4IKRA

Crystal structure of type 1 human methionine aminopeptidase in complex with 2-(4-(5-chloro-6-methyl-2-(pyridin-2-yl)pyrimidin-4-yl)piperazin-1-yl)ethanol
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification, Biochemical and Structural Evaluation of Species-Specific Inhibitors against Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 101
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4ikrA00
1QZYA 1XGSA 3IG4A 4RZYA 4RGZ1 2Q93A 2GG8A 2GG2A 1CHMA 4U6EA 1XGOA 1YJ3A 1WL9A 3PKBA 2BWVA 2EVCA 3TB5A 1BOAA 4U76A 4IKRA 3PKAA 1Y1NA 2BN7A 1C22A 4U1BA 1W7VA 5CDLA 1XGNA 4FUKA 2IW2A 2GU7A 3IU8A 1C23A 1KP0A 1YW7A 5JI6A 2ADUA 2BWXA 4ZWOA 4U71A 1O0XA 2NQ7A 4PNCA 4IPAA 5D6FA 2BWUA 1XGMA 1WL6A 4MATA 1C24A 4U70A 2HOWA 5CLSA 2BWSA 1WY2A 3PKEA 4U6CA 1R58A 2BWTA 1JAWA 3BIPA 2B3KA 3L7GA 3IU7A 5CDEA 2EA4A 2GG7A 4S00A 5FCFA 1N51A 2EVOA 1YVMA 1B6AA 1A16A 4FLJA 3RORA 2ZSGA 4S01A 2BH3A 1C21A 4JUQA 4Z7MA 2DFIA 1WLRA 3CB5A 4IDYA 2V3XA 1BN5A 2GG9A 2BWYA 5JFRA 4B28A 2G6PA 2BHAA 2P9AA 2V3ZA 3FMQA 3PKDA 4HXXA 1W2MA 4U69A 5E5BA 1QXYA 2BHDA 2OAZA 3RVAA 4OOKA 4U6ZA 3FMRA 5JHUA 3Q6DA 1M35A 2BWWA 4KM3A 2V3YA 2OKNA 1YW8A 2GU4A 3TAVA 2GGCA 4IKTA 4ZNGA 1MATA 2P98A 2GG3A 5CNXA 2BHCA 4A6VA 4PV4A 4U6JA 3BIQA 3IU9A 5FCHA 2GZ5A 1QXZA 4ZWPA 2B3LA 4EGEA 1B59A 4U6WA 1WBQA 5CE6A 2GG0A 3L24A 1WKMA 2GA2A 3CTZA 2GU6A 1KQ0A 2GTXA 1XNZA 4FLKA 4RZZA 4S2RP 4U75A 4ZWUA 4IF7A 3CB6A 3MX6A 4U73A 1QXWA 3FM3A 3PKCA 3S6BA 2NQ6A 2GU5A 4FO7A 1R5HA 3BITA 4IKUA 1PV9A 2Q95A 1YW9A 4FO8A 4FLIA 3D27A 2BHBA 3MR1A 5D6EA 2P99A 4R60A 2Q94A 4A6WA 4FLLA 1R5GA 3MATA 5CIKA 2BB7A 2EA2A 4IKSA 4QR8A 1WN1A 2Q96A 2V6CA 2GG5A 4FKCA 4IECA 5CDVA 1KQ9A 2EVMA 4S2TP 2MATA 4IU6A 2B3HA 2GGBA 1C27A 2Q92A 2Q8KA
chains in the Genus database with same CATH superfamily
