4IJWA

Crystal structure of 11b-hsd1 double mutant (l262r, f278e) in complex with 3-[1-(4-chlorophenyl)cyclopropyl]-8-cyclopropyl[1,2,4]triazolo[4,3-a]pyridine
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPCRKILEELYSTSYNMDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimization of 1,2,4-Triazolopyridines as Inhibitors of Human 11 beta-Hydroxysteroid Dehydrogenase Type 1 (11 beta-HSD-1).
pubmed doi rcsb
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Homo sapiens
total genus 96
structure length 263
sequence length 263
chains with identical sequence B, D, E
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2012-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ijwA00
5DT9A 4AJJA 4Y98A 1A9YA 3IL2A 3LT0A 1DFHA 2YYYA 4YTEA 1UXIA 5TJHA 3WWZA 3JQ8B 4E4YA 2R2GA 3LK7A 2AQIA 5K6AA 4CLOA 1ONPA 2PKQP 4I9HA 3ZV5A 1PGOA 3C3XA 2B4QA 1I30A 1O5IA 1P45A 3D64A 4WCFA 1DIHA 5LDGA 3GT0A 1LA2A 4NJMB 4XYLA 1BW9A 1CWUA 4XJTA 4RPGA 1ZH8A 2V6BA 1KC1A 4MVJG 3E5MA 4J4TA 4PLGA 4WNIA 4ZD6A 5AXAA 1NPTO 3GQVA 2IYPA 3EYWA 4UVEA 2Y1CA 5U1PA 1T2DA 3ITKA 1X7GA 1KVUA 3P7MA 2D1YA 4M87A 2XXJA 3JCZA 2O2YA 4KMSA 3NV9A 3NTOA 4W7HA 4PG8A 2X5OA 1Z75A 3C1OA 4UUNA 1HTBA 3CMMA 5TT0A 3W8DA 4CR7A 3M1AA 3WNVA 5DCUA 1VKOA 3U62A 1JKJA 3AUTA 2J5KA 3BMNB 1NR7A 1GZ4A 5AXBA 5B4TA 2J6IA 4RPJA 3AI3A 1Q2XA 1YL7A 3KBOA 5G4KB 4OKNA 1QYWA 2EW8A 2Z95A 2W2LD 4PIVA 1EK6A 1DPGA 2YV2A 4E5YA 5L4LA 1J49A 5L7TA 3PDJA 3K2EA 1GADO 4R1NA 2Z5LA 4BMNA 2C5AA 3KO8A 1HEUA 4CMHA 1PJ4A 4CV0A 4EEXA 3E03A 1YRLA 4EEZA 4HNGA 3Q3CA 3SJ7A 1LRKA 3R6DA 2PLAA 1U1IA 4IIUA 2CFCA 4BNTA 1KEWA 4ZRNA 4P4GA 2BFMA 3S2GA 1LX6A 5IG2A 1FF9A 1NQTA 2HJSA 2X4GA 4E13A 3E8XA 1I10A 2A35A 2X7HA 3H3FA 3OQBA 4LGVA 2C7VA 4K28A 4ZQGA 3U0BA 1JTVA 3UH1A 4CUJA 4XYBA 3ZW8A 3DHEA 5HM8A 3ZWVA 5IN5A 2VZ8A 1IE3A 4B4UA 5KCZA 3L4SO 2UAGA 1HSOA 4MVJE 3KZVA 1YOVB 2X9VA 1UUFA 3I3OA 3ZV4A 5L40A 3RKUA 3VTFA 4KUHA 1DIGA 4PLWA 2NWQA 1EBFA 4YRAA 4FFLA 5KOIA 4ZGWA 4WLEA 3VC7A 3EAGA 4R5HA 4WUVA 1X14A 2YFQA 3GOHA 5EMHA 3OHSX 3WICA 1EDZA 5TT1A 3WQQA 4BV8A 2WD8A 2EV9A 4CM4B 3SLGA 3ZHBA 5HWSA 1M6WA 1BXZA 5TF4A 2X0IA 3F47A 4IMRA 4H7PA 1JVSA 3D3EA 2O3UA 1HDRA 1ZSVA 3KYDA 4I1IA 4JJFA 1AHHA 4D43A 4IDGA 5A05A 5T8KC 3V2GA 2Q4EA 1LDBA 4R41A 3TQHA 5G2OA 2VUSA 4HXYA 3MJ4A 4WOKA 4GKVA 3KETA 1XU7A 3L6DA 1DB3A 1EQ2A 2EGHA 4J43A 3Q9NA 3BMOA 1YQGA 1MXHA 3CSDA 3H4VA 3MEQA 5A03A 3TOZA 3ZWPA 3JYLA 5A04A 4Y9DA 4F45A 5JE8A 3B70A 3IP3A 4RF4A 3VZQA 4XGIA 4DREA 5KTKA 2NLOA 3ZWBA 3UXYA 5TC4A 3INTA 3QSGA 2OORA 4GX5A 4MKXA 4L4SA 3ST7A 2TMDA 3I23A 3L9XA 1WZIA 1ZVMA 3QA9A 5FEUA 5KWEA 4XJSA 1WDKA 4HY3A 4W9NC 3AY7A 4QECA 5CDGA 3KTDA 5AVOA 4HX5A 3AFMA 2RH4A 1PSDA 4IS2A 4KP7A 4CMAA 4IZHA 4UUMA 5B4UA 4L75A 1ML3A 1QV7A 2NV6A 4GWGA 2FP4A 2Q2QA 2QRJA 4P38A 1M75A 1C14A 4ALKA 4FQ8A 5IDWA 4Q39A 3RROA 3C1TA 4J0FA 3HFGA 1H93A 4GQAA 1I5RA 1KVSA 4D46A 2VRCD 5KJFA 3JQ6A 2FZWA 2O7QA 2V6FA 1FXSA 3GG9A 3Q1LA 5ADHA 1ISGA 3GGPA 3IS3A 5HA5A 1RM4A 3ZHXA 1HZZA 4AJOA 2HMSA 5DDIP 1QKIA 5T8KA 1ZK0A 4RVGA 1IZ0A 3O4RA 3V2UA 1TEHA 2YUTA 2ZB7A 2AE2A 1OOEA 2ZYAA 3DZJA 4IDAA 1P0FA 4IXWA 2OGUA 4FPXA 1HLDA 3VDQA 4CPDA 4L4XA 3PWSA 4WASA 3PGJA 2Q46A 3NDIA 3Q2KA 5DN9A 1BSVA 2WE7A 2Q45A 1P44A 1PJBA 8ADHA 1EMDA 2O23A 2NQTA 3GHHA 4R4JA 3BYZA 3DMTA 2X5JO 3QWBA 1PGNA 4OH1A 4WEQA 4NFHA 1FDVA 3TL2A 2VNSA 1MB4A 4ZQHA 3DBHB 1JQBA 1DJQA 3LVFO 1E3EA 3CINA 1Z7BA 4CMIB 1R4NA 4DQUA 3GEMA 3ENNA 3JD3A 4FN4A 4K1LA 5DOZA 4L76A 1I2ZA 3OBBA 3PI7A 4BO1A 1S6YA 1E3WB 1AGNA 3V1UA 3JQAB 1NFQA 2X86A 3NEPX 4GWKA 4HFNA 4WE3A 3NGLA 3Q0EA 1I3KA 4RPLA 1BXGB 5IXYA 4YPOA 1R6DA 2IZ0A 4N5MA 2NU8A 4B79A 1IB6A 2WD7A 1RWBA 4B7CA 3AY6A 5JMPA 1ZUD1 1T26A 5EQDA 4TRRA 2Z1MA 1ENPA 3I9LA 4PLTA 2J5QA 2B5WA 3ZU2A 2I6TA 1D1SA 1OC4A 2JFHA 1DRWA 4JX8A 4ALJA 4E5NA 5AQ1A 3FNFA 1R0LA 2XF8A 5JBIA 4GMFA 1IHYA 1XEAA 2RIRA 2UUPA 3BA1A 1U4OA 3H65A 2FOIA 3GLQA 3EW7A 1C1DA 4EGFA 2OZPA 4YT5A 5CPBA 4TROA 3I9NA 3UF0A 3TZCA 3WWYA 4K6FA 3IKTA 1V3UA 3WNQA 1C1XB 4KDEA 1GYQA 3AI1A 1A72A 4J1TA 1Y8QA 2ILTA 4FFNA 4Y6SA 3RJ9A 2PGLA 5I7SA 5JDIC 2DTEA 4GKBA 1VSUA 1GEGA 1TA4A 1J5PA 1WMAA 3TNLA 4NZ9A 1DFIA 2XPCA 3D3WB 1SEPA 3JYOA 1VC2A 1RM0A 3CZMA 2W2KA 3A1NA 1NQOA 1Q0LA 3ANMA 4MIOA 4K6CA 1MFPA 1DHRA 2HMWA 3PFWO 3ROMA 2QRLA 3OETA 4HNHA 4WOJA 5TS3A 3FNGA 1YH3A 4ALNA 4NFYA 4OQZA 2AXQA 1DIRA 3RCBA 1Y81A 3RC9A 4QFCA 4PLPA 1HWYA 1P1IA 1MXFA 2PZLA 2X9GA 3FPCA 1U7HA 2VWPA 2B4TO 1PWZA 3W6UA 1MLDA 2EEZA 3Q6IA 3LYLA 1H9AA 1I2BA 2EF1A 3OJEA 4MVJM 4JJIA 1YBAA 3O8QA 3HQ4O 4GMGA 2VUUA 4P4NA 3ZWCA 4J49A 1O9BA 5TGDA 3EMKA 2OO5A 1KIFA 1DAOA 4FBGA 2HK8A 4DC1A 5F1KA 3CH6A 3MOGA 4FC6A 1YGYA 3ROKA 4EW6A 1DRUA 3AFNA 4BNWA 3QVSA 3WIDA 3ETEA 5JDIA 4XQEA 2X0RA 4U6SA 1GY8A 1SB9A 4XD2A 1NPDA 2Y05A 2OFPA 3E9QA 1N9GB 1JAXA 1X7HA 3I9JA 1ZW1A 3BIOA 3LU1A 4O63O 4N5NA 4B7UA 3K2BA 5F1OA 3VH2A 1R0SA 3RUFA 3VOSA 3OJ0A 3ONFA 1U9JA 3QWFA 1U7TA 3JQCA 4LCEA 2XOXA 5DP2A 4E21A 2D2IA 5C7IO 2DKNA 4AJ2A 1TT5B 4WLFA 4IM7A 1T1RA 4YJGB 4DC0A 3D5QA 2YHIB 4QTZA 3R1IA 3RI3A 3B20A 2H5LA 1TT7A 1BRMA 4RVFA 4WLUA 4HUJA 4M8SA 3I83A 3KSZO 1NX6A 