4IJWA

Crystal structure of 11b-hsd1 double mutant (l262r, f278e) in complex with 3-[1-(4-chlorophenyl)cyclopropyl]-8-cyclopropyl[1,2,4]triazolo[4,3-a]pyridine
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPCRKILEELYSTSYNMDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Optimization of 1,2,4-Triazolopyridines as Inhibitors of Human 11 beta-Hydroxysteroid Dehydrogenase Type 1 (11 beta-HSD-1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 96
structure length 263
sequence length 263
chains with identical sequence B, D, E
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2012-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ijwA00
1SBYA 3CXRA 3Q9NA 3AFNA 1DC3A 4GWGA 4ZRMA 5F5NA 1E92A 4FFNA 3BHMA 5G0UA 3D5TA 3C8MA 3QP9A 3NGLA 3DBRB 3AI2A 2R6JA 4TZTA 4CJXA 3MEQA 1E1MA 2NM0A 4HFRA 2DTEA 3RKUA 3O8QA 1Z73A 3JQAD 1HSOA 2CDBA 4MVJP 3OQBA 4KWIA 4D3FA 3F1LA 3L6EA 3H9UA 2NVUB 3G1UA 4PG6A 4XCVA 4YT4A 3H3FA 2D5CA 4GSLA 2XXBA 1ENZA 3GK3A 4UEJA 3W4JA 4PN3A 5KOIA 4CR6A 2Y05A 3OJ0A 3NTRA 2WYVA 3PP8A 4QTZA 1PL7A 4MKZA 3VAZA 2EGHA 3V5NA 4CPDA 1WAMA 2FR8A 2GF2A 3I4FA 5T64A 4D0RA 1YVEI 1D1SA 1NFFA 3ZWCA 2IXAA 1B8VA 5C7LO 3GDOA 2VUUA 4P4GA 3WGGA 4MVJA 1ZK0A 4UREA 2DUUA 3DAPA 1VE9A 4UUNA 3R0IA 2X0RA 3PI7A 5CDGA 1U4OA 5LC1A 4FN4A 3OQ6A 4BKOA 2IE0A 3QJ5A 4BNGA 4PZEA 3BIOA 2GCGA 4RVUA 2V6GA 3JTMA 1MLDA 2RHRA 1J5PA 2PKQO 4AJJA 3IJPA 2F00A 3ZV6A 4BHTA 4WOJA 4CM9A 3LU1A 1M2WA 1GQYA 4U7WA 1T2AA 3AI1A 4TROA 4CMIA 1GUFA 3BTSA 2D1YA 4NBTA 1YQXA 3PQDA 4R9RA 4L76A 1VL0A 5ER6A 4O1MA 3HB5X 4EITA 4RVFA 4TWRA 1KIFA 1NQAO 2DM6A 3LF1A 3OICA 4XJSA 4WCFA 4AJLA 1EBUA 3EVNA 3HDYA 1EE9A 4WCFC 4RLHA 4BKPA 1U3TA 2B69A 2PTGA 3NTQA 3I4CA 4HNHA 1HE5A 1R4MB 4NFYA 2X0JA 3QV1A 4NJOA 4O5OA 4WPGA 3GN1A 3PVZA 3NDRA 1VKOA 4Y98A 1E7MA 4I5FA 3JQ8B 3STHA 3JQ6A 2BFMA 4Z6KA 2EJVA 1YXMA 2CY0A 4PGFA 3ZWYA 3VVBA 4TZKA 5F5LA 3ZHXA 4RZIA 1MV8A 4UEKA 5FEUA 1WMBA 4I9HA 3GGOA 2YHUA 4E2ZA 2HRBA 4XZ3A 3OJEA 4HXYA 5ILGA 3VZQA 2OBNA 3U09A 3OM9A 1PZGA 4F3YA 4BGVA 2B83A 3NYWA 5CEJA 1XKQA 1WZEA 3BAZA 4FOSA 4CR7A 3LLSA 3UCXA 3FRJA 1XQ1A 4AJ4A 4QO8A 4GLOA 5IG2A 1N7GA 3QY9A 4CQMD 2AEFA 1EVJA 1R15A 1TA4A 1PQPA 2PLAA 4WKGA 4XYMA 2OGUA 3F6YA 4ONEA 1B8UA 3GHHA 1QLHA 2AQHA 1P74A 4EEZA 4YJFA 4YQZA 1O9BA 1CYDA 2XF8A 4CMJA 4QQRA 4ZU3A 4YAJA 3P19A 2HQ1A 1NFRA 3E5RA 5B12A 3PHIA 1EDZA 1UP4A 3RUEA 3WGIA 1VJTA 4R1UA 3JYPA 3ZNPA 2I66A 4KMSA 3NAQA 1GAEO 2AQKA 1GD1O 2AMFA 4G65A 1KEUA 4KDEA 1NHWA 3INRA 3VHRA 4D3DA 1Y9AA 3H9JA 4WUVA 4CLEA 1IHXA 1GFSA 2Q3EA 3DC2A 4L74A 1WWKA 3HN7A 2CZCA 1PTJA 1E3WB 1XIVA 3K92A 4LGVA 1UUFA 1LDMA 3E18A 3ZWBA 3IIEA 3GC6A 1XU7A 1LEHA 3X2FA 4EJMA 4E21A 5JMWA 3WLEA 5B1YA 2E49A 1EQ2A 4FS3A 4TVOA 2VUSA 4AJ2A 1G0OA 5H81A 5I7VA 1BDBA 3HFGA 3LF2A 2FN7A 7MDHA 5TT0A 3F3SA 1GZ4A 1QYVA 1M76A 3GQVA 4BB5A 6ADHA 1HYGA 5KKAA 4U6SA 4WECA 2GD1O 4J0EA 4J43A 5I9MA 2JCVA 3K2EA 3M2PA 1U3VA 1BXKA 2D8AA 3ZZNA 5COQA 1ADFA 2NSDA 5IXSA 3WOHA 4YAGA 3QIVA 4XRRA 3VZPA 1PZFA 3O26A 5FF9A 5A5EA 2EEZA 2PZLA 3EGOA 1Y9EA 1R12A 2XOXA 3O9ZA 1TI7A 2QHXA 4MKRA 1JN0A 2FZEA 5F21A 1A27A 4JJIA 4OGWA 3UCEA 2IDZA 2GLXA 4NU6A 1C0KA 1DC5A 1YBVA 2Z95A 1Z75A 3PHLA 4FOOA 4FB5A 3L07A 3VZRA 1I33A 1DFIA 4W9NA 5G4KB 2WSBA 4EEXA 1E3SA 2PZKA 4W9NC 1W8DA 3NJ4A 1EE2A 1BMDA 4B3IA 3IS3A 4GGOA 1E5LA 2QRLA 2Q4BA 3KB6A 4GGPA 1C3VA 4PCVA 4DIOA 4JX8A 1NVTA 5JE8A 4M1QA 4RGBA 1J49A 1FDWA 1NQTA 4XRGA 5I8WA 2VYND 5LDGA 2GN4A 4J7CA 2DC1A 4BKQA 2J3IA 4II2A 3U9LA 2VOJA 1GV1A 5KJEA 3ZWXA 1U9JA 1VI2A 3EY4A 4DQUA 2EV9A 4L8VA 4XA8A 4IIVA 3DEYX 3JD3A 3PDUA 1QLJA 2HK8A 4PG8A 1VC2A 1GEEA 1PQUA 1ZSYA 4L0QA 3E03A 3UHAA 2OHXA 2H6EA 5BT9A 1F8GA 3JYNA 3KYDA 1H93A 5JO9A 3IL2A 3IQDB 5AXDA 1ZK4A 2W2LA 3E5MA 2DUWA 3AY7A 2ZB4A 4WOKA 4XQCA 1PJ4A 4YYZA 4OO3A 3E9NA 4J9VA 5JDIA 3U0BA 5A9TA 3MJTA 5JDIC 1BXGB 2V65A 5JDCA 1GQ2A 1UXKA 4XQEA 3TNLA 1HWYA 3E9QA 1DIHA 2JCXA 3HN2A 3EZYA 3HADA 3MWEB 4BNLA 4Q3NA 4AFNA 4ZJUA 1Z7EA 1PJTA 2WWRA 1P9LA 4RF2A 1B0AA 3GEMA 5AYVA 1ADCA 2BF7A 2CMDA 4XR9A 4YRBA 2AQ8A 2VCYA 3NDIA 3UOGA 1HDXA 5DBIA 1B3BA 3FTPA 2EKQA 1C0IA 1V6AA 4W4TA 4A73A 4OXNA 5I9LA 1KVSA 1ULSA 3B70A 4IS2A 1P3DA 2EERA 1YL7A 3BXXA 1TB4A 3JQCA 3DBLA 2EIHA 1B14A 1LQUA 1FXSA 1S7CA 1YOVA 1RWBA 3VH2A 3GZNA 1UAYA 3IMFA 1V8BA 1DLIA 3PLRA 4E5NA 3L6OO 3PGXA 4BNVA 3UF0A 1EVZA 1HL3A 3KYCA 4Q9NA 4CQLA 2DTXA 3IKVA 1E77A 4IBOA 1LDGA 1LQTA 1ZBQA 2AG5A 2B35A 4B3HA 3KLMX 4JGBA 3FNFA 2BI8A 1UXIA 2C2XA 4P4NA 1PJQA 4ITUA 1DHTA 2YHIA 3RUIA 3BHIA 4OL9A 2GN9A 4AJKA 1T24A 3BTUA 3NJ8A 1QV6A 1E3EA 1Y81A 4N18A 2VZ0A 1V9LA 1ZCJA 4XEHA 4J7UA 4DVJA 5JLAA 1WXDA 1LLCA 2O23A 3JQ9A 3OBBA 4GMGA 1H9AA 5CG2A 1T4BA 1YB4A 3HB4X 1RJWA 1ULUA 4FFOA 3IJRA 4K9DA 1PEDA 4OMUA 4IZIA 4NR0A 5B4TA 3L9WA 2P9CA 2ZTVA 3VC7A 1K5HA 4S1VA 1DJNA 2I3GA 1V35A 2Z1NA 1KY5A 3N7UA 4XR4A 1I3KA 4Q3DA 4RCVA 5JS6A 3GOHA 3JQBA 1DHRA 5BNFA 3WG9A 3JQBC 3GAFA 2GN6A 1I3NA 1JAYA 1K3TA 3ZHBA 1P0CA 1NX6A 3PTZA 1QYWA 3DMYA 3R3JA 2OBYA 1M66A 4FFPA 4TVBA 1TEHA 4E6PA 4FC7A 1Z45A 3ZI0A 1GU7A 2VT2A 3TWOA 1PL6A 1E5QA 4CM8B 3OECA 4I9NA 3JYQA 4JQCA 4JBIA 3S2FA 3H2ZA 