4IL4A

The pentameric ligand-gated ion channel glic in complex with se-ddm
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural basis for ion permeation mechanism in pentameric ligand-gated ion channels.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 98
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4il4A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4il4A01
3RQUA 5L4HA 2Y58A 4ZRUA 4HFIA 2VL0A 4PIRA 4ZZBA 2W8FA 4HQPA 2XQ8A 5HEOA 2BG9B 2YOEA 4BQTA 4WV9A 4TNVA 4QACA 2YKSA 4HFDA 3UU5A 5FJVA 4HFHA 3ZDHA 4BFQA 1UW6A 3UUBA 3TLVA 4XHEA 4ZJSA 4AFHA 5BRXA 2Y7YA 5HEGA 2XQ5A 3P50A 4ILAA 3GUAA 5AFLA 5BP0A 2ZJUA 3C79A 4ZR6A 3U8NA 5J0ZA 3WTMA 5L47A 4QAAA 4QH5A 4A98A 2Y57A 2BG9C 2ZJVA 3WTNA 5HEHA 2WZYA 4UM1A 5AFKA 3EI0A 4TNWA 4Z91A 4D01A 4ZJTA 1I9BA 4F8HA 3UQ7A 2XQ3A 2XNUA 3TLTA 5CO5A 5J5HA 4NPPA 4Z90A 2LLYA 5HEUA 4QABA 4AFTA 3WTLA 4ILBA 4QH1A 3WIPA 1OEDE 5J5GA 3SIOA 3WTKA 2WNCA 5SYOA 3LSVA 5CFBA 3IGQA 4B5DA 3C84A 5AFMB 3P4WA 3UQ4A 3RI5A 5AFNA 4EZ1A 5TVCA 3U8MA 3WTOA 5KE4A 2MAWA 2LKHA 5HCJA 4ZK1A 3ZKRA 3EAMA 2BG9A 3UU3A 2WN9A 2XQ6A 3JADA 2XYSA 3SQ6A 4IREA 4UM3P 2XYTA 4LMLA 3JAEA 2C9TA 2Y54A 1OEDB 3SH1A 2M6IA 2X00A 3T4MA 2XQ4A 5AFJA 4UM3S 3RIAA 3WTIA 4QH4A 3SQ9A 2LKGA 5HEJA 4UXUA 3TLUA 5LG3A 4NZBA 3U8KA 2BG9E 4COFA 4DBMA 2BYPA 2BYQA 2X00D 3U8JA 5AINA 5J5IA 5KZUA 2XNTA 5LXBA 2YN6A 4LMKA 4TWHA 4A97A 2XZ5A 2Y56A 2XQ7A 4HFEA 2BYRA 2QC1B 3U8LA 2BYSA 3WTJA 3UU8A 5J5FA 4HFBA 3UU6A 4IL4A 2UZ6A 2XQ9A 3PEOA 3PMZA 3RHWA 3TLSA 4ZZCA 2BJ0A 4TWFA 2PH9A 4HFCA 5BW2A 2LM2A 1UV6A 2WNJA 5AFMA 5JMEA 3TLWA 4IL9A 4X5TA 5HCMA 2YMEA 2WNLA 2XQAA 2W8GA 3JAFA 4ILCA 3WTHA 2BYNA 5AFHA 4UY2A 5L4EA 5IUXA 4FRRA 2BR7A 4UM3A 1OEDA 4XK9A 2M6BA 2BR8A 2XZ6A 3UU4A 1UX2A 1OEDC 4LMJA 3RIFA 3RQWA 3EHZA 2XNVA 2KSRA 2PGZA 4ALXA 4AFGA 2YMDA 4ZK4A 4TWDA 3ZDGA
chains in the Genus database with same CATH superfamily
2LOPA 4X1YE 3OKQA 4BQTA 4JI1T 2DWGA 2KWHA 2ZM6T 3O1IA 2Y7YA 2HPJA 3CKDA 1L0VA 3C79A 3U8NA 2ACZA 4H9PC 4TX5A 3AE2A 2UXCT 2I6HA 2JQ9A 3NZQA 2C5IT 5L3FB 1XZYA 1S94A 3ESLA 4YSXA 2X0LB 3ZC1A 3CQXC 4CXWA 1V9DA 1HNWT 4ZK1A 1SA0E 2YDSA 3ZKRA 4EEDA 3UU3A 4YHHT 4LFCT 5AQQB 5HXHA 3RKOA 5AFUL 4DV4T 1N36T 1E1HB 2XPKA 4UM3S 3WTIA 5FKYA 2LKGA 2BS2A 2X51A 2LEHA 4L0RA 2N2NA 4LF8T 1UUSA 1H7CA 5BMVE 