4IL4A

The pentameric ligand-gated ion channel glic in complex with se-ddm
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural basis for ion permeation mechanism in pentameric ligand-gated ion channels.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 98
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4il4A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4il4A01
3RHWA 4UM3A 2Y58A 5BRXA 3RI5A 4COFA 3IGQA 4ZZCA 4Z91A 4HQPA 5IUXA 2YMDA 2Y57A 2W8GA 3JAFA 3UU6A 2ZJVA 4ILBA 1I9BA 4ZR6A 3UUBA 2BR7A 3C79A 4XHEA 2XQ5A 4EZ1A 2BG9E 5BP0A 5KZUA 3U8KA 4BQTA 5KE4A 2UZ6A 4TWFA 5AINA 4WV9A 2X00D 3EI0A 1UX2A 4TWHA 5CO5A 5CFBA 2X00A 3WTNA 2XQ7A 3T4MA 4AFHA 3U8JA 4NPPA 4TWDA 1OEDB 2QC1B 2WNJA 2YKSA 5L4HA 4UM1A 3PEOA 5JMEA 4HFEA 2YN6A 4Z90A 5L4EA 3SQ9A 3SIOA 3JADA 3WTOA 3EHZA 5HEOA 3WTHA 3TLUA 3UQ4A 5AFKA 2LKGA 4BFQA 5J5IA 2LM2A 5HCMA 5SYOA 4LMJA 1OEDC 3U8NA 5LXBA 5AFMB 2XQ8A 1OEDE 4HFHA 2Y7YA 2XQ3A 3U8LA 2WN9A 3WTJA 3P4WA 4QH5A 5AFHA 4XK9A 2W8FA 2XNVA 3WTIA 4IL9A 3LSVA 5LG3A 5J0ZA 2BYRA 5HEUA 2PGZA 2Y54A 3RIAA 2BJ0A 2XQ9A 5FJVA 2BYSA 5HEJA 3UU5A 5L47A 3WTKA 4ZJTA 2XQAA 2XYSA 1OEDA 1UV6A 2XYTA 4ILCA 2XNUA 5HEGA 2ZJUA 3TLVA 4ALXA 3GUAA 4FRRA 3TLWA 4UY2A 5BW2A 5AFJA 3ZDGA 3UU3A 2VL0A 4ILAA 2XZ5A 2YMEA 4F8HA 4ZRUA 2PH9A 4HFCA 4QAAA 2XQ6A 3C84A 4TNWA 2M6IA 4QH4A 3TLSA 4QACA 2WNCA 2BR8A 3WTLA 2BYNA 2LLYA 5AFMA 2BYQA 4LMLA 5J5FA 4LMKA 4ZZBA 4X5TA 3SH1A 3UU4A 4IL4A 2KSRA 3SQ6A 2BG9B 2WZYA 5TVCA 4UXUA 3RIFA 4QH1A 4ZK4A 4ZK1A 4HFIA 3U8MA 3WTMA 3P50A 5AFLA 4HFBA 5HCJA 3RQWA 3PMZA 5AFNA 2XZ6A 5J5GA 4AFGA 3TLTA 1UW6A 2XQ4A 3ZDHA 4HFDA 4D01A 3UU8A 3JAEA 4B5DA 2BG9C 4IREA 4UM3P 3ZKRA 3EAMA 2Y56A 4AFTA 4ZJSA 2WNLA 3UQ7A 4A98A 2MAWA 4A97A 2BYPA 3RQUA 4DBMA 4TNVA 5HEHA 2LKHA 2C9TA 4UM3S 5J5HA 2M6BA 4QABA 2XNTA 3WIPA 2YOEA 4NZBA 4PIRA 2BG9A
chains in the Genus database with same CATH superfamily
5BRXA 3EDVA 4HQPA 3IGQA 3Q9DA 3SOLA 2HN1A 3A7MA 1ZHCA 3RX6A 2XQ5A 2F4VT 2BKOA 2V6YA 3KINB 5HXSA 4ISTA 3PTRB 4AISA 4NPPA 4O8SA 2K9AA 4H9PC 4LFCT 2KXPB 3AEFA 5HEOA 3WTHA 3IBPA 5JR9C 5AFKA 1NEKA 3LBXA 4HWHA 2JQ9A 4CZZB 3QNUA 3P4WA 4TZ4C 5C3JA 1N33T 5J0ZA 2QYWA 4PJLA 3T1HT 3RIUC 2LSKA 3V5UA 3X1DA 1HX1B 1W0AA 4ISSA 3N2OA 3I9WA 3V5SA 4AKGA 4ZI3D 3UU3A 2PH9A 3B5MA 2XQ6A 3MK7C 2HHHT 4DV7T 3O1IA 4H63H 3VRAA 1KEYA 3CIRA 3UU4A 1IZNB 3QC9A 1Y01A 3BQIA 4DR7T 4U7IA 3CQGB 3N5LA 4HFIA 4EOZB 3UUNA 3CMLA 4QXBB 5J5GA 4AFGA 5LA6E 2KINB 4I55E 4LF7T 3KVAA 4ZI7E 4JI0T 4ZJSA 4LFAT 1EZ3A 2XM2A 4EGWA 2CWYA 3RF1A 4TNVA 2C9TA 5L3DB 2KMFA 5CJ5A 3AAEB 4OX9T 3RYIE 3PUSA 4EYYR 3AE5A 2Y57A 3AXJB 2W00A 1UUSA 3DTOA 4WNKA 2KWHA 3EI0A 3LK3B 5CFBA 2IMLA 5AQQB 2Q9QB 3RYFE 2VKOA 4L5GA 3ANWA 3T8OA 3KV4A 1OWAA 5KMGP 4AQYT 4LMJA 3RKGA 1MMDA 1E7PA 5AQGB 3WTJA 3EABA 3LJCA 3EUHA 3OTOT 5FYMA 3ETUA 5JDGA 2X9WA 2C5IT 4EZ4A 3OVUA 1UV6A 3L8RA 4H63V 2XAHB 2VL0A 2BDEA 3OYXA 4TV9E 3WTLA 1YD8G 4I50E 2C5JA 5AQPB 3VRBA 5JDQA 5J5FA 4I43B 4LMKA 2WZIA 5DQWA 4DR3T 4GYRA 2VB6A 5AFLA 4HFBA 4YY3T 4DUZT 3ZYKA 4ZS3A 3TLTA 4YTNA 1BR4A 4PAGA 2LOSA 4UM3P 2A3DA 3L3PA 5DQVA 4A98A 1IBKT 5M4YA 3AE4A 4OFZA 4UM3A 3NKZA 1MMAA 4ZZCA 3I1AA 4ZXLA 1YXRA 4X62T 4ZOLE 4LF6T 1I9BA 1UK5A 5JDFA 3U8KA 2JQQA 5L3BB 5DJQC 3UFGA 5CO5A 2CE7A 3ZMUB 3O1JA 3QB5A 3MZKB 2HPLA 3D0TA 3H37A 1OEDB 5JMEA 4TV8E 2XSBA 2VKDA 3DP7A 1S94A 4EEBA 5FL1A 3C98B 4AKRB 4GKKT 4BFQA 1HX8A 4IIJE 5KXJA 4IE0A 2Q9QC 3VKHA 5EZYE 1D1BA 3IHRA 1ZV4X 3N9NA 4DR4T 4JI1T 2Y54A 2XQ9A 3AE6A 1W09A 3IEEA 2X9YA 3TLVA 3G06A 3F31A 2XZEA 4U72A 1KNZA 3TLSA 2LLYA 4WW0A 4YFSA 4AXPA 4DV2T 2C0SA 1GQEA 1HFAA 3NRXA 2IC6A 2AXDS 1D0YA 3SQ6A 1HNWT 4O2AE 4KBMB 4UXUA 4QH1A 1UURA 2K24A 4DMWA 4UV9B 2K48A 5BMVE 2B76A 4X1KE 2YDQA 2XAJB 2VVSA 2EHOA 5HXCA 2NW9A 1J5WA 2CLYB 2MAWA 3CWZB 3QUJA 2W61A 2XNTA 3FZLB 4KX6A 1KFYA 2LSIA 5KDMC 2WQYA 