3LC1O 3H3JA 4NU6A 4I08A 1EVYA 1LSUA 1VL8A 3JQFC 4PVDA 4IY1A 1LSJA 5AXDA 2D0IA 1ZZEA 4XIYA 3BHIA 1YJQA 1P3DA 1ISHA 2Y0EA 4IGEA 1WW8A 1PGQA 1P1JA 5ITWA 5L4NA 4CQMB 1P1FA 2GN6A 4ESOA 4PGFA 6ADHA 3GF4A 1ULUA 4DPKA 4MPDA 4RQUA 2BHLA 1KETA 1VSVA 4KOAA 2IE0A 3AJRA 4E0BA 4W7IA 4WLOA 2FPGA 1D8AA 2O3TA 4TWRA 1HE2A 1PL8A 4YQYA 1BTOA 4JBIA 2EP5A 4PG4A 2BFOA 1J6UA 1EEHA 1F8FA 3P5SA 3L4BC 4D7AA 2PH5A 3CZRA 3SC4A 5IDXA 4D45A 4BKUA 2VOJA 2FPIA 3U49A 2QW8A 5G0TA 1D3AA 4CQLB 1CDOA 3JQ7B 3F5SA 4EDFA 1SPXA 3KLMX 5KVQA 3ANLA 5C5IA 1YE3A 1YL6A 3L6OO 4TMFA 4E5MA 1U3TA 3BTUA 4GLLA 5DBIA 1S7CA 4OAQA 2WTBA 4OO3A 3K92A 1RPNA 4MKZA 4JIGA 1E5LA 4IQ8A 1GZ6A 2QYTA 2X23A 1EZ4A 2X0NA 3I52A 1C3VA 4AJHA 3JQFA 4E2WA 3BTSA 4YT8A 1X13A 3K96A 3K73O 4ZN6A 4C4OA 3B1FA 1R0KA 5A06A 4BO9A 1U8FO 2F1KA 3ON5A 1ZEJA 4B8ZA 4E32A 1GD1O 1OMOA 3RBZA 4TVOA 4LN1A 3SX2A 1AHIA 3PHIA 3GZNA 5T6BA 4RF2A 1B15A 1M6HA 3PP8A 3AUSA 2NVUB 3IKVA 4R9RA 5CDUA 3GG2A 1PS9A 1V3TA 4OHUA 2DBQA 2Q1SA 3SJUA 4R54A 4E2ZA 4F6CA 1F14A 3UW3A 1YONA 3WOHA 4TRJA 5JSFA 1A7KA 3FN4A 4MVJI 1Z74A 3JYQA 2P9CA 3GFBA 3RC2A 3F4LA 3KYCA 1KOLA 3ZNOA 1JLLA 2X5KO 5TQVA 2GYYA 2CY0A 4D79A 1GQ2A 4A0SA 1QLHA 1WZEA 3BMQB 2QYSA 3VPFA 5IZCC 3A06A 4EITA 1FDUA 4PFJA 3KM0A 1PR9A 1G1AA 1P77A 3OM9A 4YCAA 4RF5A 4ILKA 2Y1DA 5L45A 1Z73A 2C59A 1LQUA 1NAHA 3QP9A 3RQSA 4RVHA 5C3MA 4J4HA 1N7GA 2Y93A 3IOYA 4URFA 1ZK4A 3C7CB 4FR5A 1ARZA 5IXSA 3NT4A 2DBVO 2UUOA 3PIIA 1HLPA 1KY4A 3EK2A 3NTRA 4J1NA 5KIAA 1YBVA 1K6JA 2ZTLA 1C0IA 4DPLA 1IL0A 3M2TA 4BMSA 3PQFA 2AEFA 4BO8A 2AMFA 1XHLA 1P33A 4WKGA 2DPHA 3H7AA 3VPGA 1MUUA 4L74A 4BS9A 1MG0A 5DCWA 3NTQA 2PTGA 3WR5A 1HDGO 3O38A 2X0JA 4FW8A 4BQPA 1JN0A 1NASA 2ZYDA 4Z9FA 2DU8A 1ID1A 2C5EA 4IIVA 5CP8A 4B4OA 4MVJD 5IJZA 2RAFA 2JCVA 4R1TA 2E48A 3GVPA 3W8FA 1R12A 2PK3A 2LDBA 3GDOA 3HWRA 1CQIA 4E31A 3GK3A 1ZO8A 2VRBA 4AJLA 1VJTA 2BFPA 3T7EA 4OJNA 1NFRA 1LU9A 3VH3A 1GUZA 2BD0A 1E3SA 1SOVA 3N58A 4BNZA 2P5YA 2YV3A 3CTMA 3DOJA 3PGXA 3DXFA 4PZDA 3PHJA 2AG5A 1K89A 4BQRA 2VWHA 4CMBA 3OJOA 3DAFA 3VPSA 1UXKA 4N5LA 5KJ6A 3QLJA 4QO7A 3LQFA 4WGGA 4ZJUA 1ULSA 2W98A 3MTJA 4HV4A 1UXJA 1ADBA 1WPQA 3OFSA 3RUCA 4DPMA 1PQUA 4J0EA 4A27A 2CNBA 1UZNA 1PJQA 1DBVO 2GR9A 1R4MA 1GCOA 3GEGA 1NM5A 3O9ZA 1XYGA 3MCVA 2PD4A 3TZHA 4BKRA 1EDOA 1DRVA 3JQEA 4J6FA 2LDXA 3UCFA 3VAZA 3PZRA 5U4QA 4DBVO 1YB4A 2VHXA 4NG5A 5JCXA 4NBUA 2DAPA 2VT2A 3AI2A 5G4LA 3W6ZA 1LC0A 5T67A 4YT4A 4GL4A 2B36A 2VWGA 1K5HA 3CUKA 4FD3A 5EL0A 3S2IA 3D0OA 1XA0A 1NAIA 2VQ3A 2I66A 4J1QA 2FHSA 4YWJA 4GH5A 1X1TA 4YA6A 5FYDA 4C7KA 1QP8A 1X0XA 4XDZA 1U2DA 3I1JA 1QYXA 4GVXA 3ZWMA 1H6DA 3UOGA 4PZEA 3PEFA 4O5OA 3FRJA 4DL9A 3DC2A 4YAKA 3B6ZA 1Y9EA 4Q3CA 1G6KA 2JJYA 4NIMA 5EQFA 1I01A 1MP0A 4ZQEA 1GV0A 2GPTA 2NU6A 3TZQA 2I9PA 2FZEA 3K5PA 3S55A 2HMTA 4ALMA 1C0PA 2ZATA 3WGOA 3AOGA 4E33A 1DHTA 4ITUA 1Y8RA 3ZU4A 3SEFA 4OXYA 3NJ4A 4PRLA 2HO5A 4WNCA 1DJNA 4D44A 4FDAA 1PJLA 3U5TA 4NJOA 1JWBB 3FR8A 3VZSA 4N54A 1N1GA 3BHJA 3D1LA 4CM5A 3OJLA 5EPOA 2E82A 1NR1A 2H6EA 3LLVA 1N92A 4IJKA 2R00C 4I9UA 5DBFA 2DUWA 5JS6A 1DAPA 2ZIZA 1N7HA 3R3SA 4TZTA 4PLVA 1HDZA 4YJFB 4E2XA 2HMUA 5FF9A 4UVDA 1XGKA 1R66A 1B2LA 1Y1PA 1B14A 5JO0A 1BHSA 3L77A 1W4ZA 3RIHA 4XEHA 3QVOA 1PGJA 2HRZA 4EUFA 4ZHSA 5ICSA 3AWDA 4FFRA 1SO8A 2DUUA 3FNEA 1F0YA 4YJHB 2EKQA 1PJSA 2VZ9A 4E5KA 1CJCA 1E7QA 2BLLA 2PR2A 2G5CA 3IJRA 4OGWA 5FWNA 1ENZA 2J8ZA 3G49A 3DAPA 3UCXA 1U8XX 2JCXA 4Z0HO 1WDMA 2WYUA 4FJ0A 4AJ1A 1HYGA 4MO2A 4CMKA 4MVJH 2Y1GA 1M2WA 4BNUA 3V2HA 3JQ8A 4AJPA 4J4BA 2VOEA 5THKA 1O89A 3DZHA 2NACA 2PGJA 3WQSB 4WEOA 5A1TA 1XG5A 3NAQA 1A4IA 3KSDO 3D7LA 2X1HA 4NJMA 5JYDA 4Z9XA 5MDHA 1VL6A 4D0SA 4W82A 5J23A 4UUPA 4FGSA 4CM6A 2NTVA 4DIOA 3DWFA 4OIMA 2O3RA 2F00A 3COSA 3DBRB 3F4BA 3GDFA 3HUDA 4PG7A 4R68A 3ZHZA 1N8KA 2R00A 4RDIA 5CG2A 5G0SA 2CDBA 3TFOA 5B4VA 3G1TA 3VVBA 1U2GA 4MIYA 3C7AA 1QYVA 2VHZA 2FSVA 2ZB3A 4U5QA 3X2FA 5L95A 1IZ9A 3K30A 3WB9A 1NHGA 3GRPA 4QEDA 1XKQA 3WSWA 4MKRA 3E18A 4YR9A 2ZTUA 5MGBA 1HT0A 4Q9NA 5DNAA 3C24A 1MGOA 3L07A 1WXDA 4XQGA 3BMNA 4R9SA 3STHA 5H81A 1JDJA 3H2ZA 3G1UA 1HYEA 4KUGA 2DC1A 3HHPA 3DDNA 2IRWA 5G4KA 5TLSA 2E6UX 1LSSA 4P22A 1UZLA 2UYYA 5EERA 5EN4A 4BNVA 1CERA 3AM5A 2A94A 2H63A 3DAGA 4D41A 3NDRA 3WFJA 3DOOA 1ZMTA 1SB8A 2D8AA 4L9RA 2IZ1A 4B4VA 3ADOA 1PZGA 5L3ZA 4IS3A 2YHUA 3WGYA 5A9RA 3LF1A 5ER6A 1DC5A 3V1TC 4AICA 4GAEA 4CUZA 3CEAA 3WYCA 1QV6A 5TNXA 1VI2A 4EI2A 3GRKA 3RU7A 2VTDA 2WEKA 3IQDB 1ZCJA 3QWAA 2E49A 1W8DA 1MFZA 3HB5X 5F3RA 1PX0A 2VZ0A 3PWZA 4RF3A 1VE9A 2CDAA 2J3IA 3FHLA 1DO8A 1R15A 3AM3A 3VZRA 2W8ZA 5GZ1A 3PFFA 3E9MA 1Q7CA 4JLWA 3SLKA 1YOVA 3PQDA 4YEDA 1LLCA 3ASUA 1LEHA 5KJ1A 1B3BA 1EUZA 2CZCA 4Y6RA 3NRCA 5FFFA 2DVMA 1HDOA 3H9GA 4LW8A 2GDZA 1E6EA 1I2CA 3LZ6A 5B37A 3TPCA 5JY1A 4UEKA 2FRDA 2FMUA 2V65A 1U5AA 4BVAA 2AEJA 3IUPA 4IQ0A 5JLAA 5L7YA 3GAZA 1E7MA 4AJKA 5F5LA 3ZWAA 2G17A 5JAIA 1HDCA 5BNTA 3WQRA 4DIBA 4TZKA 2VYVA 2I3GA 3KYBA 1ZXLA 3H9QA 4XWYA 3ORFA 4CM4A 2Q2VA 4XB1A 5C7LO 1GU7A 5CHEA 1EVZA 4JNKA 5JAZA 1FDSA 2ZK7A 1GFSA 4MVJP 5HTOA 3I9KA 1F06A 2GLXA 1VLLA 2AA3A 4HWKA 4JBHA 3DHYA 2BELA 2NU9A 2GSDA 1P9LA 1D1TA 1LNQA 