4HFEA 3ZMSB 2MPKA 2V6XA 3UU6A 3GN5B 2WDQA 3VR8A 1JNZA 5LB7B 3KDSE 3NRYA 5FXWA 4JEUB 4IE5A 3QK6A 3LDQB 4AIUA 4FRRA 2M6BA 2BR8A 4WNKA 1WCRA 2DHRA 4DUZT 4DR4T 4KMCA 2YMDA 4PNIA 2EHOD 4AKHA 2BVMA 4ZRUA 1HNZT 5CA0E 3LG7A 4HQPA 2CLYC 3C51A 4BFQA 3TLVA 3R84B 2XZEA 2EHOC 2W00A 3C64A 3I0QA 5L3EB 3RC3A 2ZJVA 2L8KA 3WTNA 2LSIA 3H3MA 5AQIB 3IA3A 3X1DA 4QH1A 1IJ5A 4DV2T 2PJQA 1W0AA 4HE8A 3C84A 4JUYA 1NAFA 4JEHB 4H9RC 4UVCB 2HN1A 1WYCA 3QC9A 2Y54A 2A3DA 3PUQA 3ZMVB 2LM9A 2WDRA 3HKBE 2BVLA 3C4ZA 2BKOA 2X0HA 3ONLC 1WYBA 5JDLA 2A2FX 2BG9E 5FL0A 3KV6A 4QWNB 3F57A 4LMKA 4UIGA 5AQOB 1R8IA 3GA8A 4U72A 4DR7T 2BYSA 4ZHQE 3JC6D 4UF0A 3PMZA 5BW2A 2W66A 3WAJA 4YXDA 1SHZC 5A1LA 1OEDA 5TAOA 3NZPA 4PJJA 3KBTA 1HNXT 5EK4A 2XZ6A 1HR0T 4IE7A 3O1JA 4V1Av 3G06A 5FXZA 4DO0A 4ZI3C 1IBKT 2E2AA 4TWDA 3ZDGA 2CBIA 5AQSB 1WR0A 3MZKB 3VKGA 1YKEB 2J47A 3RIUA 1MIYA 4HFHA 4ZJSA 4X62T 2RP4A 3C98B 4QAAA 4NUUA 4HN9A 5HXRA 2SPCA 4AQFC 3NRXA 4NPPA 4DBQA 4A5XA 2UU9T 3WTLA 3UUMA 4ISTA 1VCSA 2YU2A 5JDMA 2JQQA 5JRCB 2QYWA 4X1KE 4TUYE 3RLFF 2WM9A 4FI5A 2M6IA 2IW5B 2X66A 2XQ4A 3Q5XA 4PFOA 4QH4A 5HEJA 3ZN1B 5H6QB 2BYQA 3U8JA 3ZYKA 4EEBA 4GK0E 4Z8XA 5EK2A 4NXNT 1MMNA 1UV6A 4IDNA 4IGUA 2V7MA 3JAFA 1HFAA 3PURA 4AKLA 4JI4T 2BYNA 5LBMA 4IE4A 1XMQT 4UM3A 4IDQA 2BS4A 2VWAA 1YKHB 3N9PA 1IAPA 4X20E 4WBNE 4UVAB 1LVKA 3AEFA 3O4XE 3AA7B 4IE0A 4O8SA 3MA9A 2JQHA 5JR9B 5FP3A 2WMOA 3ANWB 5HEGA 5EK3A 5L2LA 3M3ZB 2CMRA 5BP0A 3PTRB 1XMOT 4QH5A 4LF9T 2BG9C 5JDQA 2XSAA 1UK5A 4Z91A 2XQ3A 2V26A 3PDYA 1O3XA 5LHGB 2VKJA 1UCUA 3AE5A 3RRWA 3WTOA 4GIWA 2Z6EA 3AVSA 4YY3T 3L39A 3Q2MA 3P4RA 2VKDA 4CN4A 2WS3A 5CGMA 2XQYA 4C91A 3I0OA 2CA5A 2Q9QA 3AAAB 4CI3B 2XAGB 3AE7A 3IHRA 2P9BA 4P1NA 2YN6A 3U3IA 3N9OA 3RRCA 1E2AA 1N32T 4JI2T 5JQGE 1M62A 4I4TE 5AFHA 4DV6T 5LGNB 5BR8T 2C5KT 3ZJ1A 5LCYA 1UX4A 1UX2A 3ZCJA 2VKOA 4O2AE 4AFGA 3T4MA 5FXXA 2LE8A 4YSYA 2LHRA 5FYMA 5JDNA 3QB5K 4WV9A 2W63A 2YU1A 3AXJA 3DP7A 4ZR6A 4TNWA 1FMWA 3UQ7A 2VQFT 5J5HA 4QXCB 5FXVA 2RPAA 4IIJE 4QABA 5J5GA 2JPFA 5FNVE 4G2AA 3KINB 3ZT7A 4X66T 3WAKA 1HTJF 3EAMA 3VKHA 1YD8G 4AI6A 5JVDE 3VR9A 2CWYA 5LOVE 1LKXA 5JDHA 2DL1A 2VKHA 3PUWF 5JR9C 2A9UA 4Q25A 3LFMA 1FJGT 4TV8E 3C50A 4GKJT 4H9SE 3SRZA 4YTMA 1HCIA 3T1YT 2BDEA 4TWFA 2WB5A 3Q5WA 3VHLA 3F31A 3KFWX 1QUUA 3SS1A 2H7VC 2N9DA 1VOMA 