4IL4A

The pentameric ligand-gated ion channel glic in complex with se-ddm
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for ion permeation mechanism in pentameric ligand-gated ion channels.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
total genus 98
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4il4A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4il4A01
5AFMA 2YOEA 2YMEA 5HEOA 3U8NA 4WV9A 2XYSA 4ZZCA 5J5IA 1I9BA 2C9TA 2BYPA 3PMZA 4PIRA 3ZKRA 3U8LA 4TWFA 2PGZA 4NZBA 1UX2A 2ZJVA 2W8FA 2WNLA 3JADA 4Z90A 5HCMA 3UU3A 4FRRA 3WTNA 3IGQA 4HFCA 3WTIA 4AFTA 4ALXA 3UU5A 5AFLA 2BYQA 2XNUA 4QABA 3EAMA 3C79A 3RHWA 3UQ7A 2LKGA 2VL0A 4ILBA 2LLYA 3RIFA 4LMKA 2X00A 4UM3A 5CO5A 3WTMA 3EHZA 3PEOA 4QAAA 3RIAA 3RQWA 4B5DA 2WZYA 2YKSA 2BG9E 4XHEA 2XZ6A 4DBMA 4ILAA 2MAWA 4ILCA 4AFHA 4IL9A 3ZDGA 4Z91A 2WNCA 4QH5A 3WTJA 2M6BA 2Y58A 3SQ6A 5CFBA 3TLSA 2UZ6A 1OEDC 4IL4A 5J5GA 5FJVA 4COFA 4HFHA 3UU8A 2BG9B 4XK9A 4UY2A 5AINA 2Y57A 5KZUA 2X00D 4ZK4A 5TVCA 2LM2A 4LMJA 2QC1B 4HQPA 3U8JA 5BP0A 4UM3S 3SH1A 4BFQA 3UU6A 3U8MA 3TLTA 4A98A 5AFHA 2XQ4A 4F8HA 2Y54A 2Y7YA 3RI5A 2XZ5A 2Y56A 3UQ4A 1OEDB 5IUXA 3UU4A 4QH1A 2YMDA 3SIOA 4ZJSA 4D01A 3RQUA 5AFKA 2XQ6A 2XQ3A 5JMEA 2BYRA 4X5TA 3LSVA 2W8GA 4IREA 4ZRUA 3T4MA 5KE4A 5HEGA 4HFIA 3WTLA 2M6IA 3TLUA 2BYSA 2LKHA 2BG9C 3WTHA 4QH4A 4HFBA 4HFEA 3SQ9A 1UW6A 2XQ9A 5SYOA 5LG3A 2XQ8A 3U8KA 4UM1A 3GUAA 3WIPA 5BW2A 3JAEA 4TNWA 2YN6A 5J5FA 2KSRA 1OEDE 2XNTA 4ZK1A 3JAFA 4ZJTA 5J0ZA 5HEHA 2XYTA 4BQTA 4EZ1A 5LXBA 2ZJUA 3P50A 4QACA 5J5HA 5L4EA 5AFJA 2XQ7A 3C84A 4ZR6A 3WTOA 2BJ0A 4UM3P 4NPPA 3EI0A 3ZDHA 3TLWA 4UXUA 2BR7A 4AFGA 5HCJA 4TNVA 4TWDA 3UUBA 5AFNA 1UV6A 4HFDA 5BRXA 5AFMB 2BR8A 4TWHA 2WN9A 2XQAA 5HEUA 2PH9A 5L4HA 4A97A 2WNJA 2XQ5A 2XNVA 1OEDA 4LMLA 5HEJA 2BYNA 3P4WA 4ZZBA 5L47A 2BG9A 3WTKA 3TLVA
chains in the Genus database with same CATH superfamily
4HWCA 4H9NC 3IF8B 4YXDA 4ZZCA 2VVNA 5LHIB 4PJLA 2PGZA 3ZN0B 5JDNA 3WTIA 1S94A 1D1BA 1HG2A 1X79A 2M67A 4UM3A 3S4UA 3VR8A 5CA0E 5M4YA 1D1CA 4UIGA 4CXYA 2WZYA 5LHGB 1UGOA 1AJ3A 4HFVA 4L9IA 3SS1A 2D0TA 4PK5A 5A1LA 5LMNT 2WDQA 3C4XA 4O4LE 4JI6T 3IA3A 2UZ6A 4LFCT 2L9QA 4P1NA 2BG9B 2H7OA 4X66T 5CGMA 2HN2A 2QC1B 4HQPA 2JMHA 2NW9A 3AE3A 3NZPA 3PU3A 3UFGA 4DVDA 3I0QA 1Y64B 1IAPA 5EK3A 2WWVA 2N1GA 2Y56A 5IUXA 3UU4A 4X1YE 4AQYT 2BBJA 3ANWA 2A72A 3AE5A 3AVSA 2W8GA 1HCIA 3PUWF 2KT9A 4HFBA 3ZEFB 4B3RT 3GUAA 2WAUA 4DNDA 4TNWA 3AA6B 2E5VA 5FY1A 4BJMA 1ZV4X 3MK7C 4O2BE 4AKLA 2PTFA 1VOMA 5HXHA 3N5LA 2ZLYA 4UXUA 4YTMA 4TWDA 5HEUA 1QLBA 5H6RB 2D2SA 1EZ3A 4A5XA 2WNJA 2IIUA 4B6XA 4ZI2D 4FJOA 5AFHA 4PW8A 1V9DA 4WV9A 2KWIB 2BVLA 4J2CA 4NZBA 1UX2A 3AE6A 5AQJB 1KNZA 4DR7T 2FBWA 2XTLA 4LMKA 2LRLA 4DV6T 2BG9E 2CEAA 4QXBB 4AI6A 1XNRT 2WDRA 3AA7B 1D1AA 3PUQA 2X00D 2J47A 2DL1A 3Q5DA 5HWYA 3UU6A 4P0AA 2UXNB 3PUZF 5LCYA 1KNRA 4DUYT 1MMAA 1MNDA 5FNVE 3AB3B 2A3DA 1NAFA 4QHOA 3PURA 2W2UA 4IREA 4GKJT 4AQFA 2LSIA 2JIWA 3IHRA 3UFEA 4P0BA 4PK4A 3JC6C 3U8KA 2VB6A 2K9AA 2Q9QB 4UELA 2XQYA 2XYTA 2E8IA 2JQHA 4I4TE 2BJ0A 3O1JA 2YINA 4H9RC 5AFMB 4PNIA 4DMVA 3AEDA 4EYYR 4JI1T 2X0HA 2XAFB 5LJNA 5AQNB 5LP6E 4EZHA 1HG5A 3GN5A 4K0UA 5LOVE 4O4HE 2CM0A 3T8OA 5C3JA 4JI4T 4KI0F 4ISTA 3O1HA 5J5IA 2DI4A 3HKEE 2C5IT 2ZJVA 3SRZA 3BQKA 4EEDA 3UU3A 1ZKEA 5AFLA 3UU5A 4QABA 5L3DB 3UQ7A 5FP3A 3DP7A 3PUXF 4EIWA 2XM1A 3I0OA 4ZXLA 2BS3A 1OXZA 4ZI3C 3ZMUB 4X64T 5ABFA 3ZYKA 4QH5A 2M6BA 3CQXC 1US7B 4YTPA 2LM2A 3AEAA 2X9WA 4BFQA 2YDQA 5L3CB 4DV0T 2Z6EA 4EV6A 4XZCA 4DUZT 5DQVA 1T72A 3RQUA 4CN1A 4HWFA 3AEEA 2DCFA 4HTEA 2BYRA 3P8CD 4KHZF 3ZT6A 5KE4A 5F8PA 2XZEA 4MLKA 4JI5T 3AAEB 1XDPA 3VKHA 4G2AA 3HI2A 5J5FA 2EHOD 3RIUA 3RKGA 5LXBA 4GK0E 1FMWA 3WTOA 1UV6A 5BRXA 4A97A 4AQFC 3ZT7A 2UUAT 4HE8A 2XSAA 3PJAA 2CWYA 2VK9A 3RH3A 2LE8A 2C5JA 4ZEYA 2V7JA 5HCMA 2W4XA 4JI7T 