4IJWA

Crystal structure of 11b-hsd1 double mutant (l262r, f278e) in complex with 3-[1-(4-chlorophenyl)cyclopropyl]-8-cyclopropyl[1,2,4]triazolo[4,3-a]pyridine
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPCRKILEELYSTSYNMDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Optimization of 1,2,4-Triazolopyridines as Inhibitors of Human 11 beta-Hydroxysteroid Dehydrogenase Type 1 (11 beta-HSD-1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 96
structure length 263
sequence length 263
chains with identical sequence B, D, E
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2012-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ijwA00
1F8GA 1LSUA 4OIMA 1R4NA 1XU9A 2BFAA 2EW2A 4BQPA 3F46A 4L0QA 4LISA 3AY6A 2I66A 1EDZA 4BGUA 4DC0A 1IPFA 3D4NA 4WCDA 5IDYA 2G17A 3I4CA 1E7RA 4OL9A 5T8KA 3WSWA 4BGEA 1QORA 4AJ4A 3KSUA 1R16A 4ND1A 4BOYA 1E1MA 4OHUA 2EP7A 2NV6A 4AJ2A 3OJLA 2WWRA 2DFDA 2CD9A 1DFGA 4Z0PA 1OAAA 2PZMA 1Z7BA 4IDGA 4WJZA 3KBOA 3INTA 4NDNE 1ULSA 2HQ1A 3WMXA 4CUZA 1N9GB 5AXBA 4RGBA 4O0LA 5JO0A 2VHZA 2IXBA 2PKRA 3WX0A 4DA9A 4JN6B 3PRJA 2VTDA 1E92A 4BO7A 4YJDA 4ZU3A 2VT2A 2YHIB 4JBHA 3P7MA 1H9AA 4RORA 3K6JA 3MTJA 3VHRA 1W4ZA 3QJ5A 5EQFA 5JS6A 1JQBA 2W2KB 2HK7A 2AE1A 5HS4A 1FDTA 5CG1A 4CLXA 1I5RA 2W2LD 3DBHA 5T5QA 3OIFA 4CQLB 1FXSA 3ZNPA 5JBIA 1A7KA 2VYVD 2PD4A 3FPCA 4JIGA 1JN0A 1BVUA 3FPLA 3JQAB 3BMOA 1AE1A 2Y66A 3RKUA 3E5RA 4UUPA 4Z9XA 2HDHA 5TQVA 4CLRB 1GYQA 1Y1PA 2E37A 2BFPA 1EQ2A 1KEWA 3WQRA 5TGDA 4MPDA 1MX3A 2VNAA 4J1NA 4BNXA 3I83A 1K2WA 1HDCA 1E3SA 4DPLA 2IYOA 2ZQYA 2FMUA 1D8AA 1WXDA 1MC5A 2VCYA 1K3TA 3ABIA 3L4SO 1V8BA 4OOFA 3K92A 1PJ2A 2PZKA 3I9OA 2V6MA 1YGYA 4U6QA 4W9NC 4NHEA 1RYDA 2LDXA 3ROMA 4TSKA 4BS9A 3AI2A 2NQ8A 3D0OA 2QRJA 4OJNA 3UAGA 4R54A 1O8CA 1YQDA 4GKVA 1EUZA 1EZ4A 1U3TA 4MIOA 4UREA 3S2IA 2GD1O 3JYPA 3RC9A 5KVCA 1QV6A 2J5KA 3MTGA 2HK8A 4FCCA 5JXWA 4KDEA 4GX0A 5BSHA 2FZEA 3JQ9A 4YACA 1SPXA 1C0LA 2ET6A 4B3IA 5JC1A 3SJUA 3MEQA 2QG4A 1GUZA 2EV9A 4W6ZA 2PKQO 4RL6A 2H1SA 4OXNA 4L4SA 2E4AA 4I5GA 2Q4BA 4AJKA 4JROA 1OMOA 3ZWYA 3HDHA 2DUWA 4GAEA 2Q1WA 4NNJA 1X13A 1UXIA 4QO8A 2XXJA 3OEYA 3WGQA 4EEZA 3GG2A 1KVQA 2GN6A 1N5DA 4BNYA 2DBZA 4IXWA 2BMAA 1B15A 3CMMA 5KCZA 2OFPA 5IXSA 5IZCA 1LLQA 3IJPA 1VJ1A 5A3JA 5HA5A 1U3UA 3U4CA 1Y8QB 4BNHA 1P9LA 1X0VA 3JQ8A 2QYSA 2WDZA 5CPBA 2J3HA 3JQ7A 4F3YA 5CP8A 3DTYA 3BMCB 3RROA 4IZHA 4L4XA 4OMUA 5GY7A 3QWFA 1T1RA 5L4LA 1ISIA 2Y1OA 4M49A 1LTHR 4A2CA 1FDWA 1YWGO 1D1SA 1I24A 1Y5MA 3O26A 4XQGA 1CJCA 5IDWA 2ZQZA 1ZMTA 1LSSA 3V5NA 3WGGA 4BNWA 3SC4A 1Z7EA 1UXHA 5I7FA 2O3RA 5I8ZA 2UYYA 1K5HA 1YB4A 2DUUA 1UXGA 3U4HA 1YQXA 5F1PA 3R0IA 3V2GA 3DBHB 4Q9NA 4JBIA 1X1TA 1R0LA 1OBFO 2DVMA 1EK6A 4XQ9A 1QSGA 3BMOB 4FQ8A 4WK6A 4YAKA 2GR9A 4NJMA 1ORRA 4IM7A 4E12A 4EYEA 4B7CA 2GGSA 4W82A 3PYLA 2ZJ0A 2O50A 1TT7A 3U49A 3PLRA 3GFBA 2PGLA 4UVHA 4ZRMA 1NX6A 3PJGA 1WPQA 1VKNA 3VPFA 4CM9D 4DYVA 1LDYA 3EC7A 3N58A 2IZ0A 4YB8A 4MP3A 4TROA 3MWDB 4IPTA 2VZ8A 3GVCA 1FJHA 1U3VA 3U0BA 2J5QA 5A9RA 4XQEA 2AQKA 2BHLA 4BIIA 1Z74A 4BNZA 3D5TA 2PR2A 4R51A 4BNNA 3TF5A 4IIVA 1GUFA 4WEOA 5GMOA 4J43A 4ZQGA 3F4BA 5KJCA 3C7DB 1N7HA 2W8ZA 1E5QA 4B3HA 3B6ZA 2Q2WA 3CH6A 4H15A 1Y8RB 3SX2A 3U09A 2HRBA 5HBRA 4TZKA 2B0JA 2R6JA 1ENYA 1GR0A 4N5NA 1EQUA 1K0UA 1U2GA 4YQZA 5K9ZA 4D41A 4ZVVA 4BUCA 2VQ3A 2A92A 1TEHA 3QVWA 3WYBA 1ZXBA 2FPIA 3TOZA 3DMTA 4EI2A 1HYHA 4OXKA 2O4UX 2ZKLA 3HFSA 1LDEA 2IYPA 1OI7A 2VOJA 4DLAA 5K0ZA 1I0ZA 2DPGA 4IMRA 4EEXA 4KQXA 3H65A 4ROSA 3DHEA 2XPCA 3DZJA 1I36A 4DMLA 3WLFA 4O59O 3JQ7B 3KOUA 4RV9A 4XQCA 3GEGA 3OEWA 5L7TA 3WMWA 3WIDA 2AXQA 1K6XA 5JDCA 3NTQA 2HO5A 3DBRA 1Y6JA 3G1UA 1NHWA 3PWSA 5DZSA 3TZQA 5F3RA 2PWZA 2GN8A 5JPIA 3IS3A 3Q9NA 1PJ4A 3WGIA 3GDGA 2X9GA 5DP1A 1MGOA 4IY1A 3M6IA 4B4VA 3CZMA 3V2HA 3CSDA 4N7RA 4UVDA 3U62A 2Q3EA 1UDCA 3JQCA 5HTOA 1V3UA 2HAEA 5G2OA 2J3JA 4DBVO 1NVTA 3ZCXA 3QE3A 1MFPA 1WAMA 4XRGA 4HADA 1NQTA 3Q2IA 5TC4A 5G0WA 4BKPA 1ZW1A 1R0KA 1NR1A 1R0SA 4A0SA 3INGA 4MVJH 3B1JA 2TMDA 3ON5A 4RVUA 3WQSB 3BZUA 5COBA 2Z1NA 3QVXA 4PLWA 3JD4A 3PJFA 3KEOA 5I7EA 4DGSA 1PQUA 1C1XA 1HKUA 4HUJA 1DAPA 3CPSA 3ONDA 1NP3A 1XELA 5L9AA 1VSUA 2VUTA 3ZHXA 4KUHA 5IXYA 5IJZA 2GZ2A 2UUOA 3JYQA 2O7QA 4J1TA 2OOSA 5ER6A 3ADOA 4IJWA 1QV7A 2GF2A 4GL4A 2Y1DA 4M87A 3G0OA 1BW9B 2JFGA 1W0CA 4BGIA 1ZK0A 4FC7A 5KJ6A 2CVOA 3PGJA 1LSOA 3EZYA 3UOGA 3QP9A 4IGEA 3LLSA 4HFRA 2WD7A 3WWZA 4E2XA 4ZQEA 3UCFA 2ZTLA 2RBEA 1SCUA 3UHAA 1CIVA 4UEKA 4RF2A 4K6FA 3FNFA 2Y67A 2AG5A 3TL2A 5CDGA 3KSDO 1B8PA 3BTOA 2O23A 3OJEA 2D4AA 4YBZA 3RFTA 5AXAA 4LK3A 1VL0A 1XQ1A 2B69A 9LDBA 3UN1A 1U4OA 2VRCA 4W4TA 4CM1A 1HYGA 3ICCA 4Q3EA 1SMKA 5L51A 2B83A 3ZHYA 1JDJA 5KKCA 1ZH8A 5DBGA 1HYEA 1B3RA 5ES3A 1JAYA 2RHCA 3MJTA 3L6OO 5IZCC 6LDHA 2DQ4A 2IZ1A 5AOVA 2X8LA 1IZ9A 4ALJA 1ZJZA 2QQ5A 4PG5A 1Y7TA 2X7HA 4EW6A 1ENPA 3K8ZA 3VPSA 3E6AA 1QP8A 3TNLA 1E3WA 1I10A 1I3LA 3H3JA 4KQWA 3V1UA 1K6JA 3PHGA 3HHPA 4PLPA 2JD2A 4K6CA 4WCFC 4M1QA 1V3VA 2XAAA 1GCOA 1PJTA 2X0NA 1DJNA 3GVXA 3H4VA 2PGDA 2B4RO 5G4KB 4GPD1 4EITA 4BMNA 3U4IA 3ASVA 2VYNA 3AOEA 3LK7A 2P68A 3DBRB 1XIVA 3I23A 4XCVA 