4XWYA 4IDAA 5JCXA 3ZV5A 4CMBA 5IDYA 4NBWA 3IOYA 4NBRA 3IKTA 3KEOA 5TIIA 1E3JA 3ENKA 3I52A 4BO6A 3D4OA 5T57A 2Y1EA 4AL4A 1XU9A 4Y6RA 2B37A 4J7XA 4E4YA 4C7JA 4BQPA 1E6UA 2DFDA 4TKLA 5BNIA 4JCOA 1FDUA 4GX0A 2WE7A 4ILKA 5JC1A 3O38A 4G5HA 1HETA 4N7RA 3ROKA 1H6AA 2P68A 4NFHA 5CEEA 1XQ6A 3ZDFA 2WD7B 2RIRA 4L4RA 2YJZA 1ZXLA 2VYVA 1B15A 5A03A 1O5IA 3RC7A 4PLWA 4QFCA 3C1AA 3U5TA 4PG5A 4R54A 3U62A 1NQ5A 4MP8A 4PLZA 2NWQA 4IMPA 2PV7A 1GADO 1PWXA 3GT0A 3WR5A 5TF4A 3AUUA 3KVOA 4H7PA 4GX2A 4YACA 3K30A 4P38A 4XGKA 4CLRB 4DQXA 1C1DB 4GX5A 1DFGA 3R6DA 3I9JA 1FDTA 3D5QA 5JAZA 3Q2IA 3WTBA 4TRMA 2OUIA 1T2DA 2VYVD 3LSYA 4JIGA 3O03A 3F5QA 3M6IA 2JFFA 3GFBA 1WW8A 3LLVA 1E1KA 4M8SA 1B7GO 3ANNA 4D46A 1P44A 2NTNA 1H6BA 4WNIA 2C0CA 3EUWA 4M49A 1N8KA 3EAGA 1DC6A 1X7GA 4YCAA 3IP3A 4MIEA 3Q6IA 1WPQA 4AJ1A 1NAHA 3W6ZA 3ZU5A 4NPCA 2C2YA 1LX6A 2IEDA 2BKAA 5BQFA 3Q3CA 3RWBA 2ZB8A 5L4SA 4Y67A 2ZQZA 5KJ1A 4OSOA 2FMUA 3MOGA 4WLVA 3LC2O 4FSHA 1CETA 5L7YA 5A02A 2X22A 2ZKLA 3KRTA 4DC0A 3V1UA 2FR1A 3AOGA 2V6BA 3PWSA 1CRWG 1UH5A 4EJ6A 4WJZA 3PYXA 4IDCA 3DHNA 3PRJA 2BRUA 2R00C 2YDXA 2PKRA 3N58A 1NAIA 3OEWA 3G49A 1JLLA 1GTMA 3HQ4O 1MG5A 4DLLA 4EJ0A 2JL1A 2WTBA 1LTHR 2ILTA 4G81A 4LVUA 2W8ZA 3AUAA 4ALJA 2J5KA 4TQGA 1ZMTA 3WGHA 1SC6A 1BVUA 1LI4A 2W4QA 4J6FA 1QXSA 2UDPA 1GYRA 5DCWA 3UICA 3VPHA 1UR5A 3S2IA 3ITKA 4ZQEA 2YW9A 1LDEA 4HFNA 3JQAB 5CFZA 5CEFA 5HS6A 3T7EA 1DO8A 4NIMA 4ID9A 3BMQA 4A27A 4B4VA 4LMRA 4R01A 5TQVA 4DWVA 1YB5A 3ZW9A 5DNAA 2FSSA 3RI3A 3KSUA 3SVTA 1SEPA 3EK2A 3ZCXA 2GNAA 4CL8A 4XIJA 2Y1CA 1O89A 5KIAA 1NPYA 2D3TA 1YS4A 1FJHA 2YY7A 1W0CA 3P2OA 5BNTA 2D0IA 4LW8A 4IDDA 4RORA 2NUAA 3CSDA 3O8QB 5L9AA 4E13A 1NR7A 1KVTA 3WGTA 3BMOB 4CMCA 3FBGA 5JY1A 3K5PA 1HE3A 5HBRA 1N9GA 3OIGA 3JD1A 1T2EA 5TRTA 4CUZA 5A3VA 3PYLA 1QSGA 5CDSA 1RM5A 4QEDA 1OFGA 3LT1A 3K8ZA 3E48A 5KWEA 2QRJA 4U0JA 2VHWA 2DPGA 4GH5A 1U7TA 1Q1NA 4ND1A 4Q3EA 2IZZA 1B3RA 3PK0A 2TMDA 3ITDA 3PHGA 5JCJD 2HRZA 1XR3A 2W2KB 4YAKA 1EUDA 4C4OA 4YT8A 4D79A 1KERA 2D2IA 4TRNA 3LT4A 3TFOA 1KC1A 1DB3A 1MC5A 3CIFA 3D3WA 2RHCA 1IE3A 4EDFA 1DC4A 1CF2O 2GR9A 2ZJ1A 4DUPA 4BO4A 1E3LA 3T4EA 1C1XB 4N5NA 3NUGA 4FIZA 4MVJE 5COBA 1I01A 3FHLA 1JAXA 1H5QA 1R0SA 3JQGA 2X9NA 2RH8A 1YL5A 3PYMA 5HM8A 1DIGA 2Q4EA 5TLSA 2O3JA 1CJCA 3VH4A 4BNWA 1H9BA 2W90A 4NU5A 2RH4A 2DAPA 5DOVA 1Y5RA 3W1VA 1PJ2A 5GZ3A 2XXJA 4WLEA 3KTDA 3KV3O 3C7AA 4BKRA 3CINA 1YKFA 2HK9A 3BMCA 5IDQA 4CMAA 3SC6A 5T8KC 1D1TA 3RBXA 2HKIA 1RM0A 4YJGB 4BNIA 2I76A 2P9EA 5BSFA 1AHHA 3ZU2A 1JWBB 2PD6A 1ZH8A 4RZHA 3VTFA 3DOJA 4CQMB 3UGKA 4CM7A 1MB4A 1QG6A 4LVCA 5FWNA 5DP2A 3GFGA 2BH9A 1PJBA 4HWKA 3GRPA 1JW9B 5TSDA 3RUFA 4J1TA 4ZICA 5B4UA 3VOSA 3BZUA 3WBFA 1NP3A 4YT2A 2NQTA 1R37A 1T26A 2BLLA 3DXFA 3HE3A 3OHSX 3DHYA 4BNUA 1VL6A 1E1NA 4I5DA 3KM0A 5C5IA 2P2SA 3H8VA 4GKVA 1K6JA 3GRKA 3GEGA 2CVOA 4Z9FA 2J6IA 5HRUA 4XYEA 5A9SB 4MVJI 2UV8A 4B7UA 1MFPA 3RC9A 1SPXA 2X0NA 4FD3A 4CMGA 5CDTA 2NTVA 4YAIA 4PLTA 3GEDA 3Q0EA 4IINA 4UEOA 2DQ4A 3I9OA 3RFVA 3OA2A 4GWKA 3S55A 4J0FA 4K6FA 2O3RA 4FFMA 2DVMA 2PD3A 4C7KA 4XJTA 1E7YA 2E82A 4YEDA 1EVIA 2QZ9A 1WLYA 4IXTA 1E6WA 3DBHB 1LLUA 2YUTA 3EMKA 1M75A 2DLDA 5DT9A 1RPNA 2E37A 3LVFO 3MTGA 1LA2A 4NQZA 3VTZA 4OH1A 3WDSA 5KVCA 4M87A 1PSDA 2ZCVA 3WTCA 4IGFA 3MJSA 3PGJA 3NX4A 3WQSB 1UP7A 5MDHA 3MTJA 4MVJD 3AOEA 5HS4A 3AOEC 2RCYA 3FNGA 3P5SA 3BMNB 4R16A 3EVTA 3UFXA 1JKJA 3I9MA 2FSVA 3HFSA 5I7SA 1DLJA 1VLLA 2Y0CA 1D3AA 3PXXA 3DZGA 3ETDA 4L75A 4UAGA 4CLOB 2C59A 2BD0A 4CM9D 4PRKA 3KO8A 3DR3A 5C7IO 4B7CA 1G0NA 4AJPA 4DIBA 2VWHA 1YRLA 1NPTO 2GZ3A 5A4DA 5J23A 5FI5A 4IDEA 3ZWPA 3JQ7A 2CUKA 1I5RA 5BSEA 2FWMX 5CAEA 3VKVA 4PLGA 2WYUA 4YB8A 1EMDA 1JDJA 1X13A 4ROSA 4MOWA 4FW8A 5T5QA 1H2BA 3CEAA 1PS8A 5A06A 3COSA 1M6WA 4O6VA 5G0WA 3PQFA 4ZD6A 1B8PA 1X0XA 4WLOA 3S2EA 3KZVA 3MOIA 2VWGA 4IUYA 2AE2A 1A5ZA 2FRDA 3GDGA 4A2CA 3H9EO 4HKTA 4Y6SA 1CQIA 2OORA 2X86A 2JFHA 1PGNA 4J90A 4PLCA 1MC4A 1R4NA 4E2XA 2ZCUA 3OSUA 3PJDA 3QQPA 2GASA 1LSOA 1AUPA 4BNXA 3AM3A 3ANMA 4BL5A 3WIDA 4DPLA 1AN9A 3CMCO 3DBRA 3PLNA 3DZHA 2VTEA 1BRMA 1D7OA 1Y8QB 5EIOA 3G1TA 4NBUA 1ZEMA 5G4LA 3VDRA 3TOXA 1HSZA 2YQ5A 3QVSA 1U8XX 1NQOA 2LDXA 1XDWA 1IPFA 4JP3A 4ND2A 4IQ0A 4M89A 3VDQA 1CWUA 2NVUA 4RF4A 1E0DA 4RVSA 1OBFO 3MWDB 3GA0A 1H2HA 3TRIA 2ZTUA 2EHDA 4CMKA 4M54A 4I5EA 1Y8RB 4L9RA 5K6AA 4IGEA 4YDRA 3Q11A 1GZ3A 1A9YA 2YV3A 3GUCA 5AXCA 3SJ7A 1EFKA 4HNGA 1BTOA 1O6ZA 3JV7A 1SAYA 3WSWA 1NWCA 3WJAA 1XEAA 3ON5A 4BS9A 3ADPA 5DBFA 4EYEA 4S3MA 3ZNNA 4PIVA 4RJTA 2BGMA 1EK6A 4A7PA 1SO8A 1ENOA 1OOEA 1ZK1A 4OM8A 3LZ6A 3KSDO 1XHLA 3TJRA 4HBGA 3U4CA 4JLWA 4Z9XA 3NT4A 1MX3A 4BNKA 3IC5A 3S2GA 3FI9A 1QKIA 1GPDG 3OFSA 1FK8A 1DIAA 1JU9A 1YDEA 2X7HA 4KUGA 4OXKA 4KOAA 4PLHA 4LCEA 2EXXA 4XDYA 1HDZA 1NPDA 2NQ8A 4NK4A 2ZYDA 4IQ8A 2PA3A 3PIDA 4PVDA 3EYWA 5HWSA 4YAEA 1LLDA 3L77A 3PIIA 4PFJA 4ALIA 4F45A 4N5LA 8LDHA 3GVIA 1C0LA 3PJEA 4Z9YA 4ESOA 2FZWA 1X14A 3LT2A 4KQWA 1F14A 4R1TA 4KZPA 5G0VA 2V6MA 3RD5A 4E0BA 1QP8A 4R41A 4XYLA 2EJWA 9LDTA 2AA3A 1DJQA 1I32A 2Y1FA 4XD2A 5L95A 5DULA 2LDBA 2D4AA 1NHGA 1R4MA 2D5AA 3KUXA 3P7MA 4MVJG 5IN4A 3ICPA 1P33A 2BMAA 