3T1HT 3RIFA 3EABA 3LFMA 1ZP0A 3BQLA 5BR8T 5IHYA 2YKSA 5EZYE 4XHEA 3GMIA 1YKHB 4CN4A 1KF6A 4NXMT 4UVAB 2EHOC 2WNCA 3OYZA 1W0AA 3RF1A 3FB2A 4IDOA 3QK6A 4JUYA 1WR6A 3MA9A 3PV0F 2L8KA 3TLTA 5EK2A 1OEDB 1YQ4A 4YSZA 2YDRA 4ILUA 1FIOA 1WYBA 4H63V 2IDOB 5HEGA 1UW6A 2EHOA 2X66A 2X67A 3FZMB 2CBIA 3EVYA 3JAFA 5L4EA 1XZYA 3UUMA 2NP9A 3N9QA 3EDVA 3NWIA 5L3GB 3GN5B 2XQAA 4LFBT 1HTJF 4V1Av 1QUUA 3VHLA 3ZMVB 3ZJ1A 2V7LA 5L2LA 2H3RA 2UXXB 2QGSA 3PUVF 4AISA 2VURA 3MZKB 5DJQC 5JRCB 3ONJA 2E9XD 5FVLA 2CRBA 4ANJA 3CX8B 2WQYA 1N33T 1HR0T 2XZ6A 5LGNB 3KBTA 3QUJA 3SQ6A 4JI8T 4IHJE 5JR9C 2BKPA 3C4ZA 3AE1A 4UF0B 2XQ4A 2DHRA 4OYJA 4OK0A 4LF5T 3HKBE 4A56A 4AKGA 3F31A 4GOUA 1DU2A 3FZHB 1OWAA 2W61A 1QSDA 4HFEA 4DV2T 2D9DA 2RP4A 3JC6D 1OEDE 4ISSA 5HEHA 3P4QA 2V8SV 4IT4A 3C64A 3NVOA 3HL6A 4QKNA 1IBKT 3AEGA 5AQLB 4HFDA 4ASKA 4JV5T 2QA7A 4ZZBA 3UT5E 3AAIA 4LF6T 2ACXA 4UXNB 2WDVA 5KXJA 2VQFT 4GIWA 4DR6T 3RGLA 4H9OC 5JREA 1I94T 4X1KE 2HN1A 5KX5E 2BYPA 2CCQA 1JNRA 2CBJA 1HNWT 3U8LA 3JADA 5ADXL 4FRRA 3FZLB 5HAXA 4NIQA 5JQGE 1HFAA 1CHUA 4JLEA 3WTMA 2KZ7B 2WY2A 3GWHA 3O9XA 5JTGA 3G06A 4ILAA 2BDEA 4TN7B 1MIVA 4AFHA 3ZDGA 5JVDE 5LNKA 1J5ET 2LRKA 4H9QC 3Q5WA 3NKZA 4WNKA 1LVKA 5TVCA 2XUEA 2XHEB 2VKDA 3AXJA 2MTQA 3U3IA 2Y7YA 2LSGA 4OFZA 1HS7A 2XJ7A 1KEYA 3ZSSA 4DR5T 4AIUA 5IWAT 2ODUA 4GKKT 3A8YC 2BG9C 1MMGA 4Q25A 1XMOT 2CHOA 2XQ8A 1SHZC 3WIPA 4Z8XA 3C98B 2XAJB 2OLTA 3ABVA 3ZLIA 3LDQB 1MMDA 2XQ7A 3FXDB 2ZMAA 5AQIB 5HYAA 3CX6B 5J2UE 4JEHB 4L0RA 4UR9A 3N9OA 4DR3T 4I55E 5LG4A 3PUYF 2LHNA 3SFDA 5L47A 2BG9A 2XASB 5AFMA 3WI3A 2I0MA 2OA5A 5HEOA 2HH7A 2YK0A 3AEBA 2ODVA 2LSJA 2CHNA 2UUBT 3RYCE 1UCUA 3H3MA 3N2OA 5FXZA 5JDGA 5LHHB 1YXRA 5LYJE 4PAGA 3VU7H 3V5UA 1HX8A 4TUYE 4I43B 3MJXA 3RC8A 5DQWA 3WTJA 2V7MA 2VKJA 2IHR1 4GK5E 2G0UA 1NENA 2BKNA 4COFA 5EK4A 5KMGP 4ZK4A 2JRKA 2IAKA 4UM3S 4EB6E 3EUHA 1UX4A 2VQET 2J62A 3RRCA 1E1HB 1IBLT 1YKEB 2IUBA 5F3JA 4YFSA 5HXSA 2NTYA 3LSVA 4XBFB 2VWAA 3D0TA 3OTOT 2M6IA 2CE7A 5C8YE 5LGTB 3N9LA 2WMNA 3ZPOA 1LRZA 2BS2A 3AEFA 3B13A 2PG8A 2VASA 5JDHA 1J1JA 4B3TT 1W09A 4KUMB 1J5WA 4UVCB 5FYMA 3PU8A 4LFAT 3AAAB 3AA1B 3ZMSB 3I9YA 2JQ9A 2I59A 1Z0PA 3R6NA 2UXDT 1ZHCA 5AQMB 4CI1B 4DMWA 1OEDA 4L5GA 1WR0A 3QNUA 4QXHB 2E9XA 3VR9A 2KINB 5LGUB 3AE4A 4U72A 2BVMA 3AE9A 4TWFA 5AQOB 1WCRA 2EHOB 2WSSV 2XNUA 2FJEA 2BKOA 3MXZA 4ZOLE 2E5LT 4DBMA 2HPLA 3PUSA 2KXPB 2CA5A 4JI3T 3UUNA 1BR0A 2JQQA 2E9XB 2WP9A 4UY2A 2Q9QA 2Y57A 1SUMB 5FY0A 1LVFA 2Y6XA 5E0OA 2WCAA 2AXDS 1HNXT 4MBQA 3V5SA 2YMDA 2AE9A 2ZM6T 5JMEA 2UXCT 4X5TA 4PFOA 3L09A 3SQ9A 3SWHA 5LG3A 5TAOA 5L3BB 5BW2A 2BS4A 3M65A 2YN6A 4MFRA 4LF4T 2KWHA 3RLFF 3I9WA 3KDSE 2YDSA 4ZHQE 3TLWA 1UURA 3OPCA 5HXRA 2WB5A 4XAXB 2XPKA 4X65T 4PJJA 5FL1A 2XNVA 4UVBB 2HHHT 1H7CA 2V6YB 4U3CA 5CA1E 3HKDE 2J1DG 2MBGA 2CXDA 4ADZA 4DV7T 3ETVA 3LK42 3Q9DA 4N78D 4O4IE 4IE6A 2W8FA 4X62T 3AVRA 2BYQA 4JYAT 4KHPT 3RKOA 3PUAA 3VRBA 4B5DA 5HXEA 4EGWA 4ILCA 4IL9A 5AFUL 1L0VA 1FMVA 3ZC0A 2FUPA 3IBPA 2UXBT 5CFBA 1W0BA 4IE4A 4ZS3A 3PTRB 4JI2T 1MIYA 4TZ4C 2KMFA 2V1DB 2ACZA 2N9DA 4DV4T 2XZ5A 5LBQB 3QB5A 1UK5A 2CLYC 3OVUA 3VKGA 4HFIA 2E9XC 3H37A 5JDMA 4JI0T 4HGAA 1WYCA 3ETUA 5SYOA 4AKIA 4AKHA 2WU5A 5FXVA 2V6XA 4ZK1A 4ZJTA 3NBXX 3ZJ2A 5AFJA 2PFVA 4NPPA 4AFGA 2KLQA 3J9X1 2A9UA 3AXJB 3P4RA 4ZI7E 2YU2A 1M7KA 4F6RC 2YOEA 2JMKA 3LK3B 3PJAJ 3BQIA 3FBLA 1IZNB 4LF7T 3OBVE 2QYWA 2NOXA 1WRDA 2W0GA 3RQWA 5FXXA 3E0ZA 4BAYB 4ZS2A 5DABA 4BA9A 2LOSA 3LBXB 2W67A 2C5KT 2GK9A 4IDPA 4TX5A 4HFHA 4XK9A 3U8JA 4YJ2E 2BZBA 4MALA 3RI5A 4D01A 3E08A 4X1IE 2VKOA 3W15B 3P7IA 5ETWA 2CXLA 3F57A 2XM2A 2V7IA 4WBNE 3FHNA 2BYSA 2IMLA 2LM9A 3WTHA 2MOZA 2SPCA 1S35A 4UEMA 1SA0E 4LF8T 2K3WA 4GYSA 4IDNA 4MHCA 1M62A 3ONXA 2ZJUA 3IEEA 4EAHA 4U74A 4YHJA 3UULA 2WZIA 4TNVA 3UUBA 5AFNA 2CLYB 2K48A 3ZMTB 4YY3T 2W62A 5LA6E 3P4PA 1WFDA 3CQCB 3BK9A 