4IKRA

Crystal structure of type 1 human methionine aminopeptidase in complex with 2-(4-(5-chloro-6-methyl-2-(pyridin-2-yl)pyrimidin-4-yl)piperazin-1-yl)ethanol
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification, Biochemical and Structural Evaluation of Species-Specific Inhibitors against Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 101
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4ikrA00
3IU8A 3MX6A 4U1BA 4RZYA 2Q8KA 4IU6A 1BOAA 1N51A 1QZYA 2BH3A 2GU7A 4FLIA 1W7VA 2Q93A 1B59A 2V3XA 3BIQA 4U6CA 4ZNGA 4U70A 3TB5A 2P98A 4FLLA 2EA2A 2BHAA 1WN1A 2G6PA 1QXZA 4IPAA 3BITA 4QR8A 1XGMA 2GU4A 3CB5A 4A6WA 1B6AA 2BWXA 2EA4A 1CHMA 1XGOA 1BN5A 2IW2A 2ADUA 4IECA 1Y1NA 5FCHA 1YW7A 4U75A 4IDYA 2GG0A 2DFIA 4S01A 4OOKA 1WL9A 3RVAA 1R58A 5CNXA 4R60A 4U69A 2GG3A 4U6EA 4U71A 5CDEA 1WL6A 5CE6A 3PKEA 4ZWPA 3CB6A 1R5GA 1YW8A 1C21A 1KQ9A 1XNZA 1WBQA 1YVMA 3IU9A 1QXYA 3IG4A 1KP0A 4FLJA 5E5BA 4FUKA 3FMRA 1C22A 2BWVA 2GG9A 4IKUA 2BHCA 1C24A 2BWTA 1JAWA 1XGSA 2BWSA 3PKBA 4RGZ1 2MATA 2BN7A 5JFRA 5JHUA 2GG2A 5D6FA 1QXWA 2OKNA 4U76A 2EVOA 1A16A 4IF7A 2B3LA 3TAVA 4FLKA 4U6JA 5CIKA 4U73A 3MR1A 3PKAA 3S6BA 4EGEA 5CDLA 2B3KA 4JUQA 4FO8A 4FKCA 4IKRA 2GG8A 2OAZA 2Q96A 2GTXA 2P9AA 4FO7A 2BHDA 3BIPA 2BWWA 2GGCA 3PKDA 2HOWA 2V6CA 1WKMA 4A6VA 4U6ZA 1C23A 4KM3A 2BHBA 2NQ7A 4ZWUA 2BWYA 2ZSGA 4Z7MA 1KQ0A 2NQ6A 3MATA 3CTZA 2V3ZA 1YJ3A 3D27A 3Q6DA 1C27A 4PV4A 2GG5A 1M35A 2GZ5A 3FMQA 5CLSA 3PKCA 1W2MA 3L7GA 4S00A 1YW9A 2V3YA 1WLRA 4IKSA 3IU7A 3L24A 4S2RP 5JI6A 2B3HA 2GGBA 4IKTA 2P99A 5FCFA 2BB7A 3RORA 2EVMA 4S2TP 5CDVA 5D6EA 2GA2A 2BWUA 1XGNA 2GU5A 4HXXA 4B28A 2GG7A 4U6WA 4PNCA 1PV9A 1MATA 3FM3A 4MATA 2Q94A 2Q92A 1R5HA 2Q95A 4RZZA 1WY2A 2GU6A 1O0XA 4ZWOA 2EVCA
chains in the Genus database with same CATH superfamily