2EP7A 3C24A 1PL8A 3SJUA 1T2CA 4FGSA 4ZQBA 3RUCA 1O95A 3PFWO 3S1LA 4DQVA 3RCBA 1LXCA 2H5LA 2ZTMA 2EG9A 1K6XA 5DOZA 5CP8A 4HFJA 4A26A 1ISIA 3INGA 1EEHA 1LSJA 1OAAA 1HKUA 2EW8A 4Q3BA 1SB9A 1T1SA 1NM5A 3GR6A 3E8XA 4QUKA 3D0OA 1U5AA 4IJVA 4CM6A 1V0JA 3QE3A 2X8LA 3W8FA 5HTOA 4NI5A 3VH3A 2PH3A 1M67A 2B0JA 1UZMA 4W82A 3RKRA 2X0IA 2QIOA 1ISJA 3AM5A 4GBJA 4NNJA 1PIWA 1P31A 4B4WA 2O48X 1VJ0A 4FCCA 4JJFA 5JW6A 9LDBA 5JNLA 2NU6A 3VPFA 2RAFA 3CE6A 1U4SA 1WDKA 2ZYGA 4ZRNA 5JDCC 5B4VA 2J8ZA 1GCOA 1P1IA 1EUZA 1MXFA 2PK3A 4UUPA 2X5JO 5EPOA 1MG0A 3HSKA 4J4BA 1LSSA 4Y6PA 3RU9A 2VWQA 1WNTA 1LRKA 1IL0A 1XSEA 1KYQA 1HYEA 2W2LD 4Z3DA 4R51A 4QT0A 2H9IA 3H7AA 5EESA 4GQAA 4KQXA 3V2HA 3ZV4A 1E3WA 4LSWA 4A5OA 1Y5MA 2UUOA 1I2CA 4G2NA 1PR9A 5KTKA 1HDRA 2NU7A 3JQDA 3TF5A 1LJ8A 3CZMA 4X54A 3H4VA 4ZA2A 4OKIA 4QO7A 3I23A 3IAHA 1KBZA 1Y1PA 1YQDA 3CKYA 4HP8A 1I2ZA 1C0PA 3KXDA 4HY3A 3OH8A 1JA9A 1X0VA 1ZVMA 1E7RA 2J3JA 3FPLA 2GSDA 4BIIA 4P22A 1TLTA 2OXIA 1ADGA 2VT3A 1PGOA 4NK5A 4Y9DA 3DONA 2AEJA 4RLSA 2PNFA 4OQZA 2PGDA 3LQFA 1VPDA 3QSGA 4ALLA 4BNYA 3RVDA 4RF5A 1GYPA 1OZAA 3CUKA 1YBAA 1QR6A 1ZK2A 3I9NA 4K28A 3TZQA 2NV6A 2VRBA 3FSRA 2VRCA 2ET6A 5G2OA 3CPSA 3PWKA 3DFZA 2CDCA 3JQ9C 4R1NA 4FJ2A 4TKMA 3TL2A 4BNJA 5IXYA 5DZSA 1JKIA 4JBHA 1GYQA 2FPIA 3PQEA 1ZSNA 3GH3A 4A10A 1ADBA 3GG9A 1OI7A 1PZEA 2C29D 3A9WA 3H9GA 1I2BA 3G3EA 4DTIA 1HDGO 1CERA 3JQEA 3QHAA 3HG7A 5C7OO 1S6YA 2B5VA 2IYPA 5G4KA 2Y1GA 1PJCA 5JPIA 1I3MA 1XLTA 2Z1MA 3F47A 4IM7A 4OOFA 2NU8A 5MGBA 4YJHA 1ISFA 3OEYA 1OC2A 4UVGA 3GVCA 2HCTA 4CLXA 2Q50A 4W6ZA 3WLFA 3H3JA 3WBBA 4Z0TA 4BMVA 4O63O 4DRYA 3T4XA 3R1IA 4I8XA 3ANLA 3IP1A 4E12A 3F1KA 4PRLA 5ICMA 1Q0LA 2JCYA 4NJMB 1P1KA 4A0SA 1VL8A 3E9MA 1J0XO 2NVWA 2A4KA 2VUTA 1SZJG 1GL3A 3U3XA 1Q2XA 1UZLA 1VSVA 2Q45A 2V7PA 4YPOA 1VRWA 3GNTA 1TT5B 4WLUA 2CVZA 3AY6A 5C37A 3PFFA 3SBOA 1KC3A 3WYBA 3L0DA 4MKXA 4MINA 1P1HA 1BXGA 3JQFA 3JQFC 1IUKA 1EZ4A 3BMQB 3RIHA 1PGPA 4R9SA 2NVBA 2O2SA 2EP5A 3WNVA 3CTMA 4Q3CA 2HMVA 2B4RO 3KEQA 3VH1A 4CM4B 1XCBA 3GMSA 3WX0A 5CHEA 1NVMB 5L4LA 3GGGA 5FYDA 1EQUA 4BO3A 2HJRA 1MFZA 2DBZA 3QWBA 1ZUD1 2VZ8A 4J9UE 2EF1A 1LBEA 2YV1A 3SLGA 1T1RA 1KVUA 4FR5A 5AXBA 1ORRA 4DLAA 4LMPA 3WGQA 3ONDA 3MZ0A 3H5RA 1SOVA 4CV1A 1UXGA 2OZPA 1NNUA 3OF2A 4YQYA 4A03A 5K9ZA 1ISGA 1P1FA 2CNBA 4XQGA 3D3EA 1VKNA 4IZHA 1JWAB 4B4UA 3QWIA 4JP2A 5COAA 2C7GA 3MJVA 3ZWWA 1R66A 4ZQGA 2XAAA 1L1FA 4RL6A 4CM3A 5JYEA 4BUCA 4ND3A 1BWSA 5A1TA 2X1HA 2TMGA 3WNQA 3ROMA 8ADHA 2Y0EA 4ZQFA 3W4IA 1AXGA 3RFTA 2GYYA 1QYDA 3C1OA 3G79A 2C5AA 4D3SA 5I9NA 4NDNE 5JSFA 4KUHA 3V1YA 1BW9B 1KEVA 2Q46A 3H5NA 2HLPA 1W6UA 4DA9A 3AK4A 4PZCA 1XA0A 4JXKA 1IHYA 3AY3A 4MDHA 3ZNQA 4JN6B 1P0FA 4U8GA 3WFIA 3NT5A 1TT7A 1JVBA 5F1OA 3CMMA 4BO0A 5EINA 2IZ1A 5FFFA 1DAOA 2IXBA 3D4PA 4ZVVA 4BGEA 1EVYA 2C20A 1EK5A 1DBVO 1NYTA 4B8WA 1HT0A 3AU9A 5TJHA 2HK7A 2VHZA 5L45A 4WEOA 2IYOA 4J1SA 1UDBA 3W8DA 3A1NA 1FDVA 3H65A 5L7WA 1KY4A 3ICCA 1G1AA 2Y99A 1M6HA 3FPCA 5A3JA 1N7HA 4R69A 2PD4A 4Q39A 4U0KA 4CM8A 1LC0A 1Q7GA 1PJSA 3PHJA 2GN8A 2H63A 1GZ6A 3ZH2A 3DZIA 3QWFA 3QW2A 4WCDA 2O3SA 5C3MA 1HE2A 3UW3A 1U2GA 5U9CA 1F8FA 2VHXA 2YQ4A 3F9IA 3A4VA 2DBRA 4GMFA 3G17A 4MIOA 1AXEA 3WQQA 3TL3A 4F6CA 1U28A 4PG7A 1LRJA 2G76A 3PJFA 3HNPA 1I0ZA 3I83A 3MCVA 3JSAA 2QQ5A 1YWGO 2G0TA 3VPGA 1GEGA 2PZJA 3ASVA 1YONA 2POQX 1XELA 3K9QO 1WVGA 4LN1A 1AE1A 4WGGA 2JHFA 2YZ7A 4PVCA 4BNTA 2E48A 4YRAA 4XQ9A 1BHSA 4WE3A 5EERA 4J2OA 3ZWAA 4IXWA 3UN1A 1UZNA 1F06A 2XPCA 5HA5A 3DHEA 4R3WA 2WJPA 1SCUA 1CDOA 4M55A 4CV0A 2C07A 2O4CA 4D42A 1ZSVA 3D4NA 3WS7A 3I9LA 4R4JA 3W8EA 3GVHA 1I24A 3JD4A 1F0YA 3U4HA 5H82A 5IZ4A 4BQRA 2GRAA 5DN9A 1C1DA 4OHUA 1Z74A 5TT1A 2AXQA 3ZWOA 5A05A 1WDMA 1I8TA 4LRTB 2HMSA 2VWPA 2O4UX 4FBGA 1XWFA 1OMOA 3F4BA 1UDAA 5AXAA 4H16A 2UUPA 4M86A 4MP6A 2BFPA 2CF5A 1ONPA 1RYEA 4H3VA 1HDCA 3ZU4A 4CMIB 1RYDA 1QYXA 1MGOA 2QG4A 4QXMA 5CPFA 4BNFA 2GGSA 3WGYA 4Z0PA 4XDZA 3ADOA 5ENDA 3LDHA 4GKBA 4OOEA 3LYLA 4MVJH 1L7EA 4AJNA 3Q9UA 3NEPX 3S8MA 3TSCA 2X9VA 4OKNA 1BSVA 1ZXBA 4WCFB 2BFOA 5ILOA 1GCUA 2FR0A 1DIBA 5DCYA 5TS3A 1YO6A 3FR7A 4KDFA 1B26A 4O0LA 1EFLA 1SNYA 3Q2KA 4O59O 1O8CA 4DC1A 2CVQA 1UDCA 3B6ZA 4B3JA 1I3LA 2FPGA 4W7IA 1BG6A 5ENVA 3RUDA 1GR0A 2Q99A 2FP4A 1HRDA 2Q1TA 5JAIA 1UXHA 2YFHA 1MP0A 1AHIA 3JQ7B 4IDBA 5H83A 4E3ZA 4HV4A 5GY7A 3L6DA 4PLPA 1CEQA 1Y7TA 2B4QA 5AQ1A 1KVRA 2FY8A 3G0OA 3FD8A 2X23A 5KNLA 4BO1A 4IDGA 5LCXA 3D7LA 3DWFA 3V1TC 2PR2A 2X58A 4DREA 5GZ6A 5IFLA 3WIEA 3HWRA 3NDJA 4IJWA 3QVWA 3QLJA 3JQAA 2OOSA 3AI3A 1O0SA 1NXQA 1Q7BA 3ORFA 1N2SA 1HLPA 1A7KA 3B1KA 2X9GA 5JAMA 1R4NB 4YJFB 4LSMA 1IYZA 3D1LA 3K6JA 2HDHA 2P4QA 3UAGA 1K89A 2FPPA 2V6FA 3ZGYA 1U3UA 2YV2A 1E3IA 1A71A 4XX0A 3TOZA 2GZ2A 4J4TA 3BA1A 3M1LA 1J4AA 1H94A 2CSUA 1R6DA 4YT5A 5JXWA 5KJCA 5BR7A 1NTOA 4DL9A 1DAPA 1KS9A 3TDKA 3UVEA 4D7AA 1WZIA 3BMOA 4K6CA 3ZWMA 3V8BA 1J6UA 5ICSA 1IULA 3NKLA 4DIFA 4FGWA 1X15A 4RO0A 5L3ZA 1BVRA 1IB6A 4HADA 4L73A 2OL4A 4E5YA 3GHYA 4FFLA 2G5CA 3IUSA 3KYBA 2J5QA 3DZJA 3HZZA 5ER9A 1Z82A 3TPCA 4D0SA 4IIUA 3L9XA 4CODB 2D59A 1QMGA 3JYLA 3B1FA 3GF4A 4AJIA 2YDYA 1QYCA 4EUEA 4NBVA 4DPMA 