5F5LA 5L4NA 4E5KA 5BT9A 4PRLA 3JTMA 4L75A 1FK8A 4ZJUA 2GUGA 2VZ9A 3HUDA 3IKVA 1YBMA 3A28A 3I52A 1Z73A 2Y0DA 1GDHA 4ILKA 1LDGA 1PJCA 2HU2A 4RQTA 1PZFA 4WOJA 3P2YA 3ZWOA 4B79A 1R4MA 1SAYA 4QX6A 5FI5A 3ZV6A 1M76A 2R2GA 1JA9A 5JY1A 3O8QA 3PQDA 1P74A 5I7SA 1VSVA 2EKLA 4GVXA 3KHUA 2ZB4A 2RHRA 4N18A 2NSDA 5DN9A 3QVOA 1KC1A 1SEPA 4MKXA 3EMKA 3CEAA 5L4SA 4J6FA 5THQA 4H7PA 1ZSYA 1BDBA 1X15A 5DT9A 1ISHA 2QRKA 2Y68A 3OETA 5JAIA 5JLAA 3GN1A 2V7PA 3QW2A 3Q11A 4CV3A 3NDJA 2ZK7A 1ZEJA 4IIUA 4I9NA 4TMFA 2E6UX 2NU6A 2J6IA 1M2WA 2OORA 3ZWAA 3LVFO 1YDEA 1NQ5A 1MUUA 4ZQFA 2VYVA 1YJQA 3MWEB 1F14A 2JAPA 1MC4A 4W9NA 3VPXA 3JQGB 1GQQA 3JYLA 1I32A 3ZW9A 1YB5A 3S2FA 4KTVE 1N2SA 4E5NA 2HK9A 1DFHA 5A9TA 3WNVA 4NBUA 1PEDA 4QT0A 3A9WA 3WSVA 5T64A 4C4OA 2WD7B 1P1IA 1RM5A 2BELA 4B4UA 3W4KA 4UAGA 1X0XA 4L74A 3VKUA 2WYWA 1EDOA 2AW5A 4OSPA 1GV1A 4R3NA 1DEHA 3MJEA 1WWKA 4GSKA 4ND3A 1TLTA 3LZ6A 4ALMA 1FDUA 5JAQA 3AM5A 3R1IA 3BMQA 4MVJI 4DMMA 4EJ6A 2YDXA 1XLTA 4RPGA 1BTOA 1B7GO 2P4HX 5COQA 1I2CA 1X7GA 2AHRA 1HETA 2B36A 4J3FA 4GX2A 4QXMA 2IDZA 5I9LA 2EJWA 4HKTA 4KZPA 2C07A 4DBZA 4HNHA 3IKTA 3QWAA 4O5OA 3HB5X 3KYBA 4LCJA 4J7XA 3NT2A 2VHXA 1FDSA 3C24A 3FCOA 1ZIDA 3F1LA 3ETEA 3UVEA 4R9RA 4RVGA 4DQUA 4IDAA 3VTFA 4F6LA 1T4BA 2FN7A 2I99A 4IGFA 5L95A 2C0CA 5CPFA 4IINA 3WGTA 2UUPA 4OGWA 3E82A 2JKVA 1X14A 2YUTA 2DAPA 4AJHA 1DAOA 3PTZA 3EDMA 1PQWA 2JFHA 4IZIA 1RKXA 1ISFA 2TMGA 2Q1UA 3JQEA 3WJ7A 1U4SA 4N54A 5JYEA 2B37A 2Z95A 1Z45A 3WWYA 3NDIA 1JAXA 1FF9A 2YQ5A 2X0RA 1J6UA 3WR5A 1UAYA 3GF4A 1XKQA 4Y6SA 5F1OA 3P2OA 3WJAA 3ETDA 4TRRA 3WICA 3UICA 3RUFA 3AI3A 2BH9A 1R4MB 2F00A 4DPKA 4OXYA 4L76A 3ITDA 4UVGA 1JWAB 3DR3A 3HZZA 4XRRA 4XR4A 5BNFA 5KVQA 4CMIB 1FDVA 4ZHSA 3DBVO 3PP8A 1YJ8A 2C2YA 2Y1EA 4K1LA 1ADBA 4ZQHA 1WMAA 3ZNOA 3HN2A 2RCYA 2DLDA 1SEVA 3I9LA 4B7UA 2O3JA 4YJGA 5DOVA 3KZVA 5HWSA 4IQ8A 4JP3A 1BG6A 1OC2A 1PJBA 2Y1FA 1E6WA 3BYZA 4K28A 5KJFA 3D64A 2JD1A 1KVTA 3L6EA 3OM9A 2V6BA 3NAQA 4GLLA 2JHFA 3ZWNA 2AG8A 5TS3A 5EIOA 4XJSA 1EE9A 1KOLA 1T2AA 3OHSX 4RJTA 1ZO8A 1XYGA 2VUUA 1JVBA 3ZDFA 8ADHA 2NTJA 2PD3A 4E30A 1UAGA 3H7AA 2B5WA 4NBVA 3WBFA 3FR8A 1H9BA 3SLGA 1T1SA 2HUNA 1U8XX 4MO2A 2O3TA 1HZJA 2POQX 2WMDA 2OBNA 3VPHA 4D7AA 3G79A 1MFZA 2CVZA 4CM5A 1DRWA 4CM9A 3PJDA 4WLOA 5J23A 3I9JA 4N5LA 4B3JA 4C7JA 4I5DA 1AUPA 3UGKA 3Q2KA 1ZFNA 2CF5A 3DHYA 4WLEA 1ZNQO 4FJ2A 5GZ6A 3A06A 4BO5A 3ENKA 1L1FA 3BMQB 1PGNA 3ZV4A 1GAEO 5C7LO 5IF3A 4FR5A 2OZPA 1YO6A 2V6FA 1SNYA 1NWCA 5G0UA 3S55A 4CM3A 5KJ1A 1EEHA 4RPKA 4XWYA 1HTBA 3B20A 3QWIA 1ONPA 4UUMA 1OFGA 2VYND 2X9NA 5CDTA 3MJVA 1BXKA 1WDKA 3RWBA 4OOEA 3VZRA 3FI9A 2D5AA 1LDBA 1Q1NA 2JCYA 3ZNQA 4XX0A 4CMEC 4NU6A 1R15A 2PFGA 5TNXA 4J9UE 3ZWMA 3DTTA 4I1IA 4NK4A 4TRNA 1YE3A 3AOEC 3D1LA 2EWMA 3IP1A 1B2LA 2C7VA 3NGXA 1LSJA 1HL3A 1PZGA 4KP7A 5DCUA 4IBOA 4IUYA 1EFKA 2VRBA 3U4DA 2HJRA 1E1LA 3SXPA 4B8WA 1PJLA 1PJQA 1B0AA 3Q9UA 1LLUA 4JXKA 3SLKA 3I3OA 1HSOA 1GQYA 3GGPA 2ZTUA 4LSMA 1HLDA 4IJVA 1UJMA 2AE2A 3OP4A 4R01A 3FSRA 1QMGA 1LA2A 2UDPA 4GI2A 5TLSA 3MJCA 4A10A 2NACA 5A3VA 4E6PA 1G6KA 4Q3BA 4R3WA 1IL0A 4WLNA 1S7CA 2PGJA 4UVEA 3GNTA 4YT5A 1I01A 1KY5A 4U8GA 3ZWBA 3FR7A 2FRDA 1F8FA 1N7GA 3CUKA 3UW3A 1A4UA 3EVNA 1FMCA 5TSDA 3AJRA 3D4PA 3IDSA 5IFLA 3JQ6A 4E3ZA 4Z9FA 1KVRA 1P1FA 3ADPA 4IMPA 1ID1A 2EXXA 1P0FA 4YCAA 3VPGA 4EUEA 1XR3A 3RAJA 2BI8A 3GNSA 5EQDA 1RM4A 1OOEA 1G1AA 2IRWA 2X0IA 3Q6IA 5DOZA 2OBYA 4LMRA 4KWHA 3BHMA 3WFJA 3ONEA 4BV9A 1GTMA 1GZ3A 3JQDA 1EVYA 2P4QA 3WTBA 1WP4A 3KUXA 3PHIA 2GCGA 2C7GA 1F0YA 5JSFA 2O48X 3GQVA 3TQHA 4Y6PA 3AUSA 2BI7A 2CFCA 5EL0A 1HDZA 1M6HA 3VAZA 2G1UA 1Y5RA 4F46A 2QX7A 3DXFA 1IHXA 1X7HA 2VOEA 4CR6A 4QUKA 3I5MA 4Q39A 4YXFA 3VH3A 1H5QA 2YZ7A 3D7LA 3D4OA 3M2TA 2VHYA 3DFZA 5U1PA 3LLVA 5JAMA 1GADO 1IB6A 1LLDA 2OGUA 3PIIA 4CMBA 1YBVA 3FTNA 4OQZA 1NYTA 4XGKA 4D42A 3PYXA 3M1AA 1E3IA 2Z1MA 1EBFA 1R4NB 3PFFA 3W8FA 4FGSA 1E6EA 1DLIA 2JAHA 4PG4A 2FR8A 1C0IA 1QYDA 2RAFA 3GFGA 3X2FA 1KEUA 3RUIA 4UVIA 1QYVA 2UVDA 4L4RA 5BR7A 7MDHA 1PJ3A 3NT4A 1WMBA 1LDMA 5JMWA 3BAZA 1CETA 5JC8A 1BSVA 4FFPA 4HBGA 3PDUA 1EE2A 2I5PO 3U5TA 4WCFA 5JE8A 4IXTA 3A4VA 2HMUA 2IEBA 4AJOA 3LT1A 1GPDG 5LDHA 2Q2QA 1ULUA 3Q3CA 4WLVA 1DOHA 2FZWA 4IS3A 4RQUA 3IIEA 4ALKA 3QQPA 1SOWA 2Q50A 4LRTB 4EUHA 1CEQA 1XGKA 4GBJA 3C1OA 4FFRA 4FFLA 3UFXA 4CMHA 2DM6A 2A9FA 3RCBA 4DUPA 3KTDA 4IJUA 4RF5A 1PL7A 1E1KA 4F45A 1E7MA 4CMKA 2VHWA 3K5PA 4BO2A 2D5CA 4K26A 1UR5A 1TB4A 4GX1A 4BMVA 3VVCA 3B70A 3ZGYA 3MZ0A 2YQ4A 1IOLA 1O95A 1VM6A 4LRSB 4Q3AA 3PFWO 4BKUA 4MKRA 5JCXA 4FPXA 1Q2XA 1UZLA 1YS4A 3B1KA 4INAA 2QIOA 2GZ1A 4CPDA 1PTJA 5KNLA 6ADHA 4BNLA 1DIGA 1HDXA 2SCUA 3DDNA 3GOHA 1YL6A 3AU8A 4J9VA 4PVDA 4QEDA 3RVDA 5C37A 1GL3A 2EERA 3HWRA 5I9NA 5A06A 1KEVA 1LBEA 5ILGA 4XYEA 2I9PA 4XGIA 4U7WA 5B4UA 1MG0A 5TT0A 2AMFA 4RZIA 1LRJA 5L7YA 4P38A 2ZYDA 4W7IA 3X2EA 1ZVMA 3GZNA 1NVMB 4NR0A 5I9MA 4JLWA 4YR9A 4IDCA 5JAZA 4YJHA 4XYMA 4YAJA 3I4FA 4YTEA 4MINA 1LNQA 4OM8A 1EUCA 3O9ZA 3OQ6A 4IDDA 4CMAA 1CRWG 2HMVA 4JJFA 1VJTA 2DPHA 1GFSA 2Y0EA 4WPGA 4R16A 5KTKA 3ZU5A 4TZTA 3ZV5A 4J7UA 1BVRA 2F1KA 3AY3A 4I8XA 2P5YA 4YJFA 1P1HA 5HRUA 