2BR7A 5ABFA 2V7IA 2SPCA 3GA8A 3GWHA 2NTYA 1FMWA 2L9QA 3T4MA 3PU8A 4AFHA 2YDSA 3N2GE 3ZN0B 3HKDE 3PUQA 3RC8A 4UVCB 2LE8A 4OHFA 4CXYA 2LKGA 2QRXA 1JNRA 1SA0E 3KVBA 3N9LA 1HG2A 1OEDC 2MPKA 3A5XA 4ILUA 2WN9A 2KWIB 4QH5A 2NWBA 1D1CA 1B7TA 2JPFA 4XK9A 3WTIA 3K3NA 2UU9T 2LOPA 2W67A 1KNPA 2X51A 4E7SA 2FJAA 2PG8A 3AEBA 1D0XA 3F2EA 5AQMB 3GUAA 3JC6C 5LXTE 1W0BA 1CUNA 2YMEA 4YTMA 4QACA 1HTJF 4AQGA 4C90A 4U2ZA 4ZZBA 3AVRA 3WAJA 1HR0T 2X0YA 5TVCA 1T72A 2NR4A 3U3IA 3K8PC 4DBRA 4ZK1A 3C50A 3AEGA 1UX5A 3PMZA 2J47A 3ZMTB 1N32T 3C4ZA 3UQ7A 5FMNA 3PUZF 4LFBT 2WBLA 2CLYC 2YOEA 4HWFA 2BG9A 3ZC1A 4UVBB 3RRWA 4LF9T 3ETVA 3AE2A 4DMVA 3JAFA 4XZCA 3RYCE 3E08A 3HL6A 3ESLA 3R6NA 2OA5A 5IHYA 2CA5A 2FJEA 5JDLA 3SS1A 4DV3T 3CKDA 3N9OA 5HXEA 5AFHA 4K0KT 1HS7A 1LVKA 4ZI3C 2W8FA 2WMNA 1WFDA 5HEUA 2VURA 2DNXA 4L9IA 5JR9A 3OJAA 4DIDB 2WZHA 4ILAA 3OBVE 2CBJA 2ACXA 1YW0A 3FBLA 3RIUA 2CRBA 2W66A 5JRCB 4MFRA 5JH7E 3HKBE 3FZKB 2KSRA 4QXCB 2WWUA 3B13A 2WU2A 3L09A 4U31A 4HFDA 2CXLA 2DHRA 4YLHA 2M67A 1VOMA 2Y56A 4AFTA 3CX7B 3CPZA 3T1YT 3ZYLA 3OKQA 2E9XD 2XAQB 3ONJA 2UXXB 2DLRA 2ZLYA 2LSJA 4Z91A 5AQUB 2LEHA 3AE1A 4ANJA 1WLXA 2IIUA 3JCFA 4UM1A 4TX5A 4QXHB 3GN5A 3NRYA 5L4EA 3SIOA 3RGLA 4V1Av 4MLKA 1G8XA 4JI4T 2J62A 4CXXA 5AFMB 2XM1A 3E22E 3C51A 2UXDT 5L3CB 1YQ3A 2ODVA 2X68A 4I0UA 1E1HB 2XNUA 3M3ZB 2WM9A 2D2SA 4HEAA 2ZMAA 4F8HA 4EAHA 1BR0A 2BS4A 3IF8B 2BYNA 4UR9A 3S4UA 2XPKA 2CPTA 3FZMB 2K3WA 3RKOA 2FBWA 4O4IE 1FJGT 2D9DA 1S35A 2IDOB 4BJMA 4CQIA 5C2TA 1UW6A 3VHLA 1N34T 5L2LA 5LNKA 2XQYA 2J4GA 2BYPA 3ZT7A 5LCYA 4B3RT 5LOVE 2D5UA 1T8BA 2V7JA 3KV9A 4EXTA 5AQTB 3I0QA 2UXBT 1VCTA 4KMCA 2JQKA 2YK0A 2UZ6A 2X00D 3AAIA 3OYZA 1HF8A 1XMOT 3N9MA 5H6RB 1KK7A 3WTOA 4AKIA 4YSXA 5HCMA 3PUWF 4MBQA 5AQFB 4ZEYA 1Z0PA 2XHEB 5JVDE 1NENA 3AXJA 1MMGA 2NW7A 2CXDA 5FY1A 3AAAB 2ZM0A 2VKHA 4O2BE 2Q9QA 4YHJA 3KV6A 1XWMA 1M62A 2YU1A 4QAAA 4QH4A 4LF4T 4P0AA 2BVMA 4LMLA 5HWXA 4GOUA 3SH1A 4B6XA 4C91A 2YINA 2KLQA 4HN9A 2UUAT 2PBIA 4X66T 4NUVA 4PJNA 4ASKA 2XQ4A 1I6ZA 5AQVB 2D0TA 4B5DA 4WZXA 5FVKA 2CHNA 1WR6A 1X79A 3RRCA 4UF0B 4UF0A 2CM0A 2WZYA 2ZM8A 2X0LB 1U4QA 1J5ET 4NUUA 2OV9A 4ZR6A 5LJMA 1WR0A 2MTQA 4DV1T 4U3CA 1LRZA 4DR5T 1H7CA 4WV9A 2A72A 2XSAA 2HPJA 2VKJA 2JJ9A 3R84B 4ZHQE 3RLFF 5LHHB 2FUPA 4YHHT 2BBHA 1FEWA 2LM2A 2XY8B 1FIOA 4DNDA 2Z6EA 1HNZT 4TN7B 5LHIB 5ETWA 4ERRA 4DBQA 2V8SV 3NWIA 1OEDA 4AI6A 2XZ5A 4HGAA 2DWKA 3AA7B 4JEUB 1QLBA 3AE8A 1Z8UA 4UELA 3Q5DA 3UULA 3KFWX 2WAUA 3P50A 4KUMB 1UGOA 3RQWA 3C64A 3I0OA 4H9SE 2HH7A 2Y6XA 4JUYA 3RQUA 2JMKA 4DO0A 3LK2B 5LP6E 5F5WA 3U8JA 4IHJE 3ZSSA 3FXDB 5ABHA 3FZFB 4DR6T 5J1GA 2WU5A 4PK6A 5HAXA 2BVLA 2H88A 2WY2A 4CI1B 4DR2T 4DUYT 4BQTA 2XQ7A 5LHGB 4DV4T 5GONE 3C4WA 5CA1E 3PEOA 2R6GF 3ONLC 3AA6B 3AVSA 1QSDA 3GMIA 4IE5A 1HNXT 1MMNA 2WB5A 5AQSB 4QX8B 1DU2A 1J1JA 3LSVA 2UUCT 2BYRA 5HWYA 2BJ0A 5L47A 4ZJTA 1WCRA 2NP9A 2PFVA 1MIWA 4ILCA 1XDPA 2ZJUA 2WWVA 4IDNA 4FRRA 4U74A 2LHRA 5BW2A 4GK5E 3H3AA 1SHZC 1QUUA 4TNWA 5E0OA 4O4HE 3ABVA 3RC3A 5FVLA 4A5XA 3MKDA 1LVFA 2BS2A 2N9DA 3TKLB 4JV5T 3LFMA 2Y48B 2MOZA 2XAFB 5AQHB 1N36T 4IGUA 3ZKRA 3ZEFB 3CQCB 2IC9A 2VQFT 3SFDA 1R8IA 4A97A 5HXHA 5ABEA 5HEHA 1KF6A 4Q25A 4EEDA 3PV0F 4U2YA 2V5DA 1D0ZA 1NAFA 2CWOA 3ZLIA 4H9RC 4IDOA 3PDYA 4EZHA 3RH3A 2IHR1 4K0UA 4ILBA 5AQJB 5BP0A 2W63A 4CI3B 5FY0A 4TWDA 2DWGA 4Z90A 2V7MA 2YN6A 4WBOA 3SQ9A 3EHZA 4KHPT 2K5BB 5SYOA 2ACZA 3VKGA 5AFUL 2UXCT 2Y7YA 4NXNT 3PJAJ 5LG3A 4G63A 2KZ7B 4F6RC 4KI0F 5HEJA 4X20E 1ZP0A 4FJOA 4PK5A 3ZYMA 3AE3A 4ZRUA 4JBWF 4YTPA 4YSZA 5AQRB 2WNCA 1I94T 3HA4A 2ODUA 5TAOA 1AJ3A 1ZKEA 3OPCA 4X1YE 2D0UA 1V9DA 3J9X1 2CBIA 2LRKA 5ABGA 1L0VA 5HCJA 3Q5EA 2WNLA 1O3XA 5JRCA 1IBLT 2FJBA 4UM3S 3WIPA 4NZBA 4PIRA 4QHOA 3ZN1B 3CX8B 4IDPA 2C5KT 4CI2B 2CMRA 1HG5A 3PUXF 4HWCA 3QK6A 3HR0A 2X9HA 3UUBA 4XAXB 5KE4A 3N9PA 5FY7A 5IWAT 5F8PA 