2W2KA 4J4HA 4J91A 4J2HA 3RJ9A 2IZ0A 3OQ1A 1XGKA 2E4AA 3B1JA 3L4SO 4RQTA 3FNEA 4QSMA 1YDWA 4GPD1 2HJSA 4P8RA 1U5CA 2BGKA 4RPHA 2EWMA 5I7FA 2DPHA 3BYZA 1N5DA 1X7HA 4GI2A 4BV9A 4CV3A 2JD0A 1LUAA 2GDZA 4BNNA 3AUSA 1XYGA 1C1XA 1NVGA 1NFQA 4EGFA 3DZKA 2GUGA 4YRDA 2PZMA 3OJOA 1IOLA 2YYYA 5IJZA 2VTDA 3F5SA 3GN2A 3WYEA 1JVSA 3KETA 1UAGA 3LC1O 3FCOA 4D45A 3ONEA 1H6DA 1DRWA 2ZYAA 4W7HA 1P1RA 3K73O 4BO8A 1GUZA 2PGLA 3V2GA 4BMSA 1PGJA 2Q1UA 1LLQA 3DB2A 1OC4A 4YA6A 3WMXA 3TZHA 1Q0QA 4GX1A 3EZLA 3AW9A 4Z0HO 4YJGA 2WDZA 2Y0DA 3M2TA 4DYVA 4WLNA 2UVDA 3ONFA 4ALMA 5BSHA 1LSUA 1VSUA 2J3KA 2VOEA 3AM4A 4CQMA 3K2BA 4URFA 1H6CA 4CUKA 4YBZA 4R68A 3INTA 3E82A 1BDMA 2BGLA 1Y6JA 3M1AA 5KVVA 1UP6A 2ZB3A 2ZQYA 2C5EA 2C7VA 3DOCA 3JCZA 3FR8A 3OIFA 2CFCA 2HAEA 1GPJA 3UKOA 2GZ1A 2DBQA 4CL3A 5IN5A 1FDSA 4CUJA 2A9FA 2JAPA 5L40A 3H9QA 3BTVA 3LT0A 2B36A 4BMNA 3KYDB 5EMHA 4MIYA 1E7WA 3WB9A 4R1SA 4FPXA 1TXGA 3VZSA 4BO2A 1Q0HA 1JTVA 3ASUA 3EC7A 4E33A 5CPBA 4EBFA 5A9SA 4KP7A 1SB8A 3RQSA 2DKNA 1DDOA 5A5FA 2IRWA 3HUDA 4DGSA 3GY0A 3WWZA 4OAQA 1MUUA 4L4XA 4EUFA 4XB1A 4HX5A 5KVSA 3ABIA 3AFMA 5K6AC 4DBVO 2P5YA 1ISMA 1JKFA 3O4RA 2AEMA 4ZN6A 3V2UA 2VQ3A 4ZGWA 1HYHA 1N92A 3FWZA 1ONNA 1ZW1A 3GMDA 3WFJA 1UJMA 5IF3A 3DBHA 4GSKA 4DMMA 1G6KA 3I1JA 1ZEJA 1ENYA 3TFQA 4OXYA 1LU9A 1LDBA 4RPGA 1JQBA 4ND4A 3RUHA 4ND5A 2O7SA 1HDYA 3DBLB 3ZHYA 4UVIA 5DP1A 4LK3A 3AJRA 5IAAA 1PZHA 1YOVB 2I3AA 4RV9A 4MP3A 4BGIA 3DOOA 3FNHA 2EW2A 5DF1A 3GZNB 3DQPA 2WD8A 4PLVA 1NBOA 5JYDA 2JJYA 3PZRA 3P2YA 3KYCB 1NR1A 3QA9A 2DBVO 4CQLB 1WP4A 2JD2A 2A94A 2W98A 1TVEA 4N54A 2G1UA 1LDNA 2OFPA 3BMNA 4YR9A 1ZFNA 3UXYA 2JD1A 2NACA 3AWDA 2Q1WA 3RASA 1GV0A 2FOIA 2YHIB 3OIDA 4XGIA 4J16A 4FQ8A 4GVLA 1DOHA 2QW8A 4CLOA 3C1TA 4WNCA 4ALKA 3DBVO 2BI7A 2CDAA 2BHLA 3MJEA 3U49A 3RC1A 3JQ8A 5JBIA 2F1KA 5A9RA 3DZFA 3RUAA 2X6TA 2GPTA 5ADHA 4BV8A 2OMEA 2WYWA 2VYNA 3GVXA 4QECA 2ZK7A 3DZBA 1E1LA 3AUTA 4R3NA 2G17A 1ZK3A 1MXHA 3KOUA 2HU2A 3WGOA 2EKLA 2X5OA 4LCJA 3R3SA 3HDHA 5GMOA 3C7DB 4LISA 4E5PA 4I5GA 3EW7A 2NNLD 3FN4A 3NGXA 3GGPA 1GY8A 5B37A 4YJHB 5I8ZA 3I5MA 4BO7A 2EKPA 3PHHA 1ISHA 3QVXA 3VPSA 2YFQA 3RJ5A 3LK7A 4E2WA 4Z3KA 2Q2QA 3TZKA 1C14A 1V3TA 2QX7A 2P9GA 4OQYA 3RBZA 4PZDA 3HDQA 3GNSA 2BFAA 2WM3A 4LRSB 3TZ6A 5L53A 3N74A 1Y8QA 1NASA 1B16A 1YBMA 4NH4A 5EL0A 3VPXA 1PS0A 2O3QA 3KBOA 1YL6A 1WMAA 2CD9A 2IEBA 4JNKA 5I7EA 3WICA 2JFGA 4GVXA 5KVQA 3ROQA 4IJUA 4BB6A 2HMTA 3OETA 4OYRA 3D64A 1HEUA 4RQUA 1PJLA 3GG2A 4BKUA 3TN7A 3VKUA 1Y8RA 4E2YA 1HTBA 2QYSA 2X4GA 4BOYA 4GAEA 3WWYA 2NLOA 4IS3A 1DFHA 3ST7A 1DRVA 3DAGA 3QRWA 4JK3A 4CM1A 1A9ZA 2Q2WA 1CQJA 4IMRA 1IY8A 2X5KO 1BXZA 3A28A 4XB2A 3ZWVA 4H15A 4D43A 4JJGA 1R0KA 1PX0A 1H0KA 2Y68A 3RBVA 4DMLA 2HO5A 3RROA 4MJLA 1K0UA 2AE1A 1HXHA 4IY1A 1IZ0A 5EQFA 7ADHA 1EDOA 4KWHA 3QWHA 2AW5A 2HSDA 4UULA 3FWNA 1Q7CA 4YWJA 1YJ8A 5KJ6A 2DT5A 3DAFA 2PH5A 4BNMA 5AVOA 2UYYA 4BO5A 1U1IA 3HDJA 2C82A 1E7QA 3AU8A 2O50A 3NT2A 4PLYA 4E5KA 1YE3A 1LDYA 2I9PA 3BHJA 4K26A 3WXBA 4D41A 3ULKA 4F46A 4XYGA 5TC4A 2PGJA 2PWZA 1RM4A 4XIYA 1LNQA 4UUMA 1V3UA 3PPIA 2ZATA 4BO9A 4IPTA 3TQHA 1X1TA 3SX2A 5U1PA 1ZJYA 1U8FO 3RAJA 4BNHA 1DXYA 5K0ZA 1E7SA 4UVDA 4UVEA 3WYCA 2QZZA 2Y1OA 3CH6A 5JO0A 1IZ9A 3A06A 1HF3A 1T25A 1I30A 2VRCD 3F4LA 1ZIDA 1HZZA 2OP1A 4GLLA 3RU7A 4YJDA 1X1EA 1GDHA 2OP0A 4EZBA 5GZ1A 1AGNA 4PG4A 1N1EA 3KHUA 2HMWA 1KEWA 4NZ9A 4AJHA 1MA0A 5JMPA 4FJ0A 3CZRA 3GVPA 2QRKA 3OMLA 1A4UA 4XGNA 1ML3A 4FDAA 1PU2A 3ZU3A 1D4FA 4NMHA 5BSGA 4CV2A 3VVCA 4UUOA 2PKQP 5DCUA 2A35A 1KEPA 3ZW8A 1HZJA 2FHSA 3PZBA 5TX7A 4I1IA 3IDSA 3I6QA 3JD0A 5T6BA 1DIRA 2G82A 1PS9A 2WEKA 3JD2A 3DTYA 4NHEA 1F17A 4RDHA 5TGDA 3ENNA 3BTOA 1U3WA 3NV9A 4CLDA 2P4HX 1HE4A 3K31A 3LC7O 4FFRA 1NWHA 3EDMA 1K2WA 3I9KA 2HMUA 4QX6A 4CR8A 2J3HA 3U4DA 3MJ4A 3UH1A 3OJFA 1GQQA 2Y66A 5IZCA 5ES3A 2PY6A 5IZCC 3WSVA 4E30A 1R0LA 3Q1LA 3SLKA 2JKVA 3K96A 4MPDA 2ZIZA 1L7DA 2RBEA 1VM6A 1LRLA 2Y1DA 1ID1A 2NU9A 4TSKA 3H6KA 5AOVA 3TZCA 5U4QA 1R16A 3T7CA 1A4IA 5DDIP 2I67A 5KJFA 2VHYA 4AG3A 2P5UA 4E31A 3PWZA 4OSPA 5KCZA 1N9GB 4KTVE 4DPKA 4R5MA 4Y8VA 3A14A 2O3TA 3WQRA 5T67A 1YQGA 1ZMOA 3GZ4A 1Z7BA 1SEVA 2B4TO 1VJ1A 2E6UX 3FF4A 3ZHZA 4BGUA 5IDWA 2PFGA 2R2GA 3E1KA 1T4DA 4K1LA 1K6IA 3UCFA 5CG1A 3H5AA 5F1KA 2O2YA 1LC3A 4R5HA 3PEFA 3OA0A 2ZB7A 1YJQA 3QVOA 4Q3AA 5LDHA 3FTNA 4II3A 4QFDA 1IPEA 4UVHA 3DFUA 1ZZEA 5TJ9A 4B7XA 1FMCA 4ALNA 4B4OA 1EUCA 3D3WB 4HFMA 1FF9A 4RVGA 4RVHA 3NRCA 2SCUA 1V3VA 4J1NA 2AG8A 4INAA 4NFSA 1E6EA 3W4KA 4YXFA 2H1SA 1A72A 2O7QA 3U4IA 5ITWA 3ZNOA 4AJOA 3JQGB 4RPJA 3MJCA 1I36A 4FC6A 2A92A 3OP4A 4RPLA 1ZKMA 1DEHA 3DDNA 4TRRA 2Q1SA 4F6LA 1P1JA 2VHVA 3QWAA 3RC2A 1P77A 3BMCB 3DL2A 3ROPA 4OJNA 5JY6A 1ZJZA 1YB1A 1ZNQO 3JYOA 1RM3A 1F12A 4N5MA 4JROA 4D44A 4MVJF 4RDIA 4MVJM 2R00A 3HHPA 1QRRA 1U2DA 3ETEA 5G0SA 1DSSG 2DU8A 5G0TA 1YH3A 4NJMA 4DBZA 3ZN2A 1DRUA 4TMFA 2VNAA 1ENPA 4DYDA 3W6UA 1WDLA 3ZWNA 2NADA 3H2SA 5TNXA 1W73A 3WMWA 4B79A 1TT5A 4BVAA 3GPIA 2VN8A 1EBFA 4J3FA 4MO2A 4U5QA 1ZO8A 1SMKA 1RKXA 4L4SA 4E5MA 5EQDA 2I65A 3FBTA 4JBGA 1I10A 4YVFA 1Z6ZA 2VNSA 3EHEA 4CMEA 2IODA 4E32A 1PWZA 5IDXA 4IJKA 4CM5A 