3VDRA 4BUCA 2NTJA 4IQGA 1H6BA 4F3YA 4MDHA 3F6YA 4CJXA 4NBTA 5BSFA 3RC7A 5EIOA 8LDHA 5K0ZA 2G0TA 4XGNA 4JXKA 3QE3A 5AYVA 3ZDFA 4A5OA 4W9NA 3WIEA 3WGZA 3IMFA 2BI7A 2V6MA 2WYVA 3VKVA 2GO1A 1GL3A 3GPIA 5JAMA 4KTVE 3JQGB 4BNNA 4CLRB 5I9NA 1J0XO 2BKAA 5C7OO 1X0VA 1UP7A 2PZMA 2GRAA 4NBRA 4ALIA 1OBFO 3JSAA 3D4PA 3F5QA 1UAYA 4CMGA 1HE5A 1NTOA 4HADA 2OHXA 2I76A 4CL8A 3WBFA 1HE4A 2WM3A 3DQPA 4KWHA 4MP6A 2EJWA 4QXMA 1X1EA 4CM8B 4XRGA 4B3HA 2EG9A 3X2EA 1YVEI 4WLVA 1DIBA 1H5QA 2B5VA 4GSKA 1PR3A 1U28A 3VVCA 4LSWA 1B7GO 3QQPA 5EINA 2P9GA 3EZLA 4YYZA 2EJVA 3AM4A 4RPHA 2NUAA 3KRTA 3DL2A 4RLHA 1LI4A 3TDKA 1HXHA 3HADA 3UKOA 4XIJA 4CLHA 2B37A 3GMSA 3VPHA 3HJAA 3ICCA 1E7YA 4YAJA 1E7RA 3AW9A 1SCUA 4XQCA 4FOOA 1R37A 2GASA 3MZ0A 1C0KA 2HJRA 4WCDA 3JTMA 3MJSA 1B16A 1NBOA 1WDLA 1TI7A 1PQWA 2EKPA 5T57A 4E2YA 3HN2A 2DFVA 1UDAA 2DFDA 3KV3O 1AUPA 5COQA 5JAQA 2J3JA 4DBZA 4CR6A 3GDGA 1F8GA 3DONA 1NVTA 4IJVA 4LRTB 5LDHA 1BWSA 1E0DA 3VH4A 3G3EA 1Q7GA 1Z6ZA 1WWKA 3DBHA 3V1YA 3KHUA 4TKLA 5CG1A 5BNIA 1GTMA 4I9NA 4IDDA 4CMIA 3SXPA 1I36A 1PEDA 1Q7BA 1WAMA 3PLRA 2ZB4A 3GN1A 4HFRA 1EE2A 2PKQO 3ANNA 4NHEA 5KNLA 1E3WA 1ADFA 2Y1OA 3JQAA 4BMVA 4BGEA 4NBWA 4PLHA 2GCGA 3PYMA 2BGLA 5KVSA 1BXGA 1FMCA 3R0IA 5L9AA 3RBXA 5DBGA 4J9VA 5CAEA 4GLOA 2HMVA 3C85A 3PJDA 3IP1A 3BMCB 1LUAA 4YVFA 2DBRA 4GX1A 5IFLA 4E6PA 4RDHA 3WGIA 3MJEA 4DXHA 2O2SA 2XAAA 2EWMA 2CSUA 3RVDA 5GMOA 1Z82A 2AQ8A 1LLUA 1X15A 3VH1A 3ZNPA 3GUCA 3V8BA 4G81A 1JWAB 1T2FA 3MWEB 1GCUA 4CMCA 4BNFA 4WECA 1T1SA 4DWVA 1C0LA 3FCOA 1B8VA 5DOVA 3Q2IA 1LJ8A 3GVXA 5EJ2A 3JQAD 4BGVA 1LQTA 1ONOA 4FSHA 3EGOA 5DCYA 2P4HX 4TRNA 3EDMA 3OQ6A 4XX0A 4YACA 3RJ5A 3AOEC 3M1LA 1A7AA 3VHRA 4M86A 1C1XA 4YAEA 1E7SA 2O50A 4O1MA 4EZBA 3H9JA 1V6AA 5IAAA 4AJ4A 4BHTA 3QW2A 2I3AA 4KWIA 3ZU5A 2X22A 1O0SA 2EERA 3D3WA 5ENVA 2BRUA 3UGKA 1T2CA 4I5DA 3HB4X 4I5EA 4LK3A 4OOFA 3ZWXA 2GN9A 4Z0PA 5DZSA 3KSUA 4BNGA 2ZKLA 2C29D 2P9EA 3DBLB 1KEPA 3GAFA 3H5NA 4ID9A 4FJ2A 1YBMA 2VT3A 3TOXA 1SBYA 3DFUA 3MOIA 3RSHA 2DT5A 1SC6A 3PTZA 4Q3DA 3K8ZA 3PHHA 1YS4A 4IJWA 4CM9A 4Z3KA 5CFZA 5I9LA 1IPFA 3A14A 4RGBA 3O26A 3KLPX 4R51A 1BDBA 3W8EA 4GI2A 2JFFA 2ZCVA 3I6IA 3UVEA 1A27A 4G2NA 3WX0A 3NT2A 2GN4A 3NUGA 4II2A 4DIFA 1E1MA 3DZKA 1JW9B 1DDOA 3WMXA 1N2SA 5I7EA 2Q1WA 3RUAA 3IJPA 1EUCA 2WWRA 3VPXA 4K9DA 2OL4A 4CV1A 1ISJA 3IAHA 1SEVA 2J5RA 4TKMA 1ZIDA 2HU2A 1NWCA 3AOEA 2A4KA 1H6AA 1HRDA 4D3FA 1PZFA 2WMDA 4D3DA 4RO0A 4RVUA 1H6CA 1NXQA 2WE8A 2C2XA 2Y1FA 4DMLA 2GN8A 3TZ6A 2B0JA 4DQVA 5A9SB 1GPDG 5KKCA 1N9GA 3ZV6A 1U4SA 1EBUA 3HNPA 2V7PA 4OM8A 5B12A 3JQ9C 3DTYA 3D4NA 1U5CA 2CVZA 4O0LA 4LISA 4FIZA 3ETGA 4JP2A 3F1LA 3DR3A 5L53A 1M76A 2ZJ1A 3GC6A 1TT5A 1I24A 3H6KA 4YJGA 5F1PA 2Y0CA 2DLDA 1V8BA 4GX2A 5JO9A 2VYNA 2YHIA 1T24A 1CQJA 1DC3A 2QX7A 4UVGA 4DRYA 4DQXA 4XCVA 1ZSNA 3RASA 3IIEA 4ND1A 4IBOA 3OF2A 1GV1A 4IGFA 3AU9A 1BVRA 1I3LA 2WYWA 4GX0A 4FOSA 4JP3A 4XR9A 2X58A 2IXBA 3TWOA 3FBTA 3TJRA 4JROA 4P8RA 4W6ZA 4BOYA 3HN7A 4UAGA 5IDYA 5A3VA 3ROPA 3UCEA 5AOVA 3I6QA 4EUEA 3LF2A 4GBJA 1W73A 3L4BA 1PIWA 4S1VA 4CQMA 1IHXA 1H0KA 3HE3A 2A92A 5ES3A 3WBBA 4B8WA 4E12A 2QZ9A 3TF5A 2BI8A 3GN2A 1LXCA 5JC8A 2CVOA 5TSDA 3QVXA 3C1AA 1E6UA 1I0ZA 2VYND 3DB2A 4OQYA 4PLYA 3INGA 2CMDA 4BIIA 4Q3NA 3TSCA 2IXAA 2FSSA 1PU2A 3ZWOA 3DO5A 2WDZA 3CKYA 2WJPA 3JV7A 3JQ9A 2NADA 3E9NA 3PHGA 7MDHA 1I3MA 5ENDA 1PQPA 4CQLA 2C0CA 4BV9A 3N7UA 3GFGA 1A9ZA 3JQ7A 4R69A 1EFKA 3GGGA 4AL4A 1M67A 2X8LA 2CDCA 2BMAA 1CF2O 3M6IA 1IYZA 5GZ3A 3WMWA 4MJLA 3W1VA 1EFLA 3HSKA 3JYPA 1E3LA 3DFZA 5JCJA 5COAA 1L1FA 2PV7A 1ADGA 1NNUA 4BO6A 2GUGA 1OAAA 4MINA 4PG6A 5DULA 4P4LA 1H2BA 2QIOA 4UULA 2YV1A 1XU9A 4DGSA 2BH9A 3RUHA 3VZPA 2BGMA 4DYDA 5I9MA 4O59O 5C37A 1OFGA 3OECA 4BO5A 1PL6A 3D4OA 3PYLA 5KKAA 4NH4A 1QYDA 3ABIA 3IUSA 2C20A 1U3VA 3QIVA 2Q50A 1PZHA 4FFOA 3WTBA 4CLOB 1YQDA 3OA2A 4AG3A 1DFGA 1TB4A 3ZGYA 2NVUA 4WCFB 4CLDA 5IZCA 1UDBA 2Y68A 1BW9B 2ET6A 2JCYA 5ER9A 4QO8A 3JD2A 1GR0A 2JHFA 5T64A 1E92A 5JCJD 3SBOA 4OSPA 1N5DA 4J90A 1UXHA 5G0UA 2P91A 4F6LA 1UXGA 4QSMA 4J2HA 1ISFA 1EE9A 2FR8A 4YT2A 3BMQA 4I5FA 4B3JA 2YDYA 1F17A 4BNMA 4JCOA 3S1LA 4DLBA 3FSRA 3UAGA 4BNHA 4BO0A 2HK7A 3T4XA 3KB6A 2RBEA 1XDWA 3ULKA 2W90A 1GAEO 1NQ5A 1NQAO 1KBZA 2QG4A 1BDMA 2JAHA 5BQFA 4J7XA 4N18A 4LVCA 1ONNA 1ENOA 3NT5A 2E4AA 3OA0A 2OXIA 3PDUA 1HF3A 2CVQA 3BTVA 2FWMX 1O6ZA 1T2EA 5AXCA 5A3JA 4ZU3A 4BNIA 1W6UA 3ASVA 3GA0A 4LMRA 4AFNA 4IMPA 2VN8A 3A4VA 3RWBA 5HS4A 4EJ0A 3GY0A 1IULA 5IDQA 3EVTA 3ZV3A 4M1QA 1AE1A 1RM5A 2DPGA 1AXEA 4GGOA 3VKUA 3I4CA 3H9UA 3GR6A 3Q11A 2IEDA 2PKRA 3ZNNA 4Z6KA 3S8MA 7ADHA 3FI9A 4BB5A 2CUKA 4IXTA 2BGKA 1UH5A 1I8TA 1KERA 1P1KA 3WGGA 1ZK3A 5FI3A 4U0JA 3OIGA 4Q3EA 3JD1A 2I99A 2YY7A 1I32A 1VRWA 2W2LA 3DHNA 4E5PA 4BO7A 3K6JA 4HFMA 3KOUA 5JPIA 3MJCA 3IDSA 4CLEA 1V35A 4D42A 1M66A 4YJDA 4ND5A 2JFGA 2B69A 4KQXA 1UR5A 1LTHR 2Q99A 1J4AA 2Q2WA 3KXDA 4QQRA 3H5RA 4UVIA 3RUIA 2SCUA 3DEYX 1GYRA 2YQ4A 5LC1A 3RBVA 3OEYA 3GMDA 5IF3A 1A5ZA 1AN9A 4PLFA 1ZJZA 2YJZA 4BB6A 1P1RA 2IEBA 3TRIA 4TQGA 3OP4A 2Y99A 4I8XA 1HL3A 4KZPA 3KYDB 3LT1A 3WLEA 1LDYA 2QZZA 1YKFA 1YQXA 1B3RA 4IJUA 2OMEA 3AUAA 4BO4A 