA 3PPYA 2AR9A 1K5HA 1BMFA 2AC7A 3GXBA 4LQLA 4HDKA 3QUQA 2ALJA 4D44A 5F77A 2B94A 1XFAA 3G9XA 1PYOA 3IJPA 5CH3A 4Z3KA 3A2KA 1EU1A 4BNIA 1NVWQ 3AFHA 1VMAA 2JEYA 5ALOA 4JI1B 3NHSA 4B4VA 4IRMA 4CV0A 2C4KA 4BY9E 1ZKMA 2Y1EA 4MAAA 1U2RA 1MBZA 1RXUA 2WVAA 4RD6A 1DQRA 4I8XA 4JJ7A 4GWLA 3BGIA 1NBIA 1U7PA 2ATIA 2XZLA 1KMQA 1QYCA 2A4MA 2YWFA 3TZEA 3U5TA 1OFTA 3W8NA 3OQ6A 3U9TA 1SVNA 5BSGA 3RU9A 1SBYA 1MKYA 1VJCA 1ZD5A 4GGPA 5ALEA 4FCCA 2Z2XA 1P17A 3GLUA 1S2LA 3RNLA 3EISA 3ROQA 4P80A 4P5DA 3UQZA 2PYIA 2GZHA 1L9KA 4DMUB 4MO2A 1UDAA 3BWVA 2H92A 5A5FA 4Z9AA 3VR2A 4ZTZB 2HRCA 4CF5A 1EWVA 3ML1A 4GOXA 2O1XA 4CTOA 4LV6A 4HB3A 3W2TA 3CCCA 3KQYA 1X9IA 1I94B 3OM9A 3RSGA 2W2OA 3K5IA 3RS3A 1OJ7A 3GQBA 4XB1A 3RUIA 2IELA 1K4KA 1D0VA 3RANA 4BO0A 1RFGE 3KAPA 5CG1A 1YU9A 3O2NA 5IXSA 2JJ2A 2V7VA 2GF0A 3RH0A 3LC7O 3JWPA 4DJJA 4ZV4A 2VLIA 3T3OA 3LKDA 3PSHA 4OOFA 5D00A 3DEFA 4GUAA 4JX8A 4U5QA 3TW4A 1KOJA 1YFJA 1R0LA 1SUPA 4TZTA 2LXNA 3VU8A 6ABPA 3R0IA 1TYZA 3DPUA 4MKZA 1JYSA 4N18A 4XRRA 5TNXA 3TB6A 1UJ5A 3OCCA 1ISHA 2VSQA 1UMBB 1XEFA 2JIQA 3IUYA 1K68A 1N5RA 2YYAA 5H3CA 3I5YA 1MU0A 2W00A 5IAKA 1T2DA 5FPTA 3SX0A 3DA8A 1QNFA 2WJIA 4QWMA 5C4GB 4DA4A 1DKUA 2EGUA 4UUNA 4QSHA 1NR5A 1P31A 2X0NA 2XOKD 3FH0A 1NZDA 3SHQA 2BFEA 4UZSA 4C07A 4EELA 4ZAGA 4BO4A 3QEBZ 1S2MA 3AHHA 4BFZA 2GD0A 4YXWD 2EDAA 3GJYA 3SC2B 5LP6F 4EFKA 3N6RA 2CT8A 3A1FA 2J67A 3LFHA 3QWFA 521PA 5TVGA 2FU5C 1SBQA 3KOYA 1YAJA 3T3PB 3I04M 5KVSA 3CKLA 1JX6A 1NW5A 2JAXA 3CNEA 2HHAA 4ZN6A 5B1IA 4W7SA 1BU5A 1R12A 2H2FA 4Q7MB 1OV4A 1NSFA 4IH9A 2G8NA 5JXWA 3EZLA 3UGJA 2XR1A 2E82A 3ELUA 5CG2A 1DKNA 1KBQA 