4CMEC 3PDJA 3SC4A 1KOLA 3E6AA 4EUHA 3OJLA 3IUPA 1XG5A 1PGQA 5EJ2A 1A7AA 3B20A 5FI3A 4WASA 2WD7A 1CIVA 2Y67A 3GNQA 5L4NA 1B2LA 2AQIA 3DTTA 3GAZA 4CM4A 2Y93A 2VZ9A 4XKJA 4AVYA 3HJAA 1GUYA 3ETGA 3I3OA 4IDFA 5KKCA 2Q49A 5JFOA 3I6IA 2BELA 2JHGA 5DBGA 5L51A 4RF3A 2AHRA 2EGGA 3PJGA 4RPKA 4CLRA 4WK6A 6LDHA 4AICA 5JCJA 2J5RA 2Q2VA 2I6TA 1W4ZA 2I99A 4KUEA 1P45A 2HUNA 5THQA 1DPGA 1ARZA 3GUYA 4NG5A 4TRJA 1QORA 2O3UA 3WGZA 3DMTA 3DMTC 1D8AA 3UUWA 2CF6A 3F46A 2GERA 2P91A 4IQGA 3C85A 5THKA 1KVQA 4FJ1A 5ITVA 1PR3A 5CDUA 3GPDG 4J49A 3GLQA 1PQWA 1T2FA 3ZV3A 1BW9A 2JAHA 1BGVA 1HDOA 1X7DA 2ZJ0A 1SOWA 3KLPX 3QVTA 5F3RA 3SEFA 4I9UA 4WEQA 4B8ZA 1ONOA 1UXJA 4RVDA 2I5PO 3KSZO 4I08A 4EW6A 4PLFA 2QYTA 3RFXA 3WJ7A 4CLHA 2UAGA 3C7CB 4ZQHA 4DXHA 1KETA 4GL4A 3RSHA 1N1GA 5A04A 1O94A 3X2EA 2DFVA 2GO1A 4OIMA 4XYBA 1HLDA 5F1PA 3SXPA 1U7HA 2B5WA 4P4LA 5JAQA 5CDYA 4KTTE 3DO5A 4DLBA 4J1QA 4BNZA 2DTDA 1QV7A 2OO5A 2WE8A 2C54A 3NTOA 4WLFA 2WMDA 5L7TA 4AJEA 3GDFA 3L4BA 5T8KA 3L4BC 4W99A 4HUJA 5EN4A 1PJ3A 4ZHSA 2Z5LA 2NTJA 4EI2A 4CMHA 3C3XA 4YTEA 2ZTLA 5JC8A 4U6QA 1YGYA
chains in the Genus database with same CATH superfamily
1OAKA 1FU4A 4EW3A 3Q9NA 4UTOA 4KIJA 4Y7CA 2RJ3A 1Y7PA 2HBQA 1RNLA 2XUFA 4C0SA 1E92A 1L4NA 4DWWA 7REQA 5K0CA 2GEKA 1JGTA 4CU5A 5DO9A 2OBBA 3BHMA 4EW1A 4F3KA 4DQKA 2FLWA 2HO4A 4M7RA 2ONCA 5JRDS 2JFPA 3PQ7A 3L0BA 4O0MA 4C88A 1E1MA 2ZIVB 4IFBA 5CNMA 5KI6A 1GTRA 2XGJA 1PW7A 3O8QA 4JC4A 1WPGA 2CFTA 1E61A 1H3NA 4MRPA 2IHZA 1MA3A 5HCUA 3F1LA 3H9UA 3JVEA 3KOYA 2PQ6A 2QN3A 3CPHA 4GSYA 2NVUB 3SY8A 4AY6A 4Q1DA 3FDXA 1SCDA 3LL4A 1LPPA 3VPBA 4YT4A 2D5CA 4GSLA 1DARA 4UEJA 3R9XB 3W4JA 3EWIA 1I7SB 4CR6A 1K4KA 2JGLA 3WGKA 2GBIA 4EY5A 4EVIA 2ZJZA 3TXXA 4MWBA 1JQKA 1C9DB 5KDLA 3V5NA 5KWSA 1XWIA 2FR8A 2GF2A 3N6XA 3WLNA 4S12A 4P4SA 5T64A 3VO9A 3KJXA 3E35A 1DT3A 1G4HA 5J23A 1JDSA 1H0RA 1U7PA 3GDOA 3GP3A 4KYTA 4P4GA 1DO0A 5TEVA 1JFFB 3TW4A 5C7LO 2PUFA 3WGGA 3LD9A 4W7SA 1VE9A 3C48A 3PDCA 5FPPA 1YI0A 3A36A 4ECAA 2WSSD 4EGJA 1U4OA 3PDHA 5BSTA 2WFZA 3NS7A 2IE0A 1QIEA 3UJDA 3V2IA 2JLCA 4BNGA 3RSLA 3BIOA 1KI4A 2GM3A 2V6GA 1I4LD 1Z2CA 1J5PA 2ZU6A 3FDZA 3VVLA 3BMXA 4R1OA 4PZ0A 4EG5A 1MRNA 3RANA 1E9VA 1NBME 2F00A 3LQRA 4MLDA 1Y8CA 2EJCA 4WOJA 3ZY2A 4BHTA 1DEXA 1SHKA 2P3QA 3S3TA 4DM3A 2E89A 4QGBA 4J3JA 4TROA 1R74A 1GUFA 3FSJX 3SKYA 2WTXA 3ZXUB 1DGQA 1NULA 3HVIA 2ZVJA 3FDIA 4DSUA 3AHFA 4R9RA 1T5IA 1KDRA 3BA6A 3EVZA 4I4TB 4L76A 4UBLA 5KYVA 3HB5X 4RVFA 1I7QB 4NTZA 1U02A 3GIDA 1EGAA 1WBJB 3LF1A 3OICA 2JF0A 5EXEA 1AF4A 1JP7A 4D98A 3SZOA 4BKPA 2B69A 2PTGA 1NW8A 1Q77A 3NTQA 5FA5A 1KFJB 3FVRA 4HNHA 1HE5A 1R4MB 3T5DA 2X0JA 4NJOA 5CK5A 3R9IA 1ZESA 1YR3A 4K05A 4I5FA 4V0SA 2JBAB 5FPYA 3HJRA 1E9BA 3JQ6A 2EJVA 4HB4A 3W2HA 3QVMA 4QJ5A 1HPLA 4MGYR 1T5TA 1MV8A 4MWZA 4RZIA 3QEBZ 3EJWA 3IP9A 4AM8A 4EJ2A 1K3FA 3PX7A 4I9HA 1B2RA 4GYWA 4J6EA 5GONA 1OLSB 1V71A 3OJEA 3CH7A 4E2ZA 1Q14A 3SYMA 1ATIA 2IYNA 5EE5B 1FTSA 5ILGA 3VZQA 2VEDA 3U09A 1QF7A 1PZGA 3O8BA 5F23A 1U0NA 1UCFA 3NYWA 2APJA 4PC1A 3C3PA 1WZEA 5EC8A 2YTZA 3W6OA 1P9OA 3G1WA 4OA5A 5G3YA 1WSDA 3RW9A 2HA3A 3AUJB 1JLHA 1SBTA 4UD2A 3DUWA 2R4QA 2EJTA 4IJ5A 5KSOA 3HLTA 5HUQA 4PONA 2EL9A 1QDLB 3CIOA 2I29A 1TA4A 2VVTA 1PQPA 2OENG 4YUZA 3T95A 1PUIA 1G21E 4WKGA 4TMKA 4Q82A 4YRLA 4BAZA 2PO5A 2BJWA 2W83A 4OI1A 2YWBA 4BX2A 3JWEA 1R6AA 3OT1B 3P19A 2PUGA 4DLPA 4R9UC 3H9CA 1QCCA 4N8DA 4H6VA 1QIGA 4EPXA 2H4YA 4ZK6A 1H1DA 3W5VA 1EK0A 3RUEA 1PBNA 4N49A 3WGIA 3JYPA 4B82A 4KMSA 5JUWA 1V47A 4DMHA 1Y8AA 5DNCA 2G4VA 4G65A 4HB2A 4CL8A 4D3DA 4DHWA 5C8YA 3K35A 3SOZA 3CZ4A 2O52A 2GNPA 1Q16A 2Q4OA 2HA5A 4WUVA 5GJWC 2BKEA 5T7BA 2Q3EA 4U8HA 3L8YA 4IKPA 4UOZA 3GEIA 3KFXA 3BHNA 2OBXA 4M0MA 2EBUA 1C7ZA 2J5BA 4MS1B 4ZCTA 4F1JA 2YNMD 2CZCA 3IB3A 3QFRA 3O2QB 4G36A 3RF6A 3UK0A 5ALIA 3V9AA 2NP6A 3CV3A 4PN7A 4KGVA 1NDUA 3GAMA 3OM0A 2V9ZA 4A6DA 1FSFA 1SJ9A 1DWOA 3D8NA 4B4DA 3CISA 5JISA 5KNDH 1SFRA 4I1UA 1N2IA 1P61B 1SC1A 1KAMA 3WLEA 1SBHA 3EQ9A 3CNQS 1EQ2A 4ZCQA 3ZS9A 2X19A 1IWOA 5K0SA 2K7ZA 3CLTC 2QN1A 4L8GA 5EJGA 1CY1A 4BP9A 1PYGA 3LF2A 1GSIA 2RK6A 2B8JA 7MDHA 1MEJA 4O2BB 1Q83A 3TLAA 4CG1A 3U44A 4CI0B 1GZ4A 4B0PA 3CM0A 3ZHUA 1OREA 1Y8ZA 3GQVA 1EX6A 2ES4A 4C4XA 1QJ4A 3GJSA 1Y37A 5KKAA 1OHHA 5K7SA 2LPMA 3AEQA 4J0EA 3OE5A 3W6PA 5I9MA 1T3TA 1NQXA 2KM1A 1G8JA 3A32A 1PDVA 1KSHA 2GFQA 3I04M 2PUBA 2FPSA 1E0SA 5K2OA 1RWWA 4QVGA 3ZDAA 1RAHA 1N6OA 1USWA 2QD4A 3EG9B 3WOHA 5IXSA 1NP7A 4MR7A 1JXOA 4X1IB 4CNBA 2OCXA 1PZFA 3KQNA 2G3YA 2RI6A 2EEZA 2P2DA 1CB0A 1OBOA 1Y9EA 1MO3A 2VH1A 1MB0A 5ALDA 2YASA 3VI4B 2ZB2A 1F1BA 3O9ZA 5FTMA 4F3CA 4MKRA 4K2AA 1VE6A 3NHKA 4JJIA 3FYUB 4OGWA 1FNNA 2BE9A 4UHDA 1SM4A 3KKZA 1Q1QA 2GLXA 4LRUA 1DC5A 2C3OA 3KUCA 3OO1A 1C30B 3DE5X 4HNSA 4QAJA 2G83A 2OYRA 3L8ZA 2C04A 4C7OB 3NW9A 3VZRA 10MHA 1I33A 4RY8A 3QX7A 5KZMB 4W9NC 2GJKA 4C0BA 1GPBA 2IIBA 3AVXA 4X41A 3LPLA 2QRLA 2VJLA 2E5LB 3PUJA 4PCVA 2NU8B 1AQUA 5B6IA 2W71A 4JX8A 4QDZA 4D56A 1M5TA 1RW4A 2A58A 4JL6A 1QRDA 4R71A 1DMRA 1KJNA 1OZHA 1Z0FA 2XHZA 1NQTA 2QZSA 4LXTA 1HE1C 5AJYA 5NLLA 3RLFA 1QP4A 2OGSA 4K9MA 5REQA 1JMKC 4BKQA 1CUCA 1SUEA 1PO7A 