3WS7A 1WVGA 1I3NA 2AE1A 1ZMOA 4IDCA 3ZN2A 5CEEA 3H2SA 4MIEA 2AQHA 3BMOB 4YRBA 2JL1A 1E1NA 4MP3A 4Q3BA 3ROQA 2H1SA 2Q1UA 4RVDA 3E48A 1SOWA 1PJTA 3DBVO 1RJWA 1SZJG 3PJFA 4DMMA 3E5RA 4RCVA 4N7RA 3KEOA 1ZBQA 4HBGA 4R3NA 5CDYA 1WNTA 3WDSA 3RFTA 2CF6A 2GZ2A 4IZIA 3QVTA 6LDHA 5ICMA 4YXFA 3SC6A 2NNLD 1NVMB 1XLTA 4OL9A 4Z9YA 4UVHA 2J3KA 3FWZA 1L7EA 2BF7A 2Z1NA 1KY5A 2D5AA 4CODB 4S3MA 1Y9AA 2FR1A 3GUYA 3PLNA 2O7SA 3GVHA 4EUHA 1QMGA 3V5NA 2YW9A 4MVJF 4GVLA 2HUNA 4BO2A 1ZEMA 2RHCA 2VUTA 4RPKA 5TIIA 5I7FA 1LLDA 3MJVA 1UZMA 3AU8A 2EXXA 2PZJA 3LC2O 4QUKA 3C8MA 5CPFA 3CMCO 4DUPA 1VKNA 2X6TA 4GPD1 4J91A 2D3TA 4J7UA 3MWDB 3P2OA 3PJEA 4LRSB 2HKIA 3JQDA 4ND2A 3WFIA 1DEHA 2Q4BA 3LLSA 2OP1A 4YJFA 1NVGA 1CRWG 2NSDA 1ZK1A 3RUEA 4NI5A 3B1KA 1MV8A 2D5CA 1CYDA 1D4FA 4YRDA 2DTDA 5BSHA 1BMDA 3FTPA 1VL0A 4NFSA 3FPLA 4OMUA 1XCBA 4R16A 4YJHA 4AJNA 3H9EO 1O8CA 2B35A 1H9BA 4LVUA 3HFSA 1QRRA 1B0AA 3P2YA 1K6IA 1PTJA 4G65A 3QWHA 3W4KA 4AJIA 2E37A 2O4CA 3HDHA 3U4IA 3M2PA 1ZFNA 3BTOA 4IDFA 1DIAA 1KVRA 4U7WA 4MOWA 3T4EA 4PLZA 2VNAA 3GVCA 1R4NB 1HDYA 3W4IA 1A4UA 2IZZA 4OXNA 1H2HA 2OBNA 3OEWA 5I8WA 1K6XA 3DMTC 2GD1O 2YZ7A 2GF2A 1H94A 5THQA 4DLAA 4YAGA 2AEMA 4R3WA 2QHXA 2VRCA 3GNSA 2QRKA 4XKJA 3BHMA 3EC7A 2WD7B 4CM3A 1D7OA 2FPPA 3HDYA 3WYBA 1MC5A 1QORA 3DBRA 1L7DA 1GQQA 1PS0A 3QHAA 2C07A 4G5HA 2Q3EA 3UUWA 3WGTA 5B1YA 1OC2A 2C7GA 4R01A 2UDPA 4Y6PA 1JA9A 3ZI0A 4BNKA 3WLFA 1C1DB 5BT9A 2H9IA 5H82A 5HBRA 1DC4A 3WG9A 4FB5A 5G0WA 4RV9A 2I65A 3RKRA 1Y6JA 3HG7A 1NYTA 1RYDA 2ZB8A 4JN6B 4ZVVA 3U4DA 3F1KA 1UP6A 1PGPA 2PD3A 1GZ3A 1KEVA 1Y8QB 2I67A 5KJCA 1G0NA 2PGDA 1SMKA 1GUFA 1WLYA 3PJGA 5L4SA 2Y0DA 3I9OA 4NR0A 4BL5A 1Y7TA 4BKQA 4MP8A 3WJ7A 1ZNQO 3GGOA 4PN3A 2HQ1A 4TSKA 1NWHA 3ENKA 2W2KB 1XWFA 1SNYA 4C7JA 1UP4A 3FTNA 3U3XA 2WSBA 1E7WA 1PS8A 1Q0QA 2GZ1A 4B3IA 1FJHA 2VYVD 4BNXA 4RJTA 4CUKA 1WP4A 4PVCA 1PJ2A 2RHRA 1JKFA 3OQ1A 1E1LA 4R1SA 2OP0A 4DTIA 3INRA 3C7DB 1GPJA 3F3SA 3LT2A 3PWKA 5H83A 4L8VA 4ND4A 2PWZA 2IDZA 4XB2A 4A26A 2EP7A 4A10A 5HS6A 1BVUA 2DM6A 2PH3A 1OZAA 3OSUA 1BGVA 4B7XA 3WYEA 1QSGA 4YDRA 1PJCA 3O8QB 4O6VA 1ISMA 3P19A 1VJ1A 4FGWA 3NDJA 4ND3A 2B4RO 5CDSA 5L7WA 1DC6A 4BO3A 5JC1A 1EQUA 1P74A 3TZKA 1V3VA 4OYRA 2GERA 4W4TA 1IUKA 2RCYA 4XYMA 4CV2A 2Y67A 3PIDA 3TFQA 4WPGA 4IDBA 3ZCXA 4RL6A 2P2SA 3OIFA 1YO6A 2B83A 1MC4A 1SAYA 2O4UX 4D0RA 1GEEA 3O03A 2O48X 1XR3A 3DZFA 5TRTA 4NNJA 3ZWYA 5ILOA 1E3IA 4FS3A 2ZCUA 5F21A 1HZJA 3ONDA 5F5NA 1VPDA 2V6GA 5L51A 1YL5A 4L4RA 2GGSA 4Y8VA 5GY7A 3QWIA 2POQX 5GZ6A 1B26A 3ZHYA 5IN4A 2NU7A 3DZBA 2GNAA 1MG5A 3CXRA 2GZ3A 3UFXA 1ZKMA 2ZQYA 1PWXA 2A9FA 4XR4A 3ZNQA 2EKLA 4ZQFA 3GZ4A 4KDFA 1LDNA 4WJZA 4PZCA 1QXSA 2ZQZA 1CETA 4IDEA 4WK6A 3PYXA 3L9WA 4ONEA 5CDTA 4UUOA 1YB1A 1N1EA 3GEDA 4UEJA 4LSMA 4XZ3A 5A5FA 3U09A 4HP8A 3WTCA 1TLTA 3LT4A 1XSEA 1HETA 2UV8A 3R3JA 3SVTA 2HSDA 2J3HA 1NPYA 3JQGA 4BNYA 4CLRA 5BNFA 4ZICA 5BR7A 3KUXA 3TL3A 4IUYA 1GDHA 4UEOA 3E1KA 3D5TA 4ZRMA 5LCXA 3WSVA 1T4BA 4NU5A 4EBFA 3MTGA 3WGQA 1G0OA 2JD2A 4W99A 4RQTA 3DTTA 3QV1A 3U9LA 3G79A 3NGXA 1GQYA 2NM0A 3AK4A 4CM8A 1O94A 2D4AA 1A71A 3DMYA 1RKXA 2VTEA 1PJ3A 4NK4A 4WLNA 4M54A 5T5QA 2HK9A 1KVTA 1NFFA 4XGKA 4DA9A 3FR7A 1RYEA 4EJ6A 5ILGA 3PRJA 4M49A 1LDGA 3OH8A 1XQ6A 3L0DA 3RFVA 1DSSG 4LMPA 1Q0HA 1YJ8A 4E30A 3JQBC 1TVEA 2QQ5A 4FCCA 2OUIA 3RU9A 5TJ9A 1B8UA 2D59A 3AY3A 3PPIA 4IPTA 4NPCA 4PRKA 4XDYA 4L73A 4FJ1A 1U3UA 4J16A 4RORA 3FF4A 4NDNE 2Q49A 5JY6A 1LRJA 2P68A 1LLQA 5DF1A 2JD0A 1ISIA 2VHYA 1CIVA 1FK8A 3T7CA 4R1UA 3RD5A 4M89A 3I9MA 1JVBA 3MJTA 5IZ4A 2W4QA 1VJ0A 4B4WA 3PHLA 3GZNB 5JFOA 1B8PA 4UREA 1EK5A 3QVWA 4IINA 1IY8A 1JAYA 1Z45A 3BXXA 4CR8A 1YDWA 2DQ4A 4OKIA 5A5EA 4J3FA 3ITDA 4NK5A 4HFJA 3VTZA 4OXKA 1W0CA 4J9UE 4AJEA 5ITVA 3BMCA 3UHAA 4DLLA 4X54A 1LBEA 4XYGA 4RVSA 4KTTE 1E1KA 4A2CA 3EHEA 3KYCB 3OICA 4H15A 4J7CA 4ZA2A 2OBYA 2YDXA 4OOEA 2R6JA 2BFAA 1JU9A 4R5MA 3JQBA 3LC7O 2PD6A 3S2EA 4FFMA 3GNTA 2OOSA 5BSGA 4CM9D 1PZEA 2NTNA 4QT0A 1VM6A 2NVWA 2C54A 1Y5MA 2VHVA 3K9QO 3HZZA 3RC1A 2CF5A 1FDWA 3G0OA 4TVBA 3NJ8A 5EESA 1BXKA 4Z3DA 4XRRA 1KS9A 2X9NA 1OI7A 1ZK2A 1RM3A 2TMGA 4QX6A 4CL3A 2CD9A 3OMLA 2JKVA 3ONEA 5JW6A 4FFPA 1P0CA 3W4JA 2PY6A 4RZHA 4BGIA 5KJEA 4F46A 3A28A 3F9IA 4OSOA 5I7VA 1K2WA 1TXGA 1IPEA 1Z7EA 1U3WA 2HRBA 4GGPA 2EHDA 3WGHA 4QFDA 3S2FA 2UVDA 1PL7A 3QJ5A 2VHWA 5COBA 1E77A 1CEQA 2IYOA 2AG8A 1E5QA 3DBLA 3PXXA 3CIFA 1DLJA 1KEUA 1I33A 9LDTA 2NQ8A 3UICA 1IOLA 2PA3A 4PLCA 3BAZA 3FD8A 4CM7A 4DYVA 3U4HA 1UDCA 3DZGA 4AVYA 4DVJA 4HKTA 4RLSA 4EJMA 1XELA 2O3SA 1Y5RA 4U6QA 4ALLA 1EVIA 4GSLA 1YWGO 5JDCC 4Z0TA 1E6WA 3ZWNA 1HKUA 3Q9UA 1JKIA 1QG6A 3PQEA 3WXBA 2G76A 4CM1A 3PZBA 2DBZA 4YBZA 1LRLA 1ZSYA 3EVNA 2DTXA 3DOCA 1BG6A 4NMHA 4I5GA 4U8GA 1F12A 1QLJA 1FDTA 2EGGA 1ZXBA 4BGUA 4J2OA 1LDEA 1YDEA 1X7DA 2FY8A 2G1UA 3WJAA 1AXGA 3ETDA 3QRWA 4RZIA 4BNLA 5U9CA 3NKLA 1QR6A 4CQMD 5A9SA 2YFHA 1HYHA 3KVOA 1R4MB 1DOHA 3RFXA 4H3VA 4CMJA 3PK0A 5CEFA 4JQCA 2C82A 1Q1NA 1K3TA 2ZTVA 3LSYA 4M55A 1T4DA 3H5AA 4MVJA 3ZW9A 2EIHA 1ENYA 1EVJA 1YB5A 2HCTA 3ADPA 3JD0A 2ZYGA 5JYEA 1ORRA 5I8ZA 3FWNA 3IC5A 1EUDA 4L0QA 3TN7A 4ROSA 5K9ZA 4YQZA 4D3SA 