4IJWA

Crystal structure of 11b-hsd1 double mutant (l262r, f278e) in complex with 3-[1-(4-chlorophenyl)cyclopropyl]-8-cyclopropyl[1,2,4]triazolo[4,3-a]pyridine
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPCRKILEELYSTSYNMDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimization of 1,2,4-Triazolopyridines as Inhibitors of Human 11 beta-Hydroxysteroid Dehydrogenase Type 1 (11 beta-HSD-1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
total genus 96
structure length 263
sequence length 263
chains with identical sequence B, D, E
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2012-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ijwA00
4L4RA 1QXSA 4BO0A 3A14A 1MB4A 4IGFA 4DVJA 2EJVA 2EJWA 1O89A 4RO0A 2IODA 4MVJA 4EJ0A 5I7SA 1PL8A 3F3SA 5KKCA 4OXNA 4DREA 5CDSA 4YAKA 3EMKA 1DAPA 2Y0CA 2VUUA 4YA6A 3FI9A 4U0JA 3WDSA 3TRIA 2RAFA 4FFMA 2CY0A 1ID1A 3BA1A 2JJYA 3QLJA 2Z5LA 2Y1FA 3V2UA 3BYZA 5HA5A 2NUAA 1LLUA 2E48A 3PFFA 4JQCA 4BB5A 4HNHA 4LMPA 5TX7A 5JDCC 2I66A 5IZ4A 1A9YA 2YUTA 3L07A 3W8FA 3DFUA 7MDHA 4RLSA 3TN7A 3UGKA 2C2YA 4JBIA 4EJMA 2PD6A 1ONOA 1H5QA 2NM0A 3KUXA 3WQQA 4DIFA 2P68A 4DYDA 3P2OA 4QT0A 3UCXA 1R4MB 4LRTB 2XOXA 4TMFA 4DBVO 1DFHA 5U1PA 1GUFA 4PLYA 3PIIA 4WOKA 3WSVA 3GDGA 4NK4A 2TMDA 1YB5A 3D5QA 2P5YA 3ROKA 2ZIZA 3PGJA 3HN7A 2O2YA 3NX4A 4I9HA 1H9BA 2D5AA 1TA4A 5TS3A 1G0OA 4NK5A 1ENZA 3K92A 4ZVVA 4J9VA 1SZJG 4TROA 4CMIA 1UZLA 3K8ZA 4MVJM 3W1VA 1SOVA 1S6YA 2OORA 3FTPA 1DIAA 4FQ8A 4N5NA 1RYDA 2NU8A 2PV7A 3PWSA 1VJ0A 3DBHA 1AE1A 5IF3A 2WDZA 1H6AA 4WOJA 1D8AA 5AXDA 4K6FA 2ZTVA 2VQ3A 3ORFA 4XRRA 2JAHA 3GMSA 2P9GA 1Z45A 1UXHA 3L9WA 2POQX 4I08A 4Y6RA 1UAYA 3OICA 2EW8A 1ULUA 3JYLA 3RC2A 5C7OO 3QE3A 3A06A 1W8DA 3O8QB 3PQEA 3OIDA 3BMCB 4UVEA 4BNZA 1HL3A 4BNNA 3NAQA 1WP4A 1HSOA 3IDSA 4IXWA 4GWKA 3ZHXA 5G0TA 4NBTA 2VT2A 4WNIA 2V6MA 1ZZEA 1DRUA 1HDXA 2HLPA 3LC1O 4IDAA 4YJHB 3KEQA 5JS6A 1Q7GA 2PGDA 1EDOA 1Y9AA 2GLXA 2FR8A 4IMRA 4YCAA 1FDSA 3H9GA 4BNMA 1JVSA 2AQ8A 4P4GA 1LSUA 3WBFA 1JKIA 4NJMB 1EUDA 1CQJA 3H3FA 5LDGA 3S1LA 4HP8A 4M49A 3UAGA 3STHA 3NUGA 2V6BA 4J1QA 3T7EA 3JD0A 1ZEJA 4UUNA 5L4NA 2RHCA 4IDDA 2GPTA 1C1XA 4BKOA 4KDFA 5JO0A 3TF5A 2D8AA 4XQEA 3AU8A 1BVRA 4L4SA 3QVXA 3L6DA 5A9RA 1Q1NA 4LGVA 4II2A 2VWGA 1QR6A 1QV7A 1UJMA 3WB9A 4II3A 3WLFA 2W98A 3BMOA 3GDFA 1XHLA 1CYDA 4NHEA 1PTJA 4I5FA 2X86A 2Y66A 5BNFA 4E3ZA 4MP3A 2AA3A 4PG4A 3VKUA 1GYQA 3ROPA 1KERA 4G2NA 4DGSA 3CKYA 4J7CA 3HZZA 3DAPA 3VPGA 4ZQFA 3RBZA 3DZGA 3EW7A 4CM1A 1SEVA 1E3JA 1V9LA 1XU7A 3LF1A 3GEMA 1YRLA 1X7HA 1C0KA 4BO4A 3PLRA 3DMTC 2PKQO 2NTJA 4ND3A 3U0BA 4RPJA 4IUYA 3ROMA 3AUTA 1NQ5A 3JQGA 4WCFC 1E7MA 1R4NB 2Y0DA 4XQCA 3GFGA 1B2LA 3MEQA 4P4NA 4FFPA 5LCXA 2GCGA 5JC8A 5JXWA 3NTQA 2QZ9A 4TRMA 4NBUA 5AVOA 5IJZA 1T24A 2X0RA 5IG2A 3R1IA 1DPGA 4FOSA 1F06A 2JD0A 1E5QA 2RCYA 4GSLA 1JA9A 4J4HA 3NGLA 4OIMA 1FDTA 3WYBA 4R01A 4XKJA 3C1AA 1X7DA 2IDZA 1N9GB 3OFSA 1LA2A 4ZU3A 1LDBA 5EQFA 2PZKA 3ZNOA 2DBQA 1B8PA 1HYEA 3K96A 5HS6A 4YJHA 1NVTA 1R37A 2FZWA 2O23A 5I7FA 5KWEA 1H6DA 2ZCVA 4UVDA 1RM0A 3OF2A 4Y98A 3O26A 1K6JA 2QX7A 4J1TA 2JCYA 4Q3NA 2GD1O 2ZJ1A 5IDXA 2YDYA 4HBGA 3AJRA 4BOYA 2HJRA 2VWPA 3JQ6A 3JCZA 3LLSA 2CF6A 3QQPA 2CDBA 3LK7A 4NJOA 5JCJA 2GGSA 2DTEA 1LQUA 4CM8A 1A7KA 3AFNA 5L4SA 5A1TA 2SCUA 5EN4A 4A73A 3EC7A 3JQ9C 4YDRA 2DBRA 3RUDA 1B3BA 2AEFA 2P5UA 4PLPA 2JCXA 3TSCA 4LISA 2FMUA 2FPIA 1IULA 3ULKA 4ALNA 2Q4BA 3GN1A 1DIGA 4RORA 1WLYA 5JDCA 3JD4A 2Q1SA 2B37A 2FR0A 5DBFA 1OFGA 4JBGA 1U3TA 4YAGA 1E6UA 5CG1A 4FJ1A 4RZIA 1YL5A 2F1KA 3WGIA 4Q9NA 2G76A 5JAQA 4GGOA 3RFXA 3JD3A 4ZQGA 4A10A 1DB3A 2J5QA 2Q1UA 2X5KO 1KY4A 2HMWA 3KYDA 4N5MA 2JKVA 2O3TA 1YQDA 2AQKA 1T1SA 4Q39A 2PWZA 2PR2A 4FW8A 4U7WA 3LU1A 1PU2A 3AY7A 3ABIA 1HEUA 1FK8A 2PGLA 4H7PA 4ITUA 1GY8A 2D4AA 1UUFA 3LT1A 4BO2A 2R2GA 3AUAA 4CQLB 5CDTA 1NM5A 3K2BA 1DEHA 5F3RA 4YRAA 5K0ZA 3JQAB 3RFVA 3ONDA 3SBOA 4AJPA 4Z0TA 4E31A 3GPDG 5KKAA 1PJCA 5JPIA 3S8MA 4DRYA 2HMTA 4OXYA 3TZQA 2BMAA 2PY6A 4LSWA 3E18A 4AJOA 4M55A 1IL0A 1PL6A 3BHMA 2JCVA 3CZMA 3JYPA 5EINA 1AHIA 1XU9A 3CH6A 2H5LA 4QQRA 3VH1A 5ILGA 2VYVD 2B83A 3K5PA 1RKXA 3UF0A 4A26A 1EUCA 4J90A 1NVMB 4TZKA 2Y93A 3GEGA 3GVXA 4XR9A 1NYTA 4R1NA 5BR7A 5L51A 4PRKA 4JJFA 4TVOA 4OQZA 3PRJA 4R4JA 1IHYA 2I67A 3CIFA 4UEOA 1MG0A 1CETA 3PZRA 1FXSA 5TSDA 1YE3A 2OBNA 3BMQA 3IOYA 3KHUA 4CLDA 3IJPA 4JGBA 4MVJH 3TNLA 4OJNA 3RJ9A 2ZQYA 3OMLA 2RH4A 4HFNA 5COQA 2VOJA 4NNJA 2IEDA 3KLPX 2GSDA 1JAXA 1NBOA 4DQUA 2JFHA 3QWIA 1TT5A 2IZZA 1K89A 3ZV5A 1PZEA 4NR0A 4PGFA 2CDAA 3RUHA 3G1TA 3DOJA 5DP2A 4IINA 2AHRA 4E5YA 3GVHA 1JN0A 4ZRMA 1UZMA 3BMQB 4A7PA 3WYCA 1G1AA 1NP3A 4J3FA 4K28A 3PXXA 4FPXA 4FIZA 2JFGA 4IS2A 3G0OA 4BNGA 1T2EA 3I9KA 1OAAA 4OXKA 4BKPA 1C1DB 1BDBA 2QRKA 3WGHA 3B20A 3ZWYA 4RF5A 4BL5A 4RPKA 2YYYA 4GKBA 2VHXA 3GH3A 4Y9DA 3MOGA 3TZKA 2UDPA 1AXGA 3GNQA 4B4OA 1F8GA 1HDYA 1MFPA 3MJTA 2B35A 4BNKA 4DTIA 1ZMOA 2Z1NA 4PLTA 4B4WA 4C7KA 5L7YA 3L4SO 4ND2A 1YJ8A 4JBHA 4JLWA 2GR9A 5F21A 3LVFO 4Y6SA 1P31A 3FTNA 3TFOA 4KDEA 5GZ3A 1ORRA 3WTBA 3JD2A 1FMCA 1LDNA 3ZWCA 3KVOA 3PZBA 3GVPA 4PVDA 4WKGA 3R0IA 1R4MA 