2LSYA 1HF8A 1N34T 1LKXA 1XNQT 2CXFA 3VRAA 5LBMA 3M3ZB 3PMZA 4EZ4A 5F5WA 3ZYLA 2WNLA 1T8BA 3IGQA 3AE7A 3RHWA 2LLYA 2A2FX 3EHZA 4ZI3D 1YD8G 2MAWA 5L3EB 2FJBA 4KX6A 3OYXA 4U33A 1XDOA 3ZC1A 1JNZA 3KV4A 1MNEA 2JQKA 2IW5B 4AXPA 4HWIB 4I0UA 2W66A 4IL4A 4UF0A 5FJVA 4ZI2C 3EDUA 4FI5A 3RIUC 3U8MA 2WZHA 4IE5A 1I6ZA 3N2GE 4P09A 4CN6A 1IJ6A 1HNZT 4WYVA 2D0UA 2JJ9A 2H88A 2RA1A 5BMVE 2XAQB 4AQGA 2LKHA 2XQ9A 4NUVA 4UV9B 3PE0A 5AQUB 1U4QA 3TKLB 3B5MA 4BQTA 4E7SA 5J5HA 3EI0A 2C0SA 2Y48B 5J1GA 5JR9B 3QB5K 5AQHB 2WBLA 2XAHB 2X68A 1FEWA 3ANWB 4EOZB 2J4GA 1BR1A 4LMLA 5HEJA 5AQVB 4PK6A 3ONLC 3QOFA 2YMEA 1X9BA 3RYFE 2XYSA 2K5BB 3B57A 4CXWA 4U2ZA 3ZCIA 3AE8A 3EAMA 1T7SA 4DR2T 4TV8E 2OV9A 2NR4A 1R8IA 5AQSB 2LSKA 2YEVC 3N9MA 4NUUA 4QXCB 2W00A 2LJLA 3K1SA 4DBQA 3WAKA 1Y01A 5AINA 3E22E 4O8SA 4DR1T 2WWUA 4YSYA 4O4JE 4LMJA 5BP0A 2D5UA 3MKDA 4JBWF 2CMRA 2YU1A 3N9PA 1W9RA 2WM9A 1E7PA 2NW8A 3SIOA 4ZJSA 2CWOA 2XQ6A 3SFEA 2X0YA 3TLUA 2NWBA 1N36T 3FZFB 3CK6A 3CWZB 4QH4A 2XSBA 2LOPA 5FKYA 2CPTA 1IJ5A 4O2AE 1G73A 2UU9T 4X20E 5AQQB 4EZ1A 3KVBA 3HA4A 2XY8B 4U7IA 2LEHA 4H9PC 3ZDHA 1YQ3A 5LXTE 5HXCA 5AQGB 4PJNA 5ABFB 2ZM0A 2WMOA 4DV5T 3P4WA 3CIRA 3C50A 1KNPA 3FZKB 3ZT5A 4KP3C 3T1YT 3U8NA 1I9BA 1Z8UA 4YSXA 3WTNA 4HFCA 2V5CA 1D0XA 3KV5A 2PJQA 3C79A 3NZQA 4IGUA 2X00A 5AQRB 5CJ5A 4C91A 3PEOA 2DNXA 4YLHA 1UUSA 5AQPB 5FL0A 3SOLA 1MIWA 4YHHT 4B3ST 1N32T 1XWMA 3RPUA 2Y58A 3ZYMA 3KV6A 4DIDB 3CPZA 5KZUA 4KBMB 4IDQA 1VCSA 1CUNA 2MYSA 2MPKA 5ABHA 2Y54A 2ZM8A 3R84B 3CX7B 4DBRA 2Y8DA 3K3QC 5JH7E 4ZRUA 2LHRA 1KFYA 5JDQA 3WTLA 2HPJA 3N2KE 1O3XA 4DV3T 3OJAA 3LBXA 4OX9T 2FJDA 2XNTA 4U31A 4E7ZA 4HEAA 1UX5A 4QACA 2Q9QC 4HKAA 4ERRA 3C84A 4LF9T 2H89A 4YTNA 5HCJA 2K24A 3DTOA 5JDLA 2BR8A 2PH9A 1GQEA 2I6HA 3Q2MA 5J5GA 1WLXA 1FJGT 5FY7A 3ZKRA 4IDZA 2LT3A 4Z90A 3AECA 2IC9A 3CMLA 4I50E 4NXNT 2B1EA 4QAAA 3RIAA 1D0ZA 2JPFA 3LJCA 4PJMA 4HWHA 1XMQT 4AKRB 3NRXA 2IC6A 4G63A 4Z91A 5FXWA 3HKCE 1HX1B 2V26A 2Q9QD 4C90A 2DWKA 4H63H 2QRXA 4B3MT 2B76A 3LG7A 4JEUB 3GA8A 2VL8A 2DWGA 3HR0A 4QH1A 4QX7B 5HWXA 3PUGA 4YJ3E 3FXEB 2XQ3A 3ZSTA 1BR2A 2F4VT 3KVAA 4DR4T 3K3NA 4UM1A 5H6QB 2UUCT 2ES0A 1MMNA 2KSRA 3ZMZB 5ABGA 3A5XA 5FMNA 2P9BA 3ZCJA 4CZZB 3ZN1B 1G8XA 3FBZA 4EEBA 3C4WA 5L4HA 3J7Yq 3KINB 4DO0A 4PFPA 1BR4A 4GYRA 2WN9A 3TLVA 4CI2B 4QWNB 2WS3A 3OKQA 2C9TA 3C51A 1T98A 1NEKA 1YW0A 4AFTA 4UV8B 3UTKA 5KDMC 3L3PA 3A7MA 2X9YA 3K8PC 2DLRA 4HWDA 3H3AA 4WZXA 3TLSA 4OYKA 2QVAA 2KNDA 4CQIA 3MACA 3SH1A 2L3LA 4H9SE 1U5PA 3L8RA 4U7YA 4F8HA 5C2TA 4QX8B 3LK2B 5AQTB 2ZM2A 3I1AA 3RRWA 2NW7A 4EXTA 3O4XE 3KV9A 3T4MA 2H7VC 2WU2A 3Q5XA 4CI3B 3KFWX 3NRYA 3N9NA 3AA0B 1SE7A 2NTXA 2PBIA 3RC3A 5J0ZA 4WW0A 2VKHA 3P50A 3DJBA 3UUXB 4ZR6A 4UM3P 1IBMT 1VRBA 5AQKB 2BBHA 2V7KA 2BR7A 3CQGB 5L3FB 2RPAA 2XQ5A 5FVKA 1E2AA 5JR9A 3WTKA 1ZOYA 4M1PA 2XAGB 4KMCA 4IE0A 3AE2A 3CKDA 4PIRA 5LB7B 2E2AA 4ALXA 2N2NA 2VVSA 3WAJA 2LKGA 2VL0A 4ILBA 5LMUT 5J2TE 5CO5A 2FJAA 3KBUA 4WBOA 3QC9A 3RX6A 3O1IA 1VCTA 1D0YA 2W63A 5ABEA 5AQFB 4BJNA 4U2YA 3CVRA 1OEDC 1ZEEA 3P4SA 3RYIE 3UU8A 4IE7A 3L39A 3X1DA 4EYUA 3U78A 2R6GF 5GONE 4OHFA 4A98A 2X9XA 3JCFA 3UQ4A 4K0KT 4CXXA 5AFKA 4YT0A 2X0LB 3ESLA 4DV1T 4HN9A 5IYZE 4IIJE 3JAEA 2V5DA 1NWMX 3PDYA 2X51A 2X9HA 5LJMA 3RYHE 1KK7A 3F2EA 5JDFA 4TV9E 3K3OA 1B7TA 4TWHA 2V6YA 5CB4E 3Q5EA 2BYNA 5JRCA
chains in the Genus database with same CATH topology