2MYSA 4EYUA 4MHCA 4HFEA 3LG7A 3KDSE 2CEAA 3WI3A 4J2CA 1E2AA 3C4XA 4OK0A 3BQLA 2XQ8A 4HFHA 1XNRT 2OLTA 5DABA 3ZSTA 5JREA 2VK9A 3FBZA 2HN2A 1T98A 1WYCA 3RPUA 5LGTB 4GYSA 3TLWA 2CHOA 2N1GA 4BA9A 4Z8XA 4HFCA 3A8YC 5JTGA 2V7KA 2V26A 1XMQT 5AFMA 2IAKA 4IDQA 3L39A 1D1AA 1MIVA 1LKXA 4H9QC 3ZJ2A 4DV0T 4GIWA 5FXVA 3AEAA 4HWDA 2EHOD 5FL0A 4EB6E 3JAEA 5H6QB 2V6YB 3VU7H 5HXRA 3FB2A 3ZPOA 2XUEA 3PUAA 4EV6A 3UFEA 4QABA 3FZHB 3LBXB 5EK3A 2W0GA 3W15B 2YMDA 3BQKA 2WS3A 2A9UA 2CCQA 3WAKA 2ZJVA 3UUXB 2W4XA 5JQGE 3ZT5A 3EVYA 5KZUA 4HE8A 4HKAA 5LGUB 4UVAB 2YKSA 1CHUA 2PTFA 4B3TT 3ZMZB 1U5PA 4PNIA 4JI5T 5J5IA 2KNDA 3SWHA 3B57A 3NZQA 4JI8T 3SRZA 4ZI2D 4X65T 4ADZA 4IL9A 2NW8A 3M65A 3RIAA 3E0ZA 2BS3A 2KT9A 4ALXA 5AQNB 4IE7A 3AA1B 3PUYF 1SE7A 1FMVA 4OYKA 3PURA 5CGMA 2V7LA 2A2FX 5LMNT 1M7KA 2PJQA 5EK2A 3Q2MA 4AQFC 4IL4A 1SUMB 2AE9A 5LG4A 3U8MA 3AEEA 2LJLA 3MACA 3K1SA 1KNRA 2B1EA 4A56A 3UU8A 4BJNA 1OXZA 4H9NC 4UXNB 4QKNA 5KX5E 4L0RA 2X67A 4CN6A 1BR2A 3ANWB 2LKHA 5J5HA 1UX4A 2WP9A 4IT4A 2VL8A 3AECA 4DV5T 3NBXX 5AQIB 5IUXA 2NOXA 4U33A 4JI6T 1IJ6A 1XNQT 2V5CA 2WMOA 2H3RA 2JRKA 3FXEB 2RP4A 3Q5WA 3FHNA 4JI7T 4BAYB 5EK4A 4P09A 1OEDE 4KHZF 2XQ3A 4OYJA 4PJJA 2RA1A 2IUBA 1MNEA 4O4JE 2H7OA 5FJVA 3O4XE 2WSSV 3KBTA 5L3FB 2XASB 1BR1A 3NVOA 2YEVC 3ZDGA 4AKHA 2X9XA 4NXMT 3EDUA 1MIYA 1W9RA 2BYQA 2UXNB 4B3MT 3ZT6A 4YJ2E 3RIFA 4ZK4A 3DJBA 2LHNA 2NTXA 4X1IE 2I6HA 5FXZA 2XZ6A 2H89A 2RPAA 4LF5T 2YU2A 4QWNB 3EAMA 3F57A 4PK4A 3U78A 3Q5XA 4IE6A 2VWAA 2E8IA 2E9XB 3K3QC 5LBMA 2E9XA 4CN1A 4D01A 2Y8DA 2Y58A 2JIWA 5JDHA 4COFA 2ES0A 3UU6A 4H9OC 2LSYA 4PFPA 4TWHA 3WTNA 4YJ3E 4CXWA 2IW5B 3AB3B 2BKPA 2WDVA 3JADA 3TLUA 3IA3A 3UQ4A 5L3EB 4XBFB 4DV6T 4NIQA 3HKCE 2LM9A 2E5VA 2WCAA 1T7SA 2ZM2A 5FNVE 2JMHA 4HWIB 2ZM6T 3MJXA 4WBNE 4FI5A 4PFOA 4YXDA 5JDNA 2XQAA 4EIWA 2L8KA 4JYAT 1IBMT 2VVNA 5AFJA 4M1PA 3P8CD 2EHOB 3K3OA 5FKYA 2LSGA 5J2TE 2M6IA 3ZMVB 2L3LA 2WDRA 5LGNB 2BR8A 3HI2A 1IJ5A 1XZYA 2XJ7A 5C8YE 4UIGA 3CQXC 1ZEEA 5F3JA 2DL1A 3VR8A 1XDOA 4JEHB 3AE7A 3I9YA 2WDQA 2BZBA 4N78D 3KBUA 4HFVA 4KP3C 4GKJT 5ABFB 4IREA 1MNDA 2FJDA 3ZCJA 4HTEA 5FXXA 3P4PA 1G73A 5AQOB 2MBGA 5IYZE 5JDMA 4PW8A 1JNZA 4DVDA 2I0MA 3ZCIA 3RHWA 3SFEA 5HYAA 3NZPA 3RI5A 1VCSA 5J2UE 1WRDA 2E9XC 5A1LA 2DI4A 2GK9A 3BK9A 3ZC0A 3C79A 4LF8T 4EZ1A 5ADXL 2BG9E 4TWFA 5AINA 1X9BA 2CXFA 2X00A 2LRLA 5BR8T 2QC1B 2WNJA 5L4HA 4GK0E 4CN4A 2VASA 4JLEA 3MA9A 3N2KE 5LB7B 5LBQB 5LXBA 3LK42 3PE0A 1YKHB 3PUGA 2XNVA 1YQ4A 4UEMA 4DR1T 2P9BA 1YKEB 2QGSA 3P4RA 2PGZA 3J7Yq 5LMUT 2BYSA 1Y64B 2X66A 3QOFA 2XYSA 2Q9QD 1UCUA 2XYTA 3AA0B 2W2UA 3P7IA 5HEGA 4O4LE 4ZS2A 3C84A 3QB5K 4E7ZA 1IAPA 2YDRA 2UUBT 4G2AA 2EHOC 3PU3A 2G0UA 2BG9B 3AE9A 2VQET 3MXZA 3HKEE 4IE4A 1US7B 3UT5E 5CB4E 5AFNA 2XAGB 3ZDHA 4YSYA 3KV5A 5FXWA 5FP3A 2X0HA 2JQHA 2E2AA 4PJMA 5CA0E 2W62A 3CX6B 2M6BA 4JI3T 2V6XA 2QVAA 3ZJ1A 2BBJA 4B3ST 3O9XA 1ZOYA 2W8GA 3ZMSB 4XHEA 4UV8B 1UX2A 5JR9B 4ZI2C 4MALA 2BKNA 4U7YA 3P4QA 3U8NA 3U8LA 4AKLA 4JI2T 2H7VC 4QX7B 4WYVA 3UUMA 3UU5A 3WTKA 3P4SA 4P1NA 2QA7A 3RYHE 2N2NA 4UY2A 2J1DG 3VR9A 5LJNA 5L3GB 3ONXA 1VRBA 3N9QA 2XTLA 3CVRA 3AEDA 2V1DB 3PUVF 4P0BA 3UTKA 2LT3A 3CK6A 2I59A 3JC6D 4TUYE 4X5TA 1WYBA 3H3MA 5LYJE 3O1HA 3WTMA 3PJAA 1HCIA 1NWMX 2BG9C 4AQFA 5AQLB 2DCFA 3GN5B 4YT0A 4DBMA 3LDQB 4I4TE 4AIUA 5AQKB 4IDZA 2E5LT 4X64T
chains in the Genus database with same CATH topology
