4IKRA

Crystal structure of type 1 human methionine aminopeptidase in complex with 2-(4-(5-chloro-6-methyl-2-(pyridin-2-yl)pyrimidin-4-yl)piperazin-1-yl)ethanol
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
b'YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification, Biochemical and Structural Evaluation of Species-Specific Inhibitors against Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 101
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4ikrA00
3IU7A 1WL6A 2GGBA 2GG0A 1WN1A 3FM3A 1CHMA 4QR8A 3CTZA 4R60A 3IG4A 4FUKA 2EVCA 4FLIA 1XGOA 1R58A 2NQ6A 2OAZA 1KP0A 4U71A 2GGCA 4FLLA 4FO7A 2BB7A 1WLRA 4IU6A 2ADUA 2DFIA 1WY2A 5D6FA 1KQ9A 3PKDA 1C22A 3CB5A 1JAWA 2BHAA 1WBQA 4U6EA 3TAVA 1QXWA 5CDLA 3L7GA 2EA2A 2Q96A 4RGZ1 4S2TP 2IW2A 4Z7MA 2V3YA 1WKMA 4U76A 2BWVA 2BHDA 2BWSA 1XNZA 2GG7A 2GZ5A 2EA4A 1YW7A 4FLJA 5E5BA 5CDVA 5CDEA 2BH3A 2EVMA 2BWXA 4A6WA 1M35A 1N51A 2GA2A 4EGEA 4IKRA 5CIKA 2GU4A 2GU5A 4IDYA 5JFRA 5CNXA 1YVMA 2P98A 2BWWA 4RZYA 5D6EA 1YW8A 2B3HA 2GG8A 1BN5A 1WL9A 5JHUA 2P9AA 2BWUA 4JUQA 1C24A 2GU6A 2GTXA 2B3KA 3MR1A 1BOAA 4S01A 4IECA 1YW9A 2V6CA 3IU9A 1W7VA 1R5GA 3FMQA 4KM3A 4FLKA 1Y1NA 1QXYA 2BN7A 3BIPA 3D27A 4FKCA 1XGSA 4U1BA 3MATA 2Q95A 4FO8A 2GU7A 4ZWUA 1B59A 2B3LA 1A16A 2G6PA 2BHBA 2Q93A 5FCHA 2Q92A 2BWYA 2OKNA 2EVOA 5FCFA 3PKAA 3RVAA 2GG5A 1PV9A 2NQ7A 3CB6A 4MATA 4ZWPA 1QZYA 1KQ0A 1R5HA 3PKCA 4IKTA 2BHCA 4IF7A 4S2RP 5JI6A 3PKEA 3PKBA 1XGNA 2GG3A 4B28A 2Q94A 4U75A 5CE6A 4U69A 4RZZA 4ZNGA 3BIQA 1QXZA 4S00A 3FMRA 4ZWOA 4U73A 1O0XA 4PV4A 1B6AA 4U6ZA 4U70A 2V3ZA 1W2MA 2ZSGA 3L24A 4A6VA 1C21A 4U6CA 5CLSA 2BWTA 1XGMA 2HOWA 3BITA 3IU8A 4OOKA 4U6JA 3TB5A 3MX6A 1C23A 3Q6DA 4HXXA 3S6BA 2P99A 4U6WA 3RORA 2GG2A 4IKUA 2MATA 4IPAA 1YJ3A 2GG9A 4PNCA 2Q8KA 2V3XA 4IKSA 1C27A 1MATA
chains in the Genus database with same CATH superfamily