5AFMA 2YOEA 2YMEA 5HEOA 3U8NA 4WV9A 2XYSA 4ZZCA 5J5IA 1I9BA 2C9TA 2BYPA 3PMZA 4PIRA 3ZKRA 3U8LA 4TWFA 2PGZA 4NZBA 1UX2A 2ZJVA 2W8FA 2WNLA 3JADA 4Z90A 5HCMA 3UU3A 4FRRA 3WTNA 3IGQA 4HFCA 3WTIA 4AFTA 4ALXA 3UU5A 5AFLA 2BYQA 2XNUA 4QABA 3EAMA 3C79A 3RHWA 3UQ7A 2LKGA 2VL0A 4ILBA 2LLYA 3RIFA 4LMKA 2X00A 4UM3A 5CO5A 3WTMA 3EHZA 3PEOA 4QAAA 3RIAA 3RQWA 4B5DA 2WZYA 2YKSA 2BG9E 4XHEA 2XZ6A 4DBMA 4ILAA 2MAWA 4ILCA 4AFHA 4IL9A 3ZDGA 4Z91A 2WNCA 4QH5A 3WTJA 2M6BA 2Y58A 3SQ6A 5CFBA 3TLSA 2UZ6A 1OEDC 4IL4A 5J5GA 5FJVA 4COFA 4HFHA 3UU8A 2BG9B 4XK9A 4UY2A 5AINA 2Y57A 5KZUA 2X00D 4ZK4A 5TVCA 2LM2A 4LMJA 2QC1B 4HQPA 3U8JA 5BP0A 4UM3S 3SH1A 4BFQA 3UU6A 3U8MA 3TLTA 4A98A 5AFHA 2XQ4A 4F8HA 2Y54A 2Y7YA 3RI5A 2XZ5A 2Y56A 3UQ4A 1OEDB 5IUXA 3UU4A 4QH1A 2YMDA 3SIOA 4ZJSA 4D01A 3RQUA 5AFKA 2XQ6A 2XQ3A 5JMEA 2BYRA 4X5TA 3LSVA 2W8GA 4IREA 4ZRUA 3T4MA 5KE4A 5HEGA 4HFIA 3WTLA 2M6IA 3TLUA 2BYSA 2LKHA 2BG9C 3WTHA 4QH4A 4HFBA 4HFEA 3SQ9A 1UW6A 2XQ9A 5SYOA 5LG3A 2XQ8A 3U8KA 4UM1A 3GUAA 3WIPA 5BW2A 3JAEA 4TNWA 2YN6A 5J5FA 2KSRA 1OEDE 2XNTA 4ZK1A 3JAFA 4ZJTA 5J0ZA 5HEHA 2XYTA 4BQTA 4EZ1A 5LXBA 2ZJUA 3P50A 4QACA 5J5HA 5L4EA 5AFJA 2XQ7A 3C84A 4ZR6A 3WTOA 2BJ0A 4UM3P 4NPPA 3EI0A 3ZDHA 3TLWA 4UXUA 2BR7A 4AFGA 5HCJA 4TNVA 4TWDA 3UUBA 5AFNA 1UV6A 4HFDA 5BRXA 5AFMB 2BR8A 4TWHA 2WN9A 2XQAA 5HEUA 2PH9A 5L4HA 4A97A 2WNJA 2XQ5A 2XNVA 1OEDA 4LMLA 5HEJA 2BYNA 3P4WA 4ZZBA 5L47A 2BG9A 3WTKA 3TLVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AFM A;  2YOE A;  2YME A;  5HEO A;  3U8N A;  4WV9 A;  2XYS A;  4ZZC A;  5J5I A;  1I9B A;  2C9T A;  2BYP A;  3PMZ A;  4PIR A;  3ZKR A;  3U8L A;  4TWF A;  2PGZ A;  4NZB A;  1UX2 A;  2ZJV A;  2W8F A;  2WNL A;  3JAD A;  4Z90 A;  5HCM A;  3UU3 A;  4FRR A;  3WTN A;  3IGQ A;  4HFC A;  3WTI A;  4AFT A;  4ALX A;  3UU5 A;  5AFL A;  2BYQ A;  2XNU A;  4QAB A;  3EAM A;  3C79 A;  3RHW A;  3UQ7 A;  2LKG A;  2VL0 A;  4ILB A;  2LLY A;  3RIF A;  4LMK A;  2X00 A;  4UM3 A;  5CO5 A;  3WTM A;  3EHZ A;  3PEO A;  4QAA A;  3RIA A;  3RQW A;  4B5D A;  2WZY A;  2YKS A;  2BG9 E;  4XHE A;  2XZ6 A;  4DBM A;  4ILA A;  2MAW A;  4ILC A;  4AFH A;  4IL9 A;  3ZDG A;  4Z91 A;  2WNC A;  4QH5 A;  3WTJ A;  2M6B A;  2Y58 A;  3SQ6 A;  5CFB A;  3TLS A;  2UZ6 A;  1OED C;  4IL4 A;  5J5G A;  5FJV A;  4COF A;  4HFH A;  3UU8 A;  2BG9 B;  4XK9 A;  4UY2 A;  5AIN A;  2Y57 A;  5KZU A;  2X00 D;  4ZK4 A;  5TVC A;  2LM2 A;  4LMJ A;  2QC1 B;  4HQP A;  3U8J A;  5BP0 A;  4UM3 S;  3SH1 A;  4BFQ A;  3UU6 A;  3U8M A;  3TLT A;  4A98 A;  5AFH A;  2XQ4 A;  4F8H A;  2Y54 A;  2Y7Y A;  3RI5 A;  2XZ5 A;  2Y56 A;  3UQ4 A;  1OED B;  5IUX A;  3UU4 A;  4QH1 A;  2YMD A;  3SIO A;  4ZJS A;  4D01 A;  3RQU A;  5AFK A;  2XQ6 A;  2XQ3 A;  5JME A;  2BYR A;  4X5T A;  3LSV A;  2W8G A;  4IRE A;  4ZRU A;  3T4M A;  5KE4 A;  5HEG A;  4HFI A;  3WTL A;  2M6I A;  3TLU A;  2BYS A;  2LKH A;  2BG9 C;  3WTH A;  4QH4 A;  4HFB A;  4HFE A;  3SQ9 A;  1UW6 A;  2XQ9 A;  5SYO A;  5LG3 A;  2XQ8 A;  3U8K A;  4UM1 A;  3GUA A;  3WIP A;  5BW2 A;  3JAE A;  4TNW A;  2YN6 A;  5J5F A;  2KSR A;  1OED E;  2XNT A;  4ZK1 A;  3JAF A;  4ZJT A;  5J0Z A;  5HEH A;  2XYT A;  4BQT A;  4EZ1 A;  5LXB A;  2ZJU A;  3P50 A;  4QAC A;  5J5H A;  5L4E A;  5AFJ A;  2XQ7 A;  3C84 A;  4ZR6 A;  3WTO A;  2BJ0 A;  4UM3 P;  4NPP A;  3EI0 A;  3ZDH A;  3TLW A;  4UXU A;  2BR7 A;  4AFG A;  5HCJ A;  4TNV A;  4TWD A;  3UUB A;  5AFN A;  1UV6 A;  4HFD A;  5BRX A;  5AFM B;  2BR8 A;  4TWH A;  2WN9 A;  2XQA A;  5HEU A;  2PH9 A;  5L4H A;  4A97 A;  2WNJ A;  2XQ5 A;  2XNV A;  1OED A;  4LML A;  5HEJ A;  2BYN A;  3P4W A;  4ZZB A;  5L47 A;  2BG9 A;  3WTK A;  3TLV A; 
#chains in the Genus database with same CATH topology