4FC7A 2ZTMA 4PG5A 9LDBA 1KYQA 4A73A 1QYCA 1UJMA 1V9LA 4ZQBA 2NVBA 2VWQA 1T2AA 2HDHA 5TX7A 4CLXA 1HSZA 4LCJA 3RUDA 3ZZNA 2FR0A 3QY9A 3UN1A 4CMEC 4CV3A 1GUYA 4YB8A 2VCYA 5JDCA 1P31A 3EUWA 3E82A 2XXBA 4H16A 4EYEA 3U4CA 1DXYA 1GYPA 4NBVA 5JNLA 3KEQA 4BNJA 5A02A 2HLPA 1E3JA 3F46A 1XIVA 2JD1A 5KVCA 1T25A 2P4QA 4J1SA 2RH8A 1V0JA 5A9TA 5CEJA 5JMWA 3GNQA 5K6AC 5HRUA 4E3ZA 4BKPA 4JGBA 5G0VA 2I5PO 3JD4A 1HE3A 1P1HA 4XYEA 2YQ5A 3I5MA 1KVQA 1Y8RB 3CE6A 4XA8A 2JAPA 4WCFC 5DP1A 3FBGA 4BKOA 2C2YA 2PZKA 4PCVA 2AW5A 4U0KA 4A03A 1LC3A 1NHWA 3EY4A 3JYNA 3NYWA 4JJGA 2ZJ0A 4K26A 3HDQA 4TRMA 2P5UA 1UAGA 3GH3A 1YXMA 3HDJA 3I4FA 1R16A 1ZJYA 2O3QA 3N74A 1MX3A 1XQ1A 1NP3A 2AQKA 4Q3AA 5BSEA 1LSOA 1LDMA 3H8VA 5KVVA 3DZIA 2PFGA 3RAJA 3GHYA 4A7PA 2Q1TA 3L6EA 3ICPA 1KC3A 2HAEA 3NX4A 1MA0A 3EZYA 4KQWA 1DLIA 3GVIA 1HDXA 2G82A 3BZUA 3PVZA 3E6AA 4INAA 3AUUA 1WMBA 3GPDG 4YAIA 2O3JA 2AHRA 1O95A 2EW2A 4II3A 2FN7A 3LDHA 3A9WA 2IODA 3G17A 1K0UA 4Y67A 5A4DA 3CPSA 3K31A 3OJFA 3ZU3A 4KUEA 4JK3A 2JHGA 4XQ9A 3ZWWA 4CMEA 3OIDA 2Y1EA 1ADCA 5JXWA 4NQZA 3ZH2A 3FNHA 4JBGA 2Y66A 3B1JA 2PNFA 5FI5A
chains in the Genus database with same CATH superfamily
1Z3CA 3GJRA 3KD3A 1L4UA 2IUSA 2WHEA 3HYNA 3Q3GE 1A9XA 3V4RA 4P92A 4AJJA 2DF8A 4TXHA 1P7YA 5AR1A 1AMOA 3IL2A 1LBHA 2RH9B 2YYYA 1ZQ1A 3ES9A 3DDZX 2WAXA 4TL6A 2LP4Y 4XPIA 3LK7A 4YTEA 2AQIA 5K6AA 4TZ6A 3X2SA 4OHVA 1IJEA 4P54A 6NULA 5JQWA 3L7LA 5DK4A 3ZV5A 2XRZA 2K2QB 1I30A 3EXHA 3GX1A 2I0FA 1OCEA 1DIHA 2C77A 4GE3A 4QBIA 1MMFB 1JNYA 1OY1A 4XYLA 5CYOA 5FR2A 4RPGA 1TLLA 2EC5A 2CYBA 2XF2A 4MVJG 4PLGA 4WNIA 3TCXB 4AP6A 4YHHB 5F9FA 5AXAA 3DLBA 3H2YA 4HWSA 5EJAA 2EX1A 2PX5A 2GN0A 2ZI3A 1AZLA 2D2VA 4ND8B 4DLXA 2HIAA 3WAGA 1X7GA 1KVUA 2VVTA 4YRFA 1GTG1 3FDIA 3HKDB 1CK4A 2H2AA 1XROA 4RV4A 3IR6A 4FU0A 4GMHA 2XQJA 3C1OA 4LA4A 4NJEB 4ZCMA 3TIFA 4V03A 5SYNA 4R9UC 1HTBA 2XDAA 3F5MA 4RFSA 5CNMA 2R1UA 3BWCA 3CMMA 5TT0A 1VP3A 2FZVA 1G8FA 4X84A 4CIDA 2BBTA 3A9SA 3WNVA 1TZMA 3C3KA 1UBSB 5KWVA 1RVDA 2B3DA 3D43A 2JGLA 4ZEVA 2GEBA 2PU5A 1N5OX 3ED1A 5K01A 1XEFA 3BMNB 1NR7A 1GZ4A 4A0GA 1TCCA 2R62A 1G2QA 3AESA 1D9XA 3L1HA 5IUNC 3TSOA 1RZRD 4RPJA 3AI3A 3LVBA 2H29A 3S28A 3IQWA 3MUEA 1JXQA 2O8CB 5B6IA 5DYIA 4JR1A 4ZJYA 1PKEA 1JX6A 2QTVA 1A4XA 1NUPA 1UPBA 2A5DA 2HCJB 3KVVA 3O9VA 4TLDA 3EPKA 1JSZA 1M2HA 2B1GA 1GFWA 2VPWA 4KVFA 4DZTA 4DSZA 5IVPA 5JWOA 5L7TA 3ESCA 3IO3A 1G9XA 2BIFA 1V26A 2QLLA 1WM1A 2C97A 1R6TA 1DXOA 3E61A 5D1HA 4BMNA 4YJ3B 3BC1A 3OOSA 3K0AA 5C1PA 1HEUA 3SY8A 2WAOA 4CMHA 3COYA 4DV0B 1K66A 4HZGA 2PPLA 2XNHA 2PLAA 1QG0A 1EFHA 4IIUA 4KYUA 1ZICA 2WF6A 5EKUA 2XWQA 5IG2A 4FTWA 3B8HA 3IJ5A 3FVTA 1VG9B 3UMBA 5LUAA 2WINI 1NQTA 2X4GA 4UASA 1J8MF 1BMFA 1W1UA 3H3FA 4RA6B 4RU1A 2C7VA 1RXVA 2A9KA 1X42A 2P6OA 3MJHA 1DV2A 1O4WA 3B36A 3BE6A 4JHLA 3ZWVA 4B3GA 1YB2A 3A11A 3AHCA 2VZ8A 4WWHA 3OLWA 4HEHA 4FIDA 3LP6A 3N87A 4B45A 4UD2A 3KZVA 1YOVB 2UYOA 1QGOA 2X9VA 1U2TA 3OCWA 4RTPA 4W5RA 3C7KA 3SLRA 1S3GA 3B5EA 2OORC 2QIPA 1DQRA 3PKIA 3G2IA 4L8LA 5K2MA 5L40A 5DI3A 3RKUA 4B0PA 1DIGA 4F4JA 4FE3A 1VLQA 2RHOA 3FFWA 2GHTA 4PLWA 4YRAA 4X0EA 3BL8A 3HCWA 4J76A 4EDHA 4MUMA 5KOIA 4PQEA 4WLEA 3VC7A 4R5HA 4WUVA 1G5RA 3GJ8A 5BOSA 1CY4A 1YCDA 2ZAGA 3ND9A 1AMUA 3C6XA 1NBHA 4CEHB 5EMHA 3VKHA 3WICA 3UY4A 3RT9A 3WQQA 2EEPA 1UPXA 2FMFA 4PCLA 4V2IA 2QVCA 1SKUA 4LGMA 3H2JA 4CM4B 4EY5A 1JG3A 2WW8A 1TMOA 5FXMA 4HT3B 1ECBA 3QEBZ 4QXAA 4OHZA 2X0IA 2FKNA 1POWA 2XVZA 3WV4A 3O8OA 2O3UA 1UZAA 3KYDA 1BE0A 3UT6A 3J80A 3K70C 1YUMA 2NIPA 2MHCA 2H00A 4IDGA 1K7YA 1NLFA 1UPCA 5EAIA 5A05A 5CB4F 4IX1A 5G2OA 2VUSA 4PBSA 2WPDD 4RK6A 4WOKA 3L6DA 4M4SA 4G8CA 4J0DA 4NTZA 1IU9A 2YXNA 1YQGA 1FP6A 2VJMA 1UIMA 5A04A 2VBGA 4Z7QB 1LK7A 5IK2D 3CYFA 3USES 4M2LA 3IP3A 3ME5A 3C70A 3VZQA 1KQNA 3THWB 1W4BA 5JZBA 1CZLA 4TTIA 3ZWBA 4UM5A 1CJSA 2ZIWB 1EAYA 2QT0A 4E5VA 1TPZA 1NBEA 3AINA 1RLTA 4O2BF 1KAGA 2HLDA 2FFQA 1H3EA 5LQJA 4L4SA 1YAHA 5HHTA 3GQBB 4N4AA 2E2WA 3QA9A 1P7PA 1YJ5A 3U16A 2FN8A 4XM0A 1XQVA 4ED9A 3AF6A 4XJSA 1WDKA 2E6KA 2Q3DA 4W9NC 4HGRA 4QECA 1NKVA 4KIWA 4DLSA 5CDGA 2VHCA 1HFKA 2BUBA 3QMMA 1E1RA 2B7LA 2RH4A 1PSDA 4QGAA 4I2NA 1GPBA 2ZWMA 4IS2A 4KP7A 1SXJB 4CMAA 5B4UA 4C3ZA 1B2RA 4LXGA 2GCOB 5P8WA 1ML3A 2MMGA 4P38A 2QRJA 4J0KA 3AFIA 2HI0A 4ALKA 4FQ8A 2CXOA 3C1TA 1H93A 3BILA 1I5RA 1KVSA 2VRCD 2NUAB 5AK6A 4EHJA 4BATA 2H16A 1K6EA 1VGRA 5IEBA 5ADHA 5KNDH 3LVQE 4KLAA 1HZZA 2DSNA 2RGWA 5C8YF 6Q21A 3WYAA 4BBAA 3DMHA 4L7QA 1ZK0A 3VAAA 1IZ0A 1U81A 3EZFA 4K6KA 1TEHA 2YUTA 3UENA 4N6GA 4AYXA 2XH8A 4XWWA 3EOZA 2BHNA 3K20A 2VDJA 3T9BA 4IDAA 5KTSA 1OWNA 2OGUA 3GI1A 4FPXA 4QNNA 1HLDA 2AJDA 5LL6P 2XBMA 2VDUE 3PGJA 3Q2KA 1BSVA 2I4MA 4TMZA 3OX4A 3V33A 1WXWA 2C9CA 4CN8A 2O23A 4DANA 1VYVA 2HNKA 1PHPA 1HTWA 2E4ZA 3KPJA 4MI3A 4C21A 5BQXA 4J1TC 2PXXA 3ZXSA 4G9GA 1M5TA 1ULBA 4NFHA 4RYDA 3TL2A 4X8HA 3D2AA 3U3ZA 2VNSA 5JXIA 1NY6A 1ESMA 1MB4A 4ZQHA 3DBHB 4DABA 1I6LA 1ZH6A 5ELXA 3LVFO 2XGJA 4NBNA 2OHVA 1R4NA 5WRFA 1S8OA 4K9OA 3ENNA 2WRZA 2C1ZA 5DOZA 2V55B 3I30X 3YASA 1T8PA 4L76A 1I2ZA 2OSBA 4CETA 3OBBA 4F4FA 2UUAB 4BO1A 1S6YA 2DMRA 1QZUA 1AGNA 1NFQA 1GZDA 3HR4A 