3IU7A 1WL6A 2GGBA 2GG0A 1WN1A 3FM3A 1CHMA 4QR8A 3CTZA 4R60A 3IG4A 4FUKA 2EVCA 4FLIA 1XGOA 1R58A 2NQ6A 2OAZA 1KP0A 4U71A 2GGCA 4FLLA 4FO7A 2BB7A 1WLRA 4IU6A 2ADUA 2DFIA 1WY2A 5D6FA 1KQ9A 3PKDA 1C22A 3CB5A 1JAWA 2BHAA 1WBQA 4U6EA 3TAVA 1QXWA 5CDLA 3L7GA 2EA2A 2Q96A 4RGZ1 4S2TP 2IW2A 4Z7MA 2V3YA 1WKMA 4U76A 2BWVA 2BHDA 2BWSA 1XNZA 2GG7A 2GZ5A 2EA4A 1YW7A 4FLJA 5E5BA 5CDVA 5CDEA 2BH3A 2EVMA 2BWXA 4A6WA 1M35A 1N51A 2GA2A 4EGEA 4IKRA 5CIKA 2GU4A 2GU5A 4IDYA 5JFRA 5CNXA 1YVMA 2P98A 2BWWA 4RZYA 5D6EA 1YW8A 2B3HA 2GG8A 1BN5A 1WL9A 5JHUA 2P9AA 2BWUA 4JUQA 1C24A 2GU6A 2GTXA 2B3KA 3MR1A 1BOAA 4S01A 4IECA 1YW9A 2V6CA 3IU9A 1W7VA 1R5GA 3FMQA 4KM3A 4FLKA 1Y1NA 1QXYA 2BN7A 3BIPA 3D27A 4FKCA 1XGSA 4U1BA 3MATA 2Q95A 4FO8A 2GU7A 4ZWUA 1B59A 2B3LA 1A16A 2G6PA 2BHBA 2Q93A 5FCHA 2Q92A 2BWYA 2OKNA 2EVOA 5FCFA 3PKAA 3RVAA 2GG5A 1PV9A 2NQ7A 3CB6A 4MATA 4ZWPA 1QZYA 1KQ0A 1R5HA 3PKCA 4IKTA 2BHCA 4IF7A 4S2RP 5JI6A 3PKEA 3PKBA 1XGNA 2GG3A 4B28A 2Q94A 4U75A 5CE6A 4U69A 4RZZA 4ZNGA 3BIQA 1QXZA 4S00A 3FMRA 4ZWOA 4U73A 1O0XA 4PV4A 1B6AA 4U6ZA 4U70A 2V3ZA 1W2MA 2ZSGA 3L24A 4A6VA 1C21A 4U6CA 5CLSA 2BWTA 1XGMA 2HOWA 3BITA 3IU8A 4OOKA 4U6JA 3TB5A 3MX6A 1C23A 3Q6DA 4HXXA 3S6BA 2P99A 4U6WA 3RORA 2GG2A 4IKUA 2MATA 4IPAA 1YJ3A 2GG9A 4PNCA 2Q8KA 2V3XA 4IKSA 1C27A 1MATA
chains in the Genus database with same CATH topology
3IU7A 1WL6A 2GGBA 2GG0A 1WN1A 3FM3A 1CHMA 4QR8A 3CTZA 4R60A 3IG4A 4FUKA 2EVCA 4FLIA 1XGOA 1R58A 2NQ6A 2OAZA 1KP0A 4U71A 2GGCA 4FLLA 4FO7A 2BB7A 1WLRA 4IU6A 2ADUA 2DFIA 1WY2A 5D6FA 1KQ9A 3PKDA 1C22A 3CB5A 1JAWA 2BHAA 1WBQA 4U6EA 3TAVA 1QXWA 5CDLA 3L7GA 2EA2A 2Q96A 4RGZ1 4S2TP 2IW2A 4Z7MA 2V3YA 1WKMA 4U76A 2BWVA 2BHDA 2BWSA 1XNZA 2GG7A 2GZ5A 2EA4A 1YW7A 4FLJA 5E5BA 5CDVA 5CDEA 2BH3A 2EVMA 2BWXA 4A6WA 1M35A 1N51A 2GA2A 4EGEA 4IKRA 5CIKA 2GU4A 2GU5A 4IDYA 5JFRA 5CNXA 1YVMA 2P98A 2BWWA 4RZYA 5D6EA 1YW8A 2B3HA 2GG8A 1BN5A 1WL9A 5JHUA 2P9AA 2BWUA 4JUQA 1C24A 2GU6A 2GTXA 2B3KA 3MR1A 1BOAA 4S01A 4IECA 1YW9A 2V6CA 3IU9A 1W7VA 1R5GA 3FMQA 4KM3A 4FLKA 1Y1NA 1QXYA 2BN7A 3BIPA 3D27A 4FKCA 1XGSA 4U1BA 3MATA 2Q95A 4FO8A 2GU7A 4ZWUA 1B59A 2B3LA 1A16A 2G6PA 2BHBA 2Q93A 5FCHA 2Q92A 2BWYA 2OKNA 2EVOA 5FCFA 3PKAA 3RVAA 2GG5A 1PV9A 2NQ7A 3CB6A 4MATA 4ZWPA 1QZYA 1KQ0A 1R5HA 3PKCA 4IKTA 2BHCA 4IF7A 4S2RP 5JI6A 3PKEA 3PKBA 1XGNA 2GG3A 4B28A 2Q94A 4U75A 5CE6A 4U69A 4RZZA 4ZNGA 3BIQA 1QXZA 