 4HWC A;  4H9N C;  3IF8 B;  4YXD A;  4ZZC A;  2VVN A;  5LHI B;  4PJL A;  2PGZ A;  3ZN0 B;  5JDN A;  3WTI A;  1S94 A;  1D1B A;  1HG2 A;  1X79 A;  2M67 A;  4UM3 A;  3S4U A;  3VR8 A;  5CA0 E;  5M4Y A;  1D1C A;  4UIG A;  4CXY A;  2WZY A;  5LHG B;  1UGO A;  1AJ3 A;  4HFV A;  4L9I A;  3SS1 A;  2D0T A;  4PK5 A;  5A1L A;  5LMN T;  2WDQ A;  3C4X A;  4O4L E;  4JI6 T;  3IA3 A;  2UZ6 A;  4LFC T;  2L9Q A;  4P1N A;  2BG9 B;  2H7O A;  4X66 T;  5CGM A;  2HN2 A;  2QC1 B;  4HQP A;  2JMH A;  2NW9 A;  3AE3 A;  3NZP A;  3PU3 A;  3UFG A;  4DVD A;  3I0Q A;  1Y64 B;  1IAP A;  5EK3 A;  2WWV A;  2N1G A;  2Y56 A;  5IUX A;  3UU4 A;  4X1Y E;  4AQY T;  2BBJ A;  3ANW A;  2A72 A;  3AE5 A;  3AVS A;  2W8G A;  1HCI A;  3PUW F;  2KT9 A;  4HFB A;  3ZEF B;  4B3R T;  3GUA A;  2WAU A;  4DND A;  4TNW A;  3AA6 B;  2E5V A;  5FY1 A;  4BJM A;  1ZV4 X;  3MK7 C;  4O2B E;  4AKL A;  2PTF A;  1VOM A;  5HXH A;  3N5L A;  2ZLY A;  4UXU A;  4YTM A;  4TWD A;  5HEU A;  1QLB A;  5H6R B;  2D2S A;  1EZ3 A;  4A5X A;  2WNJ A;  2IIU A;  4B6X A;  4ZI2 D;  4FJO A;  5AFH A;  4PW8 A;  1V9D A;  4WV9 A;  2KWI B;  2BVL A;  4J2C A;  4NZB A;  1UX2 A;  3AE6 A;  5AQJ B;  1KNZ A;  4DR7 T;  2FBW A;  2XTL A;  4LMK A;  2LRL A;  4DV6 T;  2BG9 E;  2CEA A;  4QXB B;  4AI6 A;  1XNR T;  2WDR A;  3AA7 B;  1D1A A;  3PUQ A;  2X00 D;  2J47 A;  2DL1 A;  3Q5D A;  5HWY A;  3UU6 A;  4P0A A;  2UXN B;  3PUZ F;  5LCY A;  1KNR A;  4DUY T;  1MMA A;  1MND A;  5FNV E;  3AB3 B;  2A3D A;  1NAF A;  4QHO A;  3PUR A;  2W2U A;  4IRE A;  4GKJ T;  4AQF A;  2LSI A;  2JIW A;  3IHR A;  3UFE A;  4P0B A;  4PK4 A;  3JC6 C;  3U8K A;  2VB6 A;  2K9A A;  2Q9Q B;  4UEL A;  2XQY A;  2XYT A;  2E8I A;  2JQH A;  4I4T E;  2BJ0 A;  3O1J A;  2YIN A;  4H9R C;  5AFM B;  4PNI A;  4DMV A;  3AED A;  4EYY R;  4JI1 T;  2X0H A;  2XAF B;  5LJN A;  5AQN B;  5LP6 E;  4EZH A;  1HG5 A;  3GN5 A;  4K0U A;  5LOV E;  4O4H E;  2CM0 A;  3T8O A;  5C3J A;  4JI4 T;  4KI0 F;  4IST A;  3O1H A;  5J5I A;  2DI4 A;  3HKE E;  2C5I T;  2ZJV A;  3SRZ A;  3BQK A;  4EED A;  3UU3 A;  1ZKE A;  5AFL A;  3UU5 A;  4QAB A;  5L3D B;  3UQ7 A;  5FP3 A;  3DP7 A;  3PUX F;  4EIW A;  2XM1 A;  3I0O A;  4ZXL A;  2BS3 A;  1OXZ A;  4ZI3 C;  3ZMU B;  4X64 T;  5ABF A;  3ZYK A;  4QH5 A;  2M6B A;  3CQX C;  1US7 B;  4YTP A;  2LM2 A;  3AEA A;  2X9W A;  4BFQ A;  2YDQ A;  5L3C B;  4DV0 T;  2Z6E A;  4EV6 A;  4XZC A;  4DUZ T;  5DQV A;  1T72 A;  3RQU A;  4CN1 A;  4HWF A;  3AEE A;  2DCF A;  4HTE A;  2BYR A;  3P8C D;  4KHZ F;  3ZT6 A;  5KE4 A;  5F8P A;  2XZE A;  4MLK A;  4JI5 T;  3AAE B;  1XDP A;  3VKH A;  4G2A A;  3HI2 A;  5J5F A;  2EHO D;  3RIU A;  3RKG A;  5LXB A;  4GK0 E;  1FMW A;  3WTO A;  1UV6 A;  5BRX A;  4A97 A;  4AQF C;  3ZT7 A;  2UUA T;  4HE8 A;  2XSA A;  3PJA A;  2CWY A;  2VK9 A;  3RH3 A;  2LE8 A;  2C5J A;  4ZEY A;  2V7J A;  5HCM A;  2W4X A;  4JI7 T;  3T1H T;  3RIF A;  3EAB A;  3LFM A;  1ZP0 A;  3BQL A;  5BR8 T;  5IHY A;  2YKS A;  5EZY E;  4XHE A;  3GMI A;  1YKH B;  4CN4 A;  1KF6 A;  4NXM T;  4UVA B;  2EHO C;  2WNC A;  3OYZ A;  1W0A A;  3RF1 A;  3FB2 A;  4IDO A;  3QK6 A;  4JUY A;  1WR6 A;  3MA9 A;  3PV0 F;  2L8K A;  3TLT A;  5EK2 A;  1OED B;  1YQ4 A;  4YSZ A;  2YDR A;  4ILU A;  1FIO A;  1WYB A;  4H63 V;  2IDO B;  5HEG A;  1UW6 A;  2EHO A;  2X66 A;  2X67 A;  3FZM B;  2CBI A;  3EVY A;  3JAF A;  5L4E A;  1XZY A;  3UUM A;  2NP9 A;  3N9Q A;  3EDV A;  3NWI A;  5L3G B;  3GN5 B;  2XQA A;  4LFB T;  1HTJ F;  4V1A v;  1QUU A;  3VHL A;  3ZMV B;  3ZJ1 A;  2V7L A;  5L2L A;  2H3R A;  2UXX B;  2QGS A;  3PUV F;  4AIS A;  2VUR A;  3MZK B;  5DJQ C;  5JRC B;  3ONJ A;  2E9X D;  5FVL A;  2CRB A;  4ANJ A;  3CX8 B;  2WQY A;  1N33 T;  1HR0 T;  2XZ6 A;  5LGN B;  3KBT A;  3QUJ A;  3SQ6 A;  4JI8 T;  4IHJ E;  5JR9 C;  2BKP A;  3C4Z A;  3AE1 A;  4UF0 B;  2XQ4 A;  2DHR A;  4OYJ A;  4OK0 A;  4LF5 T;  3HKB E;  4A56 A;  4AKG A;  3F31 A;  4GOU A;  1DU2 A;  3FZH B;  1OWA A;  2W61 A;  1QSD A;  4HFE A;  4DV2 T;  2D9D A;  2RP4 A;  3JC6 D;  1OED E;  4ISS A;  5HEH A;  3P4Q A;  2V8S V;  4IT4 A;  3C64 A;  3NVO A;  3HL6 A;  4QKN A;  1IBK T;  3AEG A;  5AQL B;  4HFD A;  4ASK A;  4JV5 T;  2QA7 A;  4ZZB A;  3UT5 E;  3AAI A;  4LF6 T;  2ACX A;  4UXN B;  2WDV A;  5KXJ A;  2VQF T;  4GIW A;  4DR6 T;  3RGL A;  4H9O C;  5JRE A;  1I94 T;  4X1K E;  2HN1 A;  5KX5 E;  2BYP A;  2CCQ A;  1JNR A;  2CBJ A;  1HNW T;  3U8L