5C3JA 3HKCE 5J2TE 2MBGA 2I59A 3RQWA 2H3RA 4LF4T 3RQUA 4IDZA 2ZM8A 3UT5E 5EZYE 5HEOA 3ZC0A 2LRLA 4ZI2C 2EHOA 5BRXA 2LSJA 2KLQA 3AE3A 3WTMA 1NEKA 2Y57A 4UM1A 4ZJTA 3PJAA 5LJNA 2XNUA 2MOZA 2VQET 2WNCA 3LSVA 4CI1B 4MALA 1ZEEA 2ZMAA 5ADXL 2WMNA 4CQIA 5HCJA 3FB2A 5KDMC 4DV3T 3K8PC 2FJEA 4UV9B 3IBPA 3SH1A 3I9YA 2VVNA 5IHYA 5F5WA 2MYSA 5LMUT 4JI3T 3RIAA 3DJBA 4B3MT 1BR2A 3L8RA 1I94T 4AKIA 4OFZA 5LBQB 1US7B 1MMDA 2BS3A 3GWHA 3U8LA 3ZYMA 4HEAA 5KXJA 4AQYT 2NWBA 4GYRA 2WNJA 5JMEA 1D0YA 4DV5T 5HCMA 3PUVF 4EIWA 4PK6A 2V5DA 4PK4A 4JBWF 2XHEB 2WWUA 3K3OA 3RKGA 4XAXB 2XAHB 3AB3B 4IDOA 4DUYT 2IUBA 3EVYA 5FVKA 3GN5A 2XAJB 4EZHA 2VK9A 1SE7A 5J0ZA 3C4XA 2A72A 2BBHA 3ZN0B 3UUNA 1QSDA 2UXXB 1DU2A 4I43B 2LLYA 2V7LA 2YDQA 4BAYB 5JREA 4B3TT 4AKGA 4DMWA 3FBLA 4H63H 3FZFB 4EGWA 5AQNB 4I55E 2Y48B 1BR4A 4IT4A 3KV5A 2D0UA 5DJQC 5AQTB 3NWIA 4HWIB 3A8YC 5J5IA 3AEDA 2VURA 3RYHE 3WTJA 2E8IA 3Q5EA 4ZZCA 4YJ2E 4HFCA 3ZCIA 3FBZA 3Q5DA 3P4SA 5LJMA 4X1IE 3LBXB 4ERRA 3WTHA 2NR4A 4DR5T 5ETWA 3SFDA 3MXZA 4JI6T 4MFRA 3HA4A 3PU8A 4OYKA 3UU4A 1J5WA 3UUXB 2E9XB 3OBVE 5L3BB 4L9IA 2FJBA 2YEVC 4ZS2A 3AAEB 5DQVA 3KVAA 4ZI3D 2BG9B 2UXNB 3K1SA 4UF0B 1XDPA 2QRXA 2IHR1 2DI4A 1WFDA 1UX5A 3FXEB 2FJDA 4GYSA 4N78D 5ABHA 2YK0A 1OWAA 3AVRA 3VRAA 2PTFA 1IJ6A 4ISSA 4AFTA 5LG4A 1XDOA 1J1JA 2W61A 2WCAA 1KF6A 5HXSA 2UUCT 3P7IA 2ES0A 3U78A 2XQ6A 4WYVA 1HS7A 4OK0A 3P8CD 4ZS3A 2RA1A 3RYFE 4O4HE 4EB6E 3SQ9A 4H9NC 1IBLT 3LK2B 4PAGA 4X64T 4U2ZA 2V6YB 4COFA 4NIQA 2XNTA 3HL6A 5CB4E 2LRKA 2BYRA 5LMNT 2D0TA 5HYAA 5J5FA 5IWAT 1VRBA 2JIWA 1Z0PA 3TLSA 3PE0A 4X5TA 2KZ7B 3CQCB 4QKNA 5JRCA 4ADZA 4YLHA 4XK9A 2ACXA 3B57A 2XUEA 3AE6A 4HWDA 3BQKA 4A56A 5AQHB 3KV4A 3QOFA 2MTQA 2X67A 2KWIB 2BKNA 3CVRA 2YKSA 2D2SA 3UUBA 4C90A 1ZKEA 4XHEA 3OYXA 2UXDT 2CCQA 2K48A 5AQLB 2VASA 4QX7B 2OV9A 2E9XD 4NXMT 3AE8A 1D1CA 4YT0A 2D5UA 2CRBA 5AFKA 3FZKB 2CE7A 4WZXA 5JTGA 2F4VT 4IE6A 5LA6E 5HEUA 4ILBA 3NVOA 4XZCA 2E9XC 2UXBT 3UQ4A 3LJCA 1ZHCA 2K5BB 3H3AA 3E22E 3EABA 2C9TA 4JI7T 3ANWA 2NW9A 1BR0A 5L3GB 4TZ4C 5J1GA 4G63A 5LYJE 2QC1B 5AQRB 3IEEA 2LSYA 4DIDB 2PH9A 2UUAT 2CXFA 3ZT5A 2NW7A 3K3QC 3KV9A 3BK9A 2BKPA 2IDOB 2W4XA 3PUSA 4HWFA 4GOUA 2JMKA 3RIUC 5AQVB 3ZPOA 3T8OA 3HR0A 5LGTB 3N9LA 2KSRA 2XNVA 4ALXA 4CXXA 4ZEYA 1G73A 1ZOYA 2R6GF 3PUYF 5ABFB 4DV1T 2J1DG 