4MVJF 1WZEA 1U9JA 4RL6A 5EJ2A 4FJ2A 4H15A 2EF1A 4XYGA 4BKUA 3RUIA 3EDMA 4BNJA 3OJ0A 3DZBA 1NHGA 4AJJA 1EBUA 4RVUA 4W7IA 3Q0EA 2YFHA 1EUZA 3D3WA 3PFWO 1KVRA 1PJ2A 2DLDA 4IDBA 3WLEA 3PDJA 3PIDA 4Z9YA 3L6EA 2NLOA 1U2DA 3PYMA 2AG8A 1KEWA 2BELA 4FFOA 4UUOA 4CR7A 2VN8A 4NBVA 4O0LA 1DOHA 1GYPA 3ONEA 3K73O 2X6TA 1CEQA 1PSDA 1MG5A 2VUTA 3VDRA 2GN4A 3PI7A 4RJTA 3F4BA 4UVHA 3SJUA 4DQVA 4YAEA 3RC7A 1NFRA 4D44A 1SAYA 1XDWA 4ALMA 1XEAA 2JD2A 4E32A 4GAEA 5A5FA 1ADBA 4TRJA 3RIHA 2DC1A 2D1YA 4E33A 4NFHA 3F6YA 2VZ9A 3U4DA 4YQYA 1M76A 3ZNPA 5ITWA 2O7SA 3F5SA 4A5OA 3DOOA 4AJ4A 3ZN2A 4FGWA 1E7WA 3BMNA 1E6EA 3KB6A 4MIEA 4IZIA 1NQAO 1KBZA 1PJ3A 3VTZA 4NBWA 1BSVA 4WJZA 5THQA 4L74A 1ENOA 2NVWA 4NU5A 3E03A 1T2FA 1PGPA 3JV7A 1Z82A 3I23A 1YO6A 2EP5A 2CMDA 1BXZA 1XR3A 5CAEA 1YWGO 3GNSA 3PQDA 4I8XA 3W6ZA 5T64A 1PJ4A 3VKVA 5T8KA 4ZICA 3E5RA 1I5RA 3DZHA 3WYEA 4ZA2A 3D5TA 4R9RA 4B8WA 1N9GA 4XEHA 3OJLA 3PYXA 5ENVA 5JCJD 1EK6A 1D4FA 2YHIB 2VZ8A 2RH8A 2EKLA 2VT3A 4P8RA 2QW8A 4YJDA 1NFFA 3H7AA 4CLEA 1R15A 3KYCA 4QECA 2BGLA 1Q0LA 1DLJA 3PVZA 5KJ1A 1X13A 3QA9A 2Q50A 3Q3CA 4L76A 1WMBA 3EZLA 5JFOA 3ZHZA 3QY9A 1LUAA 4G65A 1GCUA 3ZGYA 1SC6A 5L3ZA 1M6HA 5KJFA 3OBBA 3WGTA 3OEYA 1ADFA 3IJRA 3TJRA 3WMXA 3VOSA 4PLFA 4OMUA 5IDYA 1P74A 4M86A 1AHHA 1GUYA 1R12A 2HAEA 2C59A 2J5RA 4PLVA 1ISMA 1LSSA 4HFRA 3N74A 4CMIB 1LDMA 4L9RA 3ITKA 1JQBA 3ZH2A 4DL9A 6LDHA 1EFKA 4FS3A 4RF3A 4MJLA 4NPCA 5JYDA 3GDOA 1YDEA 2PZJA 3AY3A 5LC1A 4CUJA 3NJ4A 4ZJUA 2EEZA 4PLWA 2C7VA 3FBTA 1EE9A 2I5PO 2VWQA 1Z75A 5G0SA 3JYOA 5TJ9A 2PD3A 4YB8A 1E1LA 3HUDA 4WGGA 2GN9A 4YBZA 2Q2VA 5KJ6A 1YBAA 3AOEA 2X1HA 3H6KA 1I10A 1V3UA 3GK3A 2OGUA 4E2YA 3RQSA 4DMLA 4P4LA 1O5IA 1LSOA 1F8FA 4OQYA 1BGVA 2J3HA 4CLXA 4ZN6A 2WE8A 4PZDA 4OYRA 1LNQA 1PGQA 2EW2A 3RD5A 4XA8A 1CRWG 2J3IA 3DC2A 1DAOA 4E5PA 1L7DA 3V1YA 4HY3A 1B8VA 4HUJA 4MO2A 1PQWA 2R6JA 1LLCA 3UW3A 3H2ZA 3I3OA 4PLGA 2X7HA 4DC1A 1Q2XA 3V5NA 1MGOA 1ZSVA 3HDHA 3PQFA 4GX0A 1PS8A 5K6AC 3NV9A 3K6JA 4N7RA 2G1UA 2X0NA 1D3AA 1OMOA 1DC3A 2QYTA 4CV0A 2H1SA 1P33A 1WVGA 4JCOA 3I9MA 4B3IA 1Z7BA 4CR8A 4K6CA 5LDHA 4W6ZA 1VC2A 2G5CA 4BNWA 4JP3A 1UXIA 1IB6A 3VTFA 1GPJA 3I5MA 3NTOA 5TNXA 2B4QA 4B7XA 3DBLA 3L77A 2FR1A 2IRWA 4G5HA 3G1UA 4YJGA 3RSHA 3IC5A 1F12A 3QIVA 3NDIA 4PLCA 5A04A 1LRJA 1TB4A 2ZYGA 4WECA 5IXYA 1HF3A 1PJLA 1CWUA 3IMFA 3HDYA 1X1EA 3ZZNA 1OI7A 3FCOA 3BMOB 1I2BA 4GPD1 1K6IA 3O9ZA 3GY0A 1CF2O 2XF8A 4H3VA 1HZJA 5HBRA 5IXSA 1VJTA 4CM8B 4E5KA 3DBHB 5EQDA 4RF4A 2OFPA 4GSKA 4XYMA 4YXFA 1FJHA 1TEHA 3ENKA 1QRRA 3M1LA 5CEFA 3HADA 5AXCA 4D3DA 5F1OA 5THKA 4UULA 4XIYA 4CM3A 4E5NA 3RI3A 4J2HA 3U9LA 2VWHA 4QTZA 2C07A 3HFSA 2EERA 3O03A 3OETA 2BFPA 3AI2A 2OMEA 3U4CA 3TZ6A 3HDJA 2IXAA 4RDHA 3ZWMA 3PGXA 5ER6A 2NADA 1N2SA 3SJ7A 1LBEA 3KEOA 2B0JA 5IAAA 1EE2A 2BGMA 1HE3A 9LDBA 1P1RA 1KEPA 5L95A 1KIFA 1H2HA 1LQTA 3OJOA 4E0BA 1J6UA 3K2EA 3MWDB 1F14A 1X7GA 5BSEA 1BW9A 4TQGA 1BXGA 1MC5A 3GAZA 4D3SA 3DXFA 1MFZA 1T4BA 2B36A 4RVGA 4WLEA 1NAIA 2NTVA 3DZIA 3PDUA 3VHRA 2HMUA 4WASA 3BXXA 5KVCA 5K6AA 1R6DA 1GQQA 2FWMX 2WJPA 3CMMA 3RWBA 2VHZA 4MKRA 4R16A 3LZ6A 2RHRA 1NR7A 3E9QA 3DBLB 1L7EA 5L45A 1UDBA 1JDJA 1PIWA 3IP3A 3TOZA 3IKVA 1AGNA 1DDOA 1Z74A 2GDZA 2O3JA 1GCOA 4J7UA 2Q1TA 5CPFA 5KJCA 2QQ5A 4RVFA 3WFJA 5A06A 2I3GA 3UH1A 3ZNNA 5HRUA 1J4AA 2D2IA 1ZFNA 1NQTA 3I4FA 2OBYA 3TZHA 5IZCA 1LRLA 2C5EA 1E77A 1T2DA 4DUPA 1ZJZA 1B7GO 5DZSA 1HTBA 1LC3A 1T4DA 3FPLA 5JMWA 5B4UA 1HE4A 3HNPA 5TC4A 5TT0A 3GGOA 3Q1LA 3UOGA 5CHEA 1UR5A 2Y05A 4CM5A 3CEAA 2DUWA 3SEFA 4NU6A 4CR6A 4AJEA 1EVJA 4FFRA 5CPBA 4NJMA 3KV3O 4OHUA 5AOVA 5L4LA 2X8LA 2BFMA 1WDLA 4E21A 2B5VA 3G79A 3WWYA 1T25A 1W73A 2VUSA 3H5NA 2W2LD 3WIDA 4LCEA 5K9ZA 4R51A 1H0KA 3U5TA 1I3MA 1BVUA 4RZHA 2X5JO 1GPDG 2Q46A 3L0DA 1PX0A 1P44A 2CF5A 2OP0A 4TSKA 5IDWA 4BV8A 1O95A 3ZU2A 4PLHA 4H16A 2GZ1A 1U5CA 3UXYA 1DIBA 1JWAB 1N1GA 4U6QA 2ZK7A 4NBRA 3FRJA 3C7AA 2EKPA 4YWJA 1GADO 1EDZA 2W90A 3O8QA 4CUKA 1ZEMA 1JKFA 4OL9A 4Q3CA 1YL6A 1AXEA 3D3EA 4U8GA 2PZLA 2YQ5A 5DT9A 2HKIA 5DCWA 3VC7A 1HLPA 1NNUA 1KY5A 1FF9A 4XCVA 3TQHA 4UREA 1NTOA 2CDCA 1IZ9A 1EQUA 3I6QA 3ZCXA 2PGJA 4GL4A 3KETA 5I9NA 1GAEO 4LSMA 4CODB 1HWYA 2QRJA 1MX3A 2QYSA 3F47A 3GZ4A 5B37A 1IHXA 5HM8A 5F5LA 1JKJA 3CPSA 3RFTA 1U5AA 3AM5A 4BO6A 1GZ4A 3E82A 4D45A 4FB5A 3BAZA 2CD9A 5FF9A 4XZ3A 1GL3A 2UUPA 4YPOA 4XGKA 3V2GA 4YTEA 5TT1A 4BNTA 1NHWA 3DZKA 4FCCA 3RROA 1C14A 1PZHA 4MP6A 3RBVA 1DHRA 4EGFA 3ASVA 1Y7TA 3PHJA 3ETEA 1HE2A 1T2AA 5KVVA 4W9NA 1H94A 2D3TA 2HK9A 1EVZA 1W0CA 2OXIA 3WICA 2FP4A 5T6BA 3ANNA 3JQFA 4N5LA 3I4CA 4IDFA 3EHEA 4TRRA 4ZQBA 1JWBB 1K5HA 3GOHA 4KUHA 3AOGA 4TKMA 4AVYA 4BNYA 1B26A 2D5CA 4M89A 4RDIA 3VPXA 3UFXA 5L9AA 3BTOA 5HTOA 2O3RA 4AJ1A 2PNFA 4QFDA 3HE3A 3INTA 4ALLA 3QJ5A 1PGJA 2H63A 3T4XA 4PIVA 2WD7A 4KQXA 3OJFA 4BNLA 1RYEA 3H9JA 1X0VA 4GWGA 1GQYA 3L6OO 2UAGA 4FOOA 1JVBA 4EJ6A 4BO8A 3HB4X 2P4QA 3FNGA 4NH4A 3PTZA 2DTXA 1B14A 3Q6IA 1FDWA 1CIVA 1KVQA 3PHGA 3KYCB 2ZB7A 1IPEA 3EGOA 2QHXA 1ISIA 3PLNA 5EMHA 4DA9A 3RUEA 1PJSA 2GN6A 4ALJA 1Z73A 3JQ8A 3FNEA 4QSMA 3KZVA 2FY8A 3JD1A 2O3QA 4R3WA 5TLSA 2NSDA 1SPXA 1XG5A 1DSSG 3JQAD 