4IKRA

Crystal structure of type 1 human methionine aminopeptidase in complex with 2-(4-(5-chloro-6-methyl-2-(pyridin-2-yl)pyrimidin-4-yl)piperazin-1-yl)ethanol
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification, Biochemical and Structural Evaluation of Species-Specific Inhibitors against Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 101
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4ikrA00
1R5HA 2BHBA 1N51A 2GG3A 2G6PA 2BWWA 1C21A 1XGNA 4FLJA 1XNZA 3Q6DA 4RZYA 4FKCA 2B3LA 2GG7A 5CNXA 4B28A 2EVCA 2B3HA 4IU6A 5CDEA 2EA2A 4QR8A 1WL9A 2EA4A 1QZYA 4U6JA 1YW7A 4S2RP 4U6EA 2GU6A 2EVMA 1XGSA 2GG2A 2BN7A 4U75A 4IDYA 2BWVA 4KM3A 1W7VA 4U1BA 2BB7A 1R5GA 5FCFA 4U69A 4ZWPA 4RGZ1 1YW8A 2GG9A 4IECA 4EGEA 3PKEA 2B3KA 4U73A 4ZWUA 5JI6A 1WY2A 1W2MA 3MR1A 3CB5A 4U71A 3CTZA 2Q8KA 4HXXA 1Y1NA 2BWTA 2P98A 3IG4A 2BWSA 2P99A 4IKRA 2P9AA 4FUKA 4OOKA 2GTXA 3BITA 2OKNA 2GG0A 2GG8A 1B59A 4IKSA 1KP0A 2V3YA 3BIQA 3FMRA 5D6EA 1CHMA 4ZNGA 2GU5A 4A6WA 2V3XA 1XGMA 1M35A 3D27A 4FO8A 4U6WA 1YJ3A 4MATA 1BN5A 2DFIA 3RORA 4U70A 1C24A 2BWYA 5CE6A 4IPAA 1C23A 5CIKA 2Q96A 2MATA 3PKCA 4IKUA 4FO7A 1XGOA 5JHUA 5CLSA 1MATA 2V6CA 2GG5A 3FM3A 3CB6A 4ZWOA 1KQ0A 3PKBA 5JFRA 4FLKA 1QXZA 4IKTA 1R58A 4RZZA 2Q95A 2V3ZA 5CDLA 1WL6A 1BOAA 1WN1A 1C22A 2HOWA 3MX6A 4U6CA 1B6AA 4R60A 3S6BA 5CDVA 3IU9A 2GU4A 2BHDA 2ADUA 2OAZA 2BWUA 3PKAA 1PV9A 2Q94A 4PV4A 3RVAA 3BIPA 1QXYA 2BH3A 4PNCA 1A16A 1O0XA 3L24A 2GZ5A 3PKDA 4FLLA 4JUQA 3MATA 2GA2A 3FMQA 5D6FA 3TAVA 3TB5A 1WBQA 2IW2A 3IU7A 2NQ7A 2BWXA 1WLRA 2Q93A 2GGBA 2Q92A 2ZSGA 1C27A 2EVOA 1WKMA 4Z7MA 3L7GA 4S00A 4U76A 2GGCA 1QXWA 5FCHA 1YVMA 1KQ9A 3IU8A 4S01A 4U6ZA 5E5BA 2BHCA 4IF7A 4S2TP 2NQ6A 2GU7A 4A6VA 2BHAA 1JAWA 4FLIA 1YW9A
chains in the Genus database with same CATH superfamily