3IU8A 3MX6A 4U1BA 4RZYA 2Q8KA 4IU6A 1BOAA 1N51A 1QZYA 2BH3A 2GU7A 4FLIA 1W7VA 2Q93A 1B59A 2V3XA 3BIQA 4U6CA 4ZNGA 4U70A 3TB5A 2P98A 4FLLA 2EA2A 2BHAA 1WN1A 2G6PA 1QXZA 4IPAA 3BITA 4QR8A 1XGMA 2GU4A 3CB5A 4A6WA 1B6AA 2BWXA 2EA4A 1CHMA 1XGOA 1BN5A 2IW2A 2ADUA 4IECA 1Y1NA 5FCHA 1YW7A 4U75A 4IDYA 2GG0A 2DFIA 4S01A 4OOKA 1WL9A 3RVAA 1R58A 5CNXA 4R60A 4U69A 2GG3A 4U6EA 4U71A 5CDEA 1WL6A 5CE6A 3PKEA 4ZWPA 3CB6A 1R5GA 1YW8A 1C21A 1KQ9A 1XNZA 1WBQA 1YVMA 3IU9A 1QXYA 3IG4A 1KP0A 4FLJA 5E5BA 4FUKA 3FMRA 1C22A 2BWVA 2GG9A 4IKUA 2BHCA 1C24A 2BWTA 1JAWA 1XGSA 2BWSA 3PKBA 4RGZ1 2MATA 2BN7A 5JFRA 5JHUA 2GG2A 5D6FA 1QXWA 2OKNA 4U76A 2EVOA 1A16A 4IF7A 2B3LA 3TAVA 4FLKA 4U6JA 5CIKA 4U73A 3MR1A 3PKAA 3S6BA 4EGEA 5CDLA 2B3KA 4JUQA 4FO8A 4FKCA 4IKRA 2GG8A 2OAZA 2Q96A 2GTXA 2P9AA 4FO7A 2BHDA 3BIPA 2BWWA 2GGCA 3PKDA 2HOWA 2V6CA 1WKMA 4A6VA 4U6ZA 1C23A 4KM3A 2BHBA 2NQ7A 4ZWUA 2BWYA 2ZSGA 4Z7MA 1KQ0A 2NQ6A 3MATA 3CTZA 2V3ZA 1YJ3A 3D27A 3Q6DA 1C27A 4PV4A 2GG5A 1M35A 2GZ5A 3FMQA 5CLSA 3PKCA 1W2MA 3L7GA 4S00A 1YW9A 2V3YA 1WLRA 4IKSA 3IU7A 3L24A 4S2RP 5JI6A 2B3HA 2GGBA 4IKTA 2P99A 5FCFA 2BB7A 3RORA 2EVMA 4S2TP 5CDVA 5D6EA 2GA2A 2BWUA 1XGNA 2GU5A 4HXXA 4B28A 2GG7A 4U6WA 4PNCA 1PV9A 1MATA 3FM3A 4MATA 2Q94A 2Q92A 1R5HA 2Q95A 4RZZA 1WY2A 2GU6A 1O0XA 4ZWOA 2EVCA
chains in the Genus database with same CATH topology
3IU8A 3MX6A 4U1BA 4RZYA 2Q8KA 4IU6A 1BOAA 1N51A 1QZYA 2BH3A 2GU7A 4FLIA 1W7VA 2Q93A 1B59A 2V3XA 3BIQA 4U6CA 4ZNGA 4U70A 3TB5A 2P98A 4FLLA 2EA2A 2BHAA 1WN1A 2G6PA 1QXZA 4IPAA 3BITA 4QR8A 1XGMA 2GU4A 3CB5A 4A6WA 1B6AA 2BWXA 2EA4A 1CHMA 1XGOA 1BN5A 2IW2A 2ADUA 4IECA 1Y1NA 5FCHA 1YW7A 4U75A 4IDYA 2GG0A 2DFIA 4S01A 4OOKA 1WL9A 3RVAA 1R58A 5CNXA 4R60A 4U69A 2GG3A 4U6EA 4U71A 5CDEA 1WL6A 5CE6A 3PKEA 4ZWPA 3CB6A 1R5GA 1YW8A 1C21A 1KQ9A 1XNZA 1WBQA 1YVMA 3IU9A 1QXYA 3IG4A 1KP0A 4FLJA 5E5BA 4FUKA 3FMRA 1C22A 2BWVA 2GG9A 4IKUA 2BHCA 1C24A 2BWTA 1JAWA 1XGSA 2BWSA 3PKBA 4RGZ1 2MATA 2BN7A 5JFRA 5JHUA 2GG2A 5D6FA 1QXWA 2OKNA 4U76A 2EVOA 1A16A 4IF7A 2B3LA 3TAVA 4FLKA 4U6JA 5CIKA 4U73A 3MR1A 3PKAA 3S6BA 4EGEA 5CDLA 2B3KA 4JUQA 4FO8A 4FKCA 4IKRA 2GG8A 2OAZA 2Q96A 2GTXA 2P9AA 4FO7A 2BHDA 3BIPA 2BWWA 2GGCA 3PKDA 2HOWA 2V6CA 1WKMA 4A6VA 4U6ZA 1C23A 4KM3A 2BHBA 2NQ7A 4ZWUA 2BWYA 2ZSGA 4Z7MA 1KQ0A 2NQ6A 3MATA 3CTZA 2V3ZA 1YJ3A 3D27A 3Q6DA 1C27A 4PV4A 2GG5A 1M35A 2GZ5A 3FMQA 5CLSA 3PKCA 1W2MA 3L7GA 4S00A 1YW9A 2V3YA 1WLRA 