1U7HA 2FPGA 3KSUA 4RPHA 2X9NA 4ND1A 1KEVA 2ILTA 3D0OA 1BW9B 3PP8A 5ICMA 3OA0A 4FD3A 1YJQA 4BGUA 1GEGA 5CDYA 3TL2A 3KBOA 4R54A 4WLVA 2IEBA 3X2EA 5FYDA 4BMNA 2YJZA 1YQGA 2HUNA 1C0IA 3EYWA 4D0SA 1IOLA 3WQSB 5A9SB 5F1KA 1ZCJA 2GNAA 3F1LA 4LK3A 1QKIA 3DAFA 1LEHA 5JDIC 4A03A 1KVUA 3Q2IA 4NZ9A 1ZUD1 1VL6A 3W4KA 1PS0A 1SEPA 1A9ZA 1NQOA 1GZ3A 1SNYA 4CQMB 4BMSA 4BQPA 3IQDB 3DBRB 4KTTE 3FBGA 2PKRA 3PYLA 4JNKA 2J5KA 1LI4A 2JL1A 2JD1A 5JBIA 3JQGB 1ZNQO 2OUIA 3N7UA 4AICA 1PZGA 1SB9A 4U6SA 1XKQA 4NI5A 3AM4A 1DJQA 4CM9A 1ADGA 4OO3A 3WR5A 2NU9A 4J43A 3TOXA 1P0CA 3VPSA 2WYUA 5A03A 1M67A 4E13A 1E92A 4WCDA 3DBRA 1KETA 3OQ6A 1NWHA 2BKAA 3DHEA 4HFMA 4B7UA 4IJVA 4HNGA 4YT2A 1CJCA 2NWQA 3CSDA 1M75A 4LVUA 4UVGA 4WLUA 4CV2A 3ZI0A 3UCEA 4TZTA 2E6UX 1NAHA 3JQBA 5H82A 1UP4A 3WTCA 4EW6A 4GMGA 4OH1A 3KXDA 4J4BA 2DAPA 1O0SA 4KWHA 3UN1A 1O94A 1NPDA 3QW2A 2LDBA 4P22A 1H9AA 1DJNA 2O4UX 1ZIDA 5G0VA 1U3VA 3A1NA 4R1SA 2O3UA 3GRKA 4J6FA 4F3YA 3HFGA 1I01A 3I9OA 1ZBQA 3V2HA 4AJNA 1YKFA 1J0XO 1R66A 1DXYA 1M2WA 1HDOA 1Y1PA 4CMAA 1XIVA 2DBVO 3E5MA 3V1TC 1RJWA 3CTMA 1B3RA 1GDHA 3DAGA 3GVCA 4HKTA 4EBFA 4YJGB 3KM0A 2Q1WA 2C5AA 3QVTA 2C82A 1LC0A 5DNAA 4A27A 3VH4A 2DT5A 4XYEA 4IMPA 3WIEA 3LYLA 3TDKA 1YQXA 3QWBA 4MIOA 5L53A 4Z9XA 3GMDA 3GGPA 4DPKA 4HX5A 1R16A 2DU8A 3GF4A 2Q45A 3DMYA 4K9DA 1ZMTA 5J23A 3ADPA 3EVTA 1PJBA 1MLDA 3MJVA 1I32A 3ICPA 1YBVA 1SMKA 1BXKA 2BF7A 4U0KA 4S1VA 4TWRA 1VI2A 4N18A 2NVBA 5ILOA 2GERA 2O50A 4EITA 1I2ZA 5TJHA 2R00A 4PN3A 5I7VA 1U1IA 3ONFA 3EY4A 4MVJD 4PRLA 3WG9A 1QYVA 3D3WB 1U2GA 1HT0A 4EEZA 3CMCO 3NEPX 2IXBA 2EIHA 2YZ7A 1HRDA 5L7WA 2A9FA 4ND5A 1VL8A 4BV9A 1TLTA 4E6PA 4XDYA 4CMEC 3BHIA 3A28A 2FRDA 4UUPA 3DDNA 4BQRA 4CV3A 4CM6A 3HDQA 3PHIA 5CEEA 4TRNA 2PA3A 3AI3A 1ADCA 4PZEA 4E12A 3GG2A 4W82A 2IYPA 4N54A 3D4PA 4B7CA 5FWNA 4RLHA 3CINA 3GZNB 4YQZA 1SOWA 3C24A 4RPGA 3FHLA 3ZHYA 2ZB4A 1DIRA 1NASA 2PK3A 2NVUA 3NRCA 1YH3A 4M54A 4C4OA 2BI7A 3PJDA 5C3MA 1TI7A 3G49A 3P5SA 1ZSNA 4HXYA 1QP8A 2P91A 4AJIA 1WW8A 3OQ1A 4YAJA 4Q3AA 4BNIA 1BWSA 4IJUA 2X5OA 3AOEC 2J3KA 3OHSX 1Y6JA 4PG8A 5A02A 2Q99A 3MCVA 4JIGA 4IQ8A 3Q11A 2W2LA 2GF2A 2NU6A 2P2SA 2A35A 1GR0A 1EVYA 1GU7A 3HB5X 2H9IA 5H83A 3S2IA 2GUGA 3RJ5A 4XJTA 4HADA 5JC1A 4CL3A 2LDXA 4RQUA 3W8DA 5AXBA 3ZWOA 1D7OA 1UZNA 1WZIA 2WYVA 3AWDA 4IBOA 3PHLA 4J49A 2Y0EA 3D7LA 3ZV4A 1Q0QA 1C0LA 3WBBA 1V3TA 4RQTA 5T57A 1XELA 5DOZA 1WPQA 2VHWA 4DWVA 4F45A 3P19A 1E7RA 1V35A 1B16A 2V6FA 5IN5A 4UUMA 2CSUA 2EKQA 2BLLA 2E82A 4KOAA 3A4VA 2DKNA 3QWHA 1NX6A 1CQIA 1ARZA 3RKUA 2AE1A 4XR4A 4JP2A 2BH9A 3GEDA 3OQBA 4E30A 4BKRA 1NFQA 2HJSA 4B8ZA 5DULA 1GTMA 3BMNB 4L4XA 5JY1A 3HSKA 5B1YA 3AFMA 5ITVA 2YW9A 3NGXA 1R0SA 3NTRA 4IPTA 4OAQA 5DP1A 3ZWWA 4MVJI 2NU7A 2BHLA 4WUVA 5DDIP 2YDXA 5KVQA 3CUKA 4GMFA 3VZQA 3JQEA 3GUCA 3IP1A 3TFQA 1HYGA 4XIJA 1NR1A 1LSJA 4NQZA 4CUZA 3ZWNA 1VM6A 4MPDA 4CM7A 5BSGA 4EUEA 1HXHA 2CZCA 2A4KA 5DN9A 2CUKA 3P7MA 4IDGA 1Y5MA 1QORA 1TT7A 3H5RA 1XA0A 3K31A 4D79A 5HS4A 2NQ8A 3RKRA 4WE3A 3TL3A 5AQ1A 3F4LA 4BGVA 2F00A 2W8ZA 2Q49A 4XQGA 2QRLA 3DFZA 4CMJA 1MXFA 3SLGA 1G0NA 3KTDA 1YOVA 1XYGA 3F5QA 1MA0A 5EIOA 1BHSA 1I0ZA 3UICA 3F46A 4AJHA 1UAGA 1RM4A 4CMHA 4Z9FA 3SXPA 4CM4B 1E3IA 2VOEA 3PJFA 2O48X 4R41A 4URFA 2UYYA 3NJ8A 1EVIA 1NXQA 3DOCA 4Q3BA 3ROQA 1XGKA 4WEQA 2I9PA 4R5HA 5TGDA 2OL4A 2UV8A 1TVEA 2RIRA 3ENNA 2JHFA 2ZJ0A 2ZYAA 4YJFA 1A27A 4RVDA 4PLZA 1KC3A 1P1KA 4BO5A 1GZ6A 1Y5RA 5CG2A 4JK3A 2VZ0A 3ZU3A 3HG7A 4KWIA 4E5MA 2VRBA 2VTDA 3GHHA 4HFJA 4DIBA 1IE3A 1ZJYA 2VNAA 5L40A 3GR6A 3JQAA 1B0AA 4J91A 3TPCA 1EZ4A 5KTKA 4R1TA 2C7GA 5ER9A 2I6TA 3LDHA 4TKLA 1QYDA 4OKIA 1BMDA 4LN1A 3S2EA 1DC4A 4BGEA 1PQPA 1AUPA 2FHSA 1CERA 4DIOA 4IXTA 2HDHA 3MJSA 4K26A 4CJXA 4AG3A 2IZ1A 3T4EA 5C7IO 5G4KA 2DUUA 2E37A 3JTMA 4ZRNA 1V8BA 1ZXLA 3JYNA 4BNVA 4B3HA 4O63O 4BS9A 3IUSA 3NT4A 4W7HA 3ANMA 3U4IA 4XJSA 3NT2A 1LLDA 4W4TA 2ZATA 4GLOA 2ZB8A 5GZ6A 2HCTA 2VTEA 5A9SA 2XXJA 1R0KA 3GZNA 3FWNA 5C7LO 3JYQA 4DLLA 1YS4A 4R69A 1Y8RB 1DIHA 2FOIA 1U28A 2Y1EA 4LW8A 3GLQA 3PJGA 4PG5A 2GZ3A 3LT4A 4CQLA 3WS7A 4Z3KA 3L9XA 5B4VA 3V8BA 5GY7A 2QZZA 2VYVA 1J5PA 2O3SA 1VSUA 3C1OA 1IUKA 5AXAA 1HETA 2PH3A 3WGOA 3QSGA 4PVCA 4BUCA 2PD4A 5ENDA 4J0FA 3T7CA 4YYZA 2ZKLA 5B4TA 3WGQA 2RBEA 1V6AA 1DO8A 5T5QA 1SCUA 3B6ZA 3UVEA 1P1FA 1A4IA 3L4BA 3H4VA 2B4RO 3FD8A 4WCFB 1N92A 5F5NA 3D64A 2OO5A 3PK0A 4FBGA 4XDZA 2YHUA 5DF1A 1EBFA 5B12A 3INRA 1HDRA 4GVLA 2YY7A 3H9UA 2X0IA 5A9TA 3ITDA 3ETDA 4QX6A 2DPGA 2VRCA 4QUKA 3R3JA 3M2TA 1MXHA 5I7EA 2WD7B 5MGBA 1ONPA 1E1NA 2G0TA 1E6WA 3DONA 4RPLA 1A4UA 3U62A 3F9IA 4FJ0A 1SBYA 4NIMA 3RASA 5IDQA 1RWBA 4GBJA 4R3NA 3Q2KA 3R6DA 5BT9A 1ISGA 2ZTLA 4Q3EA 4RVSA 3A9WA 3X2FA 5C37A 5JSFA 2PH5A 4CMEA 1DHTA 3QVOA 3FR7A 1S7CA 4I9UA 1ZK1A 2J6IA 3Q9NA 5CDUA 3UCFA 2X22A 2HSDA 2OP1A 4Y8VA 3WGGA 1ZW1A 3NYWA 4XGIA 3SLKA 1A72A 4AFNA 5DCYA 4DLAA 2NVUB 3QVWA 4DXHA 5CEJA 1RM3A 2GYYA 1EEHA 1KOLA 2EP7A 2I65A 3OA2A 5JO9A 5TF4A 4WK6A 3WQRA 1B8UA 1CDOA 4MKXA 1K6XA 2B5WA 4IIVA 3WGYA 3ZWVA 1ZK2A 1FDUA 3LLVA 1YL7A 4WNCA 3JQCA 2YHIA 4KUGA 4XYBA 4GH5A 1C3VA 1U8XX 4XRGA 1WNTA 4AJ2A 3WOHA 2C2XA 4FGSA 3E6AA 