2DWKA 2NW8A 2K24A 1HX1B 2PG8A 4CXYA 3GUAA 5L47A 4QHOA 1Y01A 4QXBB 4U33A 4KHPT 4F8HA 3AECA 2GK9A 5AQGB 3WIPA 1YW0A 3RH3A 3AEGA 3RI5A 2V7IA 5TVCA 2DLRA 3O1HA 5LHIB 4YJ3E 2AXDS 4DVDA 3ONXA 1S35A 3V5UA 3KVBA 2KT9A 2IMLA 2WDVA 3PUGA 5CJ5A 1WLXA 1N33T 3TLUA 3VU7H 5LG3A 4ILUA 2E5LT 2XAFB 3N9QA 4PJLA 4PK5A 3C4WA 2G0UA 4KP3C 2KNDA 2BJ0A 2XJ7A 3RGLA 4KI0F 5FVLA 3AEBA 1Y64B 4ILCA 3L3PA 4NUVA 2VB6A 2AE9A 5L4EA 2BR7A 2WSSV 2WU2A 4PW8A 5LP6E 4LMJA 2PBIA 4P0AA 2CXLA 2LOSA 3UULA 1GQEA 4JYAT 2X9XA 4GK5E 2VL0A 4ZZBA 1T98A 1MNEA 5L3CB 4MLKA 4U2YA 4CI2B 1X9BA 2ODVA 1UW6A 1D1BA 5E0OA 3ZJ2A 2K3WA 4LF5T 2ZJUA 3R6NA 1WRDA 4ZI2D 4FJOA 1X79A 3E0ZA 4EV6A 5M4YA 3ZMUB 3TLTA 4CZZB 2CHOA 3MK7C 1XNRT 3SIOA 2H89A 2Q9QC 3A5XA 3PU3A 4XBFB 5J2UE 1YQ3A 5AFMB 4J2CA 3UTKA 2MAWA 4P09A 4MBQA 1LRZA 3MJXA 4YTPA 5AQPB 1WR6A 5AFJA 5GONE 2JJ9A 2W2UA 3ZMTB 4UEMA 2DCFA 2XQ7A 4X65T 4KBMB 4I50E 3UFEA 3PUXF 3CPZA 5F3JA 5KX5E 4IL9A 2YMEA 2HPLA 4UV8B 2WNLA 2W8GA 3S4UA 3TKLB 4UY2A 3N9NA 1N34T 4HKAA 2WQYA 4DNDA 2LHNA 5AQFB 5H6RB 4AQGA 2WBLA 3PJAJ 2HH7A 2X0YA 4HWCA 3HI2A 5FL1A 1D0XA 2CWOA 3ZLIA 4QACA 1FEWA 5FJVA 3P50A 3FZLB 3I9WA 5FY1A 4DR6T 4KX6A 1EZ3A 2V7JA 2NTXA 1I9BA 4JV5T 3M65A 4DV7T 3J7Yq 5CFBA 3P4QA 3SOLA 2V7KA 1B7TA 3U8MA 5KE4A 3AA1B 2WN9A 2XYSA 4EZ4A 3CX7B 4AQFA 2H7OA 4E7SA 2VL8A 1W9RA 4LFAT 5C2TA 2N1GA 2WU5A 4IHJE 5LXBA 5HWYA 2CHNA 4TN7B 4A97A 3J9X1 3OTOT 2V1DB 2WY2A 2X9YA 3N2KE 3ZEFB 2CM0A 4HFBA 2UZ6A 3RHWA 4UELA 3MACA 5JH7E 1T8BA 1ZV4X 2XTLA 3RX6A 2XQAA 1T7SA 3L09A 3B5MA 1MIVA 1W0BA 3HKDE 3ZYLA 2X68A 3NBXX 2KXPB 2L9QA 5FY7A 3EHZA 4GKKT 4UVBB 2PGZA 3GMIA 1YXRA 5JDGA 1SUMB 3VRBA 3WI3A 3CX6B 4L5GA 1VCTA 2B76A 3AE1A 2WZHA 4U74A 3F2EA 4B6XA 1KK7A 1E7PA 2BBJA 3RC8A 4PJMA 4O4IE 3LBXA 3N9MA 4HFVA 4BJNA 4E7ZA 2LJLA 1XWMA 1FIOA 3EI0A 3RPUA 2IAKA 3AA0B 5IYZE 2IC9A 3H37A 3HKEE 4QXHB 1OEDE 2E9XA 3WTKA 3IGQA 4TV9E 4EZ1A 4M1PA 2DNXA 2CBJA 2BG9A 3JADA 4IREA 4UM3P 5LHHB 2D9DA 1OEDB 2IC6A 3CQGB 1BR1A 4H63V 3N5LA 3OPCA 2XM2A 4UXUA 4NZBA 2ZM2A 4KHZF 3AAIA 4EYUA 3JC6C 4EYYR 4DBMA 5AINA 3ZSSA 3AA6B 3CX8B 3PUAA 3V5SA 2Y56A 2LSKA 4IL4A 2XQ9A 3EUHA 2HN2A 2JMHA 2QGSA 4BJMA 1MMGA 5AQKB 2CEAA 5IUXA 4P0BA 2QVAA 2W62A 2OLTA 3ZSTA 5AQMB 1HF8A 2C5JA 5HWXA 2V6YA 1KNPA 3AE9A 4HFIA 1AJ3A 2XQ8A 2X9WA 2YOEA 1KFYA 3ZMZB 4U31A 1YQ4A 