1XU7A 2XOXA 1PGOA 4LVUA 1DRUA 1VC2A 2AEMA 4GGOA 4A26A 4DQXA 4E5PA 3NJ8A 3NUGA 4NQZA 3CE6A 2AQIA 2Q49A 3IAHA 3GAZA 3L6DA 4L8VA 5EINA 3F1KA 5CHEA 2I65A 5L40A 1BXGA 2AQ8A 4RPHA 1PR3A 2BD0A 1UZMA 2YV3A 4PLCA 3L4BA 3NTRA 4YDRA 2VZ0A 2NLOA 2WTBA 4DIOA 1XA0A 3RU9A 2A4KA 1ENZA 2VT3A 4R1SA 3Q0EA 2W4QA 3JQ8B 3NV9A 1PL6A 1Q0LA 1SOVA 4S3MA 3E9QA 4XIJA 3ZV3A 2I3GA 1E7SA 2WSBA 4RO0A 1E1NA 1X7DA 4GVLA 5DULA 3OJ0A 4B8ZA 3WGYA 3U9LA 3K96A 3P19A 4BV8A 2WD8A 5EJ2A 4A5OA 1OC4A 4BNFA 1UUFA 4P8RA 3TWOA 3VKVA 3ZU2A 4BHTA 1ISGA 4Z9YA 1I3NA 3GUCA 3RSHA 1GUYA 2V65A 5H82A 1DSSG 1E77A 1YH3A 3R3SA 3LDHA 1I2ZA 3NJ4A 2ZB3A 3RUEA 3VDRA 1LI4A 3GC6A 1HLPA 1LC0A 3HADA 1WNTA 3OBBA 4MDHA 4BKQA 5KVSA 4S1VA 1ARZA 2QRLA 3H5RA 1QR6A 2Q1TA 4G81A 2PY6A 3F5QA 3NDRA 4BKOA 2FP4A 2IXAA 1HEUA 2Q99A 3INRA 2WJPA 2PTGA 4WASA 3ZNNA 4CM7A 2V6GA 2I6TA 2RH8A 1A5ZA 1T2EA 2VHVA 4CMCA 4NJMB 5JO9A 1R37A 3AU9A 4WE3A 1R6DA 3PDJA 3C85A 3OJOA 5ICSA 1W8DA 3ZU3A 2WE8A 4PLYA 3NYWA 4W7HA 3UCEA 3GN2A 1ZK2A 1QYCA 1WW8A 2ZYAA 2AEFA 4CV0A 4B7XA 3OICA 4XKJA 4FD3A 3QA9A 2PK3A 3S1LA 1ZSNA 5A9SA 1JTVA 1CQIA 3AWDA 1A9ZA 3HDJA 4BVAA 2JJYA 3AUUA 3F6YA 3NTOA 5A02A 2HMTA 1T2CA 2GASA 3TFQA 3DAGA 1B14A 3DFUA 4F6CA 4O1MA 4XR9A 4MJLA 2GDZA 2EF1A 5AXCA 1U5CA 4OQYA 3I6IA 3QVTA 4WNIA 3E1KA 1LX6A 4P4NA 4J2HA 1QXSA 3ZI0A 1SC6A 1DC3A 4MKZA 4CLHA 4JK3A 4UUOA 4NBTA 4FIZA 1CYDA 4D3FA 2I3AA 3PPIA 4YT8A 2DBRA 3TPCA 3NX4A 2P9CA 2D1YA 4RLSA 2NVWA 3E03A 5GZ1A 4D45A 3FNEA 4PG8A 2GRAA 1BXGB 3RJ9A 4D46A 4Y8VA 5TX7A 3N74A 2B5VA 1NAHA 3WBBA 2ILTA 2CVQA 3HE3A 4R5MA 1OZAA 5I7VA 2X23A 1GU7A 2P9EA 5IN5A 1PX0A 2PD6A 4MVJP 1P44A 2VN8A 3C7CB 1QKIA 3F3SA 3KYCA 5LC1A 3RC7A 3NRCA 3RD5A 3VH4A 3VH2A 4CMEA 4E4YA 3EY4A 4D0RA 1B16A 4BO6A 3GA0A 3MJSA 1LQUA 3LQFA 4U6SA 3CMCO 4BNJA 3IMFA 3LC2O 1Q7CA 3DAPA 3P5SA 4J49A 1LXCA 4YT2A 4BMSA 1LU9A 1PIWA 3IQDB 2H5LA 1NVGA 1P1RA 3GR6A 3GVHA 1P0CA 3LF1A 1TT5A 2GN9A 5ICMA 1ZJYA 3QV1A 1DB3A 3GRKA 2PH3A 4TRMA 3PHHA 4WECA 4CODB 4L73A 5A5EA 4FOOA 4BB6A 1BHSA 2Y99A 3JYOA 1TA4A 4TWRA 4EJMA 1L7EA 3RU7A 4WNCA 2XF8A 4LW8A 4CL8A 1C1DA 2CUKA 5C5IA 3O03A 4E33A 3VZQA 2I67A 3DZHA 1ZK3A 1EVZA 4Y98A 3TFOA 1NFQA 3ZU4A 1VE9A 2BRUA 4IS2A 3TZHA 2DC1A 3PJEA 4E32A 3ZWVA 4KMSA 3ZWPA 1D3AA 4J4TA 3KSZO 1C1XB 1E7YA 2HJSA 4MVJA 3W6UA 5A9SB 3BHJA 4XD2A 5TT1A 2YFHA 4XDYA 1EVIA 1Q7GA 2C54A 4HY3A 5TRTA 3RIHA 4ALNA 3KM0A 4CUKA 3BTVA 2EEZA 3IP3A 4LCEA 3TL3A 2DTDA 4CQMA 4PRKA 1NTOA 1TI7A 5ITWA 2Q1SA 3BHIA 5MDHA 3N7UA 2G5CA 1S6YA 3PHLA 3H2SA 2DTEA 4Z0TA 2ZJ1A 2PH5A 3K2BA 1PZHA 3DONA 3IOYA 3ROPA 1JKIA 4I5FA 2RIRA 1HE2A 1XWFA 3M2PA 4G2NA 1UH5A 1GZ4A 1YL7A 2EHDA 4XYBA 3VH1A 2D8AA 1DXYA 3JSAA 2Q46A 3QY9A 3RC1A 4IJKA 4ZD6A 1I33A 3FHLA 5FFFA 3E18A 1DFIA 2HMSA 2WYVA 4NIMA 3TDKA 1KYQA 1BWSA 1YXMA 3OA2A 1D1TA 3OF2A 3RBXA 1LJ8A 4CR7A 1E7WA 4DYDA 4D0SA 4CR8A 1NXQA 1R66A 2DTXA 1ISJA 2O7SA 3L4BC 4ND2A 4KTTE 1NFFA 3OIDA 3ST7A 5I8WA 1F12A 5JMPA 4WLUA 4AJEA 1I8TA 3RUCA 2YYYA 3KYCB 1E3WB 3DAFA 2BGKA 3I1JA 3RUHA 4CV1A 1NR7A 3FN4A 5T6BA 1BGVA 4JJIA 1ONOA 4BO8A 1HE4A 1W6UA 5CFZA 1VJ0A 1B8VA 4DRYA 3FD8A 4PFJA 2PA3A 3WGZA 4Q3CA 1YOVA 2EGGA 4AJ1A 4Q3DA 4OKNA 1EUDA 3K9QO 4EDFA 4OYRA 4KUGA 4QFDA 4JX8A 5EPOA 3PZBA 1XQ6A 1LEHA 3OIGA 2CDAA 1F17A 4BNTA 3L07A 1P31A 3QWBA 7ADHA 1D4FA 3GVIA 2GERA 2NM0A 1TT5B 3DZKA 3JQFC 4HV4A 4YRDA 3GG9A 3MJ4A 4GKBA 1T26A 4AJNA 1HDYA 5JDIC 1HDRA 4BO3A 1I2BA 1CERA 1JLLA 3FTPA 3LF2A 3K30A 3F4LA 3O8QB 1DJQA 4XEHA 2X6TA 4XJTA 4O63O 1DBVO 2NTNA 4OSOA 2EKPA 1VLLA 1CDOA 5HS6A 1ENOA 2NQTA 5T67A 3OFSA 4NFSA 4HNGA 3RUAA 1PWXA 4DREA 4FB5A 4BNGA 4R41A 3K31A 1U7HA 1U28A 4A7PA 4TVBA 3GEMA 1VKOA 4DLLA 1GCUA 1XCBA 3DOCA 5ER9A 3M1LA 3MCVA 1C14A 3OSUA 4BGVA 4AJJA 3FWNA 2EW8A 4FW8A 2O3UA 3OECA 4FFNA 4EZBA 4E2ZA 4FDAA 4IDBA 4QQRA 1QG6A 1YONA 2VNSA 4DVJA 4CQMB 4JCOA 1PU2A 4PCVA 3RC2A 3TSCA 3WGHA 2D59A 4R9SA 4R69A 3W8DA 4X54A 4C7KA 1XHLA 1V0JA 3ORFA 4GWGA 3GHYA 2Y05A 4XGNA 2ZYGA 5CDUA 2ZCUA 3E5MA 4FJ1A 1AHHA 3W1VA 4BQRA 2B35A 4J4HA 4E13A 5EMHA 5BNIA 2Q2VA 1E7QA 3ONFA 9LDTA 5CAEA 1O6ZA 5CEEA 1N1GA 4RF3A 3IL2A 3RASA 4CM6A 4P22A 5CG2A 5BNTA 1E3LA 4PZCA 1G0OA 3ENNA 4NBWA 4U0KA 4WGGA 5C7IO 3ANNA 3HNPA 5TIIA 2X9VA 3BMNA 1LUAA 1IULA 2EP5A 3HDQA 4J91A 3H9EO 1U7TA 3CZRA 3HFGA 1RPNA 1Y9EA 2D3TA 3DWFA 3T7EA 1DLJA 2HRZA 5A03A 3LT4A 1MV8A 5GZ3A 1PSDA 3QLJA 5A1TA 2PZJA 3AUTA 4J7CA 1XG5A 3H9QA 5L7WA 3TZKA 1HE3A 4JQCA 3RKRA 1XSEA 3ROKA 5CEJA 2I76A 1ZZEA 3KO8A 1DO8A 1NPYA 2C5AA 1QYXA 3EGOA 3EHEA 1MG5A 1U3WA 1MXFA 3TN7A 3ZZNA 3WNQA 4E5MA 4Z3KA 3DOJA 5ITVA 3TZCA 4R5HA 1JKFA 4GLOA 4MIEA 3DO5A 4HFJA 3E8XA 2PKQP 1A4IA 2O3SA 3MOIA 1UXJA 3DB2A 4CLOA 3FRJA 4J16A 3ROQA 2Y1CA 1B3BA 2ZB8A 3EAGA 2X58A 4PN3A 2BFMA 2NUAA 1Y8QA 4XZ3A 3WLEA 4CM4A 3LSYA 1G0NA 4AG3A 1C3VA 1T24A 4JP2A 1LRKA 1BMDA 3FF4A 2FY8A 4MVJD 3BMCA 3NT5A 4FFOA 4RVDA 3STHA 1Z75A 2GN4A 5H81A 4DL9A 1DC6A 3VZSA 1I3MA 1K6IA 2HLPA 5B12A 4LVCA 4U0JA 2X0JA 4FFMA 4YJGB 3PQEA 1R12A 2BF7A 1IPEA 4YAEA 4CQMD 1V3TA 1O5IA 2IODA 2OHXA 1PJSA 5G0TA 1BRMA 1B26A 4ID9A 3K2EA 4FOSA 3VZPA 1UXKA 3GT0A 1ZEMA 1JWBB 4LGVA 3IUPA 2AEJA 2OUIA 2EJVA 1ZK1A 3GH3A 3KEQA 