4GI2A 1L1FA 1OZAA 1E0DA 4PG6A 3JQ7A 3RAJA 3RUFA 4BNHA 3UHAA 2P4HX 3SVTA 3DL2A 1R4NA 3QHAA 3UUWA 3PJEA 1T2CA 1ISHA 2EHDA 3DEYX 4ZHSA 2FN7A 2WE7A 1M6WA 4CQMA 2AE2A 2IYOA 2V7PA 3OIFA 4IM7A 3OEWA 4D43A 1U4OA 4QEDA 2BGKA 4BO7A 1Z6ZA 3OP4A 1X0XA 1A5ZA 2ZB3A 5JLAA 2TMGA 4MOWA 3GHYA 5DBGA 1UP7A 5EPOA 3SC4A 4E2WA 4EI2A 3RUAA 1PR9A 3VH3A 1UH5A 3JQDA 4OOFA 4CM4A 4FFLA 4FC7A 2HK7A 1D1TA 1H6BA 4BVAA 2EGGA 4LMRA 1I3LA 3U3XA 1MP0A 4NMHA 4GX1A 5KJEA 4HWKA 4J4TA 2YFQA 4ZQHA 4CLOA 2H6EA 4EUFA 3BTUA 3JQFC 4I9NA 1ONNA 3C1TA 1BXGB 1KVTA 2FPPA 2WSBA 4LCJA 4L0QA 4RVHA 4EZBA 1XLTA 3INGA 3ADOA 3GN2A 3RCBA 1YONA 3IIEA 1HE5A 3WNVA 4CPDA 3DHNA 4IQGA 1QMGA 1XSEA 1DFGA 1DRWA 4IQ0A 2DBZA 1PS9A 1BG6A 4R68A 3M6IA 4BHTA 4BGIA 4O1MA 3AK4A 3BTVA 3VVCA 3DB2A 2HRZA 4CV1A 1EK5A 1KVSA 4G81A 4MVJE 5DBIA 5BNIA 5TQVA 3I83A 4XB1A 3BIOA 2ZCUA 1MV8A 1SO8A 1Q7CA 3O4RA 4WCFA 3LT0A 1V0JA 1GQ2A 2XXBA 1O6ZA 3O38A 2O4CA 2OOSA 4AL4A 5MDHA 3W4IA 3KO8A 5DCUA 3AI1A 1PEDA 2Y1OA 1E5LA 3K30A 2AG5A 3H5AA 3I9NA 1GD1O 2ZTUA 2CVZA 1N7GA 2C29D 3AW9A 3UKOA 5A3VA 3ZWAA 3C8MA 3KYDB 2XPCA 4CMCA 5JY6A 3HQ4O 3JQ7B 4AJKA 3S55A 4WPGA 1VRWA 1YXMA 1IZ0A 3KOUA 4QO7A 1HDGO 2Y99A 3VPFA 5IN4A 4CM9D 3DTTA 3U4HA 4EYEA 1AN9A 2VYNA 1E1MA 4S3MA 1W6UA 3NDJA 4CQMD 3P2YA 1Y81A 2GZ2A 5COBA 1PQUA 3W6UA 3KRTA 2AEMA 3GAFA 3B70A 4MDHA 2AMFA 4UEKA 4UAGA 5JAIA 1PGNA 3H3JA 4L8VA 3EK2A 3KSZO 3I1JA 3RU9A 1M66A 3ZWBA 2I99A 1LU9A 4K1LA 2HMVA 2BFAA 4KP7A 5ES3A 1PWXA 5KOIA 1KS9A 4NDNE 4YT8A 2X23A 3VDQA 5G4LA 2DFDA 4XX0A 3JQ8B 3FNHA 4NFSA 4IS3A 5A4DA 1G6KA 3B1FA 3DR3A 1E3LA 3EUWA 3MJEA 5BSHA 4YEDA 4Z6KA 2Q2QA 3ST7A 3H9EO 2NACA 2DPHA 3E8XA 1W4ZA 3ZV6A 3BHJA 3QV1A 1NPTO 5U9CA 2Y68A 4MP8A 4MVJG 5I8ZA 4OSOA 2X58A 1UXGA 2YQ4A 4W99A 1VSVA 4F6LA 1K2WA 2CFCA 1EMDA 1ISJA 1E7YA 1N5DA 1YGYA 2HU2A 1KEUA 4BO1A 8LDHA 1Y9EA 5JAZA 3FPCA 3RVDA 1P9LA 4F6CA 4IGEA 5AYVA 2Q3EA 1QG6A 3IS3A 4EUHA 3ZNQA 3DMTA 2P9CA 4R1UA 5FFFA 1LDGA 2HMSA 1HKUA 2Q2WA 2DFVA 4D41A 4YRDA 4WLNA 1DFIA 4NFYA 3OJEA 5G0UA 4MKZA 4E2XA 5BNTA 3AUUA 4YR9A 4CLHA 2PFGA 3TZCA 4IDEA 2E49A 1PGOA 1E3WB 3I9LA 4XWYA 3R3SA 5FI3A 1VLLA 4J1NA 4JN6B 1U7TA 3MZ0A 4PG7A 1R0LA 5EERA 1NVGA 1X15A 2G82A 3C7DB 3PWZA 3W8EA 1T1RA 5TIIA 5ICSA 1QLHA 1KYQA 4Z3DA 3FSRA 4F46A 4R9SA 3QP9A 3ANLA 3GNTA 4DPLA 4Y6PA 2VCYA 3FN4A 2I76A 2DM6A 1OBFO 1ZH8A 4IY1A 1YB1A 5G4KB 4A2CA 4E2ZA 1E1KA 1O8CA 1P3DA 4GGPA 3ON5A 1U8FO 4PCVA 5G0WA 3U09A 4J9UE 1ZO8A 4ND4A 1DC6A 1X14A 1HDZA 4RGBA 2X4GA 2EGHA 1H93A 1WDKA 2AQHA 3ZV3A 1YDWA 4D46A 1GV1A 3DQPA 2VHYA 1OOEA 2GASA 4LVCA 3RBXA 3WJ7A 4GQAA 3PEFA 4INAA 2O2SA 3N58A 4FC6A 3G17A 4A0SA 4GKVA 4PFJA 2FSSA 5JAMA 3D4OA 4BNUA 3U49A 1H2BA 1VE9A 2CVQA 2JAPA 2OZPA 2YV1A 2CNBA 5BQFA 4J0EA 5EESA 3GT0A 3WSWA 1P45A 4XD2A 2AEJA 1YBMA 3D4NA 2WWRA 2C0CA 4M1QA 3GA0A 1JW9B 1QLJA 1X1TA 4BNFA 1QSGA 3ZU5A 1LTHR 5HWSA 2P9EA 4ILKA 1MUUA 5A3JA 2FZEA 4BIIA 4O6VA 1I2CA 1H6CA 5CDGA 1ZSYA 1IYZA 3E9NA 4X54A 1RM5A 1BTOA 1DRVA 4QXMA 5I9MA 4CL8A 1XQ1A 4XQ9A 1MC4A 1V3VA 2NTNA 3BMCA 1HDCA 4YVFA 4C7JA 3AY6A 1I33A 3EVNA 1Y8RA 2WTBA 4B4VA 1GV0A 1O9BA 2AXQA 4L73A 4CMBA 4NG5A 1WDMA 4WEOA 3WMWA 4R5MA 2VYND 4GVXA 3IAHA 4FR5A 1VJ1A 1LX6A 3E9MA 3V1UA 1JTVA 2UUOA 2GRAA 4B3JA 2D59A 1D1SA 1OC2A 4MINA 1I3KA 3LF2A 4AJLA 2WYWA 2WEKA 2R00C 3HN2A 3OM9A 5COAA 4DYVA 5EL0A 4J2OA 3FR8A 4ZD6A 3RC9A 4YACA 3GPIA 3QRWA 5H81A 1SB8A 3I52A 3PHHA 2V65A 5C5IA 3DWFA 3MJCA 1FDVA 3B1KA 5A5EA 3CZRA 4KZPA 2NQTA 2Z95A 1GFSA 1UXJA 2GO1A 3KYBA 2X9VA 2W2KB 3GG9A 4FFNA 2DTDA 2BRUA 1QV6A 4IJKA 2YV3A 4JJIA 1XCBA 2UVDA 2ZQZA 1E3EA 3VAZA 3VZSA 3MTGA 4EDFA 3LT2A 3FWZA 3VH2A 5KIAA 2E4AA 4GX5A 1I36A 4RF2A 3Q9UA 4U5QA 4BO3A 3LC2O 1A7AA 1VPDA 2GN8A 4OM8A 5GZ1A 2B4TO 3MOIA 1P1HA 1PR3A 3WJAA 3VPHA 5A05A 5JDIA 3LC7O 3ZU4A 4D0RA 1ML3A 1YB4A 3LQFA 2NV6A 4FSHA 5FEUA 2HK8A 1OC4A 3DZFA 2Z1MA 4O59O 3C3XA 3WFIA 3EZYA 2BI8A 2PTGA 2VNSA 3WXBA 4BO9A 1BDMA 3IKTA 4UVIA 3AM3A 4ALKA 5KCZA 4BNXA 1C0PA 2AW5A 2B69A 2OHXA 3AUSA 3DTYA 4IIUA 3ZDFA 1U3UA 5FI5A 3ETGA 1EQ2A 3COSA 3ZW8A 4PZCA 4EEXA 2WD8A 2EWMA 3M2PA 4IDCA 2A92A 2ET6A 4XYLA 4ALIA 1I3NA 2FSVA 2WM3A 3WNQA 1A71A 3C7CB 2EV9A 4M87A 1NPYA 1C1DA 1C1XB 5I8WA 4L75A 1HYHA 4ID9A 3JSAA 1VKNA 3E1KA 4HV4A 2YV2A 4J7XA 1P1IA 4I5GA 4MIYA 5G2OA 5U4QA 5I9LA 2Y1CA 1Q7BA 2PKQP 3IL2A 5T8KC 1I8TA 5JCXA 1E7QA 1YVEI 4I5EA 2Y1GA 1NWCA 1UXKA 1WWKA 1ZK3A 3S2GA 3DZJA 5IFLA 1F0YA 1K3TA 4Q3DA 5JW6A 1XQ6A 3EAGA 5CFZA 3GQVA 1U4SA 4CMGA 1GYRA 4ROSA 2IE0A 1UP6A 3H8VA 1TT5B 2HO5A 4TVBA 3L4BC 4LRSB 3D1LA 4WLFA 4CMKA 4DMMA 1VL0A 3HJAA 7ADHA 1ZK4A 4YJFB 4B4UA 2HQ1A 5JE8A 6ADHA 1ENPA 4UEJA 3RU7A 4D42A 3GGGA 2PZMA 1LJ8A 2WMDA 3NDRA 4RV9A 1Q0HA 5GMOA 4WLOA 1IY8A 3M1AA 1F17A 2ZTMA 3SC6A 4W9NC 4KQWA 5BSFA 1RPNA 3NT5A 3NKLA 2Y67A 3PWKA 3OIGA 3FNFA 4GLLA 1GUZA 4DC0A 4IZHA 8ADHA 3WX0A 1LDYA 3MTJA 1DLIA 4CLRA 2AQIA 4OSPA 4ZGWA 1LRKA 1I24A 3MJ4A 2V6GA 4ONEA 4RCVA 3I6IA 1UDAA 2C20A 4BB6A 5JYEA 3PPIA 4OOEA 3SX2A 1LDEA 1JLLA 3VZPA 2QG4A 2X9GA 4DBZA 2EG9A 3ZWPA 2J3JA 1BRMA 1ULSA 9LDTA 2X0JA 2VHVA 3IUPA 4I1IA 3B1JA 4J16A 1WAMA 3LSYA 1JAYA 4E4YA 4YT5A 3QWAA 2BFOA 3GUYA 3HWRA 2G17A 1ISFA 