3RHWA 4UM3A 2Y58A 5BRXA 3RI5A 4COFA 3IGQA 4ZZCA 4Z91A 4HQPA 5IUXA 2YMDA 2Y57A 2W8GA 3JAFA 3UU6A 2ZJVA 4ILBA 1I9BA 4ZR6A 3UUBA 2BR7A 3C79A 4XHEA 2XQ5A 4EZ1A 2BG9E 5BP0A 5KZUA 3U8KA 4BQTA 5KE4A 2UZ6A 4TWFA 5AINA 4WV9A 2X00D 3EI0A 1UX2A 4TWHA 5CO5A 5CFBA 2X00A 3WTNA 2XQ7A 3T4MA 4AFHA 3U8JA 4NPPA 4TWDA 1OEDB 2QC1B 2WNJA 2YKSA 5L4HA 4UM1A 3PEOA 5JMEA 4HFEA 2YN6A 4Z90A 5L4EA 3SQ9A 3SIOA 3JADA 3WTOA 3EHZA 5HEOA 3WTHA 3TLUA 3UQ4A 5AFKA 2LKGA 4BFQA 5J5IA 2LM2A 5HCMA 5SYOA 4LMJA 1OEDC 3U8NA 5LXBA 5AFMB 2XQ8A 1OEDE 4HFHA 2Y7YA 2XQ3A 3U8LA 2WN9A 3WTJA 3P4WA 4QH5A 5AFHA 4XK9A 2W8FA 2XNVA 3WTIA 4IL9A 3LSVA 5LG3A 5J0ZA 2BYRA 5HEUA 2PGZA 2Y54A 3RIAA 2BJ0A 2XQ9A 5FJVA 2BYSA 5HEJA 3UU5A 5L47A 3WTKA 4ZJTA 2XQAA 2XYSA 1OEDA 1UV6A 2XYTA 4ILCA 2XNUA 5HEGA 2ZJUA 3TLVA 4ALXA 3GUAA 4FRRA 3TLWA 4UY2A 5BW2A 5AFJA 3ZDGA 3UU3A 2VL0A 4ILAA 2XZ5A 2YMEA 4F8HA 4ZRUA 2PH9A 4HFCA 4QAAA 2XQ6A 3C84A 4TNWA 2M6IA 4QH4A 3TLSA 4QACA 2WNCA 2BR8A 3WTLA 2BYNA 2LLYA 5AFMA 2BYQA 4LMLA 5J5FA 4LMKA 4ZZBA 4X5TA 3SH1A 3UU4A 4IL4A 2KSRA 3SQ6A 2BG9B 2WZYA 5TVCA 4UXUA 3RIFA 4QH1A 4ZK4A 4ZK1A 4HFIA 3U8MA 3WTMA 3P50A 5AFLA 4HFBA 5HCJA 3RQWA 3PMZA 5AFNA 2XZ6A 5J5GA 4AFGA 3TLTA 1UW6A 2XQ4A 3ZDHA 4HFDA 4D01A 3UU8A 3JAEA 4B5DA 2BG9C 4IREA 4UM3P 3ZKRA 3EAMA 2Y56A 4AFTA 4ZJSA 2WNLA 3UQ7A 4A98A 2MAWA 4A97A 2BYPA 3RQUA 4DBMA 4TNVA 5HEHA 2LKHA 2C9TA 4UM3S 5J5HA 2M6BA 4QABA 2XNTA 3WIPA 2YOEA 4NZBA 4PIRA 2BG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RHW A;  4UM3 A;  2Y58 A;  5BRX A;  3RI5 A;  4COF A;  3IGQ A;  4ZZC A;  4Z91 A;  4HQP A;  5IUX A;  2YMD A;  2Y57 A;  2W8G A;  3JAF A;  3UU6 A;  2ZJV A;  4ILB A;  1I9B A;  4ZR6 A;  3UUB A;  2BR7 A;  3C79 A;  4XHE A;  2XQ5 A;  4EZ1 A;  2BG9 E;  5BP0 A;  5KZU A;  3U8K A;  4BQT A;  5KE4 A;  2UZ6 A;  4TWF A;  5AIN A;  4WV9 A;  2X00 D;  3EI0 A;  1UX2 A;  4TWH A;  5CO5 A;  5CFB A;  2X00 A;  3WTN A;  2XQ7 A;  3T4M A;  4AFH A;  3U8J A;  4NPP A;  4TWD A;  1OED B;  2QC1 B;  2WNJ A;  2YKS A;  5L4H A;  4UM1 A;  3PEO A;  5JME A;  4HFE A;  2YN6 A;  4Z90 A;  5L4E A;  3SQ9 A;  3SIO A;  3JAD A;  3WTO A;  3EHZ A;  5HEO A;  3WTH A;  3TLU A;  3UQ4 A;  5AFK A;  2LKG A;  4BFQ A;  5J5I A;  2LM2 A;  5HCM A;  5SYO A;  4LMJ A;  1OED C;  3U8N A;  5LXB A;  5AFM B;  2XQ8 A;  1OED E;  4HFH A;  2Y7Y A;  2XQ3 A;  3U8L A;  2WN9 A;  3WTJ A;  3P4W A;  4QH5 A;  5AFH A;  4XK9 A;  2W8F A;  2XNV A;  3WTI A;  4IL9 A;  3LSV A;  5LG3 A;  5J0Z A;  2BYR A;  5HEU A;  2PGZ A;  2Y54 A;  3RIA A;  2BJ0 A;  2XQ9 A;  5FJV A;  2BYS A;  5HEJ A;  3UU5 A;  5L47 A;  3WTK A;  4ZJT A;  2XQA A;  2XYS A;  1OED A;  1UV6 A;  2XYT A;  4ILC A;  2XNU A;  5HEG A;  2ZJU A;  3TLV A;  4ALX A;  3GUA A;  4FRR A;  3TLW A;  4UY2 A;  5BW2 A;  5AFJ A;  3ZDG A;  3UU3 A;  2VL0 A;  4ILA A;  2XZ5 A;  2YME A;  4F8H A;  4ZRU A;  2PH9 A;  4HFC A;  4QAA A;  2XQ6 A;  3C84 A;  4TNW A;  2M6I A;  4QH4 A;  3TLS A;  4QAC A;  2WNC A;  2BR8 A;  3WTL A;  2BYN A;  2LLY A;  5AFM A;  2BYQ A;  4LML A;  5J5F A;  4LMK A;  4ZZB A;  4X5T A;  3SH1 A;  3UU4 A;  4IL4 A;  2KSR A;  3SQ6 A;  2BG9 B;  2WZY A;  5TVC A;  4UXU A;  3RIF A;  4QH1 A;  4ZK4 A;  4ZK1 A;  4HFI A;  3U8M A;  3WTM A;  3P50 A;  5AFL A;  4HFB A;  5HCJ A;  3RQW A;  3PMZ A;  5AFN A;  2XZ6 A;  5J5G A;  4AFG A;  3TLT A;  1UW6 A;  2XQ4 A;  3ZDH A;  4HFD A;  4D01 A;  3UU8 A;  3JAE A;  4B5D A;  2BG9 C;  4IRE A;  4UM3 P;  3ZKR A;  3EAM A;  2Y56 A;  4AFT A;  4ZJS A;  2WNL A;  3UQ7 A;  4A98 A;  2MAW A;  4A97 A;  2BYP A;  3RQU A;  4DBM A;  4TNV A;  5HEH A;  2LKH A;  2C9T A;  4UM3 S;  5J5H A;  2M6B A;  4QAB A;  2XNT A;  3WIP A;  2YOE A;  4NZB A;  4PIR A;  2BG9 A; 
#chains in the Genus database with same CATH topology