5KMGP 2XQ5A 3QUJA 4ASKA 1OXZA 5LXTE 5AFLA 2I0MA 2OA5A 4HGAA 4DR1T 3ETVA 4JI8T 5F8PA 1NWMX 4LFBT 3QNUA 2M67A 4CN6A 1T72A 3OJAA 1U5PA 3AEEA 4LF6T 5SYOA 3BQLA 1D0ZA 4MHCA 3CIRA 3RYIE 2LKHA 4IDPA 3K3NA 2VVSA 4BA9A 4QX8B 5HAXA 3JAEA 4LMLA 3A7MA 4YSZA 2KMFA 3FZHB 2WP9A 2X00A 4DR2T 3FZMB 1MIWA 1UURA 2X9HA 3CMLA 3U8KA 3I1AA 4ZXLA 2BYPA 3FHNA 1FMVA 2XZ5A 2CPTA 1I6ZA 5HXEA 1LVFA 3PEOA 4UR9A 5AQJB 1HG2A 3UFGA 5JR9A 3OYZA 3NKZA 3JCFA 2W67A 5LNKA 3O9XA 1J5ET 2YDRA 4I0UA 1OEDC 3BQIA 3ZT6A 3LK42 2FJAA 3PV0F 3ETUA 5ABGA 4K0UA 2WWVA 5L4HA 1CHUA 2LSGA 4PIRA 2W8FA 4TNVA 4HFDA 3UU5A 3W15B 4AFHA 3KBUA 3ONJA 4WW0A 3OVUA 3N2GE 4EAHA 2C0SA 2Q9QB 5ABEA 2XASB 5HEHA 2WZYA 2NOXA 1NENA 2XM1A 1HG5A 4Z90A 2NP9A 4ZI7E 4KUMB 3LK3B 4B5DA 3DTOA 2V8SV 2LT3A 4WBOA 1IZNB 2NTYA 3IF8B 4LF7T 2WAUA 5ABFA 4PJNA 4OYJA 2XYTA 3EDVA 3EDUA 4AXPA 2FUPA 1MNDA 4U7IA 2J62A 3QB5A 5FMNA 3T1HT 2ZM0A 1KNZA 5KZUA 2X00D 2W0GA 5FY0A 3UU8A 2YINA 1IBMT 4B3ST 2ODUA 5L3DB 3AXJB 3P4PA 5JDFA 5AQUB 4OHFA 1M7KA 4F6RC 4PFPA 4U7YA 2JRKA 5DABA 1XNQT 2CXDA 2E5VA 2WZIA 3RIFA 4OX9T 1W09A 3CWZB 1UGOA 4JI0T 2V5CA 3ABVA 2Y58A 1CUNA 3RYCE 3SWHA 3CK6A 3RF1A 1ZP0A 4JLEA 4H9QC 1Z8UA 3ZDHA 4DBRA 2H88A 1G8XA 4CN1A 4ILAA 3SFEA 5LGUB 3FXDB 4A98A 3D0TA 4YFSA 5CA1E 2K9AA 4ZOLE 4D01A 3Q9DA 1KNRA 5CO5A 2FBWA 2L3LA 4EXTA 2BZBA 3P4WA 5AFNA 3N2OA 5C8YE 2Q9QD 3SQ6A 3B13A 4AISA 2HHHT 3AEAA 3PUZF 2JQKA 4DR3T 2IIUA 4DMVA 4B3RT 4HWHA 1KEYA 3E08A 1D1AA 4HTEA 4AKRB 1JNRA 2XSBA 4JI5T 4K0KT 4YTNA 4YHJA 4U3CA 1MMAA 2CLYB 4TWHA 2B1EA 4O4LE 1U4QA 2QA7A 1HX8A 2XAQB 2KINB 2EHOB 2LM2A 5AFMA 4EOZB 3TLWA 4DV0T 4UXNB 2XY8B 4O2BE 5DQWA 2J4GA 3AE4A 2Y8DA 2ZLYA 1QLBA 3MKDA 4H9OC 2PFVA 4O4JE 5HXCA 4ANJA 2Y6XA 2UUBT 4ZK4A
chains in the Genus database with same CATH topology
3RQUA 5L4HA 2Y58A 4ZRUA 4HFIA 2VL0A 4PIRA 4ZZBA 2W8FA 4HQPA 2XQ8A 5HEOA 2BG9B 2YOEA 4BQTA 4WV9A 4TNVA 4QACA 2YKSA 4HFDA 3UU5A 5FJVA 4HFHA 3ZDHA 4BFQA 1UW6A 3UUBA 3TLVA 4XHEA 4ZJSA 4AFHA 5BRXA 2Y7YA 5HEGA 2XQ5A 3P50A 4ILAA 3GUAA 5AFLA 5BP0A 2ZJUA 3C79A 4ZR6A 3U8NA 5J0ZA 3WTMA 5L47A 4QAAA 4QH5A 4A98A 2Y57A 2BG9C 2ZJVA 3WTNA 5HEHA 2WZYA 4UM1A 5AFKA 3EI0A 4TNWA 4Z91A 4D01A 4ZJTA 1I9BA 4F8HA 3UQ7A 2XQ3A 2XNUA 3TLTA 5CO5A 5J5HA 4NPPA 4Z90A 2LLYA 5HEUA 4QABA 4AFTA 3WTLA 4ILBA 4QH1A 3WIPA 1OEDE 5J5GA 