5SZJA 4HFNA 1D4ZA 3EJ6A 4YRKA 5HQJA 1X1AA 3IDZA 3TM5A 3V80A 5TPZA 3TDMA 4OMFG 4O2RA 4MQFA 3HU2A 5CVUA 3G8AA 5IXYA 2IZ0A 1C9DB 5KTMA 2RB4A 2Z3ZA 1SG9A 1IB6A 4NP6A 2Q3FA 4HI0E 3E5HA 3S0JA 4LJ9A 2PUWA 1T26A 2ID4A 1WUKS 3I9LA 4JI3B 1GLVA 4LQ4A 1SR8A 3GUHA 2J5QA 4PLTA 4QDOA 3FUVA 4YECA 1PD1A 1YACA 3ZU2A 4YCNA 2TMKA 1DRWA 1T1JA 3T0FA 4ZFNA 3I8SA 1D0IA 1T34A 1YS7A 2FMHA 1WB5A 2AKYA 1E9AA 2PPVA 5MFPA 1YFZA 5JVDA 2UUPA 3ZIAD 3BA1A 1U4OA 2KHZA 2FOIA 1WMSA 2EDAA 2W2VA 3I53A 5IVHA 3GLQA 3EW7A 2OO5C 4G9EA 1X7YB 3WLQA 4YO7A 3AF5A 1OJLA 3DVAB 2QU7A 3I0MA 4TYMA 2YIVX 4YT5A 3X43A 2H4YA 4B87A 4R7TA 3ZYZA 4Z54A 3I9NA 2XI4A 5ALZA 3CGGA 3W8RA 3TBFA 3KJNA 4FHEA 3DBIA 2H5JA 3F97A 5BWOA 1Y9JA 5E4TA 2MR6A 3VPCA 3GFTA 3IKTA 3WNQA 1HNWB 1EDDA 2Q3BA 2HIGA 1GYQA 3LP5A 1A72A 1KAMA 2BFEA 4KDEA 4FFNA 4FFBA 4Y6SA 2WJ4A 5JDIC 1S7GA 1VSUA 1XN1A 1Y5LA 3FUUA 1NZDA 4ICIA 4KE9A 4V0KA 5I7UA 4OIFA 5AKHA 3EBOA 4EW1A 2P2DA 2C7PA 3TJZA 3D3WB 2E87A 1U31A 4EX6A 4IZ6A 3T7IA 1RM0A 3SQLA 5GQSA 3JWHA 5AVQA 4YP5A 1PUXA 3VU8A 1KFCB 4HLDA 2IYZA 3CZ9A 1S2NA 4IEFB 3ROMA 4KX3A 1OI4A 1BX1A 4ZANA 3VXKA 2VIIA 1F20A 3T3MB 4UDYX 1B8OA 3D8SA 4MUGA 1E1CA 5L3VA 5TQJA 1YH3A 2GH1A 2VF7A 4NFYA 3LWZA 4Q9JA 4Z4EA 1WCXA 2G9RA 4CFSA 2CLEB 1JEDA 1CFZA 4OHMA 4W63A 4Y2QA 2ZBRA 4HDSA 1MT0A 5KYUA 2IS1A 4AKEA 3JVDA 4GS5A 3RDPA 1JHUA 2I6QA 4PLPA 1HWYA 2A5JA 1MXFA 3G68A 4F86A 4LYYA 3RVPA 1QFSA 2DWOA 3BF7A 4MW2A 1JECA 1Q17A 1PWZA 3LUPA 3O3NB 3W6UA 1JR3A 2H5EA 1VIMA 3LYLA 3HB1A 4IFTA 2C3YA 1H9AA 1I2BA 2EF1A 2PSDA 2XYVA 1BOFA 3GO4A 2Q5LA 4L02A 2O8VA 4GMGA 2OT3B 1DBPA 3ZWCA 4IHJB 4J49A 3QFFA 2PHZA 3NWPA 4J3JA 1TRHA 5LP6B 1EVKA 3IDAA 2OB2A 1SCKA 4OAOA 2Y6UA 2XMPA 2WJVA 2Z43A 3TI7A 4DC1A 5ADUS 5CIYA 4YJ3F 2LZ0A 5A3SA 1IEVA 3T5PA 3MOGA 3OO1A 4ZAFA 1L8OA 1C7RA 5J5VA 5SYAA 3AFNA 2ODQA 4MGZR 1MW8X 1CUBA 4JP1A 4PFSA 4GOKA 3CNQS 2R5WA 1VPWA 2P2ZA 3IYLW 3CF6R 3G2QA 2FFJA 2QX9A 2Y05A 1ZIPA 2OFPA 3E9QA 4DY4A 1GNPA 4WVLA 1X7HA 3OU7A 4D9MA 3I9JA 4DCTA 3NOVA 3QPBA 5F1OA 5KQSA 5K0GA 1O94D 2NXNA 4PNEA 3QOFA 4YI3A 3OJ0A 5CFMA 5LU9A 5AW5A 1GRRA 3RNOA 2LCIA 2XOXA 1AZSC 4EPXA 4HNUA 3AV3A 5C7IO 2DKNA 4D02A 2EVWX 3AEYA 3EW9A 1R0YA 5TB5A 4B84A 1W2WB 3K15A 2VAVA 3WRYA 3I01A 1K7FB 3V4VB 4QD3A 2Q5EA 2W22A 2YHIB 2F43B 1NT4A 3UK2A 3RI3A 5EWLB 2Q5CA 3B20A 1TT7A 4PM4A 4WLUA 3X1WA 4CIAA 3GGCA 4M8SA 1J09A 1NX6A 2GJAA 3KSZO 3LC1O 1RRCA 4NU6A 2AJCA 4BECA 2OENG 2D74A 4OAPA 1SQ6A 4QYXA 1EVYA 3OFVA 4PCUA 1VL8A 1OH8A 4Y0AA 1KR5A 3NOXA 1MABA 5KCMA 3ZQKA 1DJOA 3F8WA 1OA0A 4DV7B 1UJ4A 2QYOA 1EE1A 5AXDA 3RE1A 3VKFA 3BJZA 4N6NA 1XMVA 4UEWA 2W70A 2XMCA 5KYVA 1MCZA 1P3DA 2Y0EA 3RS5A 2A1UA 2HJVA 4QU0A 3ET4A 3HTXA 1D4AA 1P1FA 2JASA 1E5TA 4QUAA 5REQA 2Q7DA 3SVZA 4LDJA 4DPKA 4MPDA 3AB3A 1W36D 2ZUDA 3RRBA 1TU0A 2R2AA 3OP1A 2IE0A 1AKEA 5C0OE 5F3WB 4NZZA 2ADFA 3C14C 4K7JA 3OPXA 3SSOA 1XBTA 4WLOA 2B4YA 2Q41A 1D8AA 2O3TA 2YZMA 4OQDA 5BY2A 1FJ2A 3O3MB 1HE2A 4Q93A 1ZA2A 1AQLA 2GESA 3B9BA 2EP5A 4DKJA 3SHQA 3BB4A 1EEHA 1F8FA 1JHXA 1RS0A 3NUZA 4HOYA 1Z0UA 5FUVA 1G8HA 3CZRA 1WXHA 5KAMA 4BKUA 4RX1A 5JR3A 3EEQA 5GJCA 3H6HA 3R0QA 2FPIA 4D74A 3V4FA 4W5NA 5G0TA 2JGDB 3DXYA 3VSCA 2ZXUA 2C4UA 1E9RA 2PS3A 2E18A 3W5SA 3WIOA 1DJPA 3TNDA 4XWOA 4DUZB 5AH0A 4EDFA 2GEDA 4TXJA 2V4ZA 3EF1A 3EQ2A 3GUUA 4JJ6A 5C5IA 1YE3A 2HHLA 2RKOA 3L6OO 3TL6A 2XZOA 2GJ9A 1UL1X 3G2NA 5D87A 1S7CA 5BN3A 2YVAA 3BB3A 4H0FA 1ULTA 2HWUA 4HGZA 3KB8A 2VDWA 4AN0A 2YKGA 2X0NA 2QSUA 3ECAA 1C3VA 1PK9A 4ZJPA 1DCKA 2G36A 4TKVA 2C03A 1JZSA 3BTSA 3RS0A 4F11A 4M0PA 3R9XB 2JAXA 3K96A 4BIMA 4G36A 1R0KA 2YVQA 1UPTA 3CVJA 3ON5A 3VDXA 1ZEJA 4L6CA 3FOZA 1SXJE 4HSEA 1OMOA 3VVLA 3EVCA 2OZLB 4F5YA 1IN5A 2X42A 3C43A 1NU8A 3EXIB 2BKLA 3MK31 2O8DB 2QJWA 2ZE5A 3STWA 2VK4A 2CFSA 3FAZA 5T6BA 3W8NA 4BC0A 4RF2A 2BFNA 1FZTA 4HR7A 1Q0PA 2HQRA 1AHNA 4Q9HA 3A9VA 3PP8A 5F51A 3T9FA 4AKGA 3IE1A 1RHQA 2NVUB 2D5BA 1DU4A 3MLEA 3GG2A 1V3TA 3QXHA 4G1UC 4OHUA 5CDUA 2RD2A 4X7RA 4R2MA 2I78A 1CHNA 1WUYA 4N41A 3EBLA 3PVSA 4EA7A 5EJIA 3KKPA 1FYXA 1USWA 1ZNYA 2DP4E 2DWCA 3WOHA 4TRJA 4DLZA 3TQSA 5HRAA 1WTCA 5JSFA 2QJTA 1UZUA 1T3TA 3FN4A 4MVJI 3D6JA 2P9CA 4HEJA 3GFBA 1UBKS 3RC2A 1ZM2A 5GIPE 3ZHUA 2VXOA 1JLLA 4MV5A 4W8HA 3H4IA 2FX5A 2RKBA 2BBOA 4V1CI 3QK7A 2OBLA 4M0LA 4TV9B 4X1IA 3BMQB 3A2MA 4MRMB 2YZNA 3I09A 3VPFA 4I1RA 2X8JA 3IT3A 4BX9A 2IBTA 4FEAA 3T9EA 1FDUA 3ZJYA 3RLFA 4CDRA 5LXTA 5AKKA 1G7SA 5SY4A 2VDLB 1PR9A 1G1AA 2CK3D 4N9QA 3OM9A 1K8YB 3V8MA 4RTNA 1G59A 2Z83A 3HUUA 2OGSA 4ILKA 2Z8XA 1Z73A 2C59A 2POCA 4LTNA 3WLAA 4RVHA 2PX6A 4GXTA 2Y1XA 2Y93A 3OM1A 3TVYA 4AT1A 4CTOA 2DCMA 3IOYA 3KCQA 4FR5A 3KOYA 1SXQA 2QPOA 1JPUA 1XZGA 3SIPA 2A9JA 2E4WA 3N2EA 1WPXA 3PIIA 3N8HA 5KB3A 1UINA 2H9YA 4JEMA 1HLPA 2J85A 3TD9A 4YPVA 1WB4A 1SXHA 4X63A 5KIAA 4DIKA 1I5EA 3OLXA 1PFWA 3GJZA 1JHAA 5MF6A 1C0IA 3EH1A 4DPLA 3PHBE 1OZ0A 1GZUA 2L2QA 2QLBA 1MIOB 2G9VA 2RDMA 3JWPA 1XHLA 4ZU1X 1P33A 3SEAA 4C22A 4WKGA 2CZQA 4D0LB 4DA6A 3BPSA 4BQFA 2DPMA 5FV4A 3U80A 3KOZA 1F4PA 2D0OB 2V3WA 1AA6A 3NTQA 2PTGA 4JLAA 3A6EA 4YROA 4B75A 5JZOA 2R0QC 4EJSC 4XARA 3CUYA 2JH8A 4DJDC 4JDUA 3UC9A 3K9BA 3KQUA 3D54D 1ID1A 