A;  3JAD A;  5ADX L;  4FRR A;  3FZL B;  5HAX A;  4NIQ A;  5JQG E;  1HFA A;  1CHU A;  4JLE A;  3WTM A;  2KZ7 B;  2WY2 A;  3GWH A;  3O9X A;  5JTG A;  3G06 A;  4ILA A;  2BDE A;  4TN7 B;  1MIV A;  4AFH A;  3ZDG A;  5JVD E;  5LNK A;  1J5E T;  2LRK A;  4H9Q C;  3Q5W A;  3NKZ A;  4WNK A;  1LVK A;  5TVC A;  2XUE A;  2XHE B;  2VKD A;  3AXJ A;  2MTQ A;  3U3I A;  2Y7Y A;  2LSG A;  4OFZ A;  1HS7 A;  2XJ7 A;  1KEY A;  3ZSS A;  4DR5 T;  4AIU A;  5IWA T;  2ODU A;  4GKK T;  3A8Y C;  2BG9 C;  1MMG A;  4Q25 A;  1XMO T;  2CHO A;  2XQ8 A;  1SHZ C;  3WIP A;  4Z8X A;  3C98 B;  2XAJ B;  2OLT A;  3ABV A;  3ZLI A;  3LDQ B;  1MMD A;  2XQ7 A;  3FXD B;  2ZMA A;  5AQI B;  5HYA A;  3CX6 B;  5J2U E;  4JEH B;  4L0R A;  4UR9 A;  3N9O A;  4DR3 T;  4I55 E;  5LG4 A;  3PUY F;  2LHN A;  3SFD A;  5L47 A;  2BG9 A;  2XAS B;  5AFM A;  3WI3 A;  2I0M A;  2OA5 A;  5HEO A;  2HH7 A;  2YK0 A;  3AEB A;  2ODV A;  2LSJ A;  2CHN A;  2UUB T;  3RYC E;  1UCU A;  3H3M A;  3N2O A;  5FXZ A;  5JDG A;  5LHH B;  1YXR A;  5LYJ E;  4PAG A;  3VU7 H;  3V5U A;  1HX8 A;  4TUY E;  4I43 B;  3MJX A;  3RC8 A;  5DQW A;  3WTJ A;  2V7M A;  2VKJ A;  2IHR 1;  4GK5 E;  2G0U A;  1NEN A;  2BKN A;  4COF A;  5EK4 A;  5KMG P;  4ZK4 A;  2JRK A;  2IAK A;  4UM3 S;  4EB6 E;  3EUH A;  1UX4 A;  2VQE T;  2J62 A;  3RRC A;  1E1H B;  1IBL T;  1YKE B;  2IUB A;  5F3J A;  4YFS A;  5HXS A;  2NTY A;  3LSV A;  4XBF B;  2VWA A;  3D0T A;  3OTO T;  2M6I A;  2CE7 A;  5C8Y E;  5LGT B;  3N9L A;  2WMN A;  3ZPO A;  1LRZ A;  2BS2 A;  3AEF A;  3B13 A;  2PG8 A;  2VAS A;  5JDH A;  1J1J A;  4B3T T;  1W09 A;  4KUM B;  1J5W A;  4UVC B;  5FYM A;  3PU8 A;  4LFA T;  3AAA B;  3AA1 B;  3ZMS B;  3I9Y A;  2JQ9 A;  2I59 A;  1Z0P A;  3R6N A;  2UXD T;  1ZHC A;  5AQM B;  4CI1 B;  4DMW A;  1OED A;  4L5G A;  1WR0 A;  3QNU A;  4QXH B;  2E9X A;  3VR9 A;  2KIN B;  5LGU B;  3AE4 A;  4U72 A;  2BVM A;  3AE9 A;  4TWF A;  5AQO B;  1WCR A;  2EHO B;  2WSS V;  2XNU A;  2FJE A;  2BKO A;  3MXZ A;  4ZOL E;  2E5L T;  4DBM A;  2HPL A;  3PUS A;  2KXP B;  2CA5 A;  4JI3 T;  3UUN A;  1BR0 A;  2JQQ A;  2E9X B;  2WP9 A;  4UY2 A;  2Q9Q A;  2Y57 A;  1SUM B;  5FY0 A;  1LVF A;  2Y6X A;  5E0O A;  2WCA A;  2AXD S;  1HNX T;  4MBQ A;  3V5S A;  2YMD A;  2AE9 A;  2ZM6 T;  5JME A;  2UXC T;  4X5T A;  4PFO A;  3L09 A;  3SQ9 A;  3SWH A;  5LG3 A;  5TAO A;  5L3B B;  5BW2 A;  2BS4 A;  3M65 A;  2YN6 A;  4MFR A;  4LF4 T;  2KWH A;  3RLF F;  3I9W A;  3KDS E;  2YDS A;  4ZHQ E;  3TLW A;  1UUR A;  3OPC A;  5HXR A;  2WB5 A;  4XAX B;  2XPK A;  4X65 T;  4PJJ A;  5FL1 A;  2XNV A;  4UVB B;  2HHH T;  1H7C A;  2V6Y B;  4U3C A;  5CA1 E;  3HKD E;  2J1D G;  2MBG A;  2CXD A;  4ADZ A;  4DV7 T;  3ETV A;  3LK4 2;  3Q9D A;  4N78 D;  4O4I E;  4IE6 A;  2W8F A;  4X62 T;  3AVR A;  2BYQ A;  4JYA T;  4KHP T;  3RKO A;  3PUA A;  3VRB A;  4B5D A;  5HXE A;  4EGW A;  4ILC A;  4IL9 A;  5AFU L;  1L0V A;  1FMV A;  3ZC0 A;  2FUP A;  3IBP A;  2UXB T;  5CFB A;  1W0B A;  4IE4 A;  4ZS3 A;  3PTR B;  4JI2 T;  1MIY A;  4TZ4 C;  2KMF A;  2V1D B;  2ACZ A;  2N9D A;  4DV4 T;  2XZ5 A;  5LBQ B;  3QB5 A;  1UK5 A;  2CLY C;  3OVU A;  3VKG A;  4HFI A;  2E9X C;  3H37 A;  5JDM A;  4JI0 T;  4HGA A;  1WYC A;  3ETU A;  5SYO A;  4AKI A;  4AKH A;  2WU5 A;  5FXV A;  2V6X A;  4ZK1 A;  4ZJT A;  3NBX X;  3ZJ2 A;  5AFJ A;  2PFV A;  4NPP A;  4AFG A;  2KLQ A;  3J9X 1;  2A9U A;  3AXJ B;  3P4R A;  4ZI7 E;  2YU2 A;  1M7K A;  4F6R C;  2YOE A;  2JMK A;  3LK3 B;  3PJA J;  3BQI A;  3FBL A;  1IZN B;  4LF7 T;  3OBV E;  2QYW A;  2NOX A;  1WRD A;  2W0G A;  3RQW A;  5FXX A;  3E0Z A;  4BAY B;  4ZS2 A;  5DAB A;  4BA9 A;  2LOS A;  3LBX B;  2W67 A;  2C5K T;  2GK9 A;  4IDP A;  4TX5 A;  4HFH A;  4XK9 A;  3U8J A;  4YJ2 E;  2BZB A;  4MAL A;  3RI5 A;  4D01 A;  3E08 A;  4X1I E;  2VKO A;  3W15 B;  3P7I A;  5ETW