3SIOA 3WTKA 2WNCA 5SYOA 3LSVA 5CFBA 3IGQA 4B5DA 3C84A 5AFMB 3P4WA 3UQ4A 3RI5A 5AFNA 4EZ1A 5TVCA 3U8MA 3WTOA 5KE4A 2MAWA 2LKHA 5HCJA 4ZK1A 3ZKRA 3EAMA 2BG9A 3UU3A 2WN9A 2XQ6A 3JADA 2XYSA 3SQ6A 4IREA 4UM3P 2XYTA 4LMLA 3JAEA 2C9TA 2Y54A 1OEDB 3SH1A 2M6IA 2X00A 3T4MA 2XQ4A 5AFJA 4UM3S 3RIAA 3WTIA 4QH4A 3SQ9A 2LKGA 5HEJA 4UXUA 3TLUA 5LG3A 4NZBA 3U8KA 2BG9E 4COFA 4DBMA 2BYPA 2BYQA 2X00D 3U8JA 5AINA 5J5IA 5KZUA 2XNTA 5LXBA 2YN6A 4LMKA 4TWHA 4A97A 2XZ5A 2Y56A 2XQ7A 4HFEA 2BYRA 2QC1B 3U8LA 2BYSA 3WTJA 3UU8A 5J5FA 4HFBA 3UU6A 4IL4A 2UZ6A 2XQ9A 3PEOA 3PMZA 3RHWA 3TLSA 4ZZCA 2BJ0A 4TWFA 2PH9A 4HFCA 5BW2A 2LM2A 1UV6A 2WNJA 5AFMA 5JMEA 3TLWA 4IL9A 4X5TA 5HCMA 2YMEA 2WNLA 2XQAA 2W8GA 3JAFA 4ILCA 3WTHA 2BYNA 5AFHA 4UY2A 5L4EA 5IUXA 4FRRA 2BR7A 4UM3A 1OEDA 4XK9A 2M6BA 2BR8A 2XZ6A 3UU4A 1UX2A 1OEDC 4LMJA 3RIFA 3RQWA 3EHZA 2XNVA 2KSRA 2PGZA 4ALXA 4AFGA 2YMDA 4ZK4A 4TWDA 3ZDGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RQU A;  5L4H A;  2Y58 A;  4ZRU A;  4HFI A;  2VL0 A;  4PIR A;  4ZZB A;  2W8F A;  4HQP A;  2XQ8 A;  5HEO A;  2BG9 B;  2YOE A;  4BQT A;  4WV9 A;  4TNV A;  4QAC A;  2YKS A;  4HFD A;  3UU5 A;  5FJV A;  4HFH A;  3ZDH A;  4BFQ A;  1UW6 A;  3UUB A;  3TLV A;  4XHE A;  4ZJS A;  4AFH A;  5BRX A;  2Y7Y A;  5HEG A;  2XQ5 A;  3P50 A;  4ILA A;  3GUA A;  5AFL A;  5BP0 A;  2ZJU A;  3C79 A;  4ZR6 A;  3U8N A;  5J0Z A;  3WTM A;  5L47 A;  4QAA A;  4QH5 A;  4A98 A;  2Y57 A;  2BG9 C;  2ZJV A;  3WTN A;  5HEH A;  2WZY A;  4UM1 A;  5AFK A;  3EI0 A;  4TNW A;  4Z91 A;  4D01 A;  4ZJT A;  1I9B A;  4F8H A;  3UQ7 A;  2XQ3 A;  2XNU A;  3TLT A;  5CO5 A;  5J5H A;  4NPP A;  4Z90 A;  2LLY A;  5HEU A;  4QAB A;  4AFT A;  3WTL A;  4ILB A;  4QH1 A;  3WIP A;  1OED E;  5J5G A;  3SIO A;  3WTK A;  2WNC A;  5SYO A;  3LSV A;  5CFB A;  3IGQ A;  4B5D A;  3C84 A;  5AFM B;  3P4W A;  3UQ4 A;  3RI5 A;  5AFN A;  4EZ1 A;  5TVC A;  3U8M A;  3WTO A;  5KE4 A;  2MAW A;  2LKH A;  5HCJ A;  4ZK1 A;  3ZKR A;  3EAM A;  2BG9 A;  3UU3 A;  2WN9 A;  2XQ6 A;  3JAD A;  2XYS A;  3SQ6 A;  4IRE A;  4UM3 P;  2XYT A;  4LML A;  3JAE A;  2C9T A;  2Y54 A;  1OED B;  3SH1 A;  2M6I A;  2X00 A;  3T4M A;  2XQ4 A;  5AFJ A;  4UM3 S;  3RIA A;  3WTI A;  4QH4 A;  3SQ9 A;  2LKG A;  5HEJ A;  4UXU A;  3TLU A;  5LG3 A;  4NZB A;  3U8K A;  2BG9 