1ZAKA 1V2GA 4UNIA 1PNRA 1RWMA 4R2IA 5JI2E 2EQAA 2VYFA 2HV9A 4IIVA 3DEYX 1W4CA 3JD3A 3PDUA 1CY2A 1OXTA 3TCKA 4PG8A 1VC2A 3HO1A 1ZSYA 4BBJA 1N0WA 1V16B 2ODTX 5JO9A 1W36D 1Q1ZA 3IQDB 3S2SA 3GUVA 5BWMA 3ICQB 1ZK4A 4GKJB 3DV2A 4YO7A 5JYBA 3AY7A 1UPUA 2F8LA 1RADA 3E5HA 4RHXA 1YHZA 4XOUA 4O4IA 2IYUA 5SV2A 5LR6A 2H9AA 4J9VA 4BJ1A 3TGPA 4YRGA 5A9TA 621PA 2QDKA 3L05A 3RS2A 2WIBA 3H1GA 5EVJA 4ZZIA 1UXKA 4GLFA 4XQEA 4FS8A 5WRFA 4R8RA 4FI3C 3JRWA 2OBLA 4P5DA 3MWEB 1S7GA 1WXXA 4Q3NA 4ZJUA 1Z7EA 3AIOA 3M70A 3AVTA 1VJCA 2WWRA 3EFOB 5J4VA 5AESA 1P9LA 1VCOA 2ASVA 4YH1A 3UPUA 2C97A 4XR9A 3N6VA 1L3BA 3JQPA 4HDSA 1DINA 3ESBA 3R5KA 2VCYA 4DM7A 3U2QA 4H6PA 3A9RA 2YJ4A 3K9GA 3MUFA 3UOGA 5JJIA 4JDPA 4A73A 5I9LA 2WU0A 2PQ2A 4IS2A 4W5JA 1P3DA 1Z0ZA 2RI1A 5B7PA 1T5BA 1OAOC 3BXXA 3JQCA 4JB8A 1BKSB 2PX2A 3LNTA 2Y1KA 2HBRA 5JRJA 3QY0A 2O5EA 2I7CA 4TYYA 2IU6A 1KIMA 2GEBA 4UMFA 3T1NA 2XWJI 2KBEA 1JJIA 2O2IA 1Q3HA 2QSZA 2RGUA 3GZNA 3IHTA 3IMFA 4QJ4A 4RTSA 3PLRA 4S1NA 2GB4A 1TKRA 5CIQA 2CJFA 4BNVA 3UF0A 1HL3A 2CXOA 4ZREA 4IHKA 3U9TA 3LY7A 4KQIA 3UHOA 1XN4A 5I7OA 3Q3GE 2QAGB 1E77A 1BH6A 2XJ4A 3E7FA 3KOZA 4DCJA 1LQTA 4JI4B 4TKZA 2K2QB 2R7KA 3FNFA 3FKSA 5F5XA 5HKKA 1V1MB 4K7JA 1MJGM 1QVRA 1TCBA 3GPCA 4LDNA 3T9FA 2F8TA 4JSYA 4ITUA 3GRZA 4JWTA 3NMUF 2Q0XA 3BHIA 1IJKA 1YZTA 4N39A 2Z58A 5KSPA 2FMFA 2B4AA 3O90A 4ZALA 4BDTA 3NJ8A 1QV6A 5F7ZA 4Q47A 2OXEA 3TR5A 5E4JA 2JNWA 1W1WA 5HP4A 1HMPA 1XTPA 5JLAA 3H2JA 1LLCA 4DVJA 5EHZA 1VL2A 3FPAA 5I4KA 5A0VA 4BFVA 4GR9A 3OEHD 3JQ9A 4GMGA 4IRMA 1H9AA 1Z63A 1R0WA 2CLHB 1F2TB 1T4BA 1YB4A 1TUEA 2ZSJA 3TIGA 2XOEA 3RVPA 1UPTA 1WUTA 3LLUA 3FJYA 2JFNA 4S1VA 1E1CA 1L4HA 2Z4SA 5LZ5A 3N7UA 3AHDA 3ND7A 1I3KA 2VSQA 3HU5A 3ZWKA 1T2UA 5BNFA 1DOZA 4ZODA 3UA4A 2RGRA 3JQBC 3H04A 1HQKA 2I54A 3DVAA 4KMMA 1GRRA 4GXRA 4QRHA 4R2XA 2GN6A 1ABFA 4EO4A 1K3TA 1W5EA 3M82A 4DDMA 3PTZA 3AESB 1UM8A 2R4TA 3LE8A 3R3JA 3TLZA 5B7QA 1XNHA 2NW6A 1N2GA 2J5XA 4FFPA 1A97A 4TVBA 3UYKA 2OILA 1Z45A 1GU7A 2M6RA 1ZKDA 2R1VB 2RGCA 1G5IA 4RKYA 2HLDA 4KK4A 3OECA 1JR3A 3H1PA 4HNAA 3GD7A 1MVNA 2YVKA 1DEOA 1OFUX 1A7UA 2QTHA 1RPJA 1K8QA 1V96A 1YUBA 3BH6A 4JBIA 1XPUA 3H2ZA 3L04A 2BC9A 2QR2A 1WTAA 3FCCA 4RZSA 5FR1A 5KPDA 1ODSA 2HPZA 1UANA 4XGQA 1O0BA 4XSGA 2Q07A 4HPWA 2PE5A 3QUBA 3EBOA 1X80A 3D4OA 1RI3A 2JVIA 4KAAA 1BFKA 4DIDA 1XU9A 4Y6RA 3WIBA 4C7JA 4EFLA 2ISQA 1EUYA 3QV2A 3VR4H 2ZIWB 1E6UA 2DFDA 4BLPA 4GICA 2QL6A 3D3NA 4JCOA 1FDUA 5EJ4A 4CFYA 1ID8A 1LVUA 1NJ1A 2GLTA 1J23A 2HYDA 4W5HA 4Z4IA 4U1RA 5CBKA 1FUEA 3D9QX 2IDMA 4LSGA 4GOJA 5HEKA 1HETA 4A92A 1RCUA 4CT4B 3OTOB 1CEXA 3ROKA 2JRLA 3PUKA 4W8GA 1PSWA 1ICEA 2RJOA 2WD7B 3SXJA 1DUVG 2HQOA 2RIRA 3RGWS 1CPYA 2GYUA 4IXDA 1POXA 1ZXLA 2VYVA 2QE6A 3KDAA 2FV8A 5A03A 2FWNA 3RC7A 1MOSA 1SCUB 4B6QA 1JDVA 1QH1B 3EXEA 5EUQB 2RHBA 2RGYA 2WZCA 1FQJA 1FBNA 1P2VA 1NQ5A 1QQ5A 3BXHA 3ODPA 4R54A 5AUOB 3DPIA 3U3DA 4IMPA 2IU4A 2IYYA 1PWXA 1MQSA 1VDMA 4RWEA 1DQYA 1MX9A 3WR5A 4C6RA 4X7PA 5BNZA 3AUUA 1BWPA 1XCPA 4BFSA 4XGKA 3ADDA 2Q6IA 3B7WA 2CHVA 1PEKE 2P30A 2ECFA 5TVGA 4C05A 5IT0A 4MLPA 5JCOA 4KBGA 5TPWA 4JGIA 4Y9SA 3R6DA 2HDNB 4UNRA 4N1AA 5HXAA 5JJCA 3IQXA 3WTBA 5JAZA 3OQNA 4TRMA 3AP3A 5ELLA 4RULA 4IIJB 5F77A 1Z4IA 1PFWA 1TDJA 5C53B 3OPYI 4S04A 1W2WB 3QBVA 3M6IA 1OFVA 3OZRA 2JFFA 3GFBA 2C7BA 3LLVA 4IWNA 5LZ7A 3EEFA 2G04A 4XTCS 2BGRA 2NTNA 4Q7QA 1R18A 2C0CA 4DM4A 3H2KA 2O8VA 4UTXA 3WJ2A 3EAGA 5H3LA 2O6HA 4KQJA 3V4SA 4CKBB 4ZCIA 5KS2A 1JHVA 2ZBPA 1WPQA 4PU0A 1NRWA 3N8IA 1M6NA 4QYMA 4AXXA 4C4ZA 4UHBA 5E8RA 4CEJB 2C2YA 1CP3A 1J22A 3O4HA 5DNUA 2DF8A 2XE8A 4N12A 3E9DA 4JI5B 3D3QA 3GEEA 2AFVA 1AB6A 2BR4A 5KJ1A 4QTYA 2PVSA 3MOGA 5GADl 1IAQA 5CFRA 3G8DA 2X4IA 4RXMA 3U56A 1KAOA 2G7ZA 4YR7A 4UE3S 3IO5A 4DMFA 1C3LA 1NJ5A 2FPGB 4OUKX 2FP4B 3WXMA 1TCAA 3NU1A 1YQWA 4Y2XA 2AH5A 2I2BA 4A0FA 3PC4A 3LS2A 1NAIA 3N76A 3A10A 4LJSA 2FN8A 2Y9PB 1EIWA 2OB2A 1JLLA 1JJ7A 2P9FA 4RHTA 4H17A 2XWBF 4LI0A 1OBVA 5PNTA 2C9BA 1CE8A 3FZGA 2WTBA 1KBQA 2ILTA 3P9KA 4PINA 4CF5A 3AUAA 4ZYWA 4ALJA 3K5WA 4F21A 1BCRB 1U9CA 1UBMS 4TQGA 2D2FA 4H27A 3TMYA 1LI4A 2W4QA 1R7RA 1EFRA 4MLZA 2V03A 3IR5A 3INNA 4KWCA 2I2WA 4ROTA 3VPHA 2AZDA 2QZ4A 3FMVA 3S2IA 1Q2UA 2YW9A 4LY3A 4WFKA 3OIUA 3ZZTA 3JQAB 2EWWA 3ZDDA 5CEFA 2BVNA 1T34A 4UFOA 5HS6A 3T7EA 3GRFA 4NIMA 5NULA 2HZ7A 3BMQA 4GXQA 5BYJA 4EYOA 1QM5A 4LMRA 3CEJA 4DWVA 3U1BA 3K0FA 3ZVMA 4M8LA 3UWKA 2OSBA 5DYTA 2OWEA 3URKA 2O06A 5ESXA 1X74A 1SEPA 1KJ9A 1L5YA 3BH0A 4X5OA 3O74A 3O4VA 3T7AA 2Y1CA 1O89A 1KR5A 1XDSA 4XX0B 1Q19A 3C8UA 4OXXA 3T1YB 1FJHA 2YY7A 3LBNA 3JALB 2G1PA 2P78A 3FWYA 3UOAB 1XQYA 3O8QB 1CNFA 3TXYA 3RLIA 4E13A 5J2UA 3ZV7A 3OVMA 1W46A 3VR6A 1QHEA 2B1GA 1YBFA 4BXOB 1OTXA 1KVTA 5DHUA 4BZXA 3LW7A 3WGTA 1ULBA 2RC5A 1GFZA 2BHTA 2V7VA 2CNWD 3FRHA 4PPQA 3WBJA 4JXXA 5D1HA 3OEEA 1OX4A 4A0QA 1XD8A 3JD1A 1DAMA 2IW3A 4KGDA 1UQRA 1XTRA 3EXG1 3HC7A 3UWPA 4HJXA 5CDSA 4P54A 1A76A 3LT1A 1L3CA 3EA4A 4P4SB 4OQDA 5KWEA 1EVLA 1DX4A 2AIRA 3IR6A 3EGDA 2ZIXA 2VHWA 2DPGA 4LYYA 1U7TA 3O91A 4ND1A 2CVHA 3P4XA 4Q3EA 5CJJA 5MGNA 3K4HA 4DTCA 1X1CA 2IHNA 2RHDA 4N40A 4WNAA 3F49S 4PYLA 3P9ZA 3WRVA 