1HSZA 2J8ZA 4OGWA 4DQXA 4FDAA 2Y1DA 1LLQA 3ZWXA 1PJQA 4DPMA 1UDCA 3H9QA 1ZVMA 5KNLA 1Y8QB 3GVIA 4JXKA 1E3WA 3G3EA 3ZW9A 2W4QA 5IZCC 3RUCA 1N7HA 2JHGA 2DVMA 2W2KA 3CE6A 1PL7A 5T67A 2O7QA 3W4JA 3ICCA 5DOVA 3WGZA 4CLOB 4P38A 3DHYA 4O5OA 2EXXA 1Z7EA 1J49A 1Y8QA 4KTVE 3OECA 4ESOA 5L7TA 1P0FA 1EFLA 3I9JA 3AU9A 3TWOA 1ZKMA 2I3AA 4BMVA 4Y67A 4JJGA 3MWEB 2A94A 3QWFA 5F1PA 1E7SA 1B15A 1DBVO 3ASUA 3KLMX 3GC6A 4JROA 5KVSA 3DO5A 1K0UA 1TXGA 3VVBA 1HZZA 1WMAA 4YT4A 1QYWA 4GX2A 3H2SA 1VKOA 4BKQA 4I5DA 4CLRB 1GEEA 2D0IA 3GRPA 4FN4A 1HLDA 4XGNA 3BTSA 5TRTA 3CXRA 4ZQEA 4J1SA 3RC1A 1PWZA 1DC5A 4JX8A 3ZHBA 4M8SA 1QYCA 3JQBC 3KSDO 4B79A 4DLBA 5JNLA 1ENYA 1N1EA 3QVSA 1LXCA 2XAAA 3F1KA 2JFFA 2DQ4A 1E3SA 1U3WA 4D7AA 3OSUA 1I30A 1PJTA 1ZK0A 2HRBA 1QYXA 2Q4EA 3WWZA 3DBVO 3JQ9A 1N8KA 1WXDA 4QFCA 2ZYDA 4D3FA 3OH8A 4YRBA 3H65A 1T26A 4Z0PA 5ADHA 1XWFA 2CVOA 5JMPA 3S2FA 3K9QO 1PZFA 2C54A 1KC1A 3BZUA 1JU9A 4MVJP 2IZ0A 4OKNA 1P1JA 2BD0A 2PLAA 4KUEA 1YOVB 3E48A 1P77A 3C85A 2NNLD 2VRCD 2QIOA 3VZRA 4YAIA 3GFBA 5CP8A 4Z0HO 4XB2A 1IPFA 4IJWA 4KMSA 4QO8A 3HHPA 3FF4A 1ZXBA
chains in the Genus database with same CATH superfamily
1QXSA 4P4UA 3WGNA 1MB4A 4OGGA 2EKZA 5AW6A 2A1TR 1PWEA 1MJ5A 3BWBA 1O89A 4BVBA 3PICA 4AQYB 4S1VA 4TTPA 3D7NA 4MVJA 4EJ0A 3HCDA 5JNTA 1M2FA 1NZDA 2B20A 4RAOA 4AN4A 5TEVA 3RS8A 3BXPA 3FIJA 2G63A 1L5SA 1PL8A 4KFTA 4DREA 4L9AA 2O5VA 2PLNA 5CDSA 3MWDA 4AW9A 8ATCA 4QUBA 4U0JA 5CA1A 2IBMA 3ROXA 2RAFA 1KO5A 4CDGA 5ALQA 1PNVA 4LF6B 1GUAA 2SCUB 3S0JA 3V2UA 1E5TA 2XMPA 5HA5A 4AKGA 1IVSA 2H5EA 3ITNA 2GJ4A 1YMUA 2FR8C 3PFFA 5A7HA 3OHMA 4REOA 3BKXA 3EEYA 4P7FA 3RRBA 2UVQA 2JK1A 3OPYB 4PCUA 5TX7A 2IV3A 3SZMA 4X71A 5HIJA 1SN7A 5IZ4A 1YQEA 1PX2A 1B1AA 5EZYB 1VBKA 3RS7A 4D9IA 1JZSA 1KYIA 4H4CA 3REGA 4EJMA 2PD6A 2ZJ8A 1N7JA 4NYMR 1XZJA 2H31A 1Z29A 4XM0A 4DIFA 1PD1A 2CVPA 2P68A 1F2TA 4KWCA 2A0KA 2A78A 4I1UA 4IMJB 4O4JB 4OF4A 4O4LB 4HDKB 3STTA 1QE5A 1P75A 1P9WA 3E58A 3IBYA 4UDXX 1X3LA 3EXAA 3SAJA 3ZGXA 3GJTA 1WW3A 2B1QA 2GK7A 4NMWA 4NABA 3MGBA 4L7QA 4M7PA 4YDSA 3ZE6A 1C41A 1E8MA 1GUFA 2MSNA 3UXMA 3PIIA 4UUQA 5DN6A 3KXKA 3WSVA 2PFKA 2AXNA 3S5UA 1M8JA 4UTXA 1WSWA 2D2EA 4G5RA 1NJSA 4JOQA 5CLGA 5AHOA 5JAHA 3L7AA 2ZIZA 5CHYA 1YNSA 4MS3A 3VV3A 4BLRA 4RTOA 2D5AA 1TA4A 1G0OA 1O54A 2WI8A 3MAGA 3QLTA 1RYHA 1ICIA 3K92A 2PKEA 3NBMA 2AXEA 5ALDA 5H0IA 5CX4A 1SZJG 3TI7A 4CMIA 4MWTA 1UWCA 3LVRE 3TLCA 3K8ZA 3W1VA 4GP9A 1A9XB 2FG6C 1SOVA 1S6YA 2OORA 1V43A 3JVUA 5K0JA 1QX4A 1XTBA 2BKXA 3IUEA 3DLCA 3PDIA 3IKMB 1Z4IA 4MQUA 3DV9A 1A9QA 3UPDA 2QVLA 1C9JA 4MW7A 2I6XA 3B8HA 2WDZA 2EQ5A 3PRHA 1H6AA 3OZVA 5C31A 1JE1A 2JGDB 1GZ7A 4RTPA 1N5KA 5LZ5A 3GMSA 4ZK2A 4Y6RA 5T4EA 2POQX 4ZODA 1UAYA 3OICA 3W3AH 1YHNA 3QE3A 2V8BA 1NBAA 1QO0D 1W0KA 2XLCA 3DCNA 3EGVA 2CXPA 2JC3A 3LO8A 2MDTA 1VPTA 4KNWA 1BH2A 1DADA 2XDWA 4IXWA 3BUSA 2NO5A 1RFGE 4F4CA 1C9EA 5KNDH 1IUOA 3ZHXA 3A2NA 1CHNA 4WNIA 1K7EB 2V6MA 2DT8A 3GRCA 4YJHB 1RVV1 3KQQA 1GIAA 2FW9A 2PL5A 1S2LA 5JS6A 1P7WA 1XTZA 2YXLA 2C2WA 1DKOA 3TCNA 2V9PA 4FB4A 3FJOA 4GQIA 2B9VA 4TTIA 5LNK1 1FDSA 4BNMA 1JVSA 1VYVA 9MHTA 2BFNA 3NBAA 4I1PA 1PNTA 2UUCB 2HK6A 5BSMA 1HK7A 4RL4A 1HNXB 2C1ZA 5EKTA 5EQTA 1DRJA 3OLVA 1N8SA 3NUGA 4HNTA 5FUMA 3T7EA 2HLDA 1WQ4A 1FFAA 1DTSA 3CEHA 4H1TA 4BKOA 5EUCA 2ID8A 4A0RA 4BFWA 5JO0A 3DV0A 4DCSA 2W4IA 4XQEA 4JLUA 1GAXA 2JNWA 5EJEA 3DWGA 2Q1YA 4AZSA 3DB1A 1KPGA 5H8WA 3FNQA 1Z4NA 1Z3IX 1QV7A 1GFIA 1S96A 2DWUA 2OOKA 3E23A 3EGWA 2QN6A 3KLNA 3BMOA 1YZ3A 1U2EA 3I3SR 2VH2A 3TPZA 3A4MA 3H19A 4WA7A 3UMRA 3QF4A 2PMKA 5F7ZA 1SCNE 2EEPA 6GPBA 3U61B 1P73A 3Q87B 3LXXA 5BNFA 4NOKA 1INLA 1YHYA 2H57A 4JJAA 1S1CA 3KPYA 4G2NA 3ROPA 3AKEA 3WGUA 2WNIA 3EDOA 4EAAA 4ZQFA 3EW7A 2G4LA 3LF1A 1C2TA 4F5EA 4V0SA 1YRLA 2EBUA 1A3CA 3H97A 4U02A 3TIFA 4CKZA 1A97A 3NALA 5HM6A 1CFZA 1D2EA 1RWOA 5KYNA 5J2UB 3WO0A 4RPJA 4EFDA 2GEVA 3ROMA 1NXVA 3K0HA 2LKCA 5I3ZA 1H0RA 2IHBA 4I6EA 3CEJA 2Y0DA 3R77A 4ENRA 3P4XA 1B2LA 5JNWA 1IK4A 1UMDB 2QTGA 2QTAA 5FJIA 3I1YA 2GCGA 3GRAA 3UIEA 3DLIA 1RD4A 1RWXA 2QZ9A 1BS2A 2Q07A 1JXAA 4TRMA 1XQYA 1ZD1A 2OBFA 2F1HA 4X7MA 5IG2A 2PMWB 1V16B 2QUHA 1XOIA 3R74A 2JD0A 1SY7A 5A4FS 2RCYA 5TPZD 4CG0A 1UBKS 3VU9A 3C1AA 1ATZA 1UXOA 2IDZA 3KK0A 2XR1A 4OQPA 5DJ5A 5KREA 4UBLA 3KOZA 1LA2A 4AYXA 1DUSA 1LDBA 5TQ0A 1SBNE 4PYOA 1U7XA 2BFFB 5HS6A 3RSZA 1EP9A 4FQ7A 3OE7D 1R37A 3VJKA 5IK2D 1NDUA 3PEYA 4JLKA 1XZDA 3EXHA 4TLEA 4QDUA 1RM0A 4UVDA 3T0IA 3OOEA 3OJWA 4JJ6A 2QX7A 1WUKS 2INGX 3QXCA 4EO7A 4ZAXA 1OT5A 1GPWB 1K63A 4G97A 3RB8A 3NYRA 5DHPA 2IWRA 5IDXA 5I7AA 4DQDA 4B9EA 5LUAA 2HJRA 1EX9A 5LZ4A 3LLSA 3C39A 4CFZA 3OAAD 4NRDA 2CDBA 5IVHA 2J9RA 3AXSA 3GLVA 4I66A 4NJOA 2HUPA 4NENB 5E6SB 2QXYA 3W2TA 5J4YA 5DTRA 3O4VA 3KQWA 4HI0E 3TEMA 4CM8A 3AFNA 4Q7LA 3V8QA 1G4UR 1MDFA 1N33B 4C6RA 3B85A 1OXMA 1RPTA 1VHDA 2AMJA 2EDCA 2P5UA 4RSRA 1NT2A 3G68A 2DSTA 3NC1C 3IT1A 4P3YA 3LVBA 2VIIA 2JAUA 4WKPA 4LISA 5F73A 2WF6A 3TSCA 1EK1A 3PSAA 2G9NA 2R48A 2WIAA 2CXQA 1Z4MA 2Q4BA 4RORA 3W7BA 2GTIA 4DJ5X 4QVIA 3BFXA 3L7OA 2YXNA 3EQ6A 4FEAA 3I2IA 5HE9A 3DAYA 1QHGA 1LQ2A 1RC1A 2Q1SA 1OFGA 3R5HA 2XWBF 1G8YA 