4IKSA 3IU7A 3L24A 4S2RP 5JI6A 2B3HA 2GGBA 4IKTA 2P99A 5FCFA 2BB7A 3RORA 2EVMA 4S2TP 5CDVA 5D6EA 2GA2A 2BWUA 1XGNA 2GU5A 4HXXA 4B28A 2GG7A 4U6WA 4PNCA 1PV9A 1MATA 3FM3A 4MATA 2Q94A 2Q92A 1R5HA 2Q95A 4RZZA 1WY2A 2GU6A 1O0XA 4ZWOA 2EVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IU8 A;  3MX6 A;  4U1B A;  4RZY A;  2Q8K A;  4IU6 A;  1BOA A;  1N51 A;  1QZY A;  2BH3 A;  2GU7 A;  4FLI A;  1W7V A;  2Q93 A;  1B59 A;  2V3X A;  3BIQ A;  4U6C A;  4ZNG A;  4U70 A;  3TB5 A;  2P98 A;  4FLL A;  2EA2 A;  2BHA A;  1WN1 A;  2G6P A;  1QXZ A;  4IPA A;  3BIT A;  4QR8 A;  1XGM A;  2GU4 A;  3CB5 A;  4A6W A;  1B6A A;  2BWX A;  2EA4 A;  1CHM A;  1XGO A;  1BN5 A;  2IW2 A;  2ADU A;  4IEC A;  1Y1N A;  5FCH A;  1YW7 A;  4U75 A;  4IDY A;  2GG0 A;  2DFI A;  4S01 A;  4OOK A;  1WL9 A;  3RVA A;  1R58 A;  5CNX A;  4R60 A;  4U69 A;  2GG3 A;  4U6E A;  4U71 A;  5CDE A;  1WL6 A;  5CE6 A;  3PKE A;  4ZWP A;  3CB6 A;  1R5G A;  1YW8 A;  1C21 A;  1KQ9 A;  1XNZ A;  1WBQ A;  1YVM A;  3IU9 A;  1QXY A;  3IG4 A;  1KP0 A;  4FLJ A;  5E5B A;  4FUK A;  3FMR A;  1C22 A;  2BWV A;  2GG9 A;  4IKU A;  2BHC A;  1C24 A;  2BWT A;  1JAW A;  1XGS A;  2BWS A;  3PKB A;  4RGZ 1;  2MAT A;  2BN7 A;  5JFR A;  5JHU A;  2GG2 A;  5D6F A;  1QXW A;  2OKN A;  4U76 A;  2EVO A;  1A16 A;  4IF7 A;  2B3L A;  3TAV A;  4FLK A;  4U6J A;  5CIK A;  4U73 A;  3MR1 A;  3PKA A;  3S6B A;  4EGE A;  5CDL A;  2B3K A;  4JUQ A;  4FO8 A;  4FKC A;  4IKR A;  2GG8 A;  2OAZ A;  2Q96 A;  2GTX A;  2P9A A;  4FO7 A;  2BHD A;  3BIP A;  2BWW A;  2GGC A;  3PKD A;  2HOW A;  2V6C A;  1WKM A;  4A6V A;  4U6Z A;  1C23 A;  4KM3 A;  2BHB A;  2NQ7 A;  4ZWU A;  2BWY A;  2ZSG A;  4Z7M A;  1KQ0 A;  2NQ6 A;  3MAT A;  3CTZ A;  2V3Z A;  1YJ3 A;  3D27 A;  3Q6D A;  1C27 A;  4PV4 A;  2GG5 A;  1M35 A;  2GZ5 A;  3FMQ A;  5CLS A;  3PKC A;  1W2M A;  3L7G A;  4S00 A;  1YW9 A;  2V3Y A;  1WLR A;  4IKS A;  3IU7 A;  3L24 A;  4S2R P;  5JI6 A;  2B3H A;  2GGB A;  4IKT A;  2P99 A;  5FCF A;  2BB7 A;  3ROR A;  2EVM A;  4S2T P;  5CDV A;  5D6E A;  2GA2 A;  2BWU A;  1XGN A;  2GU5 A;  4HXX A;  4B28 A;  2GG7 A;  4U6W A;  4PNC A;  1PV9 A;  1MAT A;  3FM3 A;  4MAT A;  2Q94 A;  2Q92 A;  1R5H A;  2Q95 A;  4RZZ A;  1WY2 A;  2GU6 A;  1O0X A;  4ZWO A;  2EVC A; 