3U3XA 1ML3A 4EUFA 1AHIA 4FGWA 3JD3A 1I3KA 2GYYA 2DBQA 1ZSVA 2X22A 5F1KA 4XA8A 2FR0A 4IQ0A 4B4WA 2YFQA 3OJFA 3DMYA 4CM8A 4YVFA 4W99A 1LDNA 3WOHA 1M67A 4QFCA 4FS3A 1DPGA 3AK4A 4XDZA 1SO8A 2P9GA 2A35A 1KEPA 4PVCA 4YRAA 2VWPA 3I9NA 3GAFA 4R68A 2JCVA 3ZW8A 1DDOA 4YRBA 3AOGA 3F5SA 1GPJA 2C20A 3GUYA 1Z82A 5FYDA 1WZIA 5AQ1A 4RPLA 2FWMX 4PG7A 3GK3A 2EGHA 4PGFA 1U1IA 1UDAA 2O3QA 4OKIA 3ZN2A 4CV2A 3BMNB 3LC7O 1TVEA 4ALIA 4DPMA 1YKFA 4DIBA 1LRLA 3L77A 1DHRA 1KBZA 1QYWA 1HDGO 2NU7A 4ITUA 1HRDA 1DIBA 3H3FA 3HJAA 4WUVA 5DNAA 4EGFA 1Y8RA 4K9DA 3A1NA 1P77A 1J4AA 3ASUA 5DCYA 3RQSA 1QLHA 2ZIZA 2X86A 3FBTA 3CTMA 1J5PA 3FBGA 3GVPA 4OH1A 5IN4A 2NWQA 4P4GA 4I9UA 2P5UA 2NU9A 3D5QA 4KOAA 3ZH2A 5MGBA 4XB1A 3KLPX 3E9NA 3JD1A 3PQFA 2DKNA 3F47A 4KDFA 3WYCA 2HMWA 5DF1A 1D7OA 4Z6KA 2VWQA 4CLOB 1NM5A 4NZ9A 4HP8A 3DZGA 2GZ3A 2JCXA 4LMPA 1KIFA 5KWEA 2NNLD 2QHXA 3PWKA 4CM4B 2D2IA 3SEFA 3W6ZA 4BNUA 1SZJG 1SB8A 4JJGA 3GDFA 4CL3A 3AY7A 3E48A 3KVOA 4A73A 5A4DA 4DQVA 5B4TA 2C29D 5JCJA 3WB9A 1GEGA 2CNBA 4E21A 4YAGA 5ILOA 3L9WA 1O89A 3JYNA 2JD0A 3VC7A 1V6AA 1LLCA 1IUKA 1PZEA 3JQAD 3KYDA 4RDHA 4MP6A 3JD2A 4HX5A 4PZDA 3ZWCA 3TRIA 4AJLA 3KRTA 1EK5A 1H0KA 3IC5A 4FC6A 5IDQA 3WQQA 1J49A 1JVSA 3PYMA 5EESA 5TJHA 4N5MA 3EK2A 3WFIA 3EYWA 2AQHA 4J0EA 2OO5A 2E82A 1H2BA 4AVYA 1IYZA 1SBYA 1QRRA 2IEDA 3ZWXA 1M6WA 3Q1LA 3GDOA 5A5FA 1B8UA 5JY6A 1N92A 1Y81A 1YL5A 2RH4A 3JQBC 1GYRA 5F5NA 4E2WA 2O2SA 4I9HA 5ENVA 3W4IA 4CM8B 5IDXA 5COAA 4DXHA 2H9IA 2OP1A 4YPOA 2C2XA 1ADGA 1HXHA 2NADA 3I6QA 2R00C 1YBAA 3JD0A 2DU8A 5AYVA 1O0SA 1A72A 2LDBA 2OL4A 4J4BA 4D3SA 1MP0A 5TF4A 4BL5A 4IDEA 4M54A 1X1EA 4TRJA 4O6VA 4Y6RA 1GD1O 1ZUD1 4RVFA 1K89A 4Y67A 4RZHA 1GYPA 4MVJE 3TOXA 3H5NA 1NHGA 5B37A 2BKAA 1MLDA 3S8MA 3G1TA 4ZN6A 3ETGA 1BW9A 3BIOA 3D3WA 2FPPA 3FNGA 1RJWA 2X5KO 3JCZA 4UEOA 5FF9A 4BNMA 2JFFA 3C1TA 5JFOA 2HCTA 1T4DA 3C8MA 1GQ2A 4AJIA 3D3EA 1GY8A 4J1SA 4XIYA 5K6AC 4PLGA 1T2FA 5DCWA 3PHJA 1V9LA 3WIEA 2ZCVA 3LT0A 3L0DA 1LQTA 3QVSA 1L7DA 4HWKA 3ZWWA 2W98A 3DQPA 4OAQA 2C59A 5L53A 4CMJA 4M86A 3EW7A 4WCFB 1RWBA 1BDMA 3JV7A 5JNLA 4J1QA 4R1TA 2E48A 4II2A 1PS8A 2DT5A 2XXBA 2E49A 1P3DA 2VWHA 2UV8A 3MOGA 5T8KC 3LT2A 1BXZA 1RM3A 4PIVA 2YV1A 4KWIA 5H83A 5CEFA 3WGOA 3CKYA 3PWZA 3S2EA 3H9JA 5F21A 3RUDA 4BNVA 1A7AA 1NQAO 3VTZA 1DC4A 1Z6ZA 4GMGA 3WTCA 3G3EA 1SB9A 2J8ZA 2GO1A 1E5LA 3GHHA 4IDFA 4YWJA 3JQFA 1LC3A 5JDIA 5G4KA 3PZRA 4PG6A 1P33A 3FNHA 4I08A 4M89A 2JHGA 1NQOA 3QRWA 4RPJA 1I30A 1GV0A 2ZB7A 4NJOA 5BQFA 3SC6A 1HSZA 4JBGA 4XYGA 1A9YA 5FWNA 2NTVA 4B4OA 1NNUA 3KYDB 4J90A 4NFHA 1DC5A 4RF4A 1IY8A 4BO0A 3IJRA 2WM3A 1V35A 4YT4A 5BSEA 2Y1GA 4ESOA 1KS9A 1XEAA 3DHNA 3PXXA 5ADHA 3UUWA 4DC1A 3ZHZA 2FOIA 4BKRA 4DWVA 1NWHA 5U4QA 4PLHA 1NPTO 2FSVA 2QZ9A 4TKLA 3T4XA 3BXXA 2Y93A 3GRPA 3DEYX 2Q4EA 3ULKA 1TXGA 1P1JA 1E0DA 2VWGA 2X5OA 3KLMX 5BSGA 1C0KA 4BB5A 4PLVA 2QYTA 4WEQA 2YJZA 5ENDA 3O4RA 5CDYA 3GZNB 2D0IA 4YJHB 1ZXLA 3QSGA 3COSA 4J2OA 3I9KA 4E0BA 4KUEA 1Y9AA 4CMGA 4QECA 2GLXA 2VUSA 3I9MA 4YEDA 1DIHA 3UH1A 5C7OO 3DL2A 2CDBA 4NBRA 4RLHA 3BTSA 4E31A 1ZK4A 2Q45A 4YJFB 4EJ0A 3H9UA 2X4GA 3KV3O 1YB1A 2ZTVA 1J0XO 1P45A 1AXGA 8LDHA 3JQGA 5KIAA 3L9XA 3ITKA 3G17A 1IZ0A 4D3DA 3D3WB 1MXHA 1WDLA 5FI3A 3C7AA 2G82A 3NGLA 4JNKA 3F9IA 4PZEA 5DDIP 3JQ9C 5G4LA 1JU9A 4AICA 3S2GA 2FHSA 4ZGWA 5G0VA 3QWHA 5L3ZA 2WYUA 1DHTA 4IQGA 5B1YA 3AW9A 1M75A 1ZCJA 2EKQA 2FPGA 4MVJF 4YA6A 2NVUA 2CDCA 4AL4A 4NG5A 4PLFA 4GX5A 2DFVA 3PEFA 5L45A 1E6UA 1UDBA 3KB6A 4ONEA 5FEUA 3RBZA 5DP2A 4ZA2A 1KC3A 3T7CA 3GPIA 3AM4A 4J0FA 4PLZA 2CF6A 2YW9A 1JW9B 1ZMOA 4ZQBA 4ND5A 2AA3A 3CINA 3OQ1A 1KVUA 1PR9A 2C82A 4XB2A 5U9CA 3EUWA 2FR1A 3H8VA 5JCJD 4ALLA 4LN1A 4UEJA 4AJPA 4CJXA 3AFMA 4JGBA 4RDIA 2G0TA 1CQJA 2B4QA 4U5QA 3HN7A 4II3A 4MVJG 4MVJM 2YDYA 5B4VA 1N8KA 2B4TO 4TVOA 4BO9A 4PLTA 5LDGA 4CLDA 4YAIA 3T4EA 3VDQA 1NFRA 4WKGA 2UAGA 1PGJA 3TZ6A 3AM3A 4RCVA 4YYZA 5CDSA 5IZ4A 2YY7A 5TJ9A 1N1EA 1YRLA 3PIDA 3GEDA 3OH8A 1WDMA 1ISMA 3OMLA 4G5HA 4HXYA 3E9MA 4URFA 1P1KA 1U9JA 2YHUA 3RI3A 4GMFA 4ND4A 4D79A 5G0SA 4P4LA 1PL8A 2X1HA 1VI2A 4UULA 4BNKA 4LSWA 2Y0CA 2YV2A 1KERA 3GLQA 3RBVA 3H6KA 1O94A 1PS0A 2GNAA 3DBLA 3LC1O 1VL6A 4WLFA 3UKOA 4OO3A 2BLLA 2X5JO 4CMIA 4QTZA 1CWUA 3BA1A 2GPTA 4G65A 3GGOA 4QSMA 3SBOA 1QLJA 4E2YA 2A94A 4Q3NA 4CUJA 2O2YA 2OP0A 4M55A 2J5RA 2DBVO 2PZLA 5DBIA 1EMDA 2FSSA 1HT0A 1RYEA 4GQAA 2J3KA 3B1FA 1PQPA 4M8SA 4BNIA 2ZTMA 5A04A 1DIRA 2QZZA 3BTUA 2W2LA 4BO1A 3RJ5A 1ZBQA 1UP6A 2P91A 2WEKA 3HSKA 4ZRNA 3PVZA 3V2UA 3DC2A 3HG7A 3NKLA 4D44A 3H9GA 2G76A 1VRWA 4I5EA 2OMEA 5KOIA 3R3JA 4BO4A 1T25A 1PWZA 4MIYA 5KKAA 1C0PA 4NMHA 2OXIA 1IE3A 5EERA 1YDWA 2BGLA 4DLBA 1EFLA 1M66A 4H16A 4ZICA 3WS7A 1UZNA 3W8EA 1U5AA 4R1NA 1KY4A 1NASA 1KETA 1MA0A 1WVGA 4GH5A 2W90A 2PLAA 4GGPA 1EVJA 2NVUB 3QIVA 1KVSA 3V1TC 3LU1A 2QW8A 1WZEA 4MOWA 3V8BA 3QHAA 3CXRA 3K73O 5BSFA 4XYLA 1VPDA 4MP8A 4HFMA 1CF2O 4Y9DA 1H6CA 3FWZA 3G49A 4FN4A 2EIHA 4L9RA 5A05A 1F06A 3KXDA 3GMDA 3DMTC 3H2ZA 1E3JA 2NVBA 3HB4X 3GMSA 3LYLA 3O38A 4FBGA 5T57A 3RFVA 4A03A 1T2DA 3GNQA 1PS9A 2HKIA 4RVHA 4A27A 1AXEA 4Z3DA 4CLEA 2IZZA 3OA0A 1NBOA 2NU8A 