2NO5A 2D4HA 3M4NA 3EEFA 3T1YB 1O4VA 3RJ5A 2H5EA 4WK6A 4ZGWA 5LQRA 4ND5A 3VA7A 2QVGA 4MW1A 4PZEA 1U2GA 4JC4A 4PVDA 5CA0B 3Q3EA 1TX4B 3TLMA 2IPMA 3V1LA 5A4KA 4XFDA 4HNRA 4NNPA 5HFNA 1HO3A 1H2HA 4O4IF 4M8SA 3K0SA 1XVUA 3FMOB 2PCLA 4KWEA 3E70C 2WILA 4Y6PA 3G79A 3RRXA 2VYNA 3I92A 5AVVA 3ER9A 1M6VA 1L4BA 3GP3A 3OETA 4OHVA 1NRIA 3NCHA 4PF1A 3ZEIA 5DIFA 1N5OX 2Q0QA 4X1YA 2N46A 3W2FA 1C30A 3FHCB 4NPCA 3H9CA 3GFOA 4TSFA 4HDKB 3CR8A 3P9IA 2QQFA 3UJHA 4TYMA 2B2NA 3L49A 4I4LA 4LWPA 4MPJA 3FPCA 4LBYA 4FJ0A 2A8YA 3PENA 4P0PB 4U8HA 2NYRA 1GNLA 1WCV1 4TS9A 4GL2A 2JJ1D 4ESVA 2Y1KA 3WLNA 1Z6ZA 4AJJA 4DXHA 1Y6ZA 4D02A 3M6WA 4IOKA 1EVIA 2G82A 5ESRA 3T7KA 3L7AA 4QSMA 3CF4G 5FLKA 4MVJF 2R1ZA 4Z0NA 2AYXA 3FFWA 1PZXA 4FKBA 4WN9A 2Y68A 3OP4A 1V3TA 2VL7A 4QIHA 1A3CA 1E8MA 2W6PA 2OXCA 3RWOA 2J9RA 2Q5CA 3V55A 3SJAA 1YZYA 2FQXA 2WU3A 4HB0A 4K26A 1GR1A 4LGYA 1IN1A 5I7UA 4WJZA 3B3AA 1Z2EA 3U1BA 5BPHA 1PBTA 1QGUA 1CV2A 1KRWA 5BWOA 2PZ8A 1L7VC 3A2MA 3FTCA 4JEIA 1G2IA 5GV7A 1JHRA 6ADHA 4I3GA 3HL0A 4YHHB 1D7OA 2BGRA 3GQBB 2F59A 2V9ZA 1Y34E 1DO0A 2D1RA 1JHPA 5U9CA 1TZKA 4E6EA 2HRZA 1PG0A 5JCPA 1FTGA 3IGFA 4K0KB 1SHLA 2IS1A 2YMQA 3DPIA 4D74A 3KU4A 4OMCA 3A6LA 2A35A 4GLOA 1FU7A 3Q3JB 1E6KA 4YRBA 1XWWA 1GNQA 1W6UA 2O5RA 4HH4A 1SN7A 1W5AA 1GLGA 1N4DA 3JTMA 4BO6A 1AGXA 1HYEA 3LDHA 4CUJA 10MHA 2J9GA 3WGIA 1LLQA 1Z2AA 2PIDA 1KSFX 2FUKA 2CXRA 3K8ZA 3NYQA 4GPBA 5KTRA 4LY3A 1V8DA 1JAHA 1F1BA 2NO0A 4JI7B 1EBBA 3KHKA 2IGBA 5AW5A 3V1KA 1JVBA 1VJ1A 1X1CA 4D0GA 1CJMA 3QVXA 3TK1A 3ZE0B 2FZCA 2BFEB 2NADA 2Q50A 3VKGA 2JATA 3RT7A 4UBKA 2IH5A 3SY8A 4R71A 3EXG1 3DXXA 4IP0A 4NULA 