E;  4COF A;  4DBM A;  2BYP A;  2BYQ A;  2X00 D;  3U8J A;  5AIN A;  5J5I A;  5KZU A;  2XNT A;  5LXB A;  2YN6 A;  4LMK A;  4TWH A;  4A97 A;  2XZ5 A;  2Y56 A;  2XQ7 A;  4HFE A;  2BYR A;  2QC1 B;  3U8L A;  2BYS A;  3WTJ A;  3UU8 A;  5J5F A;  4HFB A;  3UU6 A;  4IL4 A;  2UZ6 A;  2XQ9 A;  3PEO A;  3PMZ A;  3RHW A;  3TLS A;  4ZZC A;  2BJ0 A;  4TWF A;  2PH9 A;  4HFC A;  5BW2 A;  2LM2 A;  1UV6 A;  2WNJ A;  5AFM A;  5JME A;  3TLW A;  4IL9 A;  4X5T A;  5HCM A;  2YME A;  2WNL A;  2XQA A;  2W8G A;  3JAF A;  4ILC A;  3WTH A;  2BYN A;  5AFH A;  4UY2 A;  5L4E A;  5IUX A;  4FRR A;  2BR7 A;  4UM3 A;  1OED A;  4XK9 A;  2M6B A;  2BR8 A;  2XZ6 A;  3UU4 A;  1UX2 A;  1OED C;  4LMJ A;  3RIF A;  3RQW A;  3EHZ A;  2XNV A;  2KSR A;  2PGZ A;  4ALX A;  4AFG A;  2YMD A;  4ZK4 A;  4TWD A;  3ZDG A; 
#chains in the Genus database with same CATH topology
 2LOP A;  4X1Y E;  3OKQ A;  4BQT A;  4JI1 T;  2DWG A;  2KWH A;  2ZM6 T;  3O1I A;  2Y7Y A;  2HPJ A;  3CKD A;  1L0V A;  3C79 A;  3U8N A;  2ACZ A;  4H9P C;  4TX5 A;  3AE2 A;  2UXC T;  2I6H A;  2JQ9 A;  3NZQ A;  2C5I T;  5L3F B;  1XZY A;  1S94 A;  3ESL A;  4YSX A;  2X0L B;  3ZC1 A;  3CQX C;  4CXW A;  1V9D A;  1HNW T;  4ZK1 A;  1SA0 E;  2YDS A;  3ZKR A;  4EED A;  3UU3 A;  4YHH T;  4LFC T;  5AQQ B;  5HXH A;  3RKO A;  5AFU L;  4DV4 T;  1N36 T;  1E1H B;  2XPK A;  4UM3 S;  3WTI A;  5FKY A;  2LKG A;  2BS2 A;  2X51 A;  2LEH A;  4L0R A;  2N2N A;  4LF8 T;  1UUS A;  1H7C A;  5BMV E;  4HFE A;  3ZMS B;  2MPK A;  2V6X A;  3UU6 A;  3GN5 B;  2WDQ A;  3VR8 A;  1JNZ A;  5LB7 B;  3KDS E;  3NRY A;  5FXW A;  4JEU B;  4IE5 A;  3QK6 A;  3LDQ B;  4AIU A;  4FRR A;  2M6B A;  2BR8 A;  4WNK A;  1WCR A;  2DHR A;  4DUZ T;  4DR4 T;  4KMC A;  2YMD A;  4PNI A;  2EHO D;  4AKH A;  2BVM A;  4ZRU A;  1HNZ T;  5CA0 E;  3LG7 A;  4HQP A;  2CLY C;  3C51 A;  4BFQ A;  3TLV A;  3R84 B;  2XZE A;  2EHO C;  2W00 A;  3C64 A;  3I0Q A;  5L3E B;  3RC3 A;  2ZJV A;  2L8K A;  3WTN A;  2LSI A;  3H3M A;  5AQI B;  3IA3 A;  3X1D A;  4QH1 A;  1IJ5 A;  4DV2 T;  2PJQ A;  1W0A A;  4HE8 A;  3C84 A;  4JUY A;  1NAF A;  4JEH B;  4H9R C;  4UVC B;  2HN1 A;  1WYC A;  3QC9 A;  2Y54 A;  2A3D A;  3PUQ A;  3ZMV B;  2LM9 A;  2WDR A;  3HKB E;  2BVL A;  3C4Z A;  2BKO A;  2X0H A;  3ONL C;  1WYB A;  5JDL A;  2A2F X;  