1QZYA 1XGSA 3IG4A 4RZYA 4RGZ1 2Q93A 2GG8A 2GG2A 1CHMA 4U6EA 1XGOA 1YJ3A 1WL9A 3PKBA 2BWVA 2EVCA 3TB5A 1BOAA 4U76A 4IKRA 3PKAA 1Y1NA 2BN7A 1C22A 4U1BA 1W7VA 5CDLA 1XGNA 4FUKA 2IW2A 2GU7A 3IU8A 1C23A 1KP0A 1YW7A 5JI6A 2ADUA 2BWXA 4ZWOA 4U71A 1O0XA 2NQ7A 4PNCA 4IPAA 5D6FA 2BWUA 1XGMA 1WL6A 4MATA 1C24A 4U70A 2HOWA 5CLSA 2BWSA 1WY2A 3PKEA 4U6CA 1R58A 2BWTA 1JAWA 3BIPA 2B3KA 3L7GA 3IU7A 5CDEA 2EA4A 2GG7A 4S00A 5FCFA 1N51A 2EVOA 1YVMA 1B6AA 1A16A 4FLJA 3RORA 2ZSGA 4S01A 2BH3A 1C21A 4JUQA 4Z7MA 2DFIA 1WLRA 3CB5A 4IDYA 2V3XA 1BN5A 2GG9A 2BWYA 5JFRA 4B28A 2G6PA 2BHAA 2P9AA 2V3ZA 3FMQA 3PKDA 4HXXA 1W2MA 4U69A 5E5BA 1QXYA 2BHDA 2OAZA 3RVAA 4OOKA 4U6ZA 3FMRA 5JHUA 3Q6DA 1M35A 2BWWA 4KM3A 2V3YA 2OKNA 1YW8A 2GU4A 3TAVA 2GGCA 4IKTA 4ZNGA 1MATA 2P98A 2GG3A 5CNXA 2BHCA 4A6VA 4PV4A 4U6JA 3BIQA 3IU9A 5FCHA 2GZ5A 1QXZA 4ZWPA 2B3LA 4EGEA 1B59A 4U6WA 1WBQA 5CE6A 2GG0A 3L24A 1WKMA 2GA2A 3CTZA 2GU6A 1KQ0A 2GTXA 1XNZA 4FLKA 4RZZA 4S2RP 4U75A 4ZWUA 4IF7A 3CB6A 3MX6A 4U73A 1QXWA 3FM3A 3PKCA 3S6BA 2NQ6A 2GU5A 4FO7A 1R5HA 3BITA 4IKUA 1PV9A 2Q95A 1YW9A 4FO8A 4FLIA 3D27A 2BHBA 3MR1A 5D6EA 2P99A 4R60A 2Q94A 4A6WA 4FLLA 1R5GA 3MATA 5CIKA 2BB7A 2EA2A 4IKSA 4QR8A 1WN1A 2Q96A 2V6CA 2GG5A 4FKCA 4IECA 5CDVA 1KQ9A 2EVMA 4S2TP 2MATA 4IU6A 2B3HA 2GGBA 1C27A 2Q92A 2Q8KA
chains in the Genus database with same CATH topology
1QZYA 1XGSA 3IG4A 4RZYA 4RGZ1 2Q93A 2GG8A 2GG2A 1CHMA 4U6EA 1XGOA 1YJ3A 1WL9A 3PKBA 2BWVA 2EVCA 3TB5A 1BOAA 4U76A 4IKRA 3PKAA 1Y1NA 2BN7A 1C22A 4U1BA 1W7VA 5CDLA 1XGNA 4FUKA 2IW2A 2GU7A 3IU8A 1C23A 1KP0A 1YW7A 5JI6A 2ADUA 2BWXA 4ZWOA 4U71A 1O0XA 2NQ7A 4PNCA 4IPAA 5D6FA 2BWUA 1XGMA 1WL6A 4MATA 1C24A 4U70A 2HOWA 5CLSA 2BWSA 1WY2A 3PKEA 4U6CA 1R58A 2BWTA 1JAWA 3BIPA 2B3KA 3L7GA 3IU7A 5CDEA 2EA4A 2GG7A 4S00A 5FCFA 1N51A 2EVOA 1YVMA 1B6AA 1A16A 4FLJA 3RORA 2ZSGA 4S01A 2BH3A 1C21A 4JUQA 4Z7MA 2DFIA 1WLRA 3CB5A 4IDYA 2V3XA 1BN5A 2GG9A 2BWYA 5JFRA 4B28A 2G6PA 2BHAA 2P9AA 2V3ZA 3FMQA 3PKDA 4HXXA 1W2MA 4U69A 5E5BA 1QXYA 2BHDA 2OAZA 3RVAA 4OOKA 4U6ZA 3FMRA 5JHUA 3Q6DA 1M35A 2BWWA 4KM3A 2V3YA 2OKNA 1YW8A 2GU4A 3TAVA 2GGCA 4IKTA 4ZNGA 1MATA 2P98A 2GG3A 5CNXA 2BHCA 4A6VA 4PV4A 4U6JA 3BIQA 3IU9A 5FCHA 2GZ5A 1QXZA 4ZWPA 2B3LA 4EGEA 1B59A 4U6WA 1WBQA 5CE6A 2GG0A 3L24A 1WKMA 2GA2A 3CTZA 2GU6A 1KQ0A 2GTXA 1XNZA 4FLKA 4RZZA 4S2RP 4U75A 4ZWUA 4IF7A 3CB6A 3MX6A 4U73A 1QXWA 3FM3A 3PKCA 3S6BA 2NQ6A 2GU5A 4FO7A 1R5HA 3BITA 