1ZOSA 1XZIA 2HRQA 5EIOA 2Q3MA 1NM5C 3RJTA 3TLAA 4OJTA 3AM1A 3K2EA 1GPLA 2AWNA 1Z8DA 3F71A 3AUFA 2XECA 3HYTA 4HLDA 5HCIA 7REQA 3LT5A 4PE5B 5HRAA 4FWTA 4UPVA 2JLWA 1EGVB 4DDKA 1XKLA 2CD9A 1MB0A 1PAUA 4LQDA 2QMEA 2QK4A 3QLVA 5AIBA 4XZ3A 2QL6A 1GYRA 5AOCA 1RIFA 5C5IA 4CL3A 3LBNA 4NE9A 3IODA 1RWWA 1FFBA 1RKXA 4K9SA 3TJZA 4KXXA 3MTIA 1KH1A 3FPKA 4HRYA 4JBWA 5ECGC 3CVWA 4X92A 4W9NC 3M2PA 5H3LA 2GPWA 4D97A 4II7A 4H6WA 4MYCA 5IJ0A 1TF7A 2C84A 3GVXA 4NBRA 3TLZA 1DKOA 4RXTA 4KO2S 4IUCS 3QGMA 1QG4A 4DHWA 2DG2A 1V7CA 4FBGA 3WVNA 2E3JA 5AVWA 2VXCA 1YQTA 1M6VB 4CLXA 2HA4A 3EVZA 2V6BA 4N01A 3S40A 3DVSX 3PFGA 3JVVA 4X1YB 3STTA 4IICA 1C30B 1U28A 3JQEA 4YFYA 3FNGA 2PWAA 1ZJYA 2BGUA 1PK8A 3BQMB 3T3HA 4DREA 4XWKA 2YH2A 1CVRA 3DLIA 4IG9A 4KVZA 1BSVA 4RV4A 4U2DA 4RV9A 2HH9A 3VPCA 1SHJA 4KC0A 1YDEA 3GLHE 2IS6A 1RQ2A 4E11A 3JS5A 4G9EA 1OOEA 1KYTA 3W78A 1AHPA 4I5EA 1BU8A 2G9RA 3RS7A 1C0EA 3AVQA 1KO4A 2HOQA 4WN9B 1Z4KA 2BCJQ 5TQ2A 1P19A 3C6YA 4B7UA 4E12A 1BKDR 1Z0AA 3O9VA 5CEJA 1OT5A 1C8KA 2ZVDA 5LZ4A 3PDJA 1GNRA 4MA4A 4TTJA 4QBFA 4HGQA 4YCMA 1YU6A 1FA9A 3V1TC 4A16A 1JAIA 3W5CA 3DM5A 1ZUHA 1QGUB 3R7SA 1EB9A 3CIFA 3P32A 3B48A 2WJYA 1Q44A 1E1KA 3EWNA 4IWNA 3C3MA 2YHBA 1VFPA 4ZOCA 2D2XA 1ZRHA 5ENVA 3OOSA 5DXFA 1ISJA 1ONSA 4GOLD 3N76A 4L8YA 1GWNA 4Q02A 3T1VA 3ZU2A 4FB4A 3KK0A 4XA8A 2O2HA 4TXJA 1DIBA 1KU6A 2CJXA 3DOUA 1UDCA 4M7OA 3COJA 4UUOA 1JHYA 1DSSG 4KXYA 1G7CA 3CZ9A 1MJFA 1VE9A 2FOIA 4NOLA 3SYTA 3G59A 2HEGA 3GA5A 1XMJA 2B34A 2BSXA 4NDAA 4W1PA 2A5GA 4JUCA 2ECPA 2G63A 1H4TA 4I50A 3O90A 3IS3A 3T9BA 1LTHR 5CLQA 3D7LA 2NNLD 4D41A 4BEVA 3QYJA 3EA4A 