A;  2CXL A;  3F57 A;  2XM2 A;  2V7I A;  4WBN E;  3FHN A;  2BYS A;  2IML A;  2LM9 A;  3WTH A;  2MOZ A;  2SPC A;  1S35 A;  4UEM A;  1SA0 E;  4LF8 T;  2K3W A;  4GYS A;  4IDN A;  4MHC A;  1M62 A;  3ONX A;  2ZJU A;  3IEE A;  4EAH A;  4U74 A;  4YHJ A;  3UUL A;  2WZI A;  4TNV A;  3UUB A;  5AFN A;  2CLY B;  2K48 A;  3ZMT B;  4YY3 T;  2W62 A;  5LA6 E;  3P4P A;  1WFD A;  3CQC B;  3BK9 A;  2LSY A;  1HF8 A;  1N34 T;  1LKX A;  1XNQ T;  2CXF A;  3VRA A;  5LBM A;  3M3Z B;  3PMZ A;  4EZ4 A;  5F5W A;  3ZYL A;  2WNL A;  1T8B A;  3IGQ A;  3AE7 A;  3RHW A;  2LLY A;  2A2F X;  3EHZ A;  4ZI3 D;  1YD8 G;  2MAW A;  5L3E B;  2FJB A;  4KX6 A;  3OYX A;  4U33 A;  1XDO A;  3ZC1 A;  1JNZ A;  3KV4 A;  1MNE A;  2JQK A;  2IW5 B;  4AXP A;  4HWI B;  4I0U A;  2W66 A;  4IL4 A;  4UF0 A;  5FJV A;  4ZI2 C;  3EDU A;  4FI5 A;  3RIU C;  3U8M A;  2WZH A;  4IE5 A;  1I6Z A;  3N2G E;  4P09 A;  4CN6 A;  1IJ6 A;  1HNZ T;  4WYV A;  2D0U A;  2JJ9 A;  2H88 A;  2RA1 A;  5BMV E;  2XAQ B;  4AQG A;  2LKH A;  2XQ9 A;  4NUV A;  4UV9 B;  3PE0 A;  5AQU B;  1U4Q A;  3TKL B;  3B5M A;  4BQT A;  4E7S A;  5J5H A;  3EI0 A;  2C0S A;  2Y48 B;  5J1G A;  5JR9 B;  3QB5 K;  5AQH B;  2WBL A;  2XAH B;  2X68 A;  1FEW A;  3ANW B;  4EOZ B;  2J4G A;  1BR1 A;  4LML A;  5HEJ A;  5AQV B;  4PK6 A;  3ONL C;  3QOF A;  2YME A;  1X9B A;  3RYF E;  2XYS A;  2K5B B;  3B57 A;  4CXW A;  4U2Z A;  3ZCI A;  3AE8 A;  3EAM A;  1T7S A;  4DR2 T;  4TV8 E;  2OV9 A;  2NR4 A;  1R8I A;  5AQS B;  2LSK A;  2YEV C;  3N9M A;  4NUU A;  4QXC B;  2W00 A;  2LJL A;  3K1S A;  4DBQ A;  3WAK A;  1Y01 A;  5AIN A;  3E22 E;  4O8S A;  4DR1 T;  2WWU A;  4YSY A;  4O4J E;  4LMJ A;  5BP0 A;  2D5U A;  3MKD A;  4JBW F;  2CMR A;  2YU1 A;  3N9P A;  1W9R A;  2WM9 A;  1E7P A;  2NW8 A;  3SIO A;  4ZJS A;  2CWO A;  2XQ6 A;  3SFE A;  2X0Y A;  3TLU A;  2NWB A;  1N36 T;  3FZF B;  3CK6 A;  3CWZ B;  4QH4 A;  2XSB A;  2LOP A;  5FKY A;  2CPT A;  1IJ5 A;  4O2A E;  1G73 A;  2UU9 T;  4X20 E;  5AQQ B;  4EZ1 A;  3KVB A;  3HA4 A;  2XY8 B;  4U7I A;  2LEH A;  4H9P C;  3ZDH A;  1YQ3 A;  5LXT E;  5HXC A;  5AQG B;  4PJN A;  5ABF B;  2ZM0 A;  2WMO A;  4DV5 T;  3P4W A;  3CIR A;  3C50 A;  1KNP A;  3FZK B;  3ZT5 A;  4KP3 C;  3T1Y T;  3U8N A;  1I9B A;  1Z8U A;  4YSX A;  3WTN A;  4HFC A;  2V5C A;  1D0X A;  3KV5 A;  2PJQ A;  3C79 A;  3NZQ A;  4IGU A;  2X00 A;  5AQR B;  5CJ5 A;  4C91 A;  3PEO A;  2DNX A;  4YLH A;  1UUS A;  5AQP B;  5FL0 A;  3SOL A;  1MIW A;  4YHH T;  4B3S T;  1N32 T;  1XWM A;  3RPU A;  2Y58 A;  3ZYM A;  3KV6 A;  4DID B;  3CPZ A;  5KZU A;  4KBM B;  4IDQ A;  1VCS A;  1CUN A;  2MYS A;  2MPK A;  5ABH A;  2Y54 A;  2ZM8 A;  3R84 B;  3CX7 B;  4DBR A;  2Y8D A;  3K3Q C;  5JH7 E;  4ZRU A;  2LHR A;  1KFY A;  5JDQ A;  3WTL A;  2HPJ A;  3N2K E;  1O3X A;  4DV3 T;  3OJA A;  3LBX A;  4OX9 T;  2FJD A;  2XNT A;  4U31 A;  4E7Z A;  4HEA A;  1UX5 A;  4QAC A;  2Q9Q C;  4HKA A;  4ERR A;  3C84 A;  4LF9 T;  2H89 A;  4YTN A;  5HCJ A;  2K24 A;  3DTO A;  5JDL A;  2BR8 A;  2PH9 A;  1GQE A;  2I6H A;  3Q2M A;  5J5G A;  1WLX A;  1FJG T;  5FY7 A;  3ZKR A;  4IDZ A;  2LT3 A;  4Z90 A;  3AEC A;  2IC9 A;  3CML A;  4I50 E;  4NXN T;  2B1E A;  4QAA A;  3RIA A;  1D0Z A;  2JPF A;  3LJC A;  4PJM A;  4HWH A;  1XMQ T;  4AKR B;  3NRX A;  2IC6 A;  4G63 A;  4Z91 A;  5FXW A;  3HKC E;  1HX1 B;  2V26 A;  2Q9Q D;  4C90 A;  2DWK A;  4H63 H;  2QRX A;  4B3M T;  2B76 A;  3LG7 A;  4JEU B;  3GA8 A;  2VL8 A;  2DWG A;  3HR0 A;  4QH1 A;  4QX7 B;  5HWX A;  3PUG A;  4YJ3 E;  3FXE B;  2XQ3 A;  3ZST A;  1BR2 A;  2F4V T;  3KVA A;  4DR4 T;  3K3N A;  4UM1 A;  5H6Q B;  2UUC T;  2ES0 A;  1MMN A;  2KSR A;  3ZMZ B;  5ABG A;  3A5X A;  5FMN A;  2P9B A;  3ZCJ A;  4CZZ B;  3ZN1 B;  1G8X A;  3FBZ A;  4EEB A;  3C4W A;  5L4H A;  3J7Y q;  3KIN B;  4DO0 A;  4PFP A;  1BR4 A;  4GYR