1R5HA 2BHBA 1N51A 2GG3A 2G6PA 2BWWA 1C21A 1XGNA 4FLJA 1XNZA 3Q6DA 4RZYA 4FKCA 2B3LA 2GG7A 5CNXA 4B28A 2EVCA 2B3HA 4IU6A 5CDEA 2EA2A 4QR8A 1WL9A 2EA4A 1QZYA 4U6JA 1YW7A 4S2RP 4U6EA 2GU6A 2EVMA 1XGSA 2GG2A 2BN7A 4U75A 4IDYA 2BWVA 4KM3A 1W7VA 4U1BA 2BB7A 1R5GA 5FCFA 4U69A 4ZWPA 4RGZ1 1YW8A 2GG9A 4IECA 4EGEA 3PKEA 2B3KA 4U73A 4ZWUA 5JI6A 1WY2A 1W2MA 3MR1A 3CB5A 4U71A 3CTZA 2Q8KA 4HXXA 1Y1NA 2BWTA 2P98A 3IG4A 2BWSA 2P99A 4IKRA 2P9AA 4FUKA 4OOKA 2GTXA 3BITA 2OKNA 2GG0A 2GG8A 1B59A 4IKSA 1KP0A 2V3YA 3BIQA 3FMRA 5D6EA 1CHMA 4ZNGA 2GU5A 4A6WA 2V3XA 1XGMA 1M35A 3D27A 4FO8A 4U6WA 1YJ3A 4MATA 1BN5A 2DFIA 3RORA 4U70A 1C24A 2BWYA 5CE6A 4IPAA 1C23A 5CIKA 2Q96A 2MATA 3PKCA 4IKUA 4FO7A 1XGOA 5JHUA 5CLSA 1MATA 2V6CA 2GG5A 3FM3A 3CB6A 4ZWOA 1KQ0A 3PKBA 5JFRA 4FLKA 1QXZA 4IKTA 1R58A 4RZZA 2Q95A 2V3ZA 5CDLA 1WL6A 1BOAA 1WN1A 1C22A 2HOWA 3MX6A 4U6CA 1B6AA 4R60A 3S6BA 5CDVA 3IU9A 2GU4A 2BHDA 2ADUA 2OAZA 2BWUA 3PKAA 1PV9A 2Q94A 4PV4A 3RVAA 3BIPA 1QXYA 2BH3A 4PNCA 1A16A 1O0XA 3L24A 2GZ5A 3PKDA 4FLLA 4JUQA 3MATA 2GA2A 3FMQA 5D6FA 3TAVA 3TB5A 1WBQA 2IW2A 3IU7A 2NQ7A 2BWXA 1WLRA 2Q93A 2GGBA 2Q92A 2ZSGA 1C27A 2EVOA 1WKMA 4Z7MA 3L7GA 4S00A 4U76A 2GGCA 1QXWA 5FCHA 1YVMA 1KQ9A 3IU8A 4S01A 4U6ZA 5E5BA 2BHCA 4IF7A 4S2TP 2NQ6A 2GU7A 4A6VA 2BHAA 1JAWA 4FLIA 1YW9A
chains in the Genus database with same CATH topology
1R5HA 2BHBA 1N51A 2GG3A 2G6PA 2BWWA 1C21A 1XGNA 4FLJA 1XNZA 3Q6DA 4RZYA 4FKCA 2B3LA 2GG7A 5CNXA 4B28A 2EVCA 2B3HA 4IU6A 5CDEA 2EA2A 4QR8A 1WL9A 2EA4A 1QZYA 4U6JA 1YW7A 4S2RP 4U6EA 2GU6A 2EVMA 1XGSA 2GG2A 2BN7A 4U75A 4IDYA 2BWVA 4KM3A 1W7VA 4U1BA 2BB7A 1R5GA 5FCFA 4U69A 4ZWPA 4RGZ1 1YW8A 2GG9A 4IECA 4EGEA 3PKEA 2B3KA 4U73A 4ZWUA 5JI6A 1WY2A 1W2MA 3MR1A 3CB5A 4U71A 3CTZA 2Q8KA 4HXXA 1Y1NA 2BWTA 2P98A 3IG4A 2BWSA 2P99A 4IKRA 2P9AA 4FUKA 4OOKA 2GTXA 3BITA 2OKNA 2GG0A 2GG8A 1B59A 4IKSA 1KP0A 2V3YA 3BIQA 3FMRA 5D6EA 1CHMA 4ZNGA 2GU5A 4A6WA 2V3XA 1XGMA 1M35A 3D27A 4FO8A 4U6WA 1YJ3A 4MATA 1BN5A 2DFIA 3RORA 4U70A 1C24A 2BWYA 5CE6A 4IPAA 1C23A 5CIKA 2Q96A 2MATA 3PKCA 4IKUA 4FO7A 1XGOA 5JHUA 5CLSA 1MATA 2V6CA 2GG5A 3FM3A 3CB6A 4ZWOA 1KQ0A 3PKBA 5JFRA 4FLKA 1QXZA 4IKTA 1R58A 4RZZA 2Q95A 2V3ZA 5CDLA 1WL6A 1BOAA 1WN1A 1C22A 2HOWA 3MX6A 4U6CA 1B6AA 4R60A 3S6BA 5CDVA 3IU9A 2GU4A 2BHDA 2ADUA 2OAZA 2BWUA 3PKAA 1PV9A 2Q94A 4PV4A 3RVAA 3BIPA 1QXYA 2BH3A 4PNCA 1A16A 1O0XA 3L24A 2GZ5A 3PKDA 4FLLA 4JUQA 3MATA 2GA2A 3FMQA 