4KE8A 4O08A 4ZOLA 2IL1A 3ZXYA 2X8BA 3PFHA 1QRAA 4KPGA 1IHPA 1JHQA 1E6UA 4GR9A 4QOHA 2AUMA 3G2PA 2V59A 1KHTA 2FMIA 4JD5A 4LX8A 4C0LA 1YS6A 4PQEA 3O9MA 2G76A 2YTZA 4CWAA 3WGIA 3DXZA 1J8DA 3NV7A 4LAFA 3RPEA 3W1WA 2O54A 3OTIA 4HUQB 4LXIA 1WE2A 1AQJA 2VATA 4WW0A 4JUBA 2RSLA 5KYUA 1I1HA 3R7NA 1DB3A 3E3LA 1UKZA 3AL3A 3OEHD 4Y0VA 1NX9A 4ZYTA 2FX3A 1TZCA 5M29A 2HMWA 1TJYA 3KYDA 4AUEA 5LJIA 3BGSA 3DPSA 4O02B 1I4EB 1PV1A 2IF2A 2PWZA 2R87A 4EHHA 3ECCA 3LU1A 3QBDA 3AY7A 4B32A 5FLXA 5ALJA 2XEDA 1ILWA 4B80A 3DZCA 1JMKC 3HBLA 3PA8A 3Q7QA 4ESEA 3EH1A 3HPRA 5FWXA 5DWVA 3E2IA 3LT1A 1A69A 2W0SA 4WXMA 2R2GA 1P4SA 2E21A 3AUAA 4LXHA 1NM5A 4NZZA 4RENA 5CDTA 1O2DA 1U1DA 4OQEA 1ND6A 2CLOB 1K9SA 2JFNA 2R8OA 3RFVA 4QFBA 3R3HA 4U2BA 3SBOA 4D81A 4EB0A 4Z0TA 1ULBA 1F1BA 4MB2A 1P3JA 5KKAA 4URUR 3GJ6A 4LNUA 4DRYA 1G2IA 4GPTA 5LZ2A 4DB4A 2HA2A 2HFKA 2ZP1A 3AF1A 2HYIC 1AUOA 2OCYC 5EJGA 3E18A 4M55A 3CZMA 2JCVA 4JLPA 4OI2A 1Y5NA 5A3SA 1AHIA 3ZHSA 5KTRA 1G2OA 1R18A 3L93A 1UJCA 3CH6A 2B5OA 1U4NA 3O6VA 1M72A 4L9WA 1MX1A 3ABRB 4J29A 4XSGA 5D84A 2VYVD 3GPLA 1HL7A 1ISSA 2B83A 4LYHA 4IRMA 2H65A 4NX2A 2VTBA 1VE1A 4BQSA 4LOIA 1YMVA 2IU3A 5BQ5A 4W1RA 5B3JC 5LQAA 4R9VA 4XR9A 4R1NA 2ZJ6A 2PX6A 1XDSA 4GI3A 2OBMA 3SSOA 2G06A 1XD2B 2G70A 2ISQA 2Z9DA 4INPA 4MAFA 4QUJA 3WA7A 3ZLJA 5AKJA 2UVPB 2W2PA 4UEOA 3NHRA 3R3YA 4TKZA 5AWFC 5JCOA 1MG0A 3PZRA 2G9ZA 4BCCA 2FUCA 1FXSA 3WOVA 4M8KA 4S05A 5TSDA 3RK4A 3FMPB 4HK4A 1Z7WA 4P5EA 4JGBA 4MVJH 1XRNA 4OJNA 3RJ9A 3MW8A 3A1CA 5COQA 3ZLBA 2I8CA 2IEDA 3CH4B 3DE2X 3ZCVA 5JROA 4DQUA 7AT1A 3KB8A 1W9HA 1R6TA 2PJDA 2EKBA 3O74A 4QU5A 5AJYA 2R6AA 1VCNA 1ZESA 2CDAA 2UVPA 3BJZA 3IR7A 4X95A 5AHKA 3RUHA 4WZBE 4N9QA 4IINA 4DLKA 2AHRA 2REQB 1JN0A 4I14A 5JZMA 3S2SA 4HZIA 4UQOA 2WJ4A 2R0QC 4KQEA 6REQB 1YVRA 4HPWA 3BZBA 4QYXA 4AJ1A 3U4QB 3TJZA 2PX5A 3PXXA 4FPXA 3LFHA 1PV2A 4IS2A 3WDKA 4Q4LA 1OE0A 1E9RA 3I9KA 4PPQA 3UO8B 4TM7A 1C1DB 3H2HA 1TEXA 1BOOA 4NY1A 4EA7A 1QDUA 4LXYA 3QBEA 3SU8A 3ESQA 3NASA 3QU4A 2WJAA 5FIUA 4IF6A 3N75A 4WOCA 5KTMA 5FOXA 2IELA 3TZKA 4DA4A 4GRAA 2UDPA 3CBGA 2IUFA 2X1VA 4KZKA 5K3DA 1YJ5A 4C7OB 1MC8A 4BNKA 4PLTA 3I64A 5KX5A 1GAQA 3DNPA 2C5LA 2H1CA 2YFYA 3V6LA 1SOAA 1YJ8A 1OGYA 4GC5A 2UXBB 4A2PA 4P3NA 3UUEA 1W5EA 3D6UA 3LVFO 2OKGA 3L18A 4KDEA 1W46A 1XI2A 3WTBA 3JD2A 1Z63A 3A1UA 1VTKA 3M3DA 4RZQA 3ZWCA 3PZBA 4CG1A 3GVPA 1JHVA 3B9RA 4XIIA 1L8AA 4WKGA 4MVJF 1R4MA 3L82B 1CHDA 3MYRA 4RL6A 3VUFA 2QG9A 4AWXA 1IJFA 1U1FA 1VCHA 2OV1A 1JXMA 2EF1A 4XYGA 3RUIA 5BXQC 1QYIA 4N3BA 4WAUA 2YY6A 2K4MA 3QE9Y 4F3CA 3KELA 4H7IA 2N46A 4P5PA 4W7IA 4S0ZA 4HATA 1DRKA 1A7JA 1EUZA 2OZKA 1PJ2A 3U2QA 2DLDA 1HZZC 4A92A 1OUMA 3AHFA 4BLOA 5BVHB 4DR4B 4POAA 1SQFA 3BJMA 4TTAA 4FM9A 2XI4A 1HTWA 2R7NA 3HH8A 2WHQA 3PYMA 2BELA 2E4ZA 1DOHA 1E6CA 1L4LA 1QS0A 1X8JA 2VEOA 1T8YA 2HBYA 1I4LD 3ESRA 2GBCA 3F4BA 3E53A 4UVHA 4UZSA 1N8TA 4GGMX 3RC7A 4DQVA 4DM7A 1T0PA 3GLSA 1LTKA 3LHSA 5D7NA 3RSGA 3UT5B 5EP2A 4D44A 4E5UA 4F1KA 4D3ZA 1HQKA 1XEAA 2CLFB 5FOSA 4YAUA 4GMHA 4KHPB 2D1YA 4C2UA 1KR5A 1A4RA 2VO1A 3ZIUA 2QLBA 2CFSA 1FP7A 1PJZA 4YQYA 2LGJA 3KDAA 5AK3A 3H8JA 2Q3LA 4K6GA 2DYKA 3TQSA 4N0MA 3F5SA 4D0NA 3DOOA 3W6OA 1JX6A 3M34A 4FGWA 3OWHA 5KOYA 4KQFA 3WLOA 1JMYA 3BMNA 2QQEA 3H1AA 4MIEA 2ZYSA 1EFAA 1MTOA 3Q8WA 3M89A 2VJMB 5HK9A 1PVVA 1Z0DA 3N2LA 4WJZA 5THQA 3KB2A 5DASA 3QE4A 3EVGA 4MV4A 2G88A 3PL1A 4FX5A 1ZD2P 4U7FA 4EPVA 3PSHA 5TQ2B 2PG3A 3CZCA 5KYGA 4OLJA 2EP5A 1YR6A 2QN1A 4HN9A 1P4GA 2W37A 3KAPA 1R5BA 4I8XA 4J0GA 4NJEB 4NYMQ 1I94B 3KEFA 4U2DA 3RSCA 4HH0A 5D86A 2B21A 2PUAA 4GIBA 1KYYA 1X1AA 4RH0A 3D02A 4R9RA 2IH5A 2BKLA 1ULZA 4JLAA 1JSCA 4MX8A 1NTRA 2FF5A 1Q0UA 4JSYA 4NCJA 2RH8A 2AX3A 3X44A 2QW8A 5C46F 2C5FA 2FWBA 3PNLA 4WZBA 4DBLE 2UYCA 5B3KA 1MRSA 3DBIA 1BEEA 3H7AA 4CLEA 2HJVA 5KU1A 2CHFA 1R15A 3BICA 3JALB 2BGLA 4QECA 4NLLA 2PWBA 1VE6A 1XA4A 3GLIA 4EPWA 1Q0LA 1CIPA 4LHWA 3GFFA 2OCAA 5KJ1A 1Z5PA 3QA9A 2Q50A 4O4HF 3Q3CA 2J0QA 2JLYA 2QUKA 1QWSA 2UYOA 2VJLA 4TUYF 4QGFA 4JLJA 1K9VF 1QIFA 2H9AA 3RU3A 5JFOA 5KWSA 1YT5A 3IVRA 1GCUA 4PS0A 3ZGYA 1SC6A 1QG4A 3IPAA 3Q9SA 4MR9B 2MWMA 5DM70 4MNTA 3WGTA 3OEYA 1ADFA 3EUFA 3WMXA 4YRLA 2WIGA 5IDYA 3VVLA 1Q1AA 1R12A 5H3CA 2J5RA 4CKCA 2HADA 2XCUA 2GBLA 2ZS9A 5LNK6 2HA7A 2XCLA 2VQFB 1E9FA 3AP1A 3RAPR 2FPKA 4PFQA 3P20A 4Q4HB 4L9RA 4JEMA 1YSCA 2E55A 5B53A 3QPBA 4DL9A 1EFKA 4RF3A 4MJLA 4ZDKA 2C9OA 2Q3CA 1YDEA 5HDQA 1R6UA 3DLPX 4DSUA 2IYQA 1L5WA 3AY3A 1JDBB 3PNVA 4WXPA 5LC1A 5CFLA 3NJ4A 2VJKA 3ELYA 5JCOC 2EEZA 4DIEA 3LTNC 2CXTA 2FE4A 5IS2A 4CZ2A 1WOMA 1Z75A 3JYOA 5E7JA 1EX7A 3V97A 4LDAA 8GPBA 3LQ1A 3TTUA 3O9VA 2GN9A 1KQ3A 3H2IA 2FFJA 5A4AA 4RC9A 4EYSA 1YBAA 3O83A 4NXNB 1WB4A 1C81A 1K6MA 3EIWA 2X1HA 4MV1A 2JIRA 2ZWAA 2OYRA 1XKXA 3GK3A 3V32A 4P4LA 1NI4A 4BFTA 3THOA 7REQA 1O5IA 1TUGA 4E3WA 1RVDA 4WTOA 4G5XA 1RDFA 4J16C 4U8HA 3KAQA 5EJMA 4TVSA 1GNVA 4Q6BA 1F4PA 4OQYA 3UHOA 4C20A 4ZN6A 2WE8A 2NZVG 2JGJA 1J1UA 1W0JD 1QGUB 4YUVA 2GZMA 3IQZA 2QI9C 1UT5A 1U6KA 3DC2A 1RMTA 1U8ZA 1VMAA 1DAOA 3K32A 2J31A 4KMMA 4DMUB 1I2AA 3JZMA 3NHZA 4HY3A 4N6NA 2R6JA 2I4TA 1LLCA 1YB7A 4ARAA 2JZOA 4RJIA 