2O4CA 4DTIA 3PGXA 1U2DA 5HM8A 4WOKA 3WYEA 3AI1A 1U8FO 3CIFA 3PLNA 2BFOA 5AVOA 4E5YA 1E3EA 4HFNA 1VL8A 1DRVA 3EZLA 4QO7A 2CMDA 5JDCC 3HDYA 1H6BA 3C1AA 2JL1A 1HDOA 1H93A 2H63A 3TJRA 3W4JA 1UP7A 1H6AA 3WXBA 1C1DB 4GSLA 1YQGA 1N9GA 3PK0A 2GSDA 3UCXA 2Z5LA 5IAAA 5EN4A 2YHIA 3IUSA 3UXYA 1HZZA 2PV7A 3GPDG 2PNFA 3DBLB 1RM0A 2W2KA 1IHYA 1YVEI 2J3IA 4NK5A 4NI5A 4NU5A 2H6EA 4DIFA 1A27A 4Z0HO 1H6DA 1XDWA 3DZIA 2ZATA 3ICPA 1H2HA 2CZCA 2HSDA 3EVTA 4FJ0A 4CQLA 1NPDA 3AFNA 4TKMA 4NH4A 1GZ6A 3DZBA 4EBFA 3JQAA 2BGMA 1A71A 2C5EA 2CSUA 1Q7BA 4H3VA 3GGGA 1HF3A 1GEEA 2CY0A 4AFNA 4CLRA 5IG2A 4R1UA 3JQBA 1O9BA 3H5AA 1Q0QA 5KJEA 1EBUA 3AUAA 1WLYA 3ANLA 4D43A 1H94A 2EG9A 1NAIA 1PGQA 3ANMA 4RVSA 3WG9A 3WDSA 2R00A 3DOOA 5JYDA 5KVVA 4NPCA 1ZKMA 2WE7A 2P2SA 1JKJA 3NEPX 1HWYA 5THKA 5DBFA 2IE0A 4TQGA 3DZFA 2VRCD 3HQ4O 3A14A 3KETA 3SJ7A 3SVTA 3C3XA 4FSHA 3GZ4A 1AGNA 1ONNA 3PI7A 4UUNA 1ADFA 1Q0HA 3UF0A 5C3MA 3OQBA 4YQYA 5K6AA 4GWKA 5JW6A 4NFYA 1UP4A 3V1YA 5LCXA 1HE5A 1W73A 5AXDA 3ZHBA 3GY0A 1PGPA 3R6DA 4R4JA 1ADCA 3VVBA 3RFXA 1DIAA 2VTEA 1AN9A 1YOVB 3VOSA 1MB4A
chains in the Genus database with same CATH superfamily
2Z83A 3D3KA 4Q34A 2IHTA 1F6BA 4D4IA 3GLIE 3LCUA 1CUJA 4L8WB 5J58A 5C80A 1TCCA 5AI8A 5EIBC 1EDZA 1ORTA 2G40A 3PVCA 4BFCA 4F4DA 1NXTA 3D4NA 5FWYA 2G17A 3EB9A 3I4CA 4PX5A 4BGEA 1DWOA 1RZVA 4FBLA 2WQ7A 1U0FA 4JUFA 2AG0A 3BE4A 1GQRA 1JQDA 2EP7A 1PG5A 1UMKA 5KDOA 4FONA 2DFDA 5LQKA 3E3LA 4JP8A 3H84A 3QEBZ 1C0EA 2PZMA 2QW0X 2UYOA 2YINC 1VBFA 1BROA 1W4BA 2PU7A 3ASZA 3GFSA 4LZZA 4EO9A 4IDGA 2MYNA 1RPZA 3INTA 3PU6A 4Y2SA 3H9BA 1N33B 2YNMA 2YCLA 3OZAA 3EVDA 4EF6A 4QG3A 1U9YA 1Z7YA 3VPCA 2BV3A 2PKRA 3WX0A 1RNLA 3M5PA 4MVYA 3A0RB 1H1LB 2VTDA 5J4LA 1P4AA 2YOGA 2VH2A 4RORA 4W9RA 3K6JA 3VHRA 1JSZA 1W4ZA 3ZE6A 1UPTA 2H51A 2X5NA 2VATA 2M9MA 3FIUA 3M5WA 2W2KB 4OXQA 3WLAA 3LQQA 2IP2A 1L7VC 3OPYA 1TPYA 3C87A 4LBWA 4BLRA 4DRXA 2ESRA 3FAKA 1NW7A 2HH9A 4L16A 5CIYA 2R85A 4NQRA 3TO5A 4ERXA 2WTEA 1EUQA 4X65B 2PX2A 2HJHA 2PMDA 1JXQA 2VYVD 1YR9A 4JIGA 4PZPA 5GIOE 2IPLA 3PFBA 1IXZA 4Z9XA 5TQVA 3M9WA 4CLRB 3M49A 5FTKA 4MGZR 4NDZA 5DE3A 4MPDA 5TGDA 2HYDA 2J5XA 2VNAA 4YS6A 4GKJB 4LWQA 1RS0A 2ZYHA 1K2WA 3LDGA 1HDCA 1UJ5A 2Z9DA 2ZQYA 1WXDA 3BBPA 1MC5A 4TVSA 2VCYA 1K3TA 2ODEA 3OTHA 1U1DA 4OOFA 4LHXA 4QXRA 1PJ2A 1B1CA 4H0FA 4UNRA 2FJUA 1MIOA 1T4MA 4MW4A 4DDVA 2WAAA 2IZOA 1RYDA 4Q93A 2PMFA 4TSKA 3ANYB 1JR3E 3KS9A 5FBHA 4AT1A 3EXHC 1D8TA 3EGDB 4PXAA 3KR9A 3CISA 3T7TA 2GD0A 3UAGA 1FU7A 1WZNA 3QVLA 1VGVA 2DSTA 4PSAA 3A9SA 4R54A 1ZLYA 1S02A 1BX1A 5IRCD 2VSQA 4ZZ3A 1JX6A 4HX2A 6GPBA 3RC9A 2IL1A 3P0RA 4FMPA 3UA4A 5KVCA 1U5BA 2JLSA 4B6EA 4FCCA 2HK8A 4XIGS 3TEFA 3N28A 3DMPA 5JI2E 3UBMA 4KDEA 3Q7SA 3TL6A 3VJMA 4GG1A 1DQSA 1WB4A 5BSHA 1E0SA 4MUXA 1R3UA 2FWBA 4NC9A 4FCWA 1TKBA 1SPXA 1C0LA 2ET6A 5ECDA 2JLXA 3WO1A 1S9DA 4OTZA 3RC3A 4QLAA 3QVMA 3SJUA 4HGQA 2WU3A 5IC4A 3ND5A 2J08A 1GUZA 1RQ7A 1TMKA 1XA3A 4D5GA 4RL6A 4RACA 3CC8A 4LKRA 1VIAA 1YAHA 4TUYF 1GR1A 4JROA 3FNIA 4QGAA 3RYHB 1VFPA 1UWLA 1X7YB 1KTVA 4IKPA 1XRPA 1P2FA 1UXIA 2AX4A 3C16C 4QO8A 4DBLC 4Z54A 3C2QA 1TEXA 3CZ4A 5HJ5A 3B9BA 2GN6A 3EVBA 4BNYA 2DBZA 1RXIA 1P81A 4DMCA 4GYYA 2BMAA 4CG3A 4F4FA 4KMOA 2KLHA 3CMMA 5KCZA 3SQWA 2Y27A 2ZSFA 4PSDA 1RD4A 3VMFA 4LV6A 3EY9A 5HA5A 1U3UA 2P8SA 4UU8A 2Z57A 1X0VA 3NWEA 3JQ8A 3RSFA 3ZX5A 2QTZA 4BXOA 2XJ4A 2EP8A 5JXHA 2O14A 5CGZA 3E27A 2PZAA 1JFLA 1RHQA 5CP8A 3DTYA 1ZW6A 3IOCA 5WRFA 3EARA 5F3WB 1UPFA 1VECA 4QWMA 4TKUA 4YP5A 3Q3VA 5GY7A 2FDRA 3OZXA 3TH5A 2FEKA 1E0AA 3VYRB 1AK1A 1KE2A 3E4CA 2QGZA 1IXSB 3E58A 2FPLA 3G5TA 3I1YA 4EUSA 3E84A 2AMYA 4DZZA 5A3QA 3T5BA 1SD2A 3ZD8A 3QOWA 4I8IA 3G13A 1DQRA 1OJLA 4RXUA 2WWYA 2O3RA 1N6HA 2HZ7A 3A1TA 4P33A 4LTDA 4YCDA 4PYIA 1RQXA 4U7HA 1OLUB 2HA2A 3JWEA 1YB4A 4QGSA 5KTSA 2TYSB 2M2IA 3U4HA 1II9A 1YB7A 4MRSA 3RU3A 3IUEA 4Q9NA 5JFTA 1ZI6A 1R0LA 1I51A 3R75A 1ZUNA 4XQ9A 3WK9A 2XNKA 4HGOA 2C1ZA 3BMOB 4Q9JA 3K5WA 4WK6A 1QYRA 1H0RA 4KGDA 2PGIA 3WLTA 4IM7A 4EYEA 2UZIR 2AZTA 2OMKA 2ZSDA 1EWVA 2ZJ5A 4YXWD 1NRIA 2GGSA 1TFRA 2ZWAA 1NUQA 3IX7A 1T8TA 1EJBA 4IFBA 5CVVA 1C3XA 1TT7A 2O50A 4JYZA 2GN1A 1VIMA 3LY7A 2DFTA 4E09A 3L4JA 2PGLA 2HCJB 1JG2A 3KE9A 1KWKA 1PT8A 4WKPA 2EWWA 1T5TA 3G7UA 4ZRMA 2BMWA 1VKNA 1PWHA 1RWWA 5DV9A 3RIXA 1SURA 1VIYA 1KL7A 3N58A 2XUZA 4C03A 4QLBA 4XM2A 4U1RA 1VE7A 2H7YA 2QDKA 4YCLA 4BMPB 3OC6A 2ECPA 1WXHA 1G7TA 3GRYA 2I62A 5LXTF 2CZQA 1RYYA 3GVCA 1WOMA 2J5QA 5A9RA 4OHBA 1GZSA 4GNRA 5IBRA 1BH6A 3FYSA 4HGYA 3T7RA 3P0EA 1I9CA 1GRRA 3D5TA 1R4AA 4MUAA 1DKLA 1E2KA 2XCIA 4ZIRB 2V97A 4L02A 3DKPA 1JHVA 4F92B 3L0CA 4WKCA 3BMXA 4F5DA 4M6WB 3PJRA 2F62A 2C5BA 4KYUA 2QVLA 2Y0PA 3VNQA 3KQWA 2FQ1A 4KIJA 5TS2A 4NESA 1PRYA 2HYIC 1QX4A 4U02A 5EWLB 4TL7A 5A4MS 1V47A 2W8ZA 1OI3A 2WAOA 3G23A 4B3HA 3OT5A 4DARA 2HQRA 4H15A 1ESCA 1EFAA 2GZSA 4RZ3A 3WB1A 1NTRA 2BGNA 4FSXA 1OX4B 3WLMA 4DYHA 1AG9A 1UBEA 4M88A 3V3KA 3L7IA 3H17A 2H57A 1PTKA 4A0QA 1K5DA 3RWMB 1K0UA 5H0IA 2PT6A 4BJ5A 4ZVVA 1L7PA 2HWYA 3AWIA 3BGSA 1CZOA 1ESZA 1TEHA 5AKYA 3WYBA 1PZMA 1IB0A 1ZXBA 3MUNA 5CT5A 4AF8A 2CHQA 1HYHA 621PA 2GCOB 3VA7A 4IHJA 