1U2GC 1JEEA 2B9VA 2EBFX 3PNBA 2PX3A 4AICA 4GM0A 2XHEA 2GPBA 4MARA 5IULC 3EZXA 1LV8A 1Z6GA 2J3JA 2X13A 4ZO9A 4AWAA 3ZCSA 2RD2A 2CF5A 2F2TA 1MFPA 2GPJA 1J8FA 2IEDA 2ODWA 4P54A 3T6KA 1GU1A 3UY4A 1QIHA 1TM5E 2BCGY 3ELWA 2IEZA 3L43A 4J1SA 2WPDA 3SFTA 4ER0A 1X7ZA 1NJ5A 1LWOA 2PQ2A 2YVAA 1VG0B 3FUTA 2ZSHA 7REQB 1BFUA 2AEFA 1ULAA 4KNVA 3DE4X 3IBGA 5EJAA 4BBAA 4BIIA 5CFNA 5B7GA 1IUKA 1EINA 4C7KA 3FOEC 4UVGA 1CUJA 1Z29A 2WWIA 2VJAA 3OOWA 4MLCA 1Z2OX 3IJRA 1ZCFA 1V6SA 2GO1A 2P9ZA 1A4XA 5K3AA 1B41A 2VDQB 5EVCA 1I1QB 3SR3A 3C3KA 3VZQA 5HZKA 3C8MA 2NV6A 5CYPA 1RWPA 3OC0A 3U3ZA 3T4UA 4HFJA 2QA5A 2DFLA 3NOVA 1NVDA 1S8AA 4C30A 2V4UA 4FDLA 1GKUB 2VCYA 3GLRA 3WHIA 1YZHA 3GRAA 1IG0A 1CF9A 5IJ0B 3QVKA 5G1NA 1Z0KA 3WMRA 5LZ9A 2OM2A 1WU7A 4FN5A 4OQEA 1B16A 3DCIA 3NHJA 1WUIS 5ECWA 4F4HA 3BRCA 4KQIA 2Z04A 3E9YA 1EWYA 1E5LA 5HZMA 5DK4A 3X2SA 5CVCA 1A8SA 4HWOA 3STUA 4L50A 3UB2A 1YONA 4Z51A 1KIMA 1BMTA 4EDHA 2QXUA 3CVJA 4B4UA 3GMSA 5L6LB 3U6KA 1PL7A 4ID3A 1L4FA 5BO5A 1M2NA 3T1TA 3V4VB 3TJMA 2PEYA 1JDPA 1TM2A 4HY3A 1LDNA 1PQUA 1W44A 4TMFA 1WXDA 3WSVA 3EF1A 3SEFA 4EY4A 4HVLA 1YJQA 4G3XA 1K9SA 3ACBA 3RD5A 1CU1A 3GRYA 3RG2A 4UQLA 4PTYA 2VJDA 5FORA 4F5EA 2JLXA 3E5HA 1QX4A 3C7TA 4H7HA 5D3KA 1UXOA 2AZDA 5TQ2B 2Q1UA 3HUFA 3IVXA 4EENA 3TL6A 1E0KA 4V24A 2G1PA 4BLPA 3BTSA 3Q2IA 4TTPA 1P7YA 2Q3EA 3EEQA 1VCIA 1K6XA 1COWA 2XWJI 1X1DA 5KOYA 3CWZA 1EP3B 2QTCA 1COZA 1KC1A 3B1ZA 4M8IA 3WG9A 4Q4AA 3VVBA 2C8JA 2Q1YA 1B26A 3BE8A 1QPGA 3MPUA 2AS0A 1YHZA 2IVFA 4KIFA 1MF7A 4OJYA 3TBFA 1Q74A 4AJNA 4EX6A 3AZPA 2ZBVA 2EIHA 3DVLA 4Q9AA 2GHIA 2QXYA 3I73A 3DLAA 4KLCA 4MB6A 3VO9A<