1KJ9A 1W59A 3MINA 2AVDA 4H2DA 4I1OA 4M1KA 4Y6GB 5K09A 5KUTA 5KX5A 1TTHA 2REBA 2QX6A 4R1TA 5EA2A 2ZJZA 3W8FA 3VO9A 2PYIA 3G2MA 1BCSB 4GBMA 1Z2PX 2Y2UA 3STUA 1EZZA 1WA5A 2F67A 2B20A 3O82A 2VRBA 3SQOA 2X6RA 3BJIC 2I87A 3CO5A 1ISRA 3SDBA 3VH3A 2F8LA 5JJKA 1G4UR 1WVIA 2ASEA 3ANTA 2QI9C 4I3FA 4QOHA 3RU3A 2QPLA 3DOJA 5DM4A 3X1YA 3TQIA 3DXFA 1ZBDA 3HL0A 4HB3A 4AK9A 2ISCA 4GQBA 4HMQA 2NZVG 1BJRE 3V4ZA 2GPAA 3CR8A 3DAFA 2E89A 1BKDR 3BH6A 5HVNA 5AKGA 3AVQA 5AVVA 2G25A 4XX1A 2J0VA 4QO7A 4TXLA 4HRXA 3SS8A 3MTJA 4FCTA 2OCYC 1TX4B 1UXJA 1KJQA 4KMOA 1V5FA 1Z6GA 1D0SA 5CK4A 4J0EA 1HT1E 2PZGA 2X15A 3KKOA 2R8RA 4A27A 1JEYB 2FYTA 2H59A 4OJQA 2SCUB 2GR9A 1R4MA 2R751 3S8YA 4HTAA 1NATA 5ERXA 1E8NA 1XYGA 2GJKA 2PD4A 3MCVA 4I1YA 1GNRA 4O3FA 3B6EA 1W5TA 1DRVA 1YDGA 2H7VA 2P9FA 4J6FA 3N70A 3H5LA 2H8GA 2GM9A 2ODAA 3LQ1A 5U4QA 1M6YA 1R6UA 2O6LA 3REQA 4BJ1A 3MWJA 4DBVO 3OCJA 2VT2A 5BSWA 3C3EA 3W6ZA 5KAPA 1LC0A 2HK6A 5T67A 4YT4A 3T3EA 1ORWA 3HSSA 1DKQA 2B36A 2OA0A 4FD3A 4GI1A 2Q7XA 3CUKA 5EL0A 3R7NA 1WZNA 4PN7A 2EF0A 3PFGA 4BFTA 5LP6F 1UM9A 1UBNA 3SNHA 1KQGA 3DE0X 2DJIA 1R5OA 4J1QA 4L5BA 2I1QA 5IF9A 4LXHA 3AF1A 2FHSA 4GH5A 4YA6A 1N0IA 2OB1A 1QP8A 1X0XA 4XDZA 2C8LA 1YA8A 2GEKA 4HF7A 5J47A 3V1NA 3ZWMA 2V7QA 3U7GA 1JFSA 3AHHA 3PEFA 3VSEA 3UHJA 7REQA 3WVNA 3BJMA 2XUIA 4YAKA 3KQLA 5KTRA 1UJCA 2QM8A 4HX9A 4KGXA 5BPFA 5ARDA 5K8LA 2DLNA 4F3RA 1GV0A 2AFHB 2NU6A 4NU0A 4O4HB 3KKEA 1REQB 2FZEA 5DKFA 5CLJA 2DUNA 5FPQA 4OL0A 3R7AA 4BEVA 3LY7A 1NYRA 3MS2A 3PUYA 5IM4F 5ISMA 3ZU4A 1E1QD 3BCUA 3TOSA 3E22A 3NJ4A 4M9XA 3H2BA 1Q1AA 2V45A 1V6SA 1W52X 1DGQA 2HO5A 2IU3A 5CIWA 3D59A 2Q5OA 2Y0BA 3GZJA 1FFBA 4FI3C 3ZDQA 1H42A 4PWYA 5JRJA 1VIAA 1UKEA 3EHDA 2B2XA 1N1GA 3D1LA 5EPOA 4BAUA 1HNNA 1W6RA 2A88A 4HS4A 4FD2A 2DT8A 3F7NA 2AOTB 3O4HA 4BLQA 4IJKA 4EP1A 5CFNA 4UE3S 2B5OA 1WD5A 3IOCA 4I9UA 2DUWA 4UBLA 5DBFA 1N0HA 1MKYA 3U4QA 1A1VA 3CRRA 1U2GC 2VDRB 1VJCA 1YRAA 3FRHA 2PXAA 5H3HA 4NE2A 1PYGA 1X7ZA 2PT5A 4LWPA 5M29A 2GVNA 1IMOA 1U02A 3SDSA 1PUJA 1Y4UA 4OQEA 3JY6A 2FWRA 1PGJA 3LHKA 4F3KA 3O0TA 1QHYA 1SD1A 4EUFA 5IHPA 4RVOA 1UMKA 5CJPA 2JGRA 2XMBA 3DW3X 1SO8A 2DUUA 3IFSA 5FORA 4AMBA 3F2IA 2C83A 2IZ6A 5LZ9A 2ACKA 3WA7A 2P41A 4BXOA 4O02B 1W29A 1CG6A 1W4AA 2CJPA 4KQGA 3H83A 3R3ZA 2ZSKA 1JQEA 1IQ0A 1NN5A 1OYWA 1IAQA 3RRNA 3G49A 1UFOA 4UKDA 2XCRB 1PFVA 2B34A 4FR0A 3E1SA 4M7PA 4ZYTA 2C5LA 4AJ1A 1HYGA 4DCCA 4MO2A 4CMKA 4F60A 2VO1A 2PM8A 1E96A 2DFTA 1OYVA 2JFQA 4QAJA 1X1SA 4ZDWA 4JQSA 2RK6A 1GGMA 3WDKA 4DXAA 1PCXA 1J9GA 4KR0A 4LYFA 3HJFA 3VJRA 4PZLA 4J0HA 1GDTA 1VE6A 1TFUA 2H06A 1XG5A 3IBTA 4FGKA 4H7HA 1Y9ZA 4TSFD 5KQPA 5KBYA 3AONB 1JEOA 1G7TA 2BEVB 4W82A 1QBKC 4DARA 5CCEA 3AO0B 3PD0A 4B82A 2FPPB 3FMFA 1ZI6A 2GUWA 3WRXC 3DWFA 4OIMA 3IKJA 4M7OA 2O3RA 5C5CA 2QQ0A 3ELDA 1UK8A 3A0RB 3IKLA 2RKWA 3KLOA 2R00A 1GKIA 3OKPA 3PG5A 4JQZA 4TLAA 3TFOA 4MUEA 3ILVA 3QEOA 1EZ1A 1S3SA 2N1BA 2ODEA 3MAGA 4P7FA 4MIYA 4U2FA 4GQIA 5H3CA 5M3BA 5TS2A 5LQDA 5BORA 2ZB3A 4U5QA 2ZG6A 3C8DA 3X2FA 3K30A 1RJDA 2YQZA 3BJEA 2WA1A 5HDBB 4FXPA 3GRPA 3WLPA 3GP8A 1XKQA 1ODCA 4OGKA 2FRDC 3SYMA 5KYWA 3OWHA 1QHSA 1SIUA 1V8FA 1H1LB 1NRIA 3QBVA 4KQKA 4KC0A 4Q9NA 1ZAKA 3L07A 4GWLA 4XQGA 3WHKA 4B3FX 4JXZA 3GXBA 2ZSFA 3ZZMA 2ZRGA 2ZBFA 5K0JA 3N1UA 3LHIA 1A1SA 3UBTA 1T3HA 2DC1A 3GT3A 3DDNA 5HJEA 1RVV1 4LY3A 2O8BA 5TLSA 4NENB 2F1IA 3VFDA 3JZIA 4IUCS 3OPQA 4XOIA 2QTCA 3OHMA 4H1UA 5IHXA 2ZYVX 3ZDCA 1P7ZA 2VQFB 3AM5A 2A94A 3KQVA 4D41A 1XXHA 1UBFA 1SCNE 1BO6A 3WFJA 4XUEA 5EE9A 1ZMTA 3AJEA 4GXQA 4QC2A 3WP0A 3L82B 1WW2A 2HSJA 3QOYA 5D00A 1HMYA 4IS3A 5L3ZA 1PT9A 3AYZB 2A9OA 3JAWB 5BV1A 3HXTA 1B0UA 2RGNC 3KAKA 1DC5A 2EFGA 4EW2A 4TTTS 4TV9F 5EY5B 1DRJA 4OY3A 4K1XA 5ALSA 1PWYE 1S8AA 3MTIA 1U4NA 2WEKA 4DAOA 4A3SA 2CE2X 1ZCJA 2DHCA 4NCKA 3KG2A 4QARA 2E49A 1I1HA 2XZDA 4YFYA 5LLSA 1MFZA 3HB5X 3J7TA 3VOBA 1L7AA 4DZZA 1PX0A 2VZ0A 4Q9KA 1DJLA 1VE9A 1Z34A 3O3OB 3P0JA 2ZXFA 4RXTA 3GAMA 2ZWVA 2Q6TA 3D02A 3FHLA 3QZUA 4IICA 3R76A 3EGIA 4J0QA 3GYGA 2ZBPA 4G5GA 2C95A 4JBNA 2EWVA 2W8ZA 3B78A 2VYCA 3EIHA 1YK0A 5GTDA 2Z2KA 4JLWA 4WY8A 4YEDA 1LLCA 5BN4B 2C8VA 3ASUA 1B3BA 2CZCA 2VT6A 2VP3A 3G6KA 5FFFA 3L2OB 1KYIA 2AZMA 5FJJA 4N0DA 5HCNA 1WL8A 3BM5A 1ZL2A 4LW8A 3HKCB 5KYXA 3R7BA 1BJKA 1KKLA 2ZT6A 4MW6A 3K9LA 4MICA 2G0NA 4P5DA 1QVVA 5JWHA 3I01M 4PYKA 1R9GA 2BZGA 2AEJA 2A5GA 4BVAA 4E5UA 3A4NA 1SRRA 3KKLA 5I6DA 3FZEA 2C42A 5FBRB 4YDQA 1NP6A 1W2GA 5F5LA 1RJGA 4D8VA 4LRWA 5IANA 3AB8A 3ZJVA 5B58T 1Q0RA 3CUUA 1FRNA 3S5UA 4ARZA 3AFGA 1ECLA 4UDNA 4MUBA 4YASA 3TRKA 5BNTA 6AT1A 1O0BA 3TVTA 1ZU4A 2VA9A 2W37A 4BFXA 5HMMA 1MBZA 3KYBA 2G1JA 2JBAB 4QULA 3GLGB 1J2EA 4NLLA 1O96A 1H2FA 2ZE8A 2AUTA 2WAYA 3PA8A 2CV2A 3JRNA 3B7WA 5C7LO 1TUGA 4LDPA 2V8BA 3B6KA 2A14A 1KSGA 1A5SB 1OA1A 4JNKA 3SF8B 3UJBA 1Y5IA 3TQQA 3CW8X 1PAUA 5T4HA 3K0HA 3OQHA 1Y3BE 4R1PA 1I0IA 1ZISA 4YGXB 4P7JA 2BFBB 2I34A 2IP2A 5HFNA 3OQMA 2GLXA 1UKZA 5C46F 2NZJA 2NMVA 5AWFC 1KZHA 3FA2A 1W76A 3AUKA 3DHYA 3HY3A 3DKVA 4FMDF 3ZCSA 3VR0A 4A8JA 3PJRA 1XJ5A 4FT4A 1P9LA 1TYBE 3FFTA 5JI3E 4DCMA 4BUCA 4A8TA 1VQ1A 4ZZ2A 1BAPA 3LA8A 1H6BA 1H66A 2WA2A 3R8XA 