4S00A 3FMRA 4ZWOA 4U73A 1O0XA 4PV4A 1B6AA 4U6ZA 4U70A 2V3ZA 1W2MA 2ZSGA 3L24A 4A6VA 1C21A 4U6CA 5CLSA 2BWTA 1XGMA 2HOWA 3BITA 3IU8A 4OOKA 4U6JA 3TB5A 3MX6A 1C23A 3Q6DA 4HXXA 3S6BA 2P99A 4U6WA 3RORA 2GG2A 4IKUA 2MATA 4IPAA 1YJ3A 2GG9A 4PNCA 2Q8KA 2V3XA 4IKSA 1C27A 1MATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IU7 A;  1WL6 A;  2GGB A;  2GG0 A;  1WN1 A;  3FM3 A;  1CHM A;  4QR8 A;  3CTZ A;  4R60 A;  3IG4 A;  4FUK A;  2EVC A;  4FLI A;  1XGO A;  1R58 A;  2NQ6 A;  2OAZ A;  1KP0 A;  4U71 A;  2GGC A;  4FLL A;  4FO7 A;  2BB7 A;  1WLR A;  4IU6 A;  2ADU A;  2DFI A;  1WY2 A;  5D6F A;  1KQ9 A;  3PKD A;  1C22 A;  3CB5 A;  1JAW A;  2BHA A;  1WBQ A;  4U6E A;  3TAV A;  1QXW A;  5CDL A;  3L7G A;  2EA2 A;  2Q96 A;  4RGZ 1;  4S2T P;  2IW2 A;  4Z7M A;  2V3Y A;  1WKM A;  4U76 A;  2BWV A;  2BHD A;  2BWS A;  1XNZ A;  2GG7 A;  2GZ5 A;  2EA4 A;  1YW7 A;  4FLJ A;  5E5B A;  5CDV A;  5CDE A;  2BH3 A;  2EVM A;  2BWX A;  4A6W A;  1M35 A;  1N51 A;  2GA2 A;  4EGE A;  4IKR A;  5CIK A;  2GU4 A;  2GU5 A;  4IDY A;  5JFR A;  5CNX A;  1YVM A;  2P98 A;  2BWW A;  4RZY A;  5D6E A;  1YW8 A;  2B3H A;  2GG8 A;  1BN5 A;  1WL9 A;  5JHU A;  2P9A A;  2BWU A;  4JUQ A;  1C24 A;  2GU6 A;  2GTX A;  2B3K A;  3MR1 A;  1BOA A;  4S01 A;  4IEC A;  1YW9 A;  2V6C A;  3IU9 A;  1W7V A;  1R5G A;  3FMQ A;  4KM3 A;  4FLK A;  1Y1N A;  1QXY A;  2BN7 A;  3BIP A;  3D27 A;  4FKC A;  1XGS A;  4U1B A;  3MAT A;  2Q95 A;  4FO8 A;  2GU7 A;  4ZWU A;  1B59 A;  2B3L A;  1A16 A;  2G6P A;  2BHB A;  2Q93 A;  5FCH A;  2Q92 A;  2BWY A;  2OKN A;  2EVO A;  5FCF A;  3PKA A;  3RVA A;  2GG5 A;  1PV9 A;  2NQ7 A;  3CB6 A;  4MAT A;  4ZWP A;  1QZY A;  1KQ0 A;  1R5H A;  3PKC A;  4IKT A;  2BHC A;  4IF7 A;  4S2R P;  5JI6 A;  3PKE A;  3PKB A;  1XGN A;  2GG3 A;  4B28 A;  2Q94 A;  4U75 A;  5CE6 A;  4U69 A;  4RZZ A;  4ZNG A;  3BIQ A;  1QXZ A;  4S00 A;  3FMR A;  4ZWO A;  4U73 A;  1O0X A;  4PV4 A;  1B6A A;  4U6Z A;  4U70 A;  2V3Z A;  1W2M A;  2ZSG A;  3L24 A;  4A6V A;  1C21 A;  4U6C A;  5CLS A;  2BWT A;  1XGM A;  2HOW A;  3BIT A;  3IU8 A;  4OOK A;  4U6J A;  3TB5 A;  3MX6 A;  1C23 A;  3Q6D A;  4HXX A;  3S6B A;  2P99 A;  4U6W A;  3ROR A;  2GG2 A;  4IKU A;  2MAT A;  4IPA A;  1YJ3 A;  2GG9 A;  4PNC A;  2Q8K A;  2V3X A;  4IKS A;  1C27 A;  1MAT A; 