 5BRX A;  3EDV A;  4HQP A;  3IGQ A;  3Q9D A;  3SOL A;  2HN1 A;  3A7M A;  1ZHC A;  3RX6 A;  2XQ5 A;  2F4V T;  2BKO A;  2V6Y A;  3KIN B;  5HXS A;  4IST A;  3PTR B;  4AIS A;  4NPP A;  4O8S A;  2K9A A;  4H9P C;  4LFC T;  2KXP B;  3AEF A;  5HEO A;  3WTH A;  3IBP A;  5JR9 C;  5AFK A;  1NEK A;  3LBX A;  4HWH A;  2JQ9 A;  4CZZ B;  3QNU A;  3P4W A;  4TZ4 C;  5C3J A;  1N33 T;  5J0Z A;  2QYW A;  4PJL A;  3T1H T;  3RIU C;  2LSK A;  3V5U A;  3X1D A;  1HX1 B;  1W0A A;  4ISS A;  3N2O A;  3I9W A;  3V5S A;  4AKG A;  4ZI3 D;  3UU3 A;  2PH9 A;  3B5M A;  2XQ6 A;  3MK7 C;  2HHH T;  4DV7 T;  3O1I A;  4H63 H;  3VRA A;  1KEY A;  3CIR A;  3UU4 A;  1IZN B;  3QC9 A;  1Y01 A;  3BQI A;  4DR7 T;  4U7I A;  3CQG B;  3N5L A;  4HFI A;  4EOZ B;  3UUN A;  3CML A;  4QXB B;  5J5G A;  4AFG A;  5LA6 E;  2KIN B;  4I55 E;  4LF7 T;  3KVA A;  4ZI7 E;  4JI0 T;  4ZJS A;  4LFA T;  1EZ3 A;  2XM2 A;  4EGW A;  2CWY A;  3RF1 A;  4TNV A;  2C9T A;  5L3D B;  2KMF A;  5CJ5 A;  3AAE B;  4OX9 T;  3RYI E;  3PUS A;  4EYY R;  3AE5 A;  2Y57 A;  3AXJ B;  2W00 A;  1UUS A;  3DTO A;  4WNK A;  2KWH A;  3EI0 A;  3LK3 B;  5CFB A;  2IML A;  5AQQ B;  2Q9Q B;  3RYF E;  2VKO A;  4L5G A;  3ANW A;  3T8O A;  3KV4 A;  1OWA A;  5KMG P;  4AQY T;  4LMJ A;  3RKG A;  1MMD A;  1E7P A;  5AQG B;  3WTJ A;  3EAB A;  3LJC A;  3EUH A;  3OTO T;  5FYM A;  3ETU A;  5JDG A;  2X9W A;  2C5I T;  4EZ4 A;  3OVU A;  1UV6 A;  3L8R A;  4H63 V;  2XAH B;  2VL0 A;  2BDE A;  3OYX A;  4TV9 E;  3WTL A;  1YD8 G;  4I50 E;  2C5J A;  5AQP B;  3VRB A;  5JDQ A;  5J5F A;  4I43 B;  4LMK A;  2WZI A;  5DQW A;  4DR3 T;  4GYR A;  2VB6 A;  5AFL A;  4HFB A;  4YY3 T;  4DUZ T;  3ZYK A;  4ZS3 A;  3TLT A;  4YTN A;  1BR4 A;  4PAG A;  2LOS A;  4UM3 P;  2A3D A;  3L3P A;  5DQV A;  4A98 A;  1IBK T;  5M4Y A;  3AE4 A;  4OFZ A;  4UM3 A;  3NKZ A;  1MMA A;  4ZZC A;  3I1A A;  4ZXL A;  1YXR A;  4X62 T;  4ZOL E;  4LF6 T;  1I9B A;  1UK5 A;  5JDF A;  3U8K A;  2JQQ A;  5L3B B;  5DJQ C;  3UFG A;  5CO5 A;  2CE7 A;  3ZMU B;  3O1J A;  3QB5 A;  3MZK B;  2HPL A;  3D0T A;  3H37 A;  1OED B;  5JME A;  4TV8 E;  2XSB A;  2VKD A;  3DP7 A;  1S94 A;  4EEB A;  5FL1 A;  3C98 B;  4AKR B;  4GKK T;  4BFQ A;  1HX8 A;  4IIJ E;  5KXJ A;  4IE0 A;  2Q9Q C;  3VKH A;  5EZY E;  1D1B A;  3IHR A;  1ZV4 X;  3N9N A;  4DR4 T;  4JI1 T;  2Y54 A;  2XQ9 A;  3AE6 A;  1W09 A;  3IEE A;  2X9Y A;  3TLV A;  3G06 A;  3F31 A;  2XZE A;  4U72 A;  1KNZ A;  3TLS A;  2LLY A;  4WW0 A;  4YFS A;  4AXP A;  4DV2 T;  2C0S A;  1GQE A;  1HFA A;  3NRX A;  2IC6 A;  2AXD S;  1D0Y A;  3SQ6 A;  1HNW T;  4O2A E;  4KBM B;  4UXU A;  4QH1 A;  1UUR A;  2K24 A;  4DMW A;  4UV9 B;  2K48 A;  5BMV E;  2B76 A;  4X1K E;  2YDQ A;  2XAJ B;  2VVS A;  2EHO A;  5HXC A;  2NW9 A;  1J5W A;  2CLY B;  2MAW A;  3CWZ B;  3QUJ A;  2W61 A;  2XNT A;  3FZL B;  4KX6 A;  1KFY A;  2LSI A;  5KDM C;  2WQY A;  2BR7 A;  5ABF A;  2V7I A;  2SPC A;  3GA8 A;  3GWH A;  2NTY A;  1FMW A;  2L9Q A;  3T4M A;  3PU8 A;  4AFH A;  2YDS A;  3N2G E;  3ZN0 B;  3HKD E;  3PUQ A;  3RC8 A;  4UVC B;  2LE8 A;  4OHF A;  4CXY A;  2LKG A;  2QRX A;  1JNR A;  1SA0 E;  3KVB A;  3N9L A;  1HG2 A;  1OED C;  2MPK A;  3A5X A;  4ILU A;  2WN9 A;  2KWI B;  4QH5 A;  2NWB A;  1D1C A;  1B7T A;  2JPF A;  4XK9 A;  3WTI A;  3K3N A;  2UU9 T;  2LOP A;  2W67 A;  1KNP A;  2X51 A;  4E7S A;  2FJA A;  2PG8 A;  3AEB A;  1D0X A;  3F2E A;  5AQM B;  3GUA A;  3JC6 C;  5LXT E;  1W0B A;  1CUN A;  2YME A;  4YTM A;  4QAC A;  1HTJ F;  4AQG A;  4C90 A;  4U2Z A;  4ZZB A;  3AVR A;  3WAJ A;  1HR0 T;  2X0Y A;  5TVC A;  1T72 A;  2NR4 A;  3U3I A;  3K8P C;  4DBR A;  4ZK1 A;  3C50 A;  3AEG A;  1UX5 A;  3PMZ A;  2J47 A;  3ZMT B;  1N32 T;  3C4Z A;  3UQ7 A;  5FMN A;  3PUZ F;  4LFB T;  2WBL A;  2CLY C;  2YOE A;  4HWF A;  2BG9 A;  3ZC1 A;  4UVB B;  3RRW A;  4LF9 T;  3ETV A;  3AE2 A;  4DMV A;  3JAF A;  4XZC A;  3RYC E;  3E08 A;  3HL6 A;  3ESL A;  3R6N A;  2OA5 A;  5IHY A;  2CA5 A;  2FJE A;  5JDL A;  3SS1 A;  4DV3 T;  3CKD A;  3N9O A;  5HXE A;  5AFH A;  4K0K T;  1HS7 A;  1LVK A;  4ZI3 C;  2W8F A;  2WMN A;  1WFD A;  5HEU A;  2VUR A;  2DNX A;  4L9I A;  5JR9 A;  3OJA A;  4DID B;  2WZH A;  4ILA A;  3OBV E;  2CBJ A;  2ACX A;  1YW0 A;  3FBL A;  3RIU A;  2CRB A;  2W66 A;  5JRC B;  4MFR A;  5JH7 E;  3HKB E;  3FZK B;  2KSR A;  4QXC B;  2WWU A;  3B13 A;  2WU2 A;  3L09 A;  4U31 A;  4HFD A;  2CXL A;  2DHR