3AVPA 1B42A 1B74A 1N3BA 4EH1A 4FNGA 2C8VA 3CUEF 4RWZA 5IJAA 3M6VA 3SSOA 4C07A 1W47A 5C1BA 1C7FA 4DIUA 4IO1A 4ME6A 2E5LB 2O5VA 1SIUA 4LXHA 3ICWA 2P2LA 3D59A 3D8NA 4KQXA 3FHOA 1XCPA 5D7NA 4YUYA 4ROSA 1ZOPA 5J4HA 4NTZA 3SQLA 2JLQA 1YI0A 2VEOA 2WLTA 1KO1A 2IF0A 2V9PA 3WLFA 4O59O 1CF4A 3TJMA 3DE5X 4DR6B 3KOUA 1F9AA 8AT1A 5KB3A 3GEGA 3OEWA 4LNHA 2FQQA 2JARA 4IVPA 2N47A 3FFAA 5JDCA 3NTQA 4B7ZA 2PUDA 1C3JA 3DBRA 1KNXA 2VDJA 3RTBA 4LX0A 4RTJA 3LXMA 1GU0A 2GN8A 3VC1A 2JIZD 3IPYA 5JPIA 4KO8A 4YLYA 3Q9NA 1PJ4A 3TQTA 1GGMA 4LX8A 4F1JA 2X9GA 4C2BA 2FB9A 4YJ2B 1RI1A 1OIWA 2QJFA 1MGOA 4RSRA 1Z7WA 4C0QC 3LI2A 3M6IA 3VFDA 2OZKA 3CSDA 2B30A 3IP7A 4N7RA 1ZICA 4A6DA 3JQCA 5HTOA 1GQSA 3DD5A 4RNDB 4B9AA 5DM2A 3GLGA 3LP6A 3P27A 3DVAB 2J3JA 3KQPA 3ODGA 3ZQ6A 3STXA 4DBVO 1NVTA 3OCVA 2P90A 3DD1A 1IK4A 4GMKA 3X1JA 3C4QA 4YRMA 2MIIA 4P34A 4RVNA 4UUAA 4EQ6A 4F11A 3ME5A 3Q2IA 16PKA 1N7IA 3AHHA 5HG0A 1B23P 1V8OA 3SZUA 4U7DA 2TMDA 3FGOA 1Z16A 3BZUA 5COBA 2Z1NA 2LNDA 3KZMA 3TLBA 3GBVA 4D1YA 3PJFA 2B99A 3BRCA 3ZG6A 3R2JA 5I7EA 1FFSA 3NW9A 3ZC3A 1ZONA 4RTRA 4G5RA 4HS9A 5CJPA 1DAPA 1CF9A 3OEEA 4Q7EA 4DS3A 1NDUA 4AWBA 3PQ4A 2J7PD 4LJ7A 3GJ7A 4AIRA 4EVRA 3EXG1 4Q03A 5IXYA 5C8ZA 2UUOA 1G6Q1 1RWVA 2CBXA 1CS4C 1IG0A 3ADOA 3EDYA 3H16A 2W2MA 1X7ZA 3B85A 3B2EA 3KKEA 4PU0A 3SHTA 5BN1A 3GLIB 2YXEA 4K46A 1YHYA 2ZSJA 1HRKA 1P4JA 4FINA 3G0OA 5MHTA 4NG4A 3QLVA 1W0CA 1XX6A 2VSYA 2FPPB 5D7BA 2GCPA 1KDVA 4BGIA 5C5DA 5KJ6A 3KZNA 3MTEA 4I81A 1ZIPA 2AUTA 2I1QA 3QP9A 4IGEA 4X5OA 5TE9A 4CN8A 2XUHA 1JG1A 2R48A 2WD7A 3WWZA 2AJ8A 4GEKA 1MGPA 2YIMA 5ALJA 3T3MB 3H2BA 3UCFA 2QAGC 1HO3A 3OLVA 2JKZA 3LE8A 2C9OA 2IQIA 4H3KB 1CR0A 5FAXA 1PT6A 1SCKA 5FUBA 3PQ8A 3O2SB 1RHJA 1YBHA 1SHLA 4H4DA 2IV2X 1E62A 1CEEA 3GJSA 2WWVD 1B8PA 3BTOA 1O57A 3D6VA 4YCNA 5ECGC 3PA8A 2MSWA 5LU8A 4TXHA 3RFTA 1RRMA 1W1UA 1NY5A 3AF3A 4IFTA 1XQ1A 5AXAA 5TR9A 3S7TA 3WHLA 1HNZB 2QL7A 4M9XA 3UN1A 1U4OA 5ETJA 4F71A 3BG5A 1WIWA 2ZIGA 2P6NA 1FJ2A 4H9GA 4WK4B 3V9PA 3CIOA 5C18A 5JRZA 1SMKA 3ZHYA 2P0YA 3OZVA 3B3JA 1VGRA 1ZS9A 4ZTBA 4U2DA 3SYMA 5A6VA 1B3RA 2YCBA 4B32A 2DQSA 3FTDA 3MJTA 2V3VA 2DQZA 1FP1D 2WWTA 2Y6VA 3L6OO 4ZYLA 2QN1A 2A58A 2DQ4A 5AOVA 2X8LA 4ALJA 2ZIWB 3X1KA 1ODTC 3F90A 4KQ1A 4MQEB 4F12A 3BRQA 3GLTA 3LM8A 4WHMA 2NPFA 1IBRA 2JS7A 4LJLA 3A6DA 1KE1A 5HCUA 3E6AA 3TNLA 3LW8A 3N1UA 4KQWA 3H3JA 3NHMA 3WA6A 1DCKA 1OH5A 3HHPA 1PT7A 1Y6RA 3I09A 4AD8A 3B8EA 2P65A 1X7XA 2I34A 4AS2A 1Y42X 2ZANA 4JZKA 2QMZA 1PJTA 2XCUA 1DJNA 3CX6A 4O8CA 4MR8A 2IHYA 4IIHA 5G4KB 1M5TA 1KNQA 1B2RA 3H5IA 4G9EA 4BMNA 2BBWA 1A88A 2P68A 3K1TA 1YS2X 2RI6A 2GPWA 1VSTA 3U39A 4XCVA 5DNWA 3VZCA 1O95D 2VJKA 5BT9A 3DDZX 3QQ5A 4GNKA 2O8EB 5LD2B 4OQXA 4L75A 1FK8A 3Q2OA 3ZCSA 4D0LB 2VZ9A 3KDPA 4KOEC 1G2PA 3HUDA 4P86A 1G55A 4ER3A 2GH1A 5H5JA 2R7NA 2NOAA 1GDHA 1GVNB 2VKQA 4B79A 4L9WA 4RQTA 2AYYA 1MQ9A 3YASA 4L6AA 5CVTA 4F21A 4EYGA 2RCNA 4JR1A 1SAYA 5A5GA 4P5EA 4Y0NA 1G9SA 2IF2A 3FXAA 3IESA 1JA9A 1XMPA 2AFVA 2OZLA 3FZYA 2G6TA 2IP1A 2CGEA 3O8QA 1OZ0A 2HSWA 4QTUB 1GGVA 4WNAA 1X42A 3X0DA 1LNSA 5AKZA 2QN6A 4MX8A 4GVXA 1Q83A 2RHRA 2VHQA 3B6KA 1A9QA 4UJ3A 4MKXA 4N5HX 1T8UA 5ADVA 5BVHA 4LGCA 2DJ5A 4URYR 1F2TA 3CEAA 4QDKA 5L4SA 3O8BA 4H7PA 2BJWA 4ZT3A 3A9UA 1BDBA 3OCZA 1P4GA 1X15A 3N0WA 3OETA 2WG1A 2FWPA 4K5QA 1OYVA 2V7PA 3QW2A 1YU6A 1O87A 5JV5A 3NDJA 1ZEJA 1BYUA 4TMFA 4TMXA 2E6UX 3BZWA 3VV2A 4QOGA 4K8OA 3GU3A 1M2WA 3R4VA 3ZWAA 3LVFO 3R6LA 1C3EA 1E6LA 1X1BA 3D4LA 3H1EA 3RFCA 3CX8A 1YJQA 3UZUA 4W9NA 3VPXA 2C7PA 3N07A 3TLGA 1WG8A 3JYLA 3R5FA 4C05A 5GV7A 2X8JA 1YE5A 2AG1A 4A15A 2HK9A 2PBRA 5EIXA 1H4TA 1PEDA 2VFAA 3KVVA 2DSNA 4ZU1X 3A9WA 3JZMA 5T64A 3EOBI 2EATA 2XCQA 2JJ1A 1JR4A 1TAQA 2JAXA 2WOJA 1YASA 1L4BA 5ARBA 1RM5A 4HNVA 2BELA 3RVOA 5E6SB 3T34A 2XIJA 3FUUA 4AYTA 4UAGA 1RSZA 2AN3A 3A7EA 1VCOA 4FMDF 1E6KA 3K6SA 3GAMA 2WYWA 3T7KA 5EJ9A 5H7XA 2CXPA 1YCDA 5LSAA 2A5LA 5FNVB 4BFTA 1QRUA 1TLTA 3LWZA 2BONA 2A8YA 1FDUA 5JAQA 1WVMA 3EX7C 2MR6A 4X6LA 3R3UA 2VDUE 1WETA 4ZVNA 1UBSB 4NPAA 1XLTA 5TEWA 2BZ1A 2YWEA 1JLKA 2P4HX 1SG0A 2YR0A 1I2CA 4EGAA 2B36A 4V03A 4KODA 5K2OA 2D2FA 2PSHA 3ZXXA 1K4KA 1MX1A 5I9LA 2C07A 5EIAA 2ZS8A 4DBZA 3D3QA 2Z6QA 1UC5B 2WWHA 5HRCA 4LCJA 2IZ7A 1VJ5A 1R9NA 4IFEA 3C24A 3FCOA 2QPLA 3K1AA 3KOZA 3OCJA 1ZIDA 3KJEA 3ETEA 3A3YA 4OGGA 4BWVA 4NMMA 1P9OA 1WRBA 2VPQA 3G2IA 5E4YA 2PO5A 2OK7A 3VTFA 1T4BA 4DQUA 4F6LA 2G5GX 4Y18A 3NXKA 2CXTA 2OCAA 2IZ5A 1LBQA 4JYPA 5GJWC 3WGTA 2YZNA 2JKVA 3GROA 2IK8A 2YUTA 3DG9A 1L5GB 4NFLA 4ZT4A 1ZJ5A 2PJZA 4RXMA 3ROFA 1GSHA 4AJHA 1DAOA 3VSDA 3EDMA 4JAVC 4HNAA 4IZIA 4YC7A 3AR7A 4RKEA 5AQEA 4NV0A 2BR5A 1U4SA 2FXIA 4N54A 3WJ7A 2B37A 3IEKA 4A8JB 1SIOA 1EKXA 4JSRA 4MI3A 1QKKA 1Z45A 4TQUS 3SYLA 1JAXA 3CRQA 2YQ5A 3CNOA 3O73A 3QBDA 2X0RA 3DTVB 4FEAA 3KYIB 2DECA 4RE6A 4X3PA 4Y6SA 3P2OA 2W6MA 5DXJA 3ETDA 5FHQA 1WU7A 3WJAA 2BH9A 1R4MB 5BMVB 1GO2A 5JPCA 4OXYA 3R8FA 5F51A 4BEBA 1NYLA 5ADWA 3ITDA 4ZI7A 1Y89A 1XRRA 1UF9A 2JASA 4L5CA 3EEIA 1CS0B 1KZ7B 1RCUA 2A4MA 2DHQA 1T9GS 3BPSA 3OF3A 2NO4A 3JARA 4RENA 4YI3A 4F2PA 1CRZA 4EB3A 3AFOA 5BPHA 1L0BA 3G2PA 4C1BA 4U7TB 4YDHB 