#chains in the Genus database with same CATH topology
 3IU7 A;  1WL6 A;  2GGB A;  2GG0 A;  1WN1 A;  3FM3 A;  1CHM A;  4QR8 A;  3CTZ A;  4R60 A;  3IG4 A;  4FUK A;  2EVC A;  4FLI A;  1XGO A;  1R58 A;  2NQ6 A;  2OAZ A;  1KP0 A;  4U71 A;  2GGC A;  4FLL A;  4FO7 A;  2BB7 A;  1WLR A;  4IU6 A;  2ADU A;  2DFI A;  1WY2 A;  5D6F A;  1KQ9 A;  3PKD A;  1C22 A;  3CB5 A;  1JAW A;  2BHA A;  1WBQ A;  4U6E A;  3TAV A;  1QXW A;  5CDL A;  3L7G A;  2EA2 A;  2Q96 A;  4RGZ 1;  4S2T P;  2IW2 A;  4Z7M A;  2V3Y A;  1WKM A;  4U76 A;  2BWV A;  2BHD A;  2BWS A;  1XNZ A;  2GG7 A;  2GZ5 A;  2EA4 A;  1YW7 A;  4FLJ A;  5E5B A;  5CDV A;  5CDE A;  2BH3 A;  2EVM A;  2BWX A;  4A6W A;  1M35 A;  1N51 A;  2GA2 A;  4EGE A;  4IKR A;  5CIK A;  2GU4 A;  2GU5 A;  4IDY A;  5JFR A;  5CNX A;  1YVM A;  2P98 A;  2BWW A;  4RZY A;  5D6E A;  1YW8 A;  2B3H A;  2GG8 A;  1BN5 A;  1WL9 A;  5JHU A;  2P9A A;  2BWU A;  4JUQ A;  1C24 A;  2GU6 A;  2GTX A;  2B3K A;  3MR1 A;  1BOA A;  4S01 A;  4IEC A;  1YW9 A;  2V6C A;  3IU9 A;  1W7V A;  1R5G A;  3FMQ A;  4KM3 A;  4FLK A;  1Y1N A;  1QXY A;  2BN7 A;  3BIP A;  3D27 A;  4FKC A;  1XGS A;  4U1B A;  3MAT A;  2Q95 A;  4FO8 A;  2GU7 A;  4ZWU A;  1B59 A;  2B3L A;  1A16 A;  2G6P A;  2BHB A;  2Q93 A;  5FCH A;  2Q92 A;  2BWY A;  2OKN A;  2EVO A;  5FCF A;  3PKA A;  3RVA A;  2GG5 A;  1PV9 A;  2NQ7 A;  3CB6 A;  4MAT A;  4ZWP A;  1QZY A;  1KQ0 A;  1R5H A;  3PKC A;  4IKT A;  2BHC A;  4IF7 A;  4S2R P;  5JI6 A;  3PKE A;  3PKB A;  1XGN A;  2GG3 A;  4B28 A;  2Q94 A;  4U75 A;  5CE6 A;  4U69 A;  4RZZ A;  4ZNG A;  3BIQ A;  1QXZ A;  4S00 A;  3FMR A;  4ZWO A;  4U73 A;  1O0X A;  4PV4 A;  1B6A A;  4U6Z A;  4U70 A;  2V3Z A;  1W2M A;  2ZSG A;  3L24 A;  4A6V A;  1C21 A;  4U6C A;  5CLS A;  2BWT A;  1XGM A;  2HOW A;  3BIT A;  3IU8 A;  4OOK A;  4U6J A;  3TB5 A;  3MX6 A;  1C23 A;  3Q6D A;  4HXX A;  3S6B A;  2P99 A;  4U6W A;  3ROR A;  2GG2 A;  4IKU A;  2MAT A;  4IPA A;  1YJ3 A;  2GG9 A;  4PNC A;  2Q8K A;  2V3X A;  4IKS A;  1C27 A;  1MAT A; 