A;  4YLH A;  2M67 A;  1VOM A;  2Y56 A;  4AFT A;  3CX7 B;  3CPZ A;  3T1Y T;  3ZYL A;  3OKQ A;  2E9X D;  2XAQ B;  3ONJ A;  2UXX B;  2DLR A;  2ZLY A;  2LSJ A;  4Z91 A;  5AQU B;  2LEH A;  3AE1 A;  4ANJ A;  1WLX A;  2IIU A;  3JCF A;  4UM1 A;  4TX5 A;  4QXH B;  3GN5 A;  3NRY A;  5L4E A;  3SIO A;  3RGL A;  4V1A v;  4MLK A;  1G8X A;  4JI4 T;  2J62 A;  4CXX A;  5AFM B;  2XM1 A;  3E22 E;  3C51 A;  2UXD T;  5L3C B;  1YQ3 A;  2ODV A;  2X68 A;  4I0U A;  1E1H B;  2XNU A;  3M3Z B;  2WM9 A;  2D2S A;  4HEA A;  2ZMA A;  4F8H A;  4EAH A;  1BR0 A;  2BS4 A;  3IF8 B;  2BYN A;  4UR9 A;  3S4U A;  2XPK A;  2CPT A;  3FZM B;  2K3W A;  3RKO A;  2FBW A;  4O4I E;  1FJG T;  2D9D A;  1S35 A;  2IDO B;  4BJM A;  4CQI A;  5C2T A;  1UW6 A;  3VHL A;  1N34 T;  5L2L A;  5LNK A;  2XQY A;  2J4G A;  2BYP A;  3ZT7 A;  5LCY A;  4B3R T;  5LOV E;  2D5U A;  1T8B A;  2V7J A;  3KV9 A;  4EXT A;  5AQT B;  3I0Q A;  2UXB T;  1VCT A;  4KMC A;  2JQK A;  2YK0 A;  2UZ6 A;  2X00 D;  3AAI A;  3OYZ A;  1HF8 A;  1XMO T;  3N9M A;  5H6R B;  1KK7 A;  3WTO A;  4AKI A;  4YSX A;  5HCM A;  3PUW F;  4MBQ A;  5AQF B;  4ZEY A;  1Z0P A;  2XHE B;  5JVD E;  1NEN A;  3AXJ A;  1MMG A;  2NW7 A;  2CXD A;  5FY1 A;  3AAA B;  2ZM0 A;  2VKH A;  4O2B E;  2Q9Q A;  4YHJ A;  3KV6 A;  1XWM A;  1M62 A;  2YU1 A;  4QAA A;  4QH4 A;  4LF4 T;  4P0A A;  2BVM A;  4LML A;  5HWX A;  4GOU A;  3SH1 A;  4B6X A;  4C91 A;  2YIN A;  2KLQ A;  4HN9 A;  2UUA T;  2PBI A;  4X66 T;  4NUV A;  4PJN A;  4ASK A;  2XQ4 A;  1I6Z A;  5AQV B;  2D0T A;  4B5D A;  4WZX A;  5FVK A;  2CHN A;  1WR6 A;  1X79 A;  3RRC A;  4UF0 B;  4UF0 A;  2CM0 A;  2WZY A;  2ZM8 A;  2X0L B;  1U4Q A;  1J5E T;  4NUU A;  2OV9 A;  4ZR6 A;  5LJM A;  1WR0 A;  2MTQ A;  4DV1 T;  4U3C A;  1LRZ A;  4DR5 T;  1H7C A;  4WV9 A;  2A72 A;  2XSA A;  2HPJ A;  2VKJ A;  2JJ9 A;  3R84 B;  4ZHQ E;  3RLF F;  5LHH B;  2FUP A;  4YHH T;  2BBH A;  1FEW A;  2LM2 A;  2XY8 B;  1FIO A;  4DND A;  2Z6E A;  1HNZ T;  4TN7 B;  5LHI B;  5ETW A;  4ERR A;  4DBQ A;  2V8S V;  3NWI A;  1OED A;  4AI6 A;  2XZ5 A;  4HGA A;  2DWK A;  3AA7 B;  4JEU B;  1QLB A;  3AE8 A;  1Z8U A;  4UEL A;  3Q5D A;  3UUL A;  3KFW X;  2WAU A;  3P50 A;  4KUM B;  1UGO A;  3RQW A;  3C64 A;  3I0O A;  4H9S E;  2HH7 A;  2Y6X A;  4JUY A;  3RQU A;  2JMK A;  4DO0 A;  3LK2 B;  5LP6 E;  5F5W A;  3U8J A;  4IHJ E;  3ZSS A;  3FXD B;  5ABH A;  3FZF B;  4DR6 T;  5J1G A;  2WU5 A;  4PK6 A;  5HAX A;  2BVL A;  2H88 A;  2WY2 A;  4CI1 B;  4DR2 T;  4DUY T;  4BQT A;  2XQ7 A;  5LHG B;  4DV4 T;  5GON E;  3C4W A;  5CA1 E;  3PEO A;  2R6G F;  3ONL C;  3AA6 B;  3AVS A;  1QSD A;  3GMI A;  4IE5 A;  1HNX T;  1MMN A;  2WB5 A;  5AQS B;  4QX8 B;  1DU2 A;  1J1J A;  3LSV A;  2UUC T;  2BYR A;  5HWY A;  2BJ0 A;  5L47 A;  4ZJT A;  1WCR A;  2NP9 A;  2PFV A;  1MIW A;  4ILC A;  1XDP A;  2ZJU A;  2WWV A;  4IDN A;  4FRR A;  4U74 A;  2LHR A;  5BW2 A;  4GK5 E;  3H3A A;  1SHZ C;  1QUU A;  4TNW A;  5E0O A;  4O4H E;  3ABV A;  3RC3 A;  5FVL A;  4A5X A;  3MKD A;  1LVF A;  2BS2 A;  2N9D A;  3TKL B;  4JV5 T;  3LFM A;  2Y48 B;  2MOZ A;  2XAF B;  5AQH B;  1N36 T;  4IGU A;  3ZKR A;  3ZEF B;  3CQC B;  2IC9 A;  2VQF T;  3SFD A;  1R8I A;  4A97 A;  5HXH A;  5ABE A;  5HEH A;  1KF6 A;  4Q25 A;  4EED A;  3PV0 F;  4U2Y A;  2V5D A;  1D0Z A;  1NAF A;  2CWO A;  3ZLI A;  4H9R C;  4IDO A;  3PDY A;  4EZH A;  3RH3 A;  2IHR 1;  4K0U A;  4ILB A;  5AQJ B;  5BP0 A;  2W63 A;  4CI3 B;  5FY0 A;  4TWD A;  2DWG A;  4Z90 A;  2V7M A;  2YN6 A;  4WBO A;  3SQ9 A;  3EHZ A;  4KHP T;  2K5B B;  5SYO A;  2ACZ A;  3VKG A;  5AFU L;  2UXC T;  2Y7Y A;  4NXN T;  3PJA J;  5LG3 A;  4G63 A;  2KZ7 B;  4F6R C;  4KI0 F;  5HEJ A;  4X20 E;  1ZP0 A;  4FJO A;  4PK5 A;  3ZYM A;  3AE3 A;  4ZRU A;  4JBW F;  4YTP A;  4YSZ A;  5AQR B;  2WNC A;  1I94 T;  3HA4 A;  2ODU A;  5TAO