2GFHA 4XOUA 3HN2A 1E2LA 3B7WA 3O8OB 3THWB 2RCYA 2DLDA 4MUHA 2BCEA 2JFNA 1W96A 1Q1EA 1X7WA 4JQOA 4AMVA 1QLWA 4B3DA 3STVA 2H4WA 3L92A 3VO2A 1BG6A 4C4XA 3BYZA 4K28A 5KJFA 3D64A 4M0LA 4BGDA 2AR0A 3L6EA 2Q5FA 4OAPA 1O6BA 5G1PA 1PDOA 4D9MA 2ETVA 2NUTA 3AVTA 2YZMA 5TS3A 1HGXA 3T99A 2EBHX 1KOLA 1JIKA 1N1DA 1T2AA 1DEXA 2BM0A 2ZRGA 1XYGA 8ADHA 3CU5A 1M73E 4HNSA 1CB7A 3PV0A 4RU1A 1YR6A 4R0NA 4RZSA 1NUUA 1WU8A 4P54A 4OJYA 4EKGA 3FR8A 2HCRA 2K87A 4GU5A 1W9HA 1QHSA 1T1SA 2D2EA 4IDHA 3SLGA 2W2TA 1BDIA 4M4SA 2O3TA 1JRLA 3N7AA 2FMXA 2POQX 2WMDA 1HORA 1X1SA 3FWPA 2ZGVA 4YMWA 3SF8A 4QVIA 4PC1A 3V4RA 1PK7A 3LQ2A 4D98A 3FIJA 2REQB 2WYHA 1AK2A 3K9HA 4AUKA 3IEVA 4WLOA 3UXEA 1S9HA 3ZGXA 5KZMB 1FQKA 1YDFA 3ADKA 3SMQA 1E2MA 3Q2KA 4LXTA 4DAOA 2Z2KA 4RIFA 3DHYA 4UCXA 4WLEA 3WNBA 1IZZA 1IN4A 3C5EA 3OAAA 4K9MA 3A06A 4X93A 1CY8A 3DDWA 1ZNWA 2W7TA 4N6OA 4EFDA 5C7LO 1PG2A 4WSOA 3WYFA 5LMCA 1L8QA 1EEHA 1NUSA 2WIKA 3MN1A 2XITA 3B20A 1R00A 4UE6A 4XUCA 3QWIA 1ONPA 3B9RA 2X9NA 1FBNA 4MJ3A 5CDTA 1BKSB 1PV4A 1XF9A 2W9XA 5SYMA 3UC9A 1KH1A 3NHUA 4OV6B 3DFMA 2IYXA 4OOEA 2QNIA 4WVLA 1YF3A 3RSOA 1LDBA 2Q6LA 3B6EA 3H8JA 2CNNA 1FXWF 5EMJA 1GDDA 2OA0A 3PEYA 3G6WA 1DVRA 2XCLA 2A2ZA 5JD6A 5ARDA 2CHGA 4N41A 4ETMA 1P4RA 4IIXA 2YKGA 3EDOA 2ZREA 3U44B 5TNXA 1JH9A 1E2HA 1FX0B 1PW5A 4D8WA 1TEZA 2PX8A 3IBSA 1NJ2A 2X9QA 4UM9B 4ZDKA 4PV7A 4RKFA 1OH6A 1OYOA 1IVSA 5DCUA 2P3OA 3GEBA 2XWQA 3IP1A 4QU9A 5DN9A 1PZGA 1TQ8A 1P29A 2VP6A 3VOBA 1IBKB 1SKMA 3SXPA 4DCMA 2IHJA 3IB6A 1ZGBA 5KO2A 2O6LA 1PJLA 3NHJA 1B0AA 3S1AA 1P7PA 1LLUA 2I2FA 1VHDA 3OQPA 4KVFA 4G4JA 4QBHA 2AC4A 4WXYB 2BGGA 3IP9A 5HIAA 2QE6A 5LNK1 1XROA 4JOCA 2C0QA 4FXOA 5E4JA 3ZDAA 4LNUB 4QHSA 5AOCA 2PEZA 4IJVA 1Q0ZA 4DCVA 4P80A 5KBYA 5AK3A 1AQNA 2UDPA 1FTWA 2QVBA 2WF9A 4PPGA 3EZGA 1IN8A 1OTYA 4G5SA 2VH1A 4PBSA 4UNIA 2HU5A 5C1IA 4JBWA 2OKCA 3P97A 5CYOA 1X9HA 2BT4A 1S7CA 5AKHA 5K0BA 3N53A 4G0NA 3ESBA 3WGUA 2AOUA 4U9HS 2FW0A 4LF8B 3FR7A 3Q5GA 2FRDA 3TQIA 3VZBA 4DG9A 3KZCA 1N7GA 2AR9A 3CUKA 3AQ4A 4CGZA 1Y98A 4EI7A 3IDSA 4FT4A 2ZOSA 4UHCA 4PY2A 1C3OB 1UK6A 2C3MA 2E4UA 4UMVA 4Z9FA 3E3AA 3CKMA 4EUEA 4REQA 1P72A 1P0FA 1ZVJA 1KYYA 3A3OA 3I72A 3NHRA 3RAJA 3FOEC 3U60B 3BKXA 2OVBA 3NXSA 1RM4A 2X0IA 2ZI6A 3Q6IA 4CDNA 4LMRA 3OZ7A 4KWHA 2ZSAA 1YRQA 4QUDA 3JQDA 2V54A 4XXHA 2J48A 3VDMA 2H08A 4F4UA 1QGOA 2ZJ8A 1WP4A 3U17A 1RXEA 2GCGA 3TQHA 2BLNA 4MV5A 3TSAA 1GCIA 4IUDS 3LT5A 1OWPA 3AUSA 4Q16A 4QXPA 1Q11A 4CG2A 1AA6A 2MR5A 2CFCA 2FWJA 3EQ6A 3E9EA 5EL0A 3FZGA 4FGUA 5KNDD 2Q9CA 2ZWPA 3O0DA 4MR9A 2OCXA 4JDPA 3N39C 4W8HA 3K4QA 5JANA 4CR6A 4GXTA 1YGPA 3NAGA 1DTWA 2WILA 2ZE5A 3NALA 1JKXA 5B7QA 3I6ZA 4U4AA 4AW9A 1G2OA 4X24A 1IONA 5E6UA 5HVNA 2I1VB 1KMHA 2PRIA 4OU4A 1OASA 3LBAA 1L5YA 1YK1A 3KVRA 5D5QA 1XAHA 3RG2A 4C21A 2VK8A 2HPVA 1G64A 3E22B 3M81A 3LL7A 1WB5A 2I4MA 3GMIA 1XV5A 2QMHA 2YJ3A 5YASA 4LGYA 3P52A 1GADO 1LLDA 3PGLA 4CMBA 2WP0A 4OQZA 3R0VA 1FEZA 1IMOA 1NYTA 2CMKA 3AONB 4TOIA 4UZFA 4D42A 3V4VB 4D4HA 4RC9A 5D1NA 4KQKA 6Q21A 1VHWA 1R4NB 3CT6A 4JBYA 2ZW9A 4FGSA 3W8FA 1GTZA 1NV8A 2WMYA 2FR8A 3QHQA 4RKRA 4YIHA 2PLRA 2QU7A 3INYA 4O2RA 3KSMA 1A4XA 2W83A 2RE8A 2XT9A 2XXAA 4K7JA 1J21A 2J9RA 3ILYA 1KEUA 1I4WA 5DM1A 4PNHA 4D02A 4L4RA 5K03A 4ARAA 3NT4A 3EVZA 2YBEA 5JMWA 2OCLA 4FFPA 3M9LA 5HE8A 2RKBA 4TLLB 5FLYA 4P9NA 2ASVA 2J3MA 3NRBA 4Y2QA 3T52A 1H2WA 3H1FA 4CW7A 1TDJA 3A4VA 4UBIA 3FSEA 2RGDA 2R25B 3DPSA 5LDHA 2UVQA 4LJYA 4UEQA 2Q2QA 2BTEA 2FJ0A 1G4AE 1U3FA 4I4NA 4AQYB 1DX4A 1TO6A 4DANA 1KO8A 4EPWA 1JPJA 3X1ZA 3E0QA 1OY1A 3QQPA 4D9JA 4HUTA 1XF1A 3BH0A 3KB1A 5I4CA 5L6LB 3VNUA 2N9UA 4RE5A 5IKPA 4DUPA 2A9FA 2V3WA 3RCBA 3TTUA 3W1EA 3ZGVA 1TA9A 4QUBA 3IQFA 1PL7A 4BVKA 2AW3A 4EPXA 5LU9A 2BGUA 3KU4A 4CMKA 3OJXA 2XQGA 3EGXB 3LH5A 2IYYA 2RI1A 1P91A 2ZM6B 4O4HA 1T9ZA 3SOZA 3UMGA 4JI3B 4KWTA 2B7BA 3KOYA 3QVUA 4GI5A 5CHYA 1TB4A 3PX7A 1XP8A 4PZAA 3VVCA 4KJZA 2LTAA 3ZGYA 1QJ4A 2YQ4A 4H6VA 4NJEA 4JJ7A 3DCYA 5KYUA 1UPUA 4CGYA 4XIIA 5JJKA 4ML3A 2VH5R 1B73A 1GPMA 1U28C 3C8ZA 1QHIA 3P9PA 4I2VA 4BKUA 5JCXA 1XUOA 3AVWA 4G36A 4BLWA 1KWGA 1Q2XA 3TK1A 3B1KA 1QUFA 2GZ1A 1KH3A 2BM8A 2RGNA 2IBSA 4MRPA 2Y2VA 2YN2A 1SRQA 2JFVA 3IQZA 4E5UA 4BNLA 4RV4A 5B64A 4J9VA 4QEDA 4PVDA 3AU8A 1KIMA 3PITA 3Q3EA 3SE7A 2XYQA 3B1ZA 1GL3A 1G7CA 2EERA 5I5GA 5KHOC 3VR3A 5CVCA 1NLYA 3GGCA 3VSEA 3KWMA 1D2CA 4JJKA 5TT0A 3ZJYA 2D5BA 3FDZB 3ZS8A 5JZMA 2AEEA 5LZ8A 1JILA 3CH5A 2B0CA 4U7GA 2G1PA 3SQNA 2IFTA 4JB3A 4X1OA 1ULBA 2PT5A 1URPA 5LQDA 4GPZA 4NR0A 2I71A 3L04A 1E3MA 2CL7X 4XYMA 2A5DA 4KSBA 4YAJA 1U0TA 1GGEA 1M1UA 2FW8A 3EYAA 3IUYA 3JZFA 4J0QA 4IDDA 3U3OA 4CMAA 4JJFA 1TKAA 4ZT2A 4H7IA 1Q3HA 3A9TA 4M83A 3TLMA 3V7YA 4PC7A 1HQCA 2ZYVX 5EI5A 2OQVA 5KTKA 3WB2A 2VHTA 4TZTA 2W93A 4MLPA 1N2GA 1XTUA 2RK6A 4LA4A 4PXYA 4AQDA 4P7GA 1XZKA 1UFQA 2WLSA 3H11A 4JKOA 2HA6A 3TBKA 3KAKA 3UAOA 5AHXA 1ZVVA 1YI1A 2I2XB 3UO8B 1TYCA 1E99A 2WSSD 3OHMA 2ACVA 1DRUA 4GGOA 3LYAA 4LVUA 4E5PA 5A5VA 3B1WA 4HZUA 2PZ8A 3CE6A 4N01A 1QIGA 2XKJE 2BHRA 1VBNA 3ENVA 3GAZA 4JQZA 1JQEA 4L8VA 4OQQA 3R76A 1EX6A 1OA0A 3QKIA 5CCEA 2IHNA 1BXGA 1AGYA 1MNQA 2D5IA 4TTTS 5K0LA 