#chains in the Genus database with same CATH homology
 3IU7 A;  1WL6 A;  2GGB A;  2GG0 A;  1WN1 A;  3FM3 A;  1CHM A;  4QR8 A;  3CTZ A;  4R60 A;  3IG4 A;  4FUK A;  2EVC A;  4FLI A;  1XGO A;  1R58 A;  2NQ6 A;  2OAZ A;  1KP0 A;  4U71 A;  2GGC A;  4FLL A;  4FO7 A;  2BB7 A;  1WLR A;  4IU6 A;  2ADU A;  2DFI A;  1WY2 A;  5D6F A;  1KQ9 A;  3PKD A;  1C22 A;  3CB5 A;  1JAW A;  2BHA A;  1WBQ A;  4U6E A;  3TAV A;  1QXW A;  5CDL A;  3L7G A;  2EA2 A;  2Q96 A;  4RGZ 1;  4S2T P;  2IW2 A;  4Z7M A;  2V3Y A;  1WKM A;  4U76 A;  2BWV A;  2BHD A;  2BWS A;  1XNZ A;  2GG7 A;  2GZ5 A;  2EA4 A;  1YW7 A;  4FLJ A;  5E5B A;  5CDV A;  5CDE A;  2BH3 A;  2EVM A;  2BWX A;  4A6W A;  1M35 A;  1N51 A;  2GA2 A;  4EGE A;  4IKR A;  5CIK A;  2GU4 A;  2GU5 A;  4IDY A;  5JFR A;  5CNX A;  1YVM A;  2P98 A;  2BWW A;  4RZY A;  5D6E A;  1YW8 A;  2B3H A;  2GG8 A;  1BN5 A;  1WL9 A;  5JHU A;  2P9A A;  2BWU A;  4JUQ A;  1C24 A;  2GU6 A;  2GTX A;  2B3K A;  3MR1 A;  1BOA A;  4S01 A;  4IEC A;  1YW9 A;  2V6C A;  3IU9 A;  1W7V A;  1R5G A;  3FMQ A;  4KM3 A;  4FLK A;  1Y1N A;  1QXY A;  2BN7 A;  3BIP A;  3D27 A;  4FKC A;  1XGS A;  4U1B A;  3MAT A;  2Q95 A;  4FO8 A;  2GU7 A;  4ZWU A;  1B59 A;  2B3L A;  1A16 A;  2G6P A;  2BHB A;  2Q93 A;  5FCH A;  2Q92 A;  2BWY A;  2OKN A;  2EVO A;  5FCF A;  3PKA A;  3RVA A;  2GG5 A;  1PV9 A;  2NQ7 A;  3CB6 A;  4MAT A;  4ZWP A;  1QZY A;  1KQ0 A;  1R5H A;  3PKC A;  4IKT A;  2BHC A;  4IF7 A;  4S2R P;  5JI6 A;  3PKE A;  3PKB A;  1XGN A;  2GG3 A;  4B28 A;  2Q94 A;  4U75 A;  5CE6 A;  4U69 A;  4RZZ A;  4ZNG A;  3BIQ A;  1QXZ A;  4S00 A;  3FMR A;  4ZWO A;  4U73 A;  1O0X A;  4PV4 A;  1B6A A;  4U6Z A;  4U70 A;  2V3Z A;  1W2M A;  2ZSG A;  3L24 A;  4A6V A;  1C21 A;  4U6C A;  5CLS A;  2BWT A;  1XGM A;  2HOW A;  3BIT A;  3IU8 A;  4OOK A;  4U6J A;  3TB5 A;  3MX6 A;  1C23 A;  3Q6D A;  4HXX A;  3S6B A;  2P99 A;  4U6W A;  3ROR A;  2GG2 A;  4IKU A;  2MAT A;  4IPA A;  1YJ3 A;  2GG9 A;  4PNC A;  2Q8K A;  2V3X A;  4IKS A;  1C27 A;  1MAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...