#chains in the Genus database with same CATH topology
 3IU8 A;  3MX6 A;  4U1B A;  4RZY A;  2Q8K A;  4IU6 A;  1BOA A;  1N51 A;  1QZY A;  2BH3 A;  2GU7 A;  4FLI A;  1W7V A;  2Q93 A;  1B59 A;  2V3X A;  3BIQ A;  4U6C A;  4ZNG A;  4U70 A;  3TB5 A;  2P98 A;  4FLL A;  2EA2 A;  2BHA A;  1WN1 A;  2G6P A;  1QXZ A;  4IPA A;  3BIT A;  4QR8 A;  1XGM A;  2GU4 A;  3CB5 A;  4A6W A;  1B6A A;  2BWX A;  2EA4 A;  1CHM A;  1XGO A;  1BN5 A;  2IW2 A;  2ADU A;  4IEC A;  1Y1N A;  5FCH A;  1YW7 A;  4U75 A;  4IDY A;  2GG0 A;  2DFI A;  4S01 A;  4OOK A;  1WL9 A;  3RVA A;  1R58 A;  5CNX A;  4R60 A;  4U69 A;  2GG3 A;  4U6E A;  4U71 A;  5CDE A;  1WL6 A;  5CE6 A;  3PKE A;  4ZWP A;  3CB6 A;  1R5G A;  1YW8 A;  1C21 A;  1KQ9 A;  1XNZ A;  1WBQ A;  1YVM A;  3IU9 A;  1QXY A;  3IG4 A;  1KP0 A;  4FLJ A;  5E5B A;  4FUK A;  3FMR A;  1C22 A;  2BWV A;  2GG9 A;  4IKU A;  2BHC A;  1C24 A;  2BWT A;  1JAW A;  1XGS A;  2BWS A;  3PKB A;  4RGZ 1;  2MAT A;  2BN7 A;  5JFR A;  5JHU A;  2GG2 A;  5D6F A;  1QXW A;  2OKN A;  4U76 A;  2EVO A;  1A16 A;  4IF7 A;  2B3L A;  3TAV A;  4FLK A;  4U6J A;  5CIK A;  4U73 A;  3MR1 A;  3PKA A;  3S6B A;  4EGE A;  5CDL A;  2B3K A;  4JUQ A;  4FO8 A;  4FKC A;  4IKR A;  2GG8 A;  2OAZ A;  2Q96 A;  2GTX A;  2P9A A;  4FO7 A;  2BHD A;  3BIP A;  2BWW A;  2GGC A;  3PKD A;  2HOW A;  2V6C A;  1WKM A;  4A6V A;  4U6Z A;  1C23 A;  4KM3 A;  2BHB A;  2NQ7 A;  4ZWU A;  2BWY A;  2ZSG A;  4Z7M A;  1KQ0 A;  2NQ6 A;  3MAT A;  3CTZ A;  2V3Z A;  1YJ3 A;  3D27 A;  3Q6D A;  1C27 A;  4PV4 A;  2GG5 A;  1M35 A;  2GZ5 A;  3FMQ A;  5CLS A;  3PKC A;  1W2M A;  3L7G A;  4S00 A;  1YW9 A;  2V3Y A;  1WLR A;  4IKS A;  3IU7 A;  3L24 A;  4S2R P;  5JI6 A;  2B3H A;  2GGB A;  4IKT A;  2P99 A;  5FCF A;  2BB7 A;  3ROR A;  2EVM A;  4S2T P;  5CDV A;  5D6E A;  2GA2 A;  2BWU A;  1XGN A;  2GU5 A;  4HXX A;  4B28 A;  2GG7 A;  4U6W A;  4PNC A;  1PV9 A;  1MAT A;  3FM3 A;  4MAT A;  2Q94 A;  2Q92 A;  1R5H A;  2Q95 A;  4RZZ A;  1WY2 A;  2GU6 A;  1O0X A;  4ZWO A;  2EVC A; 