1JTFA 2F4VB 1GXSA 2EJTA 1G21E 1XAIA 1XTJA 2BD0A 4R2LA 5DTJA 4BFYA 5EE5B 6YASA 2VZ0A 2NLOA 2WTBA 3UAYA 4DIOA 3N0RA 4RZUA 5AI9A 2A4KA 2WHYA 5CDFA 4D8YA 4BASA 4O4IA 4FR2A 1IBCA 4QZVA 1S2LA 4FK8A 1PL6A 1SOVA 3AYZB 1QIHA 3B48A 1GAQA 2I3GA 2QVYX 3E9QA 4QNMA 4S3MA 5CT8A 3SK0A 3U7RA 1TTQB 3HVHA 4DLVA 3V8VA 4E4YA 3AEYA 4XWKA 3FMFA 4HDCA 2IV3A 2P11A 3WRYA 4GVLA 3L3BA 4EY7A 2C4VA 4L57A 4PZYA 3LNCA 1EI9A 1LI5A 1NNLA 1OC4A 4J16C 4BLUA 2P1ZA 1U80A 2XBUA 1G8KA 3IDZA 4P8RA 3ZQ4A 5K8UA 1HFKA 2J7KA 1E9RA 1DDGA 3A4YA 3CO0S 1X3SA 1Q6ZA 3R3SA 3NNSA 4IJ6A 5D8DA 3LDHA 4EAAA 3S1SA 5K8IA 1G9TA 1GPAA 1NQUA 1QNLA 1SUCA 2JH9A 1YA6A 2O0HA 2X2FA 2C88A 3OIYA 4GSYA 4GQBA 3RUEA 2VQEB 4GQIA 5IVIA 1FFXA 1HLPA 1LC0A 3GC6A 1WNTA 4BKQA 5KVSA 4DXAA 1V6SA 1ARZA 2ZRJA 5I3CA 2GUWA 3GD7A 4RJLA 5JHGB 3GCZA 2IXAA 2BKXA 1HEUA 2Q99A 1IRIA 2IXTA 3INRA 3NHZA 2PTGA 4D6PA 2NMVA 1O97C 4M7RA 1DAEA 4CKCA 1RZRD 3JR3A 2J9FB 2RH8A 1ORDA 3IUQA 4HG2A 4AY3A 2RGUA 4WY8A 1R37A 1Z56C 4MW5A 5ICSA 2RGBA 3SDBA 2BISA 2AKEA 1M2JA 3T15A 3ZU3A 4PLYA 2SKCA 4OFZA 4P4TA 3QPBA 4L85A 4BBAA 5IVKA 2ADFA 2J3DA 4M8KA 3FCSB 5ALSA 5DM70 3IIKA 3OICA 4F4JA 2PK3A 4QHYA 1COZA 4N9WA 1JTVA 4W5NA 1EM8B 2QUZA 4URXR 4YRKA 1AQYA 1M2HA 2PXXA 1W2HA 5FL3A 3W7BA 5C1PA 2DWQA 4V1CI 1BEUB 3OURA 1U0HC 4IIJB 5KYVA 2Y1WA 4BP9A 1JECA 1S7GA 4AZSA 5ERYA 3COPA 5K2MA 5AI0A 2ZBQA 2OCYC 3EPPA 3LGSA 4PAOA 3KKOA 5EE9A 1KFJB 3TTXA 2EF1A 3W8RA 4W7SA 2RHMA 2JGEA 3KZ1E 4O4LA 5LOVA 4GPIB 1TM2A 4OY3A 3E1KA 3DMGA 4QOEA 4HDMB 1NMQA 4MZDA 4WW0A 1SBZA 2XSZA 4HDSA 1SRRA 1SC6A 2IS1A 1IBMB 3D8RA 1ZD8A 4UUOA 2MMCA 1CYDA 2JAOA 4D3FA 5GIPE 4G9GA 4I3HA 3PPIA 4I55A 5LKAA 1EJ0A 3A4MA 4YT8A 2Z58A 4KYIB 3O4IA 3OKCA 4ZZ2A 2XUIA 3SBEA 3TPCA 4GOOD 2P9CA 1G9XA 2OQIA 4UNQA 5JJ5A 4CTJA 5SZKB 5AESA 4S05A 1UINA 2HUPA 2NVWA 2XWSA 5GZ1A 1ZH4A 4I6JA 4D45A 1YUBA 5HKBA 2C78A 4PG8A 2FFAA 5CYGA 3RJ9A 4EVIA 2A5JA 4RSHA 5BUSA 3IPLA 4P6VF 2E7ZA 1AU9A 5TX7A 2B5VA 2VJLA 3MBIA 4DZRA 1L7NA 5HJ7A 1F2DA 4QBFA 3HE3A 5DGXA 5AVJA 3CVXA 4E3WA 5I7VA 1NSYA 3BJMA 3FKSA 3FRHA 3GA7A 1JB9A 4MUBA 4B0PA 2P9EA 3OQMA 4RA6B 3B82A 4ND8B 4MVJP 4U6NA 2VN8A 3C7CB 4R7TA 1T4CA 1TC2A 3RC7A 3IDAA 4R1MA 1LVUA 2PH1A 3LWBA 2NG1A 3BF8A 4TV9B 4Q4JB 3GP3A 2X0EA 5T41A 2Y1LA 3BGVA 4RK1A 1V1MA 4QT4A 4WBSA 2F43B 1APBA 1Q19A 4IMIB 4FEGA 4DC9A 1E8NA 4DV3B 1TJ4A 3IMFA 1WSBA 1NM5C 4W5QA 5JARA 4IEIA 1QFZA 1ES9A 4NMLA 5JNRA 1T8PA 1PIWA 2JB9A 1R6TA 5CVEA 1P1RA 1P6QA 4RD2A 2LKDA 3ONWA 3CA8A 5TGTA 3STWA 2IU6A 1QOQB 5ICMA 1NRXA 5LPNA 1EFPA 2JANA 1HQYE 1X2BA 3KU1A 3UHOA 3W3AD 1DB3A 3GRKA 3ZBQA 2PH3A 4TRMA 5DYTA 3GT4A 4RJIA 3LL4A 4WECA 4D9BA 3VU8A 3E1SA 5CITA 1G59A 1OIXA 1Z38A 4BB6A 2QTHA 4OHVA 4MPJA 5BQ3A 4MKHA 4KQHA 2Y99A 4Z1MA 1TA4A 3HKEA 3EF3A 1P7VA 3RU7A 2P2DA 2XOKA 2DUJA 3LCCA 4CL8A 4DY4A 5TQ2B 1N34B 1OFUA 2QMQA 4OP1A 4CKEA 1W93A 3O03A 3A32A 3JWJA 2ZXEA 3KIPA 4KBYA 1ZK3A 1A2KC 2DGDA 1JQAA 3DFKA 4J0IA 2C5GA 2E2WA 2C84A 2XRZA 2ODBA 2JFPA 5LIPA 2ICAA 3KAQA 4ZVPA 4BCDA 5LR6A 1HG0A 3MBKA 3BJIC 4K8RB 4UQLA 1VJDA 1RP1A 3KSZO 1E7YA 2OECA 4Z8XA 4COKA 3PT5A 5BORA 1NXXA 5T6MA 1PHRA 1A2OA 4IOLA 2E85A 3BHJA 4XD2A 1YVPA 2VF5X 2YFHA 5FWXA 2FLWA 1DXQA 1EVIA 3KQOA 3LFHA 2FFJA 1HLGA 2AB0A 2CLIB 2Z30A 4ZCPA 3TR0A 4LHYA 4MI9A 3VYWA 5JMOA 1SH7A 1NF3A 4LFAB 2OHHA 3TLEA 5ITWA 1COWD 4LXYA 2L19A 2VDQB 1Z5OA 2IGBA 3Q41A 2PZBA 2ACWA 3LNTA 3QBTA 4HYQA 5AM1A 1SUIA 5EGNA 3N7UA 5FA6A 2JGAA 2JJ2A 3I01A 3ORHA 4BFUA 2FAXA 3T0IA 1YTUA 1SKBA 3H2SA 4FUQA 1AUXA 3U1TA 1FW6A 2ZJ1A 1ODKA 2XVXA 1SCUB 3F74A 2ENUA 3F6PA 3X1XA 1JXMA 2W70A 1JKIA 3ZOKA 1HE2A 1JJAA 5JSYA 2HI0A 1UH5A 2FZKA 1YDMA 2D8AA 1DXYA 2QZ4A 3JSAA 3NBUA 4YMHA 2IH5A 3RC1A 4PBRA 4D8XA 1KQPA 1T0UA 1KSHA 1NN0A 3SFZA 2WYVA 4DDMA 1RXYA 5LA6A 5ERXA 2BJVA 1D1TA 3DVQX 1A8SA 3VAAA 3P2KA 1JAZA 4CR7A 3Q8MA 1QG0A 1TF5A 4PR3A 2PKYX 1YC5A 4CR8A 1Q14A 4ND2A 2AJTA 2NP6A 3HI6A 2HBRA 1POXA 1UPAA 4B80A 4WLUA 3BB4A 1S96A 1RRCA 2LP4Y 4CV1A 1AURA 4Q05A 3HCFA 1I7PA 4FHCA 4ZEWA 5K3FA 1CHNA 4DMRA 3AETA 1GNRA 5DIZA 2GTIA 4LJ9A 4AKTA 2WZQA 1ZJ4A 2EZUA 2I87A 3NLLA 2FGJA 5ALDA 1W1IA 2AIRA 2EGGA 3DFFA 2C4UA 3MT0A 3QNMA 2QD3A 1EBBA 5BXQC 4POAA 1Y48E 3BT7A 1XQ6A 3FPHA 3UJAA 4GOMD 3L79A 1JHYA 1NN1A 3FH0A 4RMJA 1TMOA 1ZOOA 5DTIA 1HPLA 5DFAA 2Z8YM 1K8XB 3SY8A 3K0CA 3QWBA 3UWMA 5JHHB 3B78A 3N0VA 2GERA 3HJRA 2RGEA 2YYSA 1TT5B 2ERYA 5DK6A 3UT5B 4DCPA 4JLVA 1K7YA 4LGMA 4Q47A 1O58A 4KE9A 3OZTA 4MO9A 2ZAGA 1W5TA 2BFEA 5LQCA 1ELOA 5JD4A 1G16A 2C9ZA 1D2AA 3UV7A 4AUMA 4AQ7A 1GG2A 1ZHHA 5F2OA 5AFSA 3K30A 2WG0A 1YS6A 5LLSA 2OCDA 3ZI4A 2X6TA 1VBKA 1DBVO 5JH7F 1MZVA 1VE5A 2YYZA 1ADYA 3EIFA 4U7PB 1I9GA 3Q85A 4E2XA 4J76A 4KI0A 4FKBA 4INPA 1VG9B 2RC6A 4FB5A 3LA6A 2CN1A 4QBTA 4UDXX 1VKOA 4DLLA 5AUPB 4J3NA 1ZRMA 5FWDA 3QI7A 5KOHB 3SIRA 2ZRMA 1KDRA 3MCVA 2FSIA 4ZDWA 1NR5A 4PHHA 2RMKA 5CK4A 2F64A 2C2MA 3GOQA 3PUWA 3QUCA 3UQZA 1T6YA 1FMFA 1Z8DA 1PW7A 2X7JA 3FWNA 4FNMA 2VJMB 3EC2A 4JUIA 4KIUA 2YJGA 1UJ4A 1QG6A 3IRVA 5EHQA 4DVJA 4H3HB 4F86A 2PPVA 2PYDA 3G8BA 4PYOA 3WSTA 4KAJA 2QTGA 1G21B 4CU5A 2B1IA 4UBNA 3CEMA 5IT5A 1KRHA 2GKSA 3P9NA 1L5WA 4XGNA 2ZYGA 2WP8J 5J9FA