5D6FA 3TAVA 3TB5A 1WBQA 2IW2A 3IU7A 2NQ7A 2BWXA 1WLRA 2Q93A 2GGBA 2Q92A 2ZSGA 1C27A 2EVOA 1WKMA 4Z7MA 3L7GA 4S00A 4U76A 2GGCA 1QXWA 5FCHA 1YVMA 1KQ9A 3IU8A 4S01A 4U6ZA 5E5BA 2BHCA 4IF7A 4S2TP 2NQ6A 2GU7A 4A6VA 2BHAA 1JAWA 4FLIA 1YW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R5H A;  2BHB A;  1N51 A;  2GG3 A;  2G6P A;  2BWW A;  1C21 A;  1XGN A;  4FLJ A;  1XNZ A;  3Q6D A;  4RZY A;  4FKC A;  2B3L A;  2GG7 A;  5CNX A;  4B28 A;  2EVC A;  2B3H A;  4IU6 A;  5CDE A;  2EA2 A;  4QR8 A;  1WL9 A;  2EA4 A;  1QZY A;  4U6J A;  1YW7 A;  4S2R P;  4U6E A;  2GU6 A;  2EVM A;  1XGS A;  2GG2 A;  2BN7 A;  4U75 A;  4IDY A;  2BWV A;  4KM3 A;  1W7V A;  4U1B A;  2BB7 A;  1R5G A;  5FCF A;  4U69 A;  4ZWP A;  4RGZ 1;  1YW8 A;  2GG9 A;  4IEC A;  4EGE A;  3PKE A;  2B3K A;  4U73 A;  4ZWU A;  5JI6 A;  1WY2 A;  1W2M A;  3MR1 A;  3CB5 A;  4U71 A;  3CTZ A;  2Q8K A;  4HXX A;  1Y1N A;  2BWT A;  2P98 A;  3IG4 A;  2BWS A;  2P99 A;  4IKR A;  2P9A A;  4FUK A;  4OOK A;  2GTX A;  3BIT A;  2OKN A;  2GG0 A;  2GG8 A;  1B59 A;  4IKS A;  1KP0 A;  2V3Y A;  3BIQ A;  3FMR A;  5D6E A;  1CHM A;  4ZNG A;  2GU5 A;  4A6W A;  2V3X A;  1XGM A;  1M35 A;  3D27 A;  4FO8 A;  4U6W A;  1YJ3 A;  4MAT A;  1BN5 A;  2DFI A;  3ROR A;  4U70 A;  1C24 A;  2BWY A;  5CE6 A;  4IPA A;  1C23 A;  5CIK A;  2Q96 A;  2MAT A;  3PKC A;  4IKU A;  4FO7 A;  1XGO A;  5JHU A;  5CLS A;  1MAT A;  2V6C A;  2GG5 A;  3FM3 A;  3CB6 A;  4ZWO A;  1KQ0 A;  3PKB A;  5JFR A;  4FLK A;  1QXZ A;  4IKT A;  1R58 A;  4RZZ A;  2Q95 A;  2V3Z A;  5CDL A;  1WL6 A;  1BOA A;  1WN1 A;  1C22 A;  2HOW A;  3MX6 A;  4U6C A;  1B6A A;  4R60 A;  3S6B A;  5CDV A;  3IU9 A;  2GU4 A;  2BHD A;  2ADU A;  2OAZ A;  2BWU A;  3PKA A;  1PV9 A;  2Q94 A;  4PV4 A;  3RVA A;  3BIP A;  1QXY A;  2BH3 A;  4PNC A;  1A16 A;  1O0X A;  3L24 A;  2GZ5 A;  3PKD A;  4FLL A;  4JUQ A;  3MAT A;  2GA2 A;  3FMQ A;  5D6F A;  3TAV A;  3TB5 A;  1WBQ A;  2IW2 A;  3IU7 A;  2NQ7 A;  2BWX A;  1WLR A;  2Q93 A;  2GGB A;  2Q92 A;  2ZSG A;  1C27 A;  2EVO A;  1WKM A;  4Z7M A;  3L7G A;  4S00 A;  4U76 A;  2GGC A;  1QXW A;  5FCH A;  1YVM A;  1KQ9 A;  3IU8 A;  4S01 A;  4U6Z A;  5E5B A;  2BHC A;  4IF7 A;  4S2T P;  2NQ6 A;  2GU7 A;  4A6V A;  2BHA A;  1JAW A;  4FLI A;  1YW9 A; 