4IKUA 1PV9A 2Q95A 1YW9A 4FO8A 4FLIA 3D27A 2BHBA 3MR1A 5D6EA 2P99A 4R60A 2Q94A 4A6WA 4FLLA 1R5GA 3MATA 5CIKA 2BB7A 2EA2A 4IKSA 4QR8A 1WN1A 2Q96A 2V6CA 2GG5A 4FKCA 4IECA 5CDVA 1KQ9A 2EVMA 4S2TP 2MATA 4IU6A 2B3HA 2GGBA 1C27A 2Q92A 2Q8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZY A;  1XGS A;  3IG4 A;  4RZY A;  4RGZ 1;  2Q93 A;  2GG8 A;  2GG2 A;  1CHM A;  4U6E A;  1XGO A;  1YJ3 A;  1WL9 A;  3PKB A;  2BWV A;  2EVC A;  3TB5 A;  1BOA A;  4U76 A;  4IKR A;  3PKA A;  1Y1N A;  2BN7 A;  1C22 A;  4U1B A;  1W7V A;  5CDL A;  1XGN A;  4FUK A;  2IW2 A;  2GU7 A;  3IU8 A;  1C23 A;  1KP0 A;  1YW7 A;  5JI6 A;  2ADU A;  2BWX A;  4ZWO A;  4U71 A;  1O0X A;  2NQ7 A;  4PNC A;  4IPA A;  5D6F A;  2BWU A;  1XGM A;  1WL6 A;  4MAT A;  1C24 A;  4U70 A;  2HOW A;  5CLS A;  2BWS A;  1WY2 A;  3PKE A;  4U6C A;  1R58 A;  2BWT A;  1JAW A;  3BIP A;  2B3K A;  3L7G A;  3IU7 A;  5CDE A;  2EA4 A;  2GG7 A;  4S00 A;  5FCF A;  1N51 A;  2EVO A;  1YVM A;  1B6A A;  1A16 A;  4FLJ A;  3ROR A;  2ZSG A;  4S01 A;  2BH3 A;  1C21 A;  4JUQ A;  4Z7M A;  2DFI A;  1WLR A;  3CB5 A;  4IDY A;  2V3X A;  1BN5 A;  2GG9 A;  2BWY A;  5JFR A;  4B28 A;  2G6P A;  2BHA A;  2P9A A;  2V3Z A;  3FMQ A;  3PKD A;  4HXX A;  1W2M A;  4U69 A;  5E5B A;  1QXY A;  2BHD A;  2OAZ A;  3RVA A;  4OOK A;  4U6Z A;  3FMR A;  5JHU A;  3Q6D A;  1M35 A;  2BWW A;  4KM3 A;  2V3Y A;  2OKN A;  1YW8 A;  2GU4 A;  3TAV A;  2GGC A;  4IKT A;  4ZNG A;  1MAT A;  2P98 A;  2GG3 A;  5CNX A;  2BHC A;  4A6V A;  4PV4 A;  4U6J A;  3BIQ A;  3IU9 A;  5FCH A;  2GZ5 A;  1QXZ A;  4ZWP A;  2B3L A;  4EGE A;  1B59 A;  4U6W A;  1WBQ A;  5CE6 A;  2GG0 A;  3L24 A;  1WKM A;  2GA2 A;  3CTZ A;  2GU6 A;  1KQ0 A;  2GTX A;  1XNZ A;  4FLK A;  4RZZ A;  4S2R P;  4U75 A;  4ZWU A;  4IF7 A;  3CB6 A;  3MX6 A;  4U73 A;  1QXW A;  3FM3 A;  3PKC A;  3S6B A;  2NQ6 A;  2GU5 A;  4FO7 A;  1R5H A;  3BIT A;  4IKU A;  1PV9 A;  2Q95 A;  1YW9 A;  4FO8 A;  4FLI A;  3D27 A;  2BHB A;  3MR1 A;  5D6E A;  2P99 A;  4R60 A;  2Q94 A;  4A6W A;  4FLL A;  1R5G A;  3MAT A;  5CIK A;  2BB7 A;  2EA2 A;  4IKS A;  4QR8 A;  1WN1 A;  2Q96 A;  2V6C A;  2GG5 A;  4FKC A;  4IEC A;  5CDV A;  1KQ9 A;  2EVM A;  4S2T P;  2MAT A;  4IU6 A;  2B3H A;  2GGB A;  1C27 A;  2Q92 A;  2Q8K A; 