1C0EA 4N82A 3B1XA 3RT1A 2Q6KA 3PQFA 2H4FA 2M1ZA 4AP5A 3NV9A 2CLEB 2V8OA 3C3YA 4PAWA 5MN5A 1QVZA 3L0IB 1D3AA 3TQQA 4RKEA 2EVWX 5A2GA 1P33A 1YZVA 1RLUA 1C7RA 4OFXA 1MAHA 3QJGA 2I6GA 3VU0A 2P30A 2Z2JA 4W6ZA 3ZDRA 3ZZTA 4BLQA 4CKBA 2VRWA 3JATA 4ZALA 3PCRB 4BNWA 3QGMA 3COJA 1P7PA 3GUUA 3LQRA 3GNLA 4HDSA 3NTOA 3I9FA 4JBLA 1OXKB 4BJ3A 4ZHQF 3Q8LA 2C42A 2V98A 3EWNA 2AG6A 2IU6A 5IDVA 1N34B 2XUHA 2B4QA 3BB1A 3M33A 2ATIA 3M6XA 2IRWA 4WXRA 4MS3B 2FTKE 3NDIA 5KCMA 3EDCA 4Q01A 4LXQA 3ZDZB 1HF3A 5IXYA 2CE2X 4QHSA 2C2HA 3KKPA 5A3QA 5D2CA 5CM8B 1KZHA 2VP6A 1UK8A 1F1JA 3PDCA 1BQ3A 2XADA 1SURA 1RI2A 2J1LA 3GEIA 3OMXA 3GJ8A 3L5KA 4JP5A 1DU4A 3JZIA 1HZJA 5E6UB 4ZOAA 3GP5A 4E5KA 5EQDA 4DHWA 2OFPA 3HUEA 4GSKA 4QE3A 3JRNA 4X3OA 4XYMA 1GLNA 1EHIA 1TEHA 2ZRKA 2PX2A 2XDQA 1Z06A 2QPAA 4XLZA 4GZ5A 5CEFA 5ADWA 4D3DA 5F1OA 4OHRA 5THKA 1NZFA 1XCPA 3MQFA 1YJXA 2C3MA 2I2CA 3AINA 2VWHA 4QTZA 4ZT6A 6CHYA 3HFSA 1PVDA 5BNWA 3O03A 3HYTA 4OMCA 5FBRB 4NCAA 1LH0A 3U31A 3U4CA 1DJMA 1Q3HA 1WR8A 2IXAA 3W6PA 1CRQA 3PGXA 1FVFA 5HX7A 3SJ7A 5HZMA 3ZHQA 4XUCA 1D0VA 1IY9A 3D3JA 1OLUB 2B0JA 2IPNA 3G7SA 3KEOA 3VYSB 2IUUA 4F86A 4DCMA 1HE3A 2O1EA 3A37A 3F6SA 2QV0A 2GT1A 3BWVA 4E51A 4EX7A 3MWDB 1ES9A 2Q8QA 4HN4B 3GLGA 2WC1A 1PLKA 1NJFA 1RYZA 1BXGA 3GAZA 2RHJA 3D2CA 3HMKA 3K0FB 4RHYA 4TQGA 1K4MA 1UC9A 3CCBA 4XWAA 5D85A 3V8VA 5AVRA 1KRXA 5ALFA 3MELA 4GUAA 2PUHA 1P4RA 1FSZA 3GJRA 3VKHA 2BM1A 4BZPA 1KEEB 1NAIA 3DZIA 1OLOA 4L07A 1D4AA 2NUTA 3RS4A 5ERXA 1KARA 5K6AA 4M0UA 1GQQA 2FWMX 5CIQA 1XJQA 5AUOB 1CUJA 4OBWA 3ZU6A 1KJNA 4OB7A 2IYNA 3CNOA 2RHRA 1NR7A 1MZPA 3NXSA 3OZXA 3DBLB 4A3SA 5L45A 1JDJA 3IP3A 1PIWA 2AFHE 3TOZA 1AGNA 2O3JA 4CEJA 4LNHA 4I1OA 2Q1TA 2GXUA 3RVJA 5KJCA 5DI9A 4BC1A 3WFJA 1L4UA 1C7QA 2FUEA 1J4AA 4QIHA 3T1VA 3TDNA 4P31A 3I4FA 4XI9A 2YMMA 4KVAA 2FWNA 3TZHA 3V7YA 1T2DA 3OE5A 5AI4A 4K0KB 1ZJZA 2QTWB 2YWJA 1HTBA 5DZSA 3BCRA 1KFKB 1TVCA 5JMWA 1HNZB 1V37A 4DYHA 1TUBA 3MPOA 4DLZA 2ZSBA 5GQSA 3L41A 4TT3A 3Q1LA 2UZAA 3C5HA 4QU8A 2DUWA 2XKAA 4C05A 5EJ9A 2ZM6B 4AJEA 4IIJA 5HKAA 3LJKA 1QAOA 4NJMA 4DXDA 4B76A 4HB4A 3TNFA 6REQA 3FVWA 1VGRA 1LVGA 1SKUA 3FZYA 5AOVA 3ZJUA 3AHGA 3OQIA 1Z4OA 1XD2A 4LZNA 1XRQA 3D6AA 3T99A 1W73A 4QC2A 1T10A 4JB0A 3H16A 4FGUA 2XITA 3AFOA 3DFFA 4LCEA 1NI5A 2WJWA 4OYHA 4R51A 4RULA 1JH9A 1BVUA 1GPDG 2Q46A 3L0DA 1PX0A 2Q3FA 4NBKA 1UZAA 1SBZA 2ZJ4A 2O0HA 2QVBA 2CF5A 3OQOA 3P9SA 2CK3D 2IHVA 5EEGA 2GZ1A 5HSGA 4A8JB 3U0VA 3O8BA 3EFEA 1FS5A 4H6XA 2D6FA 2O8EA 1EDZA 3VNRA 5A5DA 2QN2A 2W90A 2VP3A 2XA2A 4QNNA 4CUKA 2X3UA 5JSHA 1UK7A 2XMBA 5ECWA 4M36A 3D3EA 2PZLA 3W5CA 3JYHA 3K9GA 4ZYYA 3WKEA 2VQEB 2ONCA 3AJAA 4HWTA 4YV0A 5IMSA 4R6WA 4CEIB 5IC4A 5BUSA 2CLDX 2HX1A 3BRWD 4B40A 5C7YA 5AHRA 3LNCA 4ND8A 2Y6UA 2IPMA 1FF9A 4O4JF 4QEKA 2JCBA 3ZZUA 1WPRA 4M1OA 4ISCA 5DM60 4WOBA 1IZ9A 1J99A 1PCXA 2R751 1M0WA 3JAKB 2FF7A 2QQ0A 3UJHA 3ZBUA 3PUYA 3DYIA 3QTTA 4UNIA 5I9NA 4ED9A 1GAEO 3KETA 3HU2A 3KKQA 1PJRA 1BDIA 3P9QA 2YJ5A 3CUEF 3GZ4A 2AG1A 3AIIA 2OB2A 1XQ9A 1OLXA 1JKJA 1CT9A 5MHTA 3E82A 1SXPA 5EWLB 5H68A 3BAZA 4ZV7A 2XQKA 4XZ3A 4CN9A 5HQ3B 3QEKA 1R0YA 1WJGA 3LWBA 3AVQA 2CFIA 3RROA 3I4LA 1C14A 3A26A 3RBVA 3B1ZA 5CTJA 1X1RA 3FPBA 4EGFA 3LW8A 3IMCA 2VQ6A 2BFFA 1NUSA 2XOEA 1EP3B 1E79A 4KN5A 2JEYA 5AVVA 1KRWA 4QXPA 2D3TA 1W0CA 3L8DA 1ZOOA 1QFYA 2H0RA 2KWIA 1R74A 2DH6A 3EY9A 5T6BA 3W5VA 4DQLA 3PD0A 3N0TA 4N5LA 3I4CA 4E15A 2AVDA 3CFYA 3AEYA 3SJBA 3GOHA 2ZUEA 4TKMA 1F2UB 1B26A 1NDQA 2D5CA 1E4EA 2WSLA 1NKSA 2XMGA 4RDIA 3FGNA 3VPXA 4C78A 1GU1A 4GDFA 3DUFA 5EWMB 2WOOA 1X1DA 4Z1OA 1P5RA 2PJRA 3HE3A 1BD4A 1P6UA 4LJ7A 4KR0A 3GPCA 4C3UA 3GP8A 4RIEA 3W05A 3MLEA 5IVIA 2ES4A 1CUAA 2WD7A 2X0KA 3O2NA 4KC0A 4EHDA 3FHJA 4DS3A 4KQXA 3OJFA 3CRNA 3M3PA 4HXEB 2WAMA 3A31A 4MTCA 5AJTA 3UMCA 3WLPA 1UODA 2QWXA 1GGFA 2VYQA 2JB9A 3OCCA 3VFDA 3T7IA 1A8UA 2IQIA 4X8MA 3SIRA 3WNCA 1TUIA 1Y48E 2X14A 2Y9MB 4DHEA 1Z2PX 3SG0A 4Q00A 4IP0A 2JFWA 3MTDA 1J8YF 3Q6IA 1FDWA 2XT9A 1NONA 4V2IA 4EB6B 1TZKA 1CP2A 2YWDA 4H31A 2KLHA 4CN8A 2QVXX 1ISIA 1W19A 2NPOA 4YX9A 1N3YA 5K4GA 1XAHA 2QTRA 1D9ZA 1CY8A 4HGPA 4QSMA 3VO1A 2FA9A 2ZYRA 2ZRCA 1N0IA 1VKHA 3TE7A 4MQEB 3VNBA 4R3WA 4KJXA 4P0QB 5TLSA 4RE6A 3AV3A 1IC6A 4C4YA 4JENA 1JHYA 2OZVA 2XRMA 3JQAD 3KSUA 2X9NA 4ND1A 3OHPA 3N0WA 2OHGA 1KEVA 4WINA 1T9ZA 1DWOA 2ILTA 3D0OA 3PUWA 1D6SA 4IYJA 3STUA 5ICMA 1T4CB 3AVOA 1O0BA 1IHDA 3TL2A 3IPXA 4LZZA 3KBOA 1Z2EA 4WOPA 3OTOB 1TAUA 4WZAB 3WP1B 1Z4LA 2YJZA 1RLJA 2HUNA 1RP7A 1AS3A 2FEKA 4D0SA 3C6YA 1T9KA 1WKVA 2PYIA 2P2YA 4D4IA 1XZPA 2IYVA 5F1KA 4RGYA 1B73A 2ST1A 1ZHHA 4HYYA 3BRSA 1GT6A 1BFUA 3QKRB 1AQIA 3DULA 3PU6A 3OF3A 1H05A 2ICAA 3Q2IA 1ZUD1 5IULC 5F52A 4RJ2A 1VCIA 5LBTA 1SEPA 1CS0A 1NQOA 3LGAA 1GZ3A 4MKHA 4XASA 4ZVOA 3SBEA 5BV0A 5KUTA 2WABA 1GGEA 4JASB 4PGHA 1Y0BA 3W9BA 3L1IA 4R6XA 5F3DA 2XAUA 3N0RA 1U2QA 3PYLA 1MAVA 2A0XA 1VG0B 4GLFA 2HJGA 2QV7A 2XMRA 3EVBA 3LUJA 1DXOA 1Z0IA 4OB6A 4Y2UA 1WU7A 4GUDA 1DX6A 4AICA 2AOTB 2WM2A 4MCJA 2RC5A 5FBKA 3UHPA 4D3SA 3I28A 3AM4A 4EY8A 4URVR 5J2UF 3UA3A 3B1VA 3CGGA 4OATA 3VR4A 2HTFA 3SS7X 2GD0A 3EQ2A 4G4JA 2GKSA 4M7WA 1ETHA 2VDWA 3TOXA 