1VRVA 3CRW1 4AZWA 5CVTA 2W2KB 5KOJB 5B30A 1TZJA 2E5WA 2G06A 1T36B 1XE3A 1KERA 1XRQA 1OA1A 2WT8A 1Z2OX 3LT4A 1KC1A 1DB3A 2FFRA 3B2NA 1K27A 1Z06A 5EUCA 3UAVA 3BGIA 3THSA 4Y1EA 1IBSA 5C8DA 3D3WA 4D5EA 4NFLA 4P31A 2YWRA 1YQQA 2ZJ1A 1P60A 3LDFA 3QLTA 5TMEA 2OLJA 1MAHA 1OLUA 1XZFA 2YOFA 2MSNA 1C1XB 3T4EA 1OA0A 1QVZA 2B7LA 3O1IC 4TTSA 4B2PA 4A15A 1Z17A 3JATA 4MVJE 4A9AA 1YTLA 1H5QA 1O94C 1XI2A 1XAHA 1PT9A 1Y1RA 2G63A 2NSJA 2XNHA 3I6ZA 4GP7A 5I9IA 1NOIA 1CZKA 1YL5A 2I7TA 2O3JA 1ACLA 4GNRA 4MUXA 3ZCSA 5D1NA 2BZSA 5DU2A 4INJA 2RH4A 2AVDA 3D4LA 2DAPA 2C2MA 2CNDA 2EFGA 4K9NA 2PUCA 2Q3BA 4ME6A 4ZVUA 3FRIA 3I2KA 1MRSA 3I8XA 4WLEA 4R6WA 2A5GA 5DXFA 1HKHA 3KV3O 4D6PA 3WC4A 2GBLC 3WWCA 3HRHA 3IUBA 4CMAA 4ESEA 1GNLA 1KQGA 1JLKA 3UPDA 2VQ6A 1RM0A 4YJGB 1MHPA 3R5FA 4LKOA 4EYGA 3ZU2A 2YIJA 2V54A 3TDMA 3DOJA 4BQSA 3ROXA 4D3ZA 5KDOA 1IVNA 2EWVA 4XIIA 5DP2A 1TC1A 3GFGA 4DLRA 1CLEA 4Z1MD 4CETA 4HNTA 3RUFA 4JV5B 2JI4A 2QTNA 2JI7A 3G88A 1YJ5A 4AWAA 4IH4A 2P27A 4GE0A 4J1TC 1P4SA 1XZ8A 2R751 3WBFA 1JZTA 1XOIA 3F97A 2P75A 4KXXA 4EX7A 5CT6A 2CHEA 3WLMA 5LZ4A 2UZ4A 2V6IA 1F5SA 1RAEA 1T26A 1O58A 3HE3A 2IS2A 2LIPA 4V02A 2YVLA 4YXWD 1JDTA 3T4UA 1RQ2A 4F1WA 3BL8A 1U5BB 3KM0A 1BCSB 3E81A 1JDBC 4HLDA 1KARA 4GKVA 1HG0A 4B6EA 1K6JA 3L7IA 1QOZA 4YMTA 5K8UA 3MWLA 4MRNA 2EJBA 1W0JA 5BN4B 5HRUA 5A9SB 1ODTC 4Q6WA 1YZVA 4HDKB 4CL0A 2JASA 2ZUVA 3U31A 1MFPA 3RC9A 1SPXA 3UZUA 3GLVA 2JHCA 5CDTA 1HYQA 2NTVA 3MTAA 4PLTA 3GEDA 4XLLA 1NVKA 3I9OA 3R0VA 4GWKA 2VBGA 2BCJQ 4RIHA 3PXUA 5E9QA 1AKNA 1QU2A 1S96A 2IC5A 2Z08A 5CYPA 1E7YA 2E82A 2VLBA 3H8SA 4UJ3A 5D87A 1EVIA 5DXAA 2XUKA 1A5TA 3MWKA 4IYRA 5KNCD 1V7ZA 1RVV1 2E5FA 1QQTA 3CVVA 1RHRA 4WVLA 5CT9A 1AKUA 1LLUA 3EMKA 1T9CA 3FVWA 3QU5A 1U0EA 5A7HA 4A6XA 2CL7X 4E09A 2HTFA 2I3DA 4F4IA 1XMVA 2G71A 3HABA 2E37A 3HUUA 2XWPA 1E4EB 3IGFA 4KNVA 4MPTA 4TSRA 4JDUA 4EHJA 4LF5B 3C39A 4JJ7A 1LA2A 2AHOA 4JT8A 3VTZA 3WDSA 3BGVA 3WGVA 1SVIA 2VCEA 1PSDA 1TQ2A 3KVNA 3NNSA 4WZAB 4JLUA 3WTCA 3TLEA 2SICE 4P80A 3MJSA 3PGJA 4OLAA 5BW6B 1ORHA 4MKIA 2JFQA 5EYPA 2Q3FA 1XX6A 3I30X 5M3BA 3HYSA 1RACA 3MTJA 2P6NA 1MAVA 1NOKA 3KK0A 3IP7A 4O4IF 3AOEC 4IGAA 4PY2A 3ZE1B 5HX7A 1UBCA 3C4QA 4HXFB 3P5SA 3BMNB 3SC3A 4RLFA 5J9FA 5UKDA 2XT0A 1JKJA 2P9YA 1PF7E 2FSVA 5I7SA 2FPMA 4LF9B 4AP6A 1D3AA 1BX1A 3N07A 4WRRA 1PR6A 3CR3C 3PX2A 3ETDA 2XNJA 1I4EB 3E7WA 1K8XB 3BQMB 1PV2A 3EZFA 2P6MA 3KQYA 4IP0A 4LWOA 4NPAA 4XWTA 5LP6C 3AQ4A 4C2BA 5C1BA 1NY5A 3KLNA 3UHJA 3WRWA 3A1SA 4P4TA 4WN9A 2G40A 1G0NA 2AFIE 2UYGA 4DIBA 4J2TA 3EARA 3LOPA 3HY4A 2JJ8A 2GZ3A 1Z8DA 2IL1A 1YZQA 1YGPA 4OBEA 4BDSA 3IDOA 3B3FA 4MI9A 4PGGA 1EFDN 2PQMA 1Z6QA 4UBNA 3CJRA 5CAEA 3ISJA 3VKVA 1Z5NA 1H2RS 1KYZA 1OKKA 1WW3A 4LV6A 2MMCA 4RUKA 4Y6LA 1M9NA 4OKSA 4MWTA 4Y6GB 2VXBA 4FW8A 3K8YA 4WZBB 4C6HA 4UBMA 1OPXA 5A06A 2HF2A 3V33A 4ZD6A 1RMYA 3IELA 3IUQA 3LUCA 1D2HA 4AKIA 3TTSA 2GAIA 1A5ZA 1QZZA 2JGMA 1USGA 1KPHA 1CQIA 2OORA 4R7GA 5JAOA 3C5EA 1PGNA 1Q6ZA 2TECE 4MGKR 1R4NA 2IEIA 5CT8A 1CUZA 2DY0A 3AO0B 1IK6A 3PJDA 4H7JA 2GASA 5TY0A 5TF0A 3I5UA 2QAIA 4P0PB 3K2IA 4NE2A 4BL5A 1RAGA 4V0ME 1AN9A 1FQOA 1TW2A 3PLNA 4P1ZA 2H1CA 1FP4B 1S2NA 3TLGB 3UMYA 4Q9JA 5AKZA 5EIOA 4BBPA 5G4LA 4ZC8A 1HSZA 1KYYA 1TLFA 4MUMA 1K4MA 1Q0TA 1PNQA 3K0AB 3VNUA 4BJ3A 5FBQB 3D6UA 1KYTA 1QHFA 1XDWA 3T1HB 4JP3A 1UAAA 3GLHA 3Q1KA 5IEBA 1L4FA 3THYB 2AXEA 1E0DA 3Q9SA 1J24A 2EFHB 3A9UA 5EEGA 3V6LA 4ZV9A 3ZZUA 1OBFO 1H2HA 4G63A 2FX2A 3D6FA 1SKYB 1PTJC 3P45A 1FPMA 3BE5A 3UUGA 4G2TA 5AXCA 3UHPA 3SJ7A 1E66A 4KL8S 5JALA 1UEIA 1T8PA 2KW5A 1IMJA 1K9VF 4P0QB 1SAYA 1M7BA 2AR0A 5KHLB 2WSIA 3WJAA 3MVEA 3L93A 3AEKA 3ON5A 3BF8A 1SC4A 4QQKA 5E6RA 1H3EA 2BHRA 4JODA 7MHTA 4HN2A 5EAIA 2BGMA 5IK2A 2C57A 2R5WA 3Q7TA 4QYIA 1LX7A 1OOEA 4OM8A 3STYA 1PDOA 4ADSG 4QD3A 4HBGA 1U1DA 1ECGA 4Z9XA 1X92A 3P4YA 4H7KA 2IQ5A 4D4LA 1UDRA 4FZ5A 1KWKA 3O93A 1TMOA 1WV0A 1WQ3A 2ZRJA 3LUFA 4G4SO 1FK8A 3VNRA 1JU9A 1NMSA 1T10A 2J0QA 2FPOA 1ZH6A 5FI0B 4KOAA 4HYEA 4X1KA 3V1LA 2EXXA 4XDYA 1G5PA 5D84A 3N6RA 1RWXA 2NQ8A 3BE6A 2EKDA 1WV1A 2QYHA 4X7RA 1YBHA 2GLUA 3ROGA 3GGJA 3MRXA 4DJAA 4PVDA 1M7GA 3RARA 2XODA 3RIGA 4MRMB 3CVOA 3CF4G 1W29A 3PIIA 2RD2A 3TQRA 8LDHA 3GVIA 3MELA 4G5OA 3PJEA 4Z9YA 5BO5A 4ESOA 1MN6A 1R3DA 2FZWA 3PU6A 4OP3A 3C4JA 4S05A 1I6KA 4GMXA 2V6MA 1J0AA 4R41A 2XXAB 1GSAA 4FEYA 3SZUA 2XTNA 2GEDA 2AN1A 2MHCA 2O8NA 3GEHA 4FEAA 3ICPA 4WOPA 2WD9A 1RBQA 2OLEA 2A78A 2O07A 1FP6A 4LI3X 5EFOA 5EJFA 1RI2A 1R9NA 1WM1A 2ZM6B 3Q72A 1VE7A 2H5LA 2XNDA 4D4GA 4OP1A 1FMLA 4OJQA 4M37A 4DIUA 4YCCA 2UUBB 2UZAA 1T4GA 1YQ9A 3BXOA 5E2BA 3VU3A 4AWXA 4YDQA 5IXJA 3I1IA 1HKUA 3ZVNA 1KXJA 2OV8A 4Q3BA 3LMKA 4MI3A 5KTYA 1E0AA 1G2IA 3PT9A 1QHIA 4GF5A 3IE2A 4CE6A 2IS1A 3ZDQA 4RA9A 3HYNA 1TAGA 1QFZA 3LBYA 4CM6A 5C1OA 4TLAA 1RJDA 5DLEA 4K2HA 3VUEA 5KWJA 4PX5A 1IQRA 1KH2A 1UZMA 3OE4A 2B1QA 2ONJA 3DVRX 2X0IA 2QIOA 1TCCA 2XQKA 1PIWA 3FYHA 1P31A 3SKXA 1RQ7A 4EARA 1RWPA 4U9IS 1SCAA 4P33A 4Y0AA 4FCCA 4P82A 2J30A 1A98A 1ZVQA 2DUNA 3IOMA 4B3DA 1O6BA 1J8QA 2F3TA 4IVQA 2F3QA 5A0FA 4TWBA 9LDBA 3ESZA 5SZIA 1GGKA 2AJTA 5JNLA 1K7SN 3NBQA 4TKUA 1XJQA 4KRGA 