4F3YA 2W0SA 4CJXA 2AC7A 4NBTA 4NOLA 3D1JA 4ZQIA 3UKDA 1E6KA 5BSFA 2RI6A 4JXXA 3UPDA 3QE3A 3N86A 1NYLA 2C9ZA 3WIEA 3WGZA 3IMFA 4ZEOA 3B2NA 2F3PA 1G5IA 4BJ6A 5A4AA 3RS7A 3SQDA 3GPIA 3VKVA 5C4MA 5EWMA 1KK2A 3JQGB 1AG9A 1NBAA 1W85B 1AK1A 1VFNA 1J0XO 2ACWA 3AB7A 4LE0A 4JI4B 1VG8A 2MINA 4GR5A 3KT3A 4KFTA 1YZNA 3ROFA 1BEEA 1OBFO 3ORSA 3F5QA 4XJXA 3RODA 1UAYA 5IJ9B 1J0EA 2O59A 2K4MA 1GKLA 1NTOA 5E3JA 3TGPA 4TUYA 1IXKA 2PX3A 5BSRA 4EY8A 1E0JA 3WBFA 3I45A 1HE4A 2WSSD 1MO4A 3CRW1 1Q0ZA 1N32B 1YFLA 4CM8B 4XRGA 1OROA 4B3HA 2EG9A 3NLLA 1N7JA 3T94A 1DIBA 3CY6A 4EK9A 4QKQA 4TLEA 1MO3A 1U28A 1JMVA 3FOAA 1MEOA 2QJRA 2XITA 4LSWA 3HO1A 3IQGX 5EINA 1V37A 1XTIA 3VSAA 1YHYA 2VLBA 2Y76A 3EZLA 2ZLBA 4ISCA 2HJHA 3AERA 2QP9X 3H17A 3HADA 3K1AA 2B37A 4DCPA 1PNVA 3OJWA 3V46A 3N0TA 1XTSA 1OPXA 4YAJA 3O8BA 1E7RA 3HMKA 2PG3A 4BVHA 2W2PA 4DY6A 5ALYA 1SCUA 4XQCA 2HJWA 2XKBA 4L3WA 4O4HF 4M8KA 5DX1A 2HJRA 4WCDA 3VNSA 1Q0UA 2J45A 3U7QA 2V0NA 5FKJA 4E7PA 1ZH2A 4QLAA 4TV8A 4J6EA 2AC2A 2EKPA 1PQWA 4GEKA 4UHDA 1M2VB 2MYNA 3HN2A 1PJZA 1UDAA 4DBZA 5JAQA 3EUFA 2ZWPA 3K53A 1FU8A 3FZYA 4WK0B 2RHDA 4LRTB 4Y1RA 4ZO8A 3FYTA 1Y7PA 4ZVPA 3G3EA 1Z5WA 4JYBA 3T3GA 4LY6A 2Z2XA 3CONA 3WHPA 4EENA 1WWKA 5B55A 2FEPA 4OUKX 5BNIA 1OR8A 3SXPA 1SKMA 4UCWA 3OD5A 4COKA 5DGHA 4E3WA 3OZWA 5B58C 5A7FA 1WAMA 4DR3B 3GRYA 2D7JA 1TM4E 3ENZA 1ZOOA 2R8ZA 3MRTA 1IJFA 2Z2ZA 3JW8A 2Y1OA 4DB4A 1Y6QA 1VZ3A 2W8BA 2LE0A 3JQAA 2WU4A 4HDCA 1PWEA 1HYBA 3FVWA 2PIAA 5TEVA 1XRNA 2C61A 3L18A 1GA6A 4TL7A 2G8NA 2FW9A 1BXGA 1E20A 1OHHA 4GEGA 3KS9A 4RQAA 1CR4A 1Y63A 1BX0A 1GPUA 3K0BA 3USZA 4J9VA 2VH1A 3WWEA 5CAEA 2WF5A 1PLJA 2EBUA 3IP1A 3BMCB 3CM0A 1MENA 2DBRA 2C9OA 1EJ0A 2CLLB 5KNCA 1QHXA 2W48A 4RDHA 3UM9A 3BIFA 3F7OA 1C3OB 2OAGA 3MJEA 3MHTA 2XB2A 2XAAA 2EWMA 5C4GB 4RZQA 4YAOA 1Z82A 1E1YA 1G4AE 1JR2A 1T8SA 3PFCA 3GEBA 4PGGA 2F8TA 5EYPB 1JWAB 3Q7RA 4MV8A 1M7BA 1P0QA 1OLOA 1QTRA 2VJCA 3MWEB 1XI2A 3FKSA 3PQ8A 4CMCA 3H0EA 1Q1EA 3PXDA 1UMBB 3QHPA 1WZ2A 1SCJA 2QR5A 2VP5A 2ZJYA 3CRMA 2GZMA 4FBLA 2ZIXA 3JWIA 1DINA 4BGVA 4JOCA 2ZYWX 4F5ZA 5DCYA 2ZJ2A 1IN6A 3KP1A 3EDMA 3OQ6A 3QF4B 4YACA 3MTBA 3RJ5A 4V38A 5FPKA 4M86A 1A8QA 2NPIA 5ICGA 4OQXA 3F5DA 4O1MA 3KZNA 4FP9A 4KGZA 4KQ9A 1F5NA 4RSHA 5A7GA 4BFZA 1N4AA 3LNCA 1BS9A 1JAIA 4Q4HA 3IAEA 3QOXA 4H6WA 3H2HA 4MAFA 4DJTA 1R74A 1DWOA 1I4EB 3KWLA 4NCHA 2XNSA 4EY4A 3PTAA 4G41A 1ZIXA 3NWEA 2JS7A 4MYTA 1DOZA 3MS4A 2CUZA 2LTAA 3BSYA 3S7TA 2JGIA 2VDQB 4NSNA 1W8IA 2GM3A 1U6KA 1Q95A 3KPWA 5L3SA 1WRBA 4IGKA 1Z0JA 2ZKLA 3H84A 2REXB 3O2JA 4Z0NA 2PWPA 1GL7A 2P2CA 2V1XA 2WKPA 3H5NA 3KTAA 3O21A 3SS7X 421PA 4YPFA 1YBMA 2VT3A 4TWBA 3DFUA 3MT8A 3FETA 1SZPA 4ZTBA 4X60A 1Q19A 2DT5A 3TLXA 1UJNA 3EARA 4Q3DA 2JLRA 3K8ZA 3KJHA 2I7VA 2L19A 2GK3A 3HVKA 4KKVA 4M99A 3EH2A 1VBKA 1N2GA 1IPFA 4QTTB 2DR0A 3HFJA 1RTKA 3CTPA 3KDPA 5ABPA 2ZCVA 3I6IA 3QX9A 2B8JA 4S2EA 3LQRA 1E79D 2C9DA 4G2NA 1A8PA 4DIFA 4II2A 5FL7D 1H2XA 3GUZA 4E03A 3AJAA 1JW9B 4OGFA 4N49A 1F7VA 3WMXA 3ZK9A 2Q1WA 2W0MA 4KJXA 1XMQB 1J20A 3IJPA 1KU0A 1VYTA 3VPXA 821PA 10MHA 1ILWA 3ZY4A 3MTEA 3QXGA 2J5RA 1N0WA 1WQ4A 4X8LA 3GH1A 3QMPA 1DUVG 3NV7A 1G5PA 1Y37A 2GZAA 4BN0A 4FZVA 4C03A 2X40A 4P4SA 4D3FA 4IAOA 2AZXA 3KJZA 2N9UA 4D3DA 1PQYA 3EVAA 4PCAA 1WW3A 1GXSB 1NXQA 3QEAZ 3WAKA 4H4CA 1SQGA 3SHVA 4AW9A 1Z9BA 1C3XA 4LC9A 3WY9A 3CX3A 1CJVC 2B1IA 1N9GA 1XZAA 2XNKA 3GB9A 3W3ZB 4R2XA 3K94A 1EBUA 1XKXA 3MWLA 2V7PA 3MBOA 3IALA 3HJCA 1U5CA 4O0LA 5GJWC 4WN9B 4UZSA 3UUFA 1G3QA 1I4LD 3HM9A 1L4NA 2G80A 3AEQB 2ID7A 3DR3A 3GDWA 1W34A 2ZJ1A 1PJAA 2PKXA 1TT5A 1I24A 3H6KA 1JHQA 2RGXA 4JCCA 4G5OA 5F1PA 2Y0CA 5LQRA 2W6NA 1CQJA 2XNDD 3KPUA 4DRYA 4W8OA 3IV6A 3CT4A 2VPIA 3P0RA 3MSXA 4JB3A 2VDNB 4XCVA 3T61A 4PZ0A 1YZVA 3O4VA 4EM6A 2VJAA 3RGWS 2JCBA 4XSVA 3O2SB 1GV1A 4RXMA 1M1UA 2IIBA 3PXCX 3AM1A 2ZVDA 3DUFB 4FOSA 4WH0A 5A0FA 4BYMA 4EA8A 1HC7A 3I76A 2H08A 3CKMA 1RFLA 1DOAA 3L06A 3NUQA 4HXGA 1XQYA 3LDUA 4JROA 4LV5B 3WDMA 3CLVA 5A3VA 3ROPA 4PX2A 4EFNA 3FDZB 3UCEA 3OZIA 3V1KA 2H57A 3A26A 4IH1A 4FX2A 1PDOA 2R5FA 1HFEL 2W6MA 3PUWA 4INPA 4KLCA 4F4UA 1W73A 1I2DA 2JW5A 4S1VA 2EP8A 4PHCA 4CQMA 4WOPA 5B1SA 1G60A 4R1QA 2GPNA 2A92A 3MCUA 2IIPA 4BE4A 1R50A 1EM8A 2QZ9A 5L3RA 1DKPA 2P75A 4AMGA 4E12A 5JD4A 1GPH1 2OWDA 2BI8A 1CS0A 1LXCA 1L8AA 2E3JA 2QL5A 3QVXA 4MWEA 1Z7YA 2ETXA 2DR3A 3G0DA 1IBLB 3FRIA 2EBWA 1TUEA 2Z2IA 3RLIA 1N5IA 4IG4A 3TYXA 2CMDA 4HZUA 3AHGA 5H70A 3SZLA 4BN5A 3R4CA 2FSSA 1KEEA 1PU2A 3ZWOA 1JHZA 3FMIA 3F71A 5IT5A 2WJPA 3HCFA 2IYAA 4L5YA 3JV7A 3BXFA 3ROEA 3PHGA 3E9NA 1OX6A 2J0SA 1I3MA 1L4YA 2FR8C 2WWVD 3GXOA 4BV9A 3K9CA 5ES4B 1P6XA 3LXXA 4D3YA 5JNWA 3CG0A 4PTYA 1C8LA 1M67A 2BSXA 4MHOA 2BFWA 2CDCA 1E3QA 1M2OA 1QPBA 3GIWA 4EFKA 4EWLA 1PZXA 4O2AB 4X71A 5GZ3A 4OB8A 5AI8A 1P7CA 2BKXA 3OTGA 5E6UA 3ZWQA 1E3LA 1XPRA 1WTAA 4TYYA 3DFZA 4G0MA 5JCJA 2PV7A 1DCTA 3PFNA 3QM1A 1Z16A 1UOOA 2C99A 3TUZC 4DV5B 1E2JA 4YUAA 1HR0B 5ALIA 2B2NA 2FWIA 3MT9A 3PFBA 3AEKA 4DG9A 1H0RA 1M6NA 2IC5A 3F8TA 5FADA 2BT4A 4OJKA 2NO7A 3SBDA 1A9XB 2QIOA 3LOQA 4MW1A 4KE8A 3L1KA 2BH9A 3MTDA 2XSZD 2YFYA 4LGYA 3RUHA 5A3QA 3M82A 4UBOA 1O95C 1YQT