3D2LA 2W6JD 1T5LA 1HPLA 4DDHA 2WYUA 3OZRA 4JX9A 1GXSA 1CQZA 1KZ4A 1WVIA 4FXPA 1H2EA 1KETA 3OQ6A 5EWJB 2OPHA 3SIWA 4D6XA 4RK7A 5BYKA 2I29A 2NWQA 4O2BF 3EMDA 1M75A 5CT8A 4CDRA 1TM7E 3V8EA 5CFOA 1Z17A 3ZI0A 1V39A 1JR2A 4MMYB 4IR7A 5GAJA 4NECA 1NAHA 4HAUA 2IU4A 2XUJA 3JQBA 5H82A 5HFAA 1R0WA 3WNZA 3WTCA 5KHOC 1OXSC 2DAPA 4HG2A 2RAVA 3N8KA 5DSZA 4R84A 2QNIA 2TMKA 2LWIA 2QK4A 4QGSA 2GFIA 2IXTA 2P6MA 2W2MA 4M0PA 1Y9JA 2IDJA 4P22A 4QNMA 4QYIA 3WKBA 4Z4QA 3FKJA 4K40A 1XZGA 1H65A 1ZIDA 2QLJA 3B6MA 1T1GA 2N1BA 1VPVA 3A1NA 3BVPA 3F8SA 3IDOA 5DM0A 3TW4A 1ZNZA 5EKUA 3NUZA 3PD1A 3WZMA 2G9VA 2E7ZA 4E5VA 1E8DA 4MWEA 4MI6A 1NW3A 4MQ5A 1SXJA 1GKKA 1JQAA 4O4LA 1QVAA 3WIOA 3D8NA 1DXYA 1M2WA 1VMDA 1U1GA 1Z2NX 3AF6A 3O0DA 3D1VA 4RLFA 5MFPA 1THGA 5J4LA 3CJRA 3E5MA 5F2OA 4G5FA 5IJAA 1EUQA 3GVCA 1ZLYA 1GDHA 2XWQA 1E2GA 4GR4A 1P8JA 4R2LA 3W9UA 2L42A 3TX2A 3KM0A 3MA0A 4C6SA 2JW5A 2Q1WA 4FZJA 3U44A 3THWA 3QVTA 1LC0A 2DT5A 3A8TA 3MHPA 2FV8A 4LRYA 3OMWA 3OO1A 3C3KA 4HS4A 3LYLA 2QB5A 2I3DA 1RTKA 4KACA 3FSGA 4YRGA 3LUPA 1EU1A 4CE6A 1R16A 2DU8A 4LI0A 3WRXA 2PXCA 4TT3D 3SSAA 5BV2P 2XT0A 2I7CA 4RPCA 4K9DA 4TUYB 1J0CA 1YE5A 4PSUA 1E6LA 3SWWA 1CNMA 5AKLA 2QTBA 3O1HB 1PJBA 3RTEA 1L6IA 5KHLB 4QDOA 1DJLA 4R98A 5EIAA 2D5IA 3D7MA 1I32A 3LPAA 1NW5A 5DH9A 1QU3A 3PC2A 5E95A 2PSEA 2NYRA 1M1ZA 4HSGA 1PNRA 5ED0A 1YULA 3I45A 4JFAA 4EENA 4EEKA 2QJWA 2BF7A 1CUEA 4N18A 4QPJC 4U4AA 3VU1A 2YBDA 5K5EA 1N32B 1IEXA 4M76B 3KFLA 2Q3BA 3OT1A 2WWYA 1I2ZA 1PR0A 2KBFA 2R00A 3CT4A 3TRHA 3ONFA 4HYEA 5E4JA 3WG9A 5F4BA 2RGCA 4TPKA 4MUEA 5FORA 4MYCA 5TDHA 3CMCO 3QNWA 3RLFA 1JFVA 1TMGE 1XEXB 3JQRA 4E6PA 1JHMA 3RVLA 4EABA 4TQUS 3BHIA 3A28A 3IUMA 1RJDA 2AN9A 2BJVA 4V0LA 4BQRA 3FZEA 4CV3A 3PHIA 2R8RA 3GJZA 4KKVA 4AKEA 1WSAA 2BFCB 4N54A 3D4PA 3P97A 4OU5A 2PWAA 5IU6A 1SPBS 1BE1A 2OCXA 1G7RA 2OORC 2PT6A 1ZRHA 3C24A 3OX1A 4MV6A 4QA9A 1ZUIA 4W5HA 1S2DA 3AVWA 2ANBA 4XIGS 4BVFA 1RMYA 2BI7A 3REOA 4X1IB 5JG7A 5KX5B 1X9GA 3G49A 5BWLA 1BX3A 2HXGA 3QFSA 1QP8A 2A58A 3D6NB 4Q6WA 3EZXA 2GJKA 3BIFA 3TXXA 4AJIA 1U5BA 5SZJA 4XCXA 2CJWB 4ZOCA 2QRHA 1SVLA 1U11A 4F0JA 5IT5A 3IBGA 5KSYA 4ZT4A 3U7FB 1BWSA 1ZPDA 4IJUA 4QXAA 1K92A 2I71A 3THWB 3VNUA 3OHSX 1DEOA 3CX8A 2V7VA 2WU3A 3TGPA 2OZLA 2FRVA 4HPXB 1WA5A 1MJFA 1JS1X 1NGSA 2P62A 2Q5EA 3HB9A 5INTA 4IIYA 1D2AA 1FNBA 4AAYA 5G02A 6PFKA 1EWRA 3ZX4A 2A35A 4FOTA 3HVUA 1VYHA 1GR0A 1KMHB 5JZSA 1EVYA 3CW8X 1OAKA 2DUNA 2DX7A 4ZAGA 2XW6A 3BGDA 5K99A 3QXXA 1YFLA 3R3ZA 4HADA 3OVMA 3IDFA 2WKPA 5BQ3A 5JC1A 4M1MA 4G1EB 5BOSB 2CFRA 1TTPB 5K51A 4ITRC 3D0QA 1BZYA 1D7OA 2ZJYA 3ACCA 4IBOA 3ZDXB 1QB7A 1CUCA 1L2TA 1M7HA 3BD9A 5EIXA 1OXUA 2BHNA 2BL4A 1C0LA 2VYCA 4BAUA 4CMHA 2JH3A 4RQTA 4OHPA 4B85A 3L6CA 5DOZA 1WPQA 4J0JA 5AUQA 4GBGA 1AC5A 1V35A 3GUHA 4I8IA 5IN5A 3VC1A 4UUMA 2CXXA 2CJYA 4XM2A 4EK9A 1AS0A 3KCQA 3LX6A 3Q40A 1TVMA 4JYPA 3ZIDA 4EMTA 4ACAA 2FDCA 5JH7B 2YICA 1S2IA 4GOKA 1SU6A 2DKNA 2C88A 5HXAA 1FJXA 1ARZA 1GSIA 3RKSA 3WLMA 1T34A 4JP2A 3OQBA 5TPWB 4L27A 1FP6A 2C8VA 2JRCA 2IHYA 4GZMA 4BQQA 1NFQA 2I54A 5CT6A 3ORQA 5IT0A 1I2DA 5JH7F 5M3BA 4W5QA 2JCSA 3BL5A 4JU9A 5BO5A 5HDBB 2Z04A 3HKBB 2A1IA 3AFMA 3HSKA 5DWQA 2HL6A 2QORA 3NGXA 1EBBA 3TQTA 3IFSA 4LJLA 3IT0A 5A0FA 2NX2A 1YC5A 5D8DA 5IM5A 5BMOA 4GMFA 4HTAA 1T2NA 3NM4A 1U0LA 3W0LB 1SH7A 3DF7A 2HHHB 1HYGA 3TBHA 1NR1A 1DEXA 3I04A 1LSJA 2XB9A 3AQ4A 3KNZA 1ECCA 4NQZA 4CUZA 1UFVA 1JG3A 5FLEX 4ASUA 5BSGA 2PT9A 5EMMA 1DTEA 3H42B 1HXHA 2CZCA 1L7PA 5DN9A 5FCDA 2F59A 2CUKA 5CFRA 2Z8YM 1H0HA 2BBWA 1N2EA 3FNBA 1QORA 1S3FA 1TT7A 2MSLA 2OXFA 3H5RA 4I81A 1L5HA 3GJYA 5LMUB 2IWHA 1DMSA 4JOBA 3RS5A 1TW3A 2PU7A 4G5SA 4JZYA 4F6RA 1TCCA 1EG2A 4GI1A 4KXFB 3E1GA 2Q49A 4N7MA 4QUAA 1PEAA 4TL9A 4Z2YA 1UJ5A 3UMMA 4GL2A 4CMJA 2YFKA 3JRXA 4TMZA 3T3DA 3V80A 3A1VA 3H5OA 4WZAE 3SLGA 1I14A 5IRCD 5CT4A 1HA3A 4RHTA 4ZZIA 5KYKA 4A1FA 1PP4A 1FIUA 5AM4A 1YV9A 1I0ZA 1RWWA 4KVGA 4E22A 1VBMA 1YCHA 5REQB 5TVKA 4DIKA 1N75A 1HOTA 4D8YA 2AZ4A 3EXEA 2F43A 1M9NA 3QKRA 4P83A 1K8YB 2IZ5A 4Z9FA 3SKVA 4CM4B 4F4HA 3UAZA 1XEFA 2PUJA 3EZ2A 3JZAA 1Y4AE 4GPBA 4WWHA 4URFA 3AIOA 4DLYA 4HUQA 3ROQA 3DOCA 3PGMA 2Q21A 3GL9A 1V3QE 4WEQA 1W5FA 2I9PA 3CRVA 1W2WB 4MUBA 2I1LA 5TGDA 2KJQA 2UV8A 4YCSA 4HWOA 3KFVA 1LI7A 3E3OA 2WMNB 1BGXT 1EJ0A 2ZYAA 1P6XA 4YJFA 4NKRA 2XDQB 5CLLA 1KAOA 3T12A 1FXWF 3DVSX 1JGTA 2X8WA 1JB9A 1P1KA 2FUNB 5IKPA 2KE5A 5DLQC 2PZBA 1WTCA 3UJNA 2XBUA 1GL7A 5LD2C 1EXWA 2ADOA 3AKDA 4HB3A 3HG7A 4OI0A 4KWIA 4CKXA 2XGSA 4IIBA 4OMFG 3GHHA 2DWOA 3UOWA 4DIBA 1ZJYA 1KFJB 3T9CA 3IQEA 3GR6A 4M0LA 5L40A 2VAWA 3RTAA 4IG4A 3TPCA 3LDHA 1QYDA 5I51A 4AMBA 2C00A 1BMDA 1G6OA 1K7SN 1UPFA 4UEQA 4P7KA 3KJIA 4JT9A 4BGEA 1EFCA 1OROA 1G3RA 2NZYA 1KZYC 2DHQA 3CKLA 2AN1A 3NHBA 1AUPA 3GFSA 1CERA 3WKDA 3K71B 3FBWA 3MJSA 5DBHX 1BWRA 5JQGF 2AKEA 1LX7A 1GTL1 2A1UB 2HNKA 4HMPA 4AG3A 4D9MA 5M04A 3JTMA 1WB6A 1YIAA 4BNVA 2R4QA 5DHAA 1FSGA 1XZIA 5EIHA 2X3YA 3KZNA 3NT4A 3OY2A 3U4IA 4GMXA 4TXLA 4XJSA 2EZ8A 3U26A 3WFZA 3QU7A 4W4TA 2OA0A 2ZATA 3IVCA 1OWLA 1RMQA 1YI0A 2XXJA 2ZVJA 1R0KA 3D8BA 3PPXA 1WEKA 3U1VA 2WRZA 2FPWA 1NU6A 5DEIA 3G5AA 3AHDA