#chains in the Genus database with same CATH topology
 1QZY A;  1XGS A;  3IG4 A;  4RZY A;  4RGZ 1;  2Q93 A;  2GG8 A;  2GG2 A;  1CHM A;  4U6E A;  1XGO A;  1YJ3 A;  1WL9 A;  3PKB A;  2BWV A;  2EVC A;  3TB5 A;  1BOA A;  4U76 A;  4IKR A;  3PKA A;  1Y1N A;  2BN7 A;  1C22 A;  4U1B A;  1W7V A;  5CDL A;  1XGN A;  4FUK A;  2IW2 A;  2GU7 A;  3IU8 A;  1C23 A;  1KP0 A;  1YW7 A;  5JI6 A;  2ADU A;  2BWX A;  4ZWO A;  4U71 A;  1O0X A;  2NQ7 A;  4PNC A;  4IPA A;  5D6F A;  2BWU A;  1XGM A;  1WL6 A;  4MAT A;  1C24 A;  4U70 A;  2HOW A;  5CLS A;  2BWS A;  1WY2 A;  3PKE A;  4U6C A;  1R58 A;  2BWT A;  1JAW A;  3BIP A;  2B3K A;  3L7G A;  3IU7 A;  5CDE A;  2EA4 A;  2GG7 A;  4S00 A;  5FCF A;  1N51 A;  2EVO A;  1YVM A;  1B6A A;  1A16 A;  4FLJ A;  3ROR A;  2ZSG A;  4S01 A;  2BH3 A;  1C21 A;  4JUQ A;  4Z7M A;  2DFI A;  1WLR A;  3CB5 A;  4IDY A;  2V3X A;  1BN5 A;  2GG9 A;  2BWY A;  5JFR A;  4B28 A;  2G6P A;  2BHA A;  2P9A A;  2V3Z A;  3FMQ A;  3PKD A;  4HXX A;  1W2M A;  4U69 A;  5E5B A;  1QXY A;  2BHD A;  2OAZ A;  3RVA A;  4OOK A;  4U6Z A;  3FMR A;  5JHU A;  3Q6D A;  1M35 A;  2BWW A;  4KM3 A;  2V3Y A;  2OKN A;  1YW8 A;  2GU4 A;  3TAV A;  2GGC A;  4IKT A;  4ZNG A;  1MAT A;  2P98 A;  2GG3 A;  5CNX A;  2BHC A;  4A6V A;  4PV4 A;  4U6J A;  3BIQ A;  3IU9 A;  5FCH A;  2GZ5 A;  1QXZ A;  4ZWP A;  2B3L A;  4EGE A;  1B59 A;  4U6W A;  1WBQ A;  5CE6 A;  2GG0 A;  3L24 A;  1WKM A;  2GA2 A;  3CTZ A;  2GU6 A;  1KQ0 A;  2GTX A;  1XNZ A;  4FLK A;  4RZZ A;  4S2R P;  4U75 A;  4ZWU A;  4IF7 A;  3CB6 A;  3MX6 A;  4U73 A;  1QXW A;  3FM3 A;  3PKC A;  3S6B A;  2NQ6 A;  2GU5 A;  4FO7 A;  1R5H A;  3BIT A;  4IKU A;  1PV9 A;  2Q95 A;  1YW9 A;  4FO8 A;  4FLI A;  3D27 A;  2BHB A;  3MR1 A;  5D6E A;  2P99 A;  4R60 A;  2Q94 A;  4A6W A;  4FLL A;  1R5G A;  3MAT A;  5CIK A;  2BB7 A;  2EA2 A;  4IKS A;  4QR8 A;  1WN1 A;  2Q96 A;  2V6C A;  2GG5 A;  4FKC A;  4IEC A;  5CDV A;  1KQ9 A;  2EVM A;  4S2T P;  2MAT A;  4IU6 A;  2B3H A;  2GGB A;  1C27 A;  2Q92 A;  2Q8K A; 