#chains in the Genus database with same CATH topology
 1R5H A;  2BHB A;  1N51 A;  2GG3 A;  2G6P A;  2BWW A;  1C21 A;  1XGN A;  4FLJ A;  1XNZ A;  3Q6D A;  4RZY A;  4FKC A;  2B3L A;  2GG7 A;  5CNX A;  4B28 A;  2EVC A;  2B3H A;  4IU6 A;  5CDE A;  2EA2 A;  4QR8 A;  1WL9 A;  2EA4 A;  1QZY A;  4U6J A;  1YW7 A;  4S2R P;  4U6E A;  2GU6 A;  2EVM A;  1XGS A;  2GG2 A;  2BN7 A;  4U75 A;  4IDY A;  2BWV A;  4KM3 A;  1W7V A;  4U1B A;  2BB7 A;  1R5G A;  5FCF A;  4U69 A;  4ZWP A;  4RGZ 1;  1YW8 A;  2GG9 A;  4IEC A;  4EGE A;  3PKE A;  2B3K A;  4U73 A;  4ZWU A;  5JI6 A;  1WY2 A;  1W2M A;  3MR1 A;  3CB5 A;  4U71 A;  3CTZ A;  2Q8K A;  4HXX A;  1Y1N A;  2BWT A;  2P98 A;  3IG4 A;  2BWS A;  2P99 A;  4IKR A;  2P9A A;  4FUK A;  4OOK A;  2GTX A;  3BIT A;  2OKN A;  2GG0 A;  2GG8 A;  1B59 A;  4IKS A;  1KP0 A;  2V3Y A;  3BIQ A;  3FMR A;  5D6E A;  1CHM A;  4ZNG A;  2GU5 A;  4A6W A;  2V3X A;  1XGM A;  1M35 A;  3D27 A;  4FO8 A;  4U6W A;  1YJ3 A;  4MAT A;  1BN5 A;  2DFI A;  3ROR A;  4U70 A;  1C24 A;  2BWY A;  5CE6 A;  4IPA A;  1C23 A;  5CIK A;  2Q96 A;  2MAT A;  3PKC A;  4IKU A;  4FO7 A;  1XGO A;  5JHU A;  5CLS A;  1MAT A;  2V6C A;  2GG5 A;  3FM3 A;  3CB6 A;  4ZWO A;  1KQ0 A;  3PKB A;  5JFR A;  4FLK A;  1QXZ A;  4IKT A;  1R58 A;  4RZZ A;  2Q95 A;  2V3Z A;  5CDL A;  1WL6 A;  1BOA A;  1WN1 A;  1C22 A;  2HOW A;  3MX6 A;  4U6C A;  1B6A A;  4R60 A;  3S6B A;  5CDV A;  3IU9 A;  2GU4 A;  2BHD A;  2ADU A;  2OAZ A;  2BWU A;  3PKA A;  1PV9 A;  2Q94 A;  4PV4 A;  3RVA A;  3BIP A;  1QXY A;  2BH3 A;  4PNC A;  1A16 A;  1O0X A;  3L24 A;  2GZ5 A;  3PKD A;  4FLL A;  4JUQ A;  3MAT A;  2GA2 A;  3FMQ A;  5D6F A;  3TAV A;  3TB5 A;  1WBQ A;  2IW2 A;  3IU7 A;  2NQ7 A;  2BWX A;  1WLR A;  2Q93 A;  2GGB A;  2Q92 A;  2ZSG A;  1C27 A;  2EVO A;  1WKM A;  4Z7M A;  3L7G A;  4S00 A;  4U76 A;  2GGC A;  1QXW A;  5FCH A;  1YVM A;  1KQ9 A;  3IU8 A;  4S01 A;  4U6Z A;  5E5B A;  2BHC A;  4IF7 A;  4S2T P;  2NQ6 A;  2GU7 A;  4A6V A;  2BHA A;  1JAW A;  4FLI A;  1YW9 A; 
