4IKBB

Crystal structure of snx11 px domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
127
structure length
125
Chain Sequence
EVITVRVQDPRVQNEGSWNSYVDYKIFLHTNSKAFTAKTSVRRRYREFVWLRKQLQRNAGLVPVPELPGKSTFFGTSDEFIEKRRQGLQHFLEKVLQSVVLLSDSQLHLFLQSQLSVPEIEAVQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorting nexin-11
publication title Structure of Sorting Nexin 11 (SNX11) Reveals a Novel Extended PX Domain (PXe Domain) Critical for the Inhibition of Sorting Nexin 10 (SNX10) Induced Vacuolation
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 35
structure length 125
sequence length 127
ec nomenclature
pdb deposition date 2012-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00787 PX PX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 4ikbB00
3P0CA 4IKBB 2V6VA 4ON3A 2AR5A 1GD5A 2RAKA 3HPCX 4BGJA 4IKDA 3LUIA 4PQOA 1OCUA 2I4KA 2ETTA 2WWEA 2DYBA 2REDA 4IKBA 4OXWA 4AZ9A 1XTNA 1KMDA 4P2IA 3HPBA 4HASA 1KQ6A 2REAA 2CSKA 1O7KA 4PQPA 2V14A 2RAJA 3FOGA 2L73A 4AKVA 2RAIA 1OCSA 2YPSA 3DYTA 2IWLX 1XTEA 1H6HA 4P2JA 2CZOA 3IQ2A 4PZGA
chains in the Genus database with same CATH superfamily
3P0CA 4IKBB 2V6VA 4ON3A 2AR5A 1GD5A 2RAKA 3HPCX 4BGJA 4IKDA 3LUIA 4PQOA 1OCUA 2I4KA 2ETTA 2WWEA 2DYBA 2REDA 4IKBA 4OXWA 4AZ9A 1XTNA 1KMDA 4P2IA 3HPBA 4HASA 1KQ6A 2REAA 2CSKA 1O7KA 4PQPA 2V14A 2RAJA 3FOGA 2L73A 4AKVA 2RAIA 1OCSA 2YPSA 3DYTA 2IWLX 1XTEA 1H6HA 4P2JA 2CZOA 3IQ2A 4PZGA
chains in the Genus database with same CATH topology
3P0CA 4IKBB 2V6VA 4ON3A 2AR5A 1GD5A 2RAKA 3HPCX 4BGJA 4IKDA 3LUIA 4PQOA 1OCUA 2I4KA 2ETTA 2WWEA 2DYBA 2REDA 4IKBA 4OXWA 4AZ9A 1XTNA 1KMDA 4P2IA 3HPBA 4HASA 1KQ6A 2REAA 2CSKA 1O7KA 4PQPA 2V14A 2RAJA 3FOGA 2L73A 4AKVA 2RAIA 1OCSA 2YPSA 3DYTA 2IWLX 1XTEA 1H6HA 4P2JA 2CZOA 3IQ2A 4PZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P0C A;  4IKB B;  2V6V A;  4ON3 A;  2AR5 A;  1GD5 A;  2RAK A;  3HPC X;  4BGJ A;  4IKD A;  3LUI A;  4PQO A;  1OCU A;  2I4K A;  2ETT A;  2WWE A;  2DYB A;  2RED A;  4IKB A;  4OXW A;  4AZ9 A;  1XTN A;  1KMD A;  4P2I A;  3HPB A;  4HAS A;  1KQ6 A;  2REA A;  2CSK A;  1O7K A;  4PQP A;  2V14 A;  2RAJ A;  3FOG A;  2L73 A;  4AKV A;  2RAI A;  1OCS A;  2YPS A;  3DYT A;  2IWL X;  1XTE A;  1H6H A;  4P2J A;  2CZO A;  3IQ2 A;  4PZG A; 
#chains in the Genus database with same CATH topology
 3P0C A;  4IKB B;  2V6V A;  4ON3 A;  2AR5 A;  1GD5 A;  2RAK A;  3HPC X;  4BGJ A;  4IKD A;  3LUI A;  4PQO A;  1OCU A;  2I4K A;  2ETT A;  2WWE A;  2DYB A;  2RED A;  4IKB A;  4OXW A;  4AZ9 A;  1XTN A;  1KMD A;  4P2I A;  3HPB A;  4HAS A;  1KQ6 A;  2REA A;  2CSK A;  1O7K A;  4PQP A;  2V14 A;  2RAJ A;  3FOG A;  2L73 A;  4AKV A;  2RAI A;  1OCS A;  2YPS A;  3DYT A;  2IWL X;  1XTE A;  1H6H A;  4P2J A;  2CZO A;  3IQ2 A;  4PZG A; 
#chains in the Genus database with same CATH homology
 3P0C A;  4IKB B;  2V6V A;  4ON3 A;  2AR5 A;  1GD5 A;  2RAK A;  3HPC X;  4BGJ A;  4IKD A;  3LUI A;  4PQO A;  1OCU A;  2I4K A;  2ETT A;  2WWE A;  2DYB A;  2RED A;  4IKB A;  4OXW A;  4AZ9 A;  1XTN A;  1KMD A;  4P2I A;  3HPB A;  4HAS A;  1KQ6 A;  2REA A;  2CSK A;  1O7K A;  4PQP A;  2V14 A;  2RAJ A;  3FOG A;  2L73 A;  4AKV A;  2RAI A;  1OCS A;  2YPS A;  3DYT A;  2IWL X;  1XTE A;  1H6H A;  4P2J A;  2CZO A;  3IQ2 A;  4PZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...