#chains in the Genus database with same CATH homology
 1QZY A;  1XGS A;  3IG4 A;  4RZY A;  4RGZ 1;  2Q93 A;  2GG8 A;  2GG2 A;  1CHM A;  4U6E A;  1XGO A;  1YJ3 A;  1WL9 A;  3PKB A;  2BWV A;  2EVC A;  3TB5 A;  1BOA A;  4U76 A;  4IKR A;  3PKA A;  1Y1N A;  2BN7 A;  1C22 A;  4U1B A;  1W7V A;  5CDL A;  1XGN A;  4FUK A;  2IW2 A;  2GU7 A;  3IU8 A;  1C23 A;  1KP0 A;  1YW7 A;  5JI6 A;  2ADU A;  2BWX A;  4ZWO A;  4U71 A;  1O0X A;  2NQ7 A;  4PNC A;  4IPA A;  5D6F A;  2BWU A;  1XGM A;  1WL6 A;  4MAT A;  1C24 A;  4U70 A;  2HOW A;  5CLS A;  2BWS A;  1WY2 A;  3PKE A;  4U6C A;  1R58 A;  2BWT A;  1JAW A;  3BIP A;  2B3K A;  3L7G A;  3IU7 A;  5CDE A;  2EA4 A;  2GG7 A;  4S00 A;  5FCF A;  1N51 A;  2EVO A;  1YVM A;  1B6A A;  1A16 A;  4FLJ A;  3ROR A;  2ZSG A;  4S01 A;  2BH3 A;  1C21 A;  4JUQ A;  4Z7M A;  2DFI A;  1WLR A;  3CB5 A;  4IDY A;  2V3X A;  1BN5 A;  2GG9 A;  2BWY A;  5JFR A;  4B28 A;  2G6P A;  2BHA A;  2P9A A;  2V3Z A;  3FMQ A;  3PKD A;  4HXX A;  1W2M A;  4U69 A;  5E5B A;  1QXY A;  2BHD A;  2OAZ A;  3RVA A;  4OOK A;  4U6Z A;  3FMR A;  5JHU A;  3Q6D A;  1M35 A;  2BWW A;  4KM3 A;  2V3Y A;  2OKN A;  1YW8 A;  2GU4 A;  3TAV A;  2GGC A;  4IKT A;  4ZNG A;  1MAT A;  2P98 A;  2GG3 A;  5CNX A;  2BHC A;  4A6V A;  4PV4 A;  4U6J A;  3BIQ A;  3IU9 A;  5FCH A;  2GZ5 A;  1QXZ A;  4ZWP A;  2B3L A;  4EGE A;  1B59 A;  4U6W A;  1WBQ A;  5CE6 A;  2GG0 A;  3L24 A;  1WKM A;  2GA2 A;  3CTZ A;  2GU6 A;  1KQ0 A;  2GTX A;  1XNZ A;  4FLK A;  4RZZ A;  4S2R P;  4U75 A;  4ZWU A;  4IF7 A;  3CB6 A;  3MX6 A;  4U73 A;  1QXW A;  3FM3 A;  3PKC A;  3S6B A;  2NQ6 A;  2GU5 A;  4FO7 A;  1R5H A;  3BIT A;  4IKU A;  1PV9 A;  2Q95 A;  1YW9 A;  4FO8 A;  4FLI A;  3D27 A;  2BHB A;  3MR1 A;  5D6E A;  2P99 A;  4R60 A;  2Q94 A;  4A6W A;  4FLL A;  1R5G A;  3MAT A;  5CIK A;  2BB7 A;  2EA2 A;  4IKS A;  4QR8 A;  1WN1 A;  2Q96 A;  2V6C A;  2GG5 A;  4FKC A;  4IEC A;  5CDV A;  1KQ9 A;  2EVM A;  4S2T P;  2MAT A;  4IU6 A;  2B3H A;  2GGB A;  1C27 A;  2Q92 A;  2Q8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...