#chains in the Genus database with same CATH homology
 3IU8 A;  3MX6 A;  4U1B A;  4RZY A;  2Q8K A;  4IU6 A;  1BOA A;  1N51 A;  1QZY A;  2BH3 A;  2GU7 A;  4FLI A;  1W7V A;  2Q93 A;  1B59 A;  2V3X A;  3BIQ A;  4U6C A;  4ZNG A;  4U70 A;  3TB5 A;  2P98 A;  4FLL A;  2EA2 A;  2BHA A;  1WN1 A;  2G6P A;  1QXZ A;  4IPA A;  3BIT A;  4QR8 A;  1XGM A;  2GU4 A;  3CB5 A;  4A6W A;  1B6A A;  2BWX A;  2EA4 A;  1CHM A;  1XGO A;  1BN5 A;  2IW2 A;  2ADU A;  4IEC A;  1Y1N A;  5FCH A;  1YW7 A;  4U75 A;  4IDY A;  2GG0 A;  2DFI A;  4S01 A;  4OOK A;  1WL9 A;  3RVA A;  1R58 A;  5CNX A;  4R60 A;  4U69 A;  2GG3 A;  4U6E A;  4U71 A;  5CDE A;  1WL6 A;  5CE6 A;  3PKE A;  4ZWP A;  3CB6 A;  1R5G A;  1YW8 A;  1C21 A;  1KQ9 A;  1XNZ A;  1WBQ A;  1YVM A;  3IU9 A;  1QXY A;  3IG4 A;  1KP0 A;  4FLJ A;  5E5B A;  4FUK A;  3FMR A;  1C22 A;  2BWV A;  2GG9 A;  4IKU A;  2BHC A;  1C24 A;  2BWT A;  1JAW A;  1XGS A;  2BWS A;  3PKB A;  4RGZ 1;  2MAT A;  2BN7 A;  5JFR A;  5JHU A;  2GG2 A;  5D6F A;  1QXW A;  2OKN A;  4U76 A;  2EVO A;  1A16 A;  4IF7 A;  2B3L A;  3TAV A;  4FLK A;  4U6J A;  5CIK A;  4U73 A;  3MR1 A;  3PKA A;  3S6B A;  4EGE A;  5CDL A;  2B3K A;  4JUQ A;  4FO8 A;  4FKC A;  4IKR A;  2GG8 A;  2OAZ A;  2Q96 A;  2GTX A;  2P9A A;  4FO7 A;  2BHD A;  3BIP A;  2BWW A;  2GGC A;  3PKD A;  2HOW A;  2V6C A;  1WKM A;  4A6V A;  4U6Z A;  1C23 A;  4KM3 A;  2BHB A;  2NQ7 A;  4ZWU A;  2BWY A;  2ZSG A;  4Z7M A;  1KQ0 A;  2NQ6 A;  3MAT A;  3CTZ A;  2V3Z A;  1YJ3 A;  3D27 A;  3Q6D A;  1C27 A;  4PV4 A;  2GG5 A;  1M35 A;  2GZ5 A;  3FMQ A;  5CLS A;  3PKC A;  1W2M A;  3L7G A;  4S00 A;  1YW9 A;  2V3Y A;  1WLR A;  4IKS A;  3IU7 A;  3L24 A;  4S2R P;  5JI6 A;  2B3H A;  2GGB A;  4IKT A;  2P99 A;  5FCF A;  2BB7 A;  3ROR A;  2EVM A;  4S2T P;  5CDV A;  5D6E A;  2GA2 A;  2BWU A;  1XGN A;  2GU5 A;  4HXX A;  4B28 A;  2GG7 A;  4U6W A;  4PNC A;  1PV9 A;  1MAT A;  3FM3 A;  4MAT A;  2Q94 A;  2Q92 A;  1R5H A;  2Q95 A;  4RZZ A;  1WY2 A;  2GU6 A;  1O0X A;  4ZWO A;  2EVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...