A;  1AJ3 A;  1ZKE A;  3OPC A;  4X1Y E;  2D0U A;  1V9D A;  3J9X 1;  2CBI A;  2LRK A;  5ABG A;  1L0V A;  5HCJ A;  3Q5E A;  2WNL A;  1O3X A;  5JRC A;  1IBL T;  2FJB A;  4UM3 S;  3WIP A;  4NZB A;  4PIR A;  4QHO A;  3ZN1 B;  3CX8 B;  4IDP A;  2C5K T;  4CI2 B;  2CMR A;  1HG5 A;  3PUX F;  4HWC A;  3QK6 A;  3HR0 A;  2X9H A;  3UUB A;  4XAX B;  5KE4 A;  3N9P A;  5FY7 A;  5IWA T;  5F8P A;  2MYS A;  4EYU A;  4MHC A;  4HFE A;  3LG7 A;  3KDS E;  2CEA A;  3WI3 A;  4J2C A;  1E2A A;  3C4X A;  4OK0 A;  3BQL A;  2XQ8 A;  4HFH A;  1XNR T;  2OLT A;  5DAB A;  3ZST A;  5JRE A;  2VK9 A;  3FBZ A;  2HN2 A;  1T98 A;  1WYC A;  3RPU A;  5LGT B;  4GYS A;  3TLW A;  2CHO A;  2N1G A;  4BA9 A;  4Z8X A;  4HFC A;  3A8Y C;  5JTG A;  2V7K A;  2V26 A;  1XMQ T;  5AFM A;  2IAK A;  4IDQ A;  3L39 A;  1D1A A;  1MIV A;  1LKX A;  4H9Q C;  3ZJ2 A;  4DV0 T;  4GIW A;  5FXV A;  3AEA A;  4HWD A;  2EHO D;  5FL0 A;  4EB6 E;  3JAE A;  5H6Q B;  2V6Y B;  3VU7 H;  5HXR A;  3FB2 A;  3ZPO A;  2XUE A;  3PUA A;  4EV6 A;  3UFE A;  4QAB A;  3FZH B;  3LBX B;  5EK3 A;  2W0G A;  3W15 B;  2YMD A;  3BQK A;  2WS3 A;  2A9U A;  2CCQ A;  3WAK A;  2ZJV A;  3UUX B;  2W4X A;  5JQG E;  3ZT5 A;  3EVY A;  5KZU A;  4HE8 A;  4HKA A;  5LGU B;  4UVA B;  2YKS A;  1CHU A;  2PTF A;  4B3T T;  3ZMZ B;  1U5P A;  4PNI A;  4JI5 T;  5J5I A;  2KND A;  3SWH A;  3B57 A;  3NZQ A;  4JI8 T;  3SRZ A;  4ZI2 D;  4X65 T;  4ADZ A;  4IL9 A;  2NW8 A;  3M65 A;  3RIA A;  3E0Z A;  2BS3 A;  2KT9 A;  4ALX A;  5AQN B;  4IE7 A;  3AA1 B;  3PUY F;  1SE7 A;  1FMV A;  4OYK A;  3PUR A;  5CGM A;  2V7L A;  2A2F X;  5LMN T;  1M7K A;  2PJQ A;  5EK2 A;  3Q2M A;  4AQF C;  4IL4 A;  1SUM B;  2AE9 A;  5LG4 A;  3U8M A;  3AEE A;  2LJL A;  3MAC A;  3K1S A;  1KNR A;  2B1E A;  4A56 A;  3UU8 A;  4BJN A;  1OXZ A;  4H9N C;  4UXN B;  4QKN A;  5KX5 E;  4L0R A;  2X67 A;  4CN6 A;  1BR2 A;  3ANW B;  2LKH A;  5J5H A;  1UX4 A;  2WP9 A;  4IT4 A;  2VL8 A;  3AEC A;  4DV5 T;  3NBX X;  5AQI B;  5IUX A;  2NOX A;  4U33 A;  4JI6 T;  1IJ6 A;  1XNQ T;  2V5C A;  2WMO A;  2H3R A;  2JRK A;  3FXE B;  2RP4 A;  3Q5W A;  3FHN A;  4JI7 T;  4BAY B;  5EK4 A;  4P09 A;  1OED E;  4KHZ F;  2XQ3 A;  4OYJ A;  4PJJ A;  2RA1 A;  2IUB A;  1MNE A;  4O4J E;  2H7O A;  5FJV A;  3O4X E;  2WSS V;  3KBT A;  5L3F B;  2XAS B;  1BR1 A;  3NVO A;  2YEV C;  3ZDG A;  4AKH A;  2X9X A;  4NXM T;  3EDU A;  1MIY A;  1W9R A;  2BYQ A;  2UXN B;  4B3M T;  3ZT6 A;  4YJ2 E;  3RIF A;  4ZK4 A;  3DJB A;  2LHN A;  2NTX A;  4X1I E;  2I6H A;  5FXZ A;  2XZ6 A;  2H89 A;  2RPA A;  4LF5 T;  2YU2 A;  4QWN B;  3EAM A;  3F57 A;  4PK4 A;  3U78 A;  3Q5X A;  4IE6 A;  2VWA A;  2E8I A;  2E9X B;  3K3Q C;  5LBM A;  2E9X A;  4CN1 A;  4D01 A;  2Y8D A;  2Y58 A;  2JIW A;  5JDH A;  4COF A;  2ES0 A;  3UU6 A;  4H9O C;  2LSY A;  4PFP A;  4TWH A;  3WTN A;  4YJ3 E;  4CXW A;  2IW5 B;  3AB3 B;  2BKP A;  2WDV A;  3JAD A;  3TLU A;  3IA3 A;  3UQ4 A;  5L3E B;  4XBF B;  4DV6 T;  4NIQ A;  3HKC E;  2LM9 A;  2E5V A;  2WCA A;  1T7S A;  2ZM2 A;  5FNV E;  2JMH A;  4HWI B;  2ZM6 T;  3MJX A;  4WBN E;  4FI5 A;  4PFO A;  4YXD A;  5JDN A;  2XQA A;  4EIW A;  2L8K A;  4JYA T;  1IBM T;  2VVN A;  5AFJ A;  4M1P A;  3P8C D;  2EHO B;  3K3O A;  5FKY A;  2LSG A;  5J2T E;  2M6I A;  3ZMV B;  2L3L A;  2WDR A;  5LGN B;  2BR8 A;  3HI2 A;  1IJ5 A;  1XZY A;  2XJ7 A;  5C8Y E;  4UIG A;  3CQX C;  1ZEE A;  5F3J A;  2DL1 A;  3VR8 A;  1XDO A;  4JEH B;  3AE7 A;  3I9Y A;  2WDQ A;  2BZB A;  4N78 D;  3KBU A;  4HFV A;  4KP3 C;  4GKJ T;  5ABF B;  4IRE A;  1MND A;  2FJD A;  3ZCJ A;  4HTE A;  5FXX A;  3P4P A;  1G73 A;  5AQO B;  2MBG A;  5IYZ E;  5JDM A;  4PW8 A;  1JNZ A;  4DVD A;  2I0M A;  3ZCI A;  3RHW A;  3SFE A;  5HYA A;  3NZP A;  3RI5 A;  1VCS A;  5J2U E;  1WRD A;  2E9X C;  5A1L A;  2DI4 A;  2GK9 A;  3BK9 A;  3ZC0 A;  3C79 