#chains in the Genus database with same CATH homology
 1R5H A;  2BHB A;  1N51 A;  2GG3 A;  2G6P A;  2BWW A;  1C21 A;  1XGN A;  4FLJ A;  1XNZ A;  3Q6D A;  4RZY A;  4FKC A;  2B3L A;  2GG7 A;  5CNX A;  4B28 A;  2EVC A;  2B3H A;  4IU6 A;  5CDE A;  2EA2 A;  4QR8 A;  1WL9 A;  2EA4 A;  1QZY A;  4U6J A;  1YW7 A;  4S2R P;  4U6E A;  2GU6 A;  2EVM A;  1XGS A;  2GG2 A;  2BN7 A;  4U75 A;  4IDY A;  2BWV A;  4KM3 A;  1W7V A;  4U1B A;  2BB7 A;  1R5G A;  5FCF A;  4U69 A;  4ZWP A;  4RGZ 1;  1YW8 A;  2GG9 A;  4IEC A;  4EGE A;  3PKE A;  2B3K A;  4U73 A;  4ZWU A;  5JI6 A;  1WY2 A;  1W2M A;  3MR1 A;  3CB5 A;  4U71 A;  3CTZ A;  2Q8K A;  4HXX A;  1Y1N A;  2BWT A;  2P98 A;  3IG4 A;  2BWS A;  2P99 A;  4IKR A;  2P9A A;  4FUK A;  4OOK A;  2GTX A;  3BIT A;  2OKN A;  2GG0 A;  2GG8 A;  1B59 A;  4IKS A;  1KP0 A;  2V3Y A;  3BIQ A;  3FMR A;  5D6E A;  1CHM A;  4ZNG A;  2GU5 A;  4A6W A;  2V3X A;  1XGM A;  1M35 A;  3D27 A;  4FO8 A;  4U6W A;  1YJ3 A;  4MAT A;  1BN5 A;  2DFI A;  3ROR A;  4U70 A;  1C24 A;  2BWY A;  5CE6 A;  4IPA A;  1C23 A;  5CIK A;  2Q96 A;  2MAT A;  3PKC A;  4IKU A;  4FO7 A;  1XGO A;  5JHU A;  5CLS A;  1MAT A;  2V6C A;  2GG5 A;  3FM3 A;  3CB6 A;  4ZWO A;  1KQ0 A;  3PKB A;  5JFR A;  4FLK A;  1QXZ A;  4IKT A;  1R58 A;  4RZZ A;  2Q95 A;  2V3Z A;  5CDL A;  1WL6 A;  1BOA A;  1WN1 A;  1C22 A;  2HOW A;  3MX6 A;  4U6C A;  1B6A A;  4R60 A;  3S6B A;  5CDV A;  3IU9 A;  2GU4 A;  2BHD A;  2ADU A;  2OAZ A;  2BWU A;  3PKA A;  1PV9 A;  2Q94 A;  4PV4 A;  3RVA A;  3BIP A;  1QXY A;  2BH3 A;  4PNC A;  1A16 A;  1O0X A;  3L24 A;  2GZ5 A;  3PKD A;  4FLL A;  4JUQ A;  3MAT A;  2GA2 A;  3FMQ A;  5D6F A;  3TAV A;  3TB5 A;  1WBQ A;  2IW2 A;  3IU7 A;  2NQ7 A;  2BWX A;  1WLR A;  2Q93 A;  2GGB A;  2Q92 A;  2ZSG A;  1C27 A;  2EVO A;  1WKM A;  4Z7M A;  3L7G A;  4S00 A;  4U76 A;  2GGC A;  1QXW A;  5FCH A;  1YVM A;  1KQ9 A;  3IU8 A;  4S01 A;  4U6Z A;  5E5B A;  2BHC A;  4IF7 A;  4S2T P;  2NQ6 A;  2GU7 A;  4A6V A;  2BHA A;  1JAW A;  4FLI A;  1YW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...