A;  2WN9 A;  3TLV A;  4CI2 B;  4QWN B;  2WS3 A;  3OKQ A;  2C9T A;  3C51 A;  1T98 A;  1NEK A;  1YW0 A;  4AFT A;  4UV8 B;  3UTK A;  5KDM C;  3L3P A;  3A7M A;  2X9Y A;  3K8P C;  2DLR A;  4HWD A;  3H3A A;  4WZX A;  3TLS A;  4OYK A;  2QVA A;  2KND A;  4CQI A;  3MAC A;  3SH1 A;  2L3L A;  4H9S E;  1U5P A;  3L8R A;  4U7Y A;  4F8H A;  5C2T A;  4QX8 B;  3LK2 B;  5AQT B;  2ZM2 A;  3I1A A;  3RRW A;  2NW7 A;  4EXT A;  3O4X E;  3KV9 A;  3T4M A;  2H7V C;  2WU2 A;  3Q5X A;  4CI3 B;  3KFW X;  3NRY A;  3N9N A;  3AA0 B;  1SE7 A;  2NTX A;  2PBI A;  3RC3 A;  5J0Z A;  4WW0 A;  2VKH A;  3P50 A;  3DJB A;  3UUX B;  4ZR6 A;  4UM3 P;  1IBM T;  1VRB A;  5AQK B;  2BBH A;  2V7K A;  2BR7 A;  3CQG B;  5L3F B;  2RPA A;  2XQ5 A;  5FVK A;  1E2A A;  5JR9 A;  3WTK A;  1ZOY A;  4M1P A;  2XAG B;  4KMC A;  4IE0 A;  3AE2 A;  3CKD A;  4PIR A;  5LB7 B;  2E2A A;  4ALX A;  2N2N A;  2VVS A;  3WAJ A;  2LKG A;  2VL0 A;  4ILB A;  5LMU T;  5J2T E;  5CO5 A;  2FJA A;  3KBU A;  4WBO A;  3QC9 A;  3RX6 A;  3O1I A;  1VCT A;  1D0Y A;  2W63 A;  5ABE A;  5AQF B;  4BJN A;  4U2Y A;  3CVR A;  1OED C;  1ZEE A;  3P4S A;  3RYI E;  3UU8 A;  4IE7 A;  3L39 A;  3X1D A;  4EYU A;  3U78 A;  2R6G F;  5GON E;  4OHF A;  4A98 A;  2X9X A;  3JCF A;  3UQ4 A;  4K0K T;  4CXX A;  5AFK A;  4YT0 A;  2X0L B;  3ESL A;  4DV1 T;  4HN9 A;  5IYZ E;  4IIJ E;  3JAE A;  2V5D A;  1NWM X;  3PDY A;  2X51 A;  2X9H A;  5LJM A;  3RYH E;  1KK7 A;  3F2E A;  5JDF A;  4TV9 E;  3K3O A;  1B7T A;  4TWH A;  2V6Y A;  5CB4 E;  3Q5E A;  2BYN A;  5JRC A; 
#chains in the Genus database with same CATH homology
 5AFM A;  2YOE A;  2YME A;  5HEO A;  3U8N A;  4WV9 A;  2XYS A;  4ZZC A;  5J5I A;  1I9B A;  2C9T A;  2BYP A;  3PMZ A;  4PIR A;  3ZKR A;  3U8L A;  4TWF A;  2PGZ A;  4NZB A;  1UX2 A;  2ZJV A;  2W8F A;  2WNL A;  3JAD A;  4Z90 A;  5HCM A;  3UU3 A;  4FRR A;  3WTN A;  3IGQ A;  4HFC A;  3WTI A;  4AFT A;  4ALX A;  3UU5 A;  5AFL A;  2BYQ A;  2XNU A;  4QAB A;  3EAM A;  3C79 A;  3RHW A;  3UQ7 A;  2LKG A;  2VL0 A;  4ILB A;  2LLY A;  3RIF A;  4LMK A;  2X00 A;  4UM3 A;  5CO5 A;  3WTM A;  3EHZ A;  3PEO A;  4QAA A;  3RIA A;  3RQW A;  4B5D A;  2WZY A;  2YKS A;  2BG9 E;  4XHE A;  2XZ6 A;  4DBM A;  4ILA A;  2MAW A;  4ILC A;  4AFH A;  4IL9 A;  3ZDG A;  4Z91 A;  2WNC A;  4QH5 A;  3WTJ A;  2M6B A;  2Y58 A;  3SQ6 A;  5CFB A;  3TLS A;  2UZ6 A;  1OED C;  4IL4 A;  5J5G A;  5FJV A;  4COF A;  4HFH A;  3UU8 A;  2BG9 B;  4XK9 A;  4UY2 A;  5AIN A;  2Y57 A;  5KZU A;  2X00 D;  4ZK4 A;  5TVC A;  2LM2 A;  4LMJ A;  2QC1 B;  4HQP A;  3U8J A;  5BP0 A;  4UM3 S;  3SH1 A;  4BFQ A;  3UU6 A;  3U8M A;  3TLT A;  4A98 A;  5AFH A;  2XQ4 A;  4F8H A;  2Y54 A;  2Y7Y A;  3RI5 A;  2XZ5 A;  2Y56 A;  3UQ4 A;  1OED B;  5IUX A;  3UU4 A;  4QH1 A;  2YMD A;  3SIO A;  4ZJS A;  4D01 A;  3RQU A;  5AFK A;  2XQ6 A;  2XQ3 A;  5JME A;  2BYR A;  4X5T A;  3LSV A;  2W8G A;  4IRE A;  4ZRU A;  3T4M A;  5KE4 A;  5HEG A;  4HFI A;  3WTL A;  2M6I A;  3TLU A;  2BYS A;  2LKH A;  2BG9 C;  3WTH A;  4QH4 A;  4HFB A;  4HFE A;  3SQ9 A;  1UW6 A;  2XQ9 A;  5SYO A;  5LG3 A;  2XQ8 A;  3U8K A;  4UM1 A;  3GUA A;  3WIP A;  5BW2 A;  3JAE A;  4TNW A;  2YN6 A;  5J5F A;  2KSR A;  1OED E;  2XNT A;  4ZK1 A;  3JAF A;  4ZJT A;  5J0Z A;  5HEH A;  2XYT A;  4BQT A;  4EZ1 A;  5LXB A;  2ZJU A;  3P50 A;  4QAC A;  5J5H A;  5L4E A;  5AFJ A;  2XQ7 A;  3C84 A;  4ZR6 A;  3WTO A;  2BJ0 A;  4UM3 P;  4NPP A;  3EI0 A;  3ZDH A;  3TLW A;  4UXU A;  2BR7 A;  4AFG A;  5HCJ A;  4TNV A;  4TWD A;  3UUB A;  5AFN A;  1UV6 A;  4HFD A;  5BRX A;  5AFM B;  2BR8 A;  4TWH A;  2WN9 A;  2XQA A;  5HEU A;  2PH9 A;  5L4H A;  4A97 A;  2WNJ A;  2XQ5 A;  2XNV A;  1OED A;  4LML A;  5HEJ A;  2BYN A;  3P4W A;  4ZZB A;  5L47 A;  2BG9 A;  3WTK A;  3TLV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...