A;  4LF8 T;  4EZ1 A;  5ADX L;  2BG9 E;  4TWF A;  5AIN A;  1X9B A;  2CXF A;  2X00 A;  2LRL A;  5BR8 T;  2QC1 B;  2WNJ A;  5L4H A;  4GK0 E;  4CN4 A;  2VAS A;  4JLE A;  3MA9 A;  3N2K E;  5LB7 B;  5LBQ B;  5LXB A;  3LK4 2;  3PE0 A;  1YKH B;  3PUG A;  2XNV A;  1YQ4 A;  4UEM A;  4DR1 T;  2P9B A;  1YKE B;  2QGS A;  3P4R A;  2PGZ A;  3J7Y q;  5LMU T;  2BYS A;  1Y64 B;  2X66 A;  3QOF A;  2XYS A;  2Q9Q D;  1UCU A;  2XYT A;  3AA0 B;  2W2U A;  3P7I A;  5HEG A;  4O4L E;  4ZS2 A;  3C84 A;  3QB5 K;  4E7Z A;  1IAP A;  2YDR A;  2UUB T;  4G2A A;  2EHO C;  3PU3 A;  2G0U A;  2BG9 B;  3AE9 A;  2VQE T;  3MXZ A;  3HKE E;  4IE4 A;  1US7 B;  3UT5 E;  5CB4 E;  5AFN A;  2XAG B;  3ZDH A;  4YSY A;  3KV5 A;  5FXW A;  5FP3 A;  2X0H A;  2JQH A;  2E2A A;  4PJM A;  5CA0 E;  2W62 A;  3CX6 B;  2M6B A;  4JI3 T;  2V6X A;  2QVA A;  3ZJ1 A;  2BBJ A;  4B3S T;  3O9X A;  1ZOY A;  2W8G A;  3ZMS B;  4XHE A;  4UV8 B;  1UX2 A;  5JR9 B;  4ZI2 C;  4MAL A;  2BKN A;  4U7Y A;  3P4Q A;  3U8N A;  3U8L A;  4AKL A;  4JI2 T;  2H7V C;  4QX7 B;  4WYV A;  3UUM A;  3UU5 A;  3WTK A;  3P4S A;  4P1N A;  2QA7 A;  3RYH E;  2N2N A;  4UY2 A;  2J1D G;  3VR9 A;  5LJN A;  5L3G B;  3ONX A;  1VRB A;  3N9Q A;  2XTL A;  3CVR A;  3AED A;  2V1D B;  3PUV F;  4P0B A;  3UTK A;  2LT3 A;  3CK6 A;  2I59 A;  3JC6 D;  4TUY E;  4X5T A;  1WYB A;  3H3M A;  5LYJ E;  3O1H A;  3WTM A;  3PJA A;  1HCI A;  1NWM X;  2BG9 C;  4AQF A;  5AQL B;  2DCF A;  3GN5 B;  4YT0 A;  4DBM A;  3LDQ B;  4I4T E;  4AIU A;  5AQK B;  4IDZ A;  2E5L T;  4X64 T; 
#chains in the Genus database with same CATH homology
 3RHW A;  4UM3 A;  2Y58 A;  5BRX A;  3RI5 A;  4COF A;  3IGQ A;  4ZZC A;  4Z91 A;  4HQP A;  5IUX A;  2YMD A;  2Y57 A;  2W8G A;  3JAF A;  3UU6 A;  2ZJV A;  4ILB A;  1I9B A;  4ZR6 A;  3UUB A;  2BR7 A;  3C79 A;  4XHE A;  2XQ5 A;  4EZ1 A;  2BG9 E;  5BP0 A;  5KZU A;  3U8K A;  4BQT A;  5KE4 A;  2UZ6 A;  4TWF A;  5AIN A;  4WV9 A;  2X00 D;  3EI0 A;  1UX2 A;  4TWH A;  5CO5 A;  5CFB A;  2X00 A;  3WTN A;  2XQ7 A;  3T4M A;  4AFH A;  3U8J A;  4NPP A;  4TWD A;  1OED B;  2QC1 B;  2WNJ A;  2YKS A;  5L4H A;  4UM1 A;  3PEO A;  5JME A;  4HFE A;  2YN6 A;  4Z90 A;  5L4E A;  3SQ9 A;  3SIO A;  3JAD A;  3WTO A;  3EHZ A;  5HEO A;  3WTH A;  3TLU A;  3UQ4 A;  5AFK A;  2LKG A;  4BFQ A;  5J5I A;  2LM2 A;  5HCM A;  5SYO A;  4LMJ A;  1OED C;  3U8N A;  5LXB A;  5AFM B;  2XQ8 A;  1OED E;  4HFH A;  2Y7Y A;  2XQ3 A;  3U8L A;  2WN9 A;  3WTJ A;  3P4W A;  4QH5 A;  5AFH A;  4XK9 A;  2W8F A;  2XNV A;  3WTI A;  4IL9 A;  3LSV A;  5LG3 A;  5J0Z A;  2BYR A;  5HEU A;  2PGZ A;  2Y54 A;  3RIA A;  2BJ0 A;  2XQ9 A;  5FJV A;  2BYS A;  5HEJ A;  3UU5 A;  5L47 A;  3WTK A;  4ZJT A;  2XQA A;  2XYS A;  1OED A;  1UV6 A;  2XYT A;  4ILC A;  2XNU A;  5HEG A;  2ZJU A;  3TLV A;  4ALX A;  3GUA A;  4FRR A;  3TLW A;  4UY2 A;  5BW2 A;  5AFJ A;  3ZDG A;  3UU3 A;  2VL0 A;  4ILA A;  2XZ5 A;  2YME A;  4F8H A;  4ZRU A;  2PH9 A;  4HFC A;  4QAA A;  2XQ6 A;  3C84 A;  4TNW A;  2M6I A;  4QH4 A;  3TLS A;  4QAC A;  2WNC A;  2BR8 A;  3WTL A;  2BYN A;  2LLY A;  5AFM A;  2BYQ A;  4LML A;  5J5F A;  4LMK A;  4ZZB A;  4X5T A;  3SH1 A;  3UU4 A;  4IL4 A;  2KSR A;  3SQ6 A;  2BG9 B;  2WZY A;  5TVC A;  4UXU A;  3RIF A;  4QH1 A;  4ZK4 A;  4ZK1 A;  4HFI A;  3U8M A;  3WTM A;  3P50 A;  5AFL A;  4HFB A;  5HCJ A;  3RQW A;  3PMZ A;  5AFN A;  2XZ6 A;  5J5G A;  4AFG A;  3TLT A;  1UW6 A;  2XQ4 A;  3ZDH A;  4HFD A;  4D01 A;  3UU8 A;  3JAE A;  4B5D A;  2BG9 C;  4IRE A;  4UM3 P;  3ZKR A;  3EAM A;  2Y56 A;  4AFT A;  4ZJS A;  2WNL A;  3UQ7 A;  4A98 A;  2MAW A;  4A97 A;  2BYP A;  3RQU A;  4DBM A;  4TNV A;  5HEH A;  2LKH A;  2C9T A;  4UM3 S;  5J5H A;  2M6B A;  4QAB A;  2XNT A;  3WIP A;  2YOE A;  4NZB A;  4PIR A;  2BG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...