3VO2A 3UJNA 4HHEA 4JJAA 3CE6A 1U4SA 1WDKA 5E4TA 4BE4A 4EJSC 4I50F 4P84A 2JJ2A 4EPWA 4US0R 3E58A 2OZLB 1F2UB 4UUPA 3WZMA 1G2PA 1MG0A 4EOGA 3HSKA 4Z53A 1N0IA 5EIAA 3DGEC 1ECBA 1B6RA 1HNNA 1YDFA 2JLAA 2XZTA 1XJCA 1VG0B 5DH9A 3MMNA 3WZLA 4OTZA 2IPLA 2ZJFA 3EBLA 4ZAVA 5K8TA 1H4TA 1VSTA 2G6BA 3PRYA 4QT0A 4ZVMA 5EIEA 3H7AA 2FEKA 3ZV4A 3V2HA 3GLFE 1W93A 1NSYA 1VJDA 1R50A 2H7CA 2NU9B 4ARAA 2B2NA 4TLDA 3C16C 4V0LA 5KNDD 1H05A 1GG8A 1O03A 5ALEA 4BBZA 4TXLA 3EGVA 4IJMA 1IJFA 1XQXA 5HFNA 2J87A 3TF5A 3OPXA 1N3IA 3H4VA 3H5LA 4C1NA 1PFGA 3AYZB 2WG0A 3RVQA 3TLYA 3KT8A 3I23A 2VO1A 3IAHA 4BBAA 3EXAA 4ZCRA 1Y1PA 4LJKA 5I48A 2PFSA 4HY3A 1SQGA 1CRQA 3GPLA 3FPLA 3VKGA 5LDDC 3RS0A 4P22A 5CM2Z 1CUFA 3HXLA 2JJ1A 2OXIA 4FYHA 3SFZA 4A1FA 5B36A 1XHEA 2VT3A 3E3MA 1FFBA 3DONA 4RK7A 1XMOB 3FHCB 2PGDA 5ALJA 5IC6A 3QSGA 3AF4A 3O3NB 4HLNA 4J75A 4LHYA 3RHFA 3QG5A 1IG3A 4GQBA 1JS1X 1LVHA 2OO3A 1GYPA 4N01A 4RJIA 5D6OA 5E8JA 2QMEA 1PR1A 2WOJA 2YCLA 3K9FC 2Q5QA 4GPAA 3HKBA 2BLNA 1JQLB 1NVDA 4C3UA 4MR9A 2GTPA 4AP5A 2CDCA 1E1YA 4R1NA 4TKMA 3K5HA 3VA7A 1CIPA 4ND8A 5DZSA 1Q1GA 1NTRA 4XOIA 2MSEB 4B2IA 3FKSD 2Q4RA 5HKKD 1ADBA 1QGUA 1RHMA 2GH1A 3GG9A 3H9GA 1BS2A 1HDGO 4IDOA 3AEYA 3FLMA 3HCEA 4DMCA 3JQEA 3QHAA 2CV0A 1F7UA 4EKGA 3HG7A 5C7OO 2GPBA 2XLBA 1S6YA 2B5VA 3DD1A 5DT2A 1A88A 3HR7A 4EENA 5JPIA 2AOVA 3EH1A 4GEKA 5JZBA 2Z1MA 3AJEA 4OOFA 1QE3A 1FFAA 1UODA 5CA1F 5CVCA 1OC2A 1SCBA 4L9WA 2QRPA 3DSRA 3BJIC 1DJLA 2Z3VA 3LQ4A 3HXPA 4W6ZA 3WLFA 3ZU6A 5KYUB 3AR5A 1R5NA 3HCOA 4MGIR 4BMVA 3DUFA 5BV8A 4H0NA 4N5IX 2ZYUX 4I8XA 1LBQA 1GZ5A 1Y7HA 4F2HA 7YASA 2B9VA 2W2OA 3RYHB 1XZGA 3GCGA 2FWBA 2HEIA 1XBTA 5CLJA 2A4KA 1E5DA 4TQUS 1JQ5A 3SM3A 2R4UA 1XRSB 2EDAA 4OHVA 4G3XA 3U3XA 4XH9B 1VSVA 5FDFA 1VRWA 4WLUA 3QEMB 4DIMA 2CVZA 3GJRA 5K0NA 3U16A 2X40A 1KC3A 3UGJA 3ESXA 3L0DA 2X4DA 2CLFB 5CA0F 1J56A 1UFVA 4MINA 2GVZC 4X1YB 2YOHA 3R3XA 2J0UA 1EWYA 1M8GA 2CLKB 2HLDD 3QEOA 1JR3D 5ELMA 4BLSA 5B6PA 1AQYA 1GGEA 3JQFA 3N7AA 3QBTA 3FCXA 4ZTUB 2EJUA 3NOXA 2FJUA 3Q7QA 1MX1A 1ZISA 3BMQB 3OZAA 3IIMA 3F5FA 2GWHA 3UAOA 1AHPA 3AIKA 3EIFA 4NCHA 3KIPA 3VH1A 2FKAA 3KEQA 1GA6A 1R3UA 5LUAA 2Z8YA 4IMJB 3GIWA 3C0KA 2BDUA 3WX0A 4ENQA 2DMRA 3CLRC 4UNNA 5CHEA 3K2QA 1C9YA 2UZ1A 3ZZ1A 5FYDA 4R8MA 3SYTA 4UMDA 4JLAA 3KB8A 1MFZA 3QWBA 1XRJA 5HQJA 2XRYA 5M7EA 1MH1A 2QN6A 2YV1A 2XADA 5D7BA 4ER0A 3AKZA 3WGQA 4Y2JA 2VJKA 4UBIA 4ZIRB 3ZIAA 4PQEA 4TLEA 4BFUA 4NDAA 4CV1A 3FE2A 4ZEOA 4WBSA 3OF2A 3PPWA 4YQYA 1TE2A 4BVEA 1VBKA 4RK4A 1SUCA 1VKNA 1JWAB 1OX4B 1H4QA 2C00A 3EVEA 4Q1CA 1FL9A 3MJVA 3RU3A 3HUFA 4ZQGA 3SF8B 4D4MA 1NUPA 2XAAA 3LG2A 3X1WA 4CM3A 4ND3A 1DTWA 5FWDA 1G8GA 1OXBB 4JVMA 5ALXA 221PA 1QO9A 4EO9A 2X1HA 3VKHA 4LRXA 4MAMA 2HH9A 5LJIA 4ZQFA 3R7WB 3K71B 1A1VA 2GYYA 4FGUA 2C5AA 3VMMA 4D3SA 2IOQA 4NDNE 1J8MF 5TMDA 4NE9A 3A1WA 2V0NA 3ZDZB 4AZSA 5ARBA 4KUHA 3V1YA 3I2YX 3AEUB 1GN8A 3H5NA 2HLPA 2JFXA 5DNDA 4KO1S 4PZCA 4R7TA 2CJWB 2P6OA 3AY3A 3BD9A 1OY1A 4XDHA 1VMEA 1YACA 4ZOLA 4AUKA 1I7PA 2OCPA 3G2QA 4M8KA 5FOXA 5L3SA 4MUBA 4U8GA 1FJ2A 4JXZA 1VTKA 4YHHB 1TT7A 1EXNA 1OLUB 3QKSB 5IM4A 4ANFA 4BO0A 1Z0UA 4D9GA 2K2WA 1ZM7A 5EINA 3WKCA 2CZGA 5B3JC 2WMNB 1QHHA 4QUBA 1EVYA 1Z37A 3V8MA 4CF7A 4JC0A 1S02A 1VPWA 3U37A 1NYTA 3B1XA 3I5XA 2HK7A 3QBJA 4ILEA 3SIRA 3P2IA 1KZ7B 5EGNA 3CNOA 4NYMR 3RKSA 5AVQA 2ADOA 4M22A 1P81A 4NEHB 2IYOA 2A5JA 1CJKC 2YY6A 1JFTA 1UDBA 3FB1A 1H9CA 3ICOA 3A1NA 4PZUA 3DEIA 1FDVA 1YS6A 1NQWA 1KY4A 5L7WA 1G1AA 3FPCA 1UQTA 2HY7A 1N7HA 5A3JA 1N57A 2PD4A 4CM8A 1EP1B 3B2QA 4U0KA 4EKNB 3DMHA 1SUWA 4B74A 3I2FA 2G77B 3M6LA 5FUBA 4URXR 3UAXA 1E8DA 4G37A 4PXAA 1GZ6A 1XCJA 1XLWA 3QWFA 3WRYA 4DARA 1Q1EA 1HE2A 4PC6A 2A33A 3GZJA 4C0KA 1MQAA 1RWQA 1G7CA 3AR6A 5DIFA 4YCLA 4OYYA 4P3KA 5D86A 3IDFA 4NZNA 4F9EA 4L8WB 4MIOA 3ZVKA 4NSNA 2G9UA 3HJTA 5E6UA 4DEYA 4BLWA 2RG1A 4QPZA 4B3MB 1LRJA 2Q9BA 3KFLA 1I0ZA 3HXKA 1NUSA 2LD4A 3JSAA 1DBSA 4GRAA 5DEOA 3VR4D 4P58A 4LK2A 4EQZA 1Y3FE 2WBLC 3FM9A 3EGIA 4OVKA 3N2YA 4RIIA 4WKNA 1KDZA 3VPGA 4B71A 1NMEA 1CT9A 1HUQA 2OQ2A 3K9QO 4TMXA 4GP9A 3MTDA 4URHA 3ZJTA 3FMGA 2RGEA 4PC7A 2JHFA 3T9AA 1KKLA 2YZ7A 1R0RE 3IVAA 3K0CA 4FDVA 1NKSA 3DR5A 3O95A 4B6OA 4CKEA 4V1CB 1BHSA 2WTAA 3KYJB 4NOMA 4D2IA 3W79A 2PLFA 2H07A 4W1QA 4DJJA 3A9TA 3VYTB 2X3YA 2CT8A 3QEAZ 4A5SA 1II0A 4D3YA 3WNCA 1UZNA 4FEGA 1F06A 2HHLA 4Q1EA 4B34A 3IAEA 1DV1A 1J8VA 5IPFA 1GL9B 1QNLA 2XAUA 5EZYA 5IJAA 2VPTA 3LHDA 2D00A 1ZVVA 1Y6FA 2VLIA 3DEKA 3KQMA 1YSCA 2VYCA 5JS8A 1IJBA 2C07A 2ZZMA 4RJ2A 2F43A 2O8CA 4YJ2B 1E2FA 2M98A 4QGGA 3RJMA 4ZYVA 1ZSVA 2ZYVX 3X43A 1J0CA 1GFIA 2JIRA 3GVHA 4M9ZA 1JDPA 4NENA 2BBSA 4C7OA 1M2JA 1KS2A 1ZONA 3U4HA 4HDMB 4IUCS 4BQRA 5C1DA 1M7HA 4OHUA 3SSMA 3AXTA 2XBUA 1T0JB 1FFDA 3KJFA 2IS6A 3TZBA 2QLJA 3O7WA 2ZDQA 1T29A 1STOA 4LRTB 1RXIA 5G41A 4ARBA 4F2DA 4LNAA 1Z13A 3GJ7A 1ZOIA 4YQEA 4JLNA 1DKPA 5JVDA 4R2WA 1PT6A 2B1IA 4FHZA 4OLHA 4Q3LA 2WAOA 5CNIA 1XNQB 2DOKA 3PQ6A 3E8SA 4J0KA 1QU3A 1M1YB 1T3GA 3FB4A 2CXSA 2W6QA 4A2PA 4EQ6A 4EMTA 1U99A 1RYEA 1UBNA 1ZLXA 1P80A 3F2IA 3I32A 3L6CA 1R9JA 1RYDA 1MGOA 3ZU4A 2DHCA 4BNFA 4TWJA 2OG1A 4MITA 4Z0PA 2XYHA