2BG9 E;  5FL0 A;  3KV6 A;  4QWN B;  3F57 A;  4LMK A;  4UIG A;  5AQO B;  1R8I A;  3GA8 A;  4U72 A;  4DR7 T;  2BYS A;  4ZHQ E;  3JC6 D;  4UF0 A;  3PMZ A;  5BW2 A;  2W66 A;  3WAJ A;  4YXD A;  1SHZ C;  5A1L A;  1OED A;  5TAO A;  3NZP A;  4PJJ A;  3KBT A;  1HNX T;  5EK4 A;  2XZ6 A;  1HR0 T;  4IE7 A;  3O1J A;  4V1A v;  3G06 A;  5FXZ A;  4DO0 A;  4ZI3 C;  1IBK T;  2E2A A;  4TWD A;  3ZDG A;  2CBI A;  5AQS B;  1WR0 A;  3MZK B;  3VKG A;  1YKE B;  2J47 A;  3RIU A;  1MIY A;  4HFH A;  4ZJS A;  4X62 T;  2RP4 A;  3C98 B;  4QAA A;  4NUU A;  4HN9 A;  5HXR A;  2SPC A;  4AQF C;  3NRX A;  4NPP A;  4DBQ A;  4A5X A;  2UU9 T;  3WTL A;  3UUM A;  4IST A;  1VCS A;  2YU2 A;  5JDM A;  2JQQ A;  5JRC B;  2QYW A;  4X1K E;  4TUY E;  3RLF F;  2WM9 A;  4FI5 A;  2M6I A;  2IW5 B;  2X66 A;  2XQ4 A;  3Q5X A;  4PFO A;  4QH4 A;  5HEJ A;  3ZN1 B;  5H6Q B;  2BYQ A;  3U8J A;  3ZYK A;  4EEB A;  4GK0 E;  4Z8X A;  5EK2 A;  4NXN T;  1MMN A;  1UV6 A;  4IDN A;  4IGU A;  2V7M A;  3JAF A;  1HFA A;  3PUR A;  4AKL A;  4JI4 T;  2BYN A;  5LBM A;  4IE4 A;  1XMQ T;  4UM3 A;  4IDQ A;  2BS4 A;  2VWA A;  1YKH B;  3N9P A;  1IAP A;  4X20 E;  4WBN E;  4UVA B;  1LVK A;  3AEF A;  3O4X E;  3AA7 B;  4IE0 A;  4O8S A;  3MA9 A;  2JQH A;  5JR9 B;  5FP3 A;  2WMO A;  3ANW B;  5HEG A;  5EK3 A;  5L2L A;  3M3Z B;  2CMR A;  5BP0 A;  3PTR B;  1XMO T;  4QH5 A;  4LF9 T;  2BG9 C;  5JDQ A;  2XSA A;  1UK5 A;  4Z91 A;  2XQ3 A;  2V26 A;  3PDY A;  1O3X A;  5LHG B;  2VKJ A;  1UCU A;  3AE5 A;  3RRW A;  3WTO A;  4GIW A;  2Z6E A;  3AVS A;  4YY3 T;  3L39 A;  3Q2M A;  3P4R A;  2VKD A;  4CN4 A;  2WS3 A;  5CGM A;  2XQY A;  4C91 A;  3I0O A;  2CA5 A;  2Q9Q A;  3AAA B;  4CI3 B;  2XAG B;  3AE7 A;  3IHR A;  2P9B A;  4P1N A;  2YN6 A;  3U3I A;  3N9O A;  3RRC A;  1E2A A;  1N32 T;  4JI2 T;  5JQG E;  1M62 A;  4I4T E;  5AFH A;  4DV6 T;  5LGN B;  5BR8 T;  2C5K T;  3ZJ1 A;  5LCY A;  1UX4 A;  1UX2 A;  3ZCJ A;  2VKO A;  4O2A E;  4AFG A;  3T4M A;  5FXX A;  2LE8 A;  4YSY A;  2LHR A;  5FYM A;  5JDN A;  3QB5 K;  4WV9 A;  2W63 A;  2YU1 A;  3AXJ A;  3DP7 A;  4ZR6 A;  4TNW A;  1FMW A;  3UQ7 A;  2VQF T;  5J5H A;  4QXC B;  5FXV A;  2RPA A;  4IIJ E;  4QAB A;  5J5G A;  2JPF A;  5FNV E;  4G2A A;  3KIN B;  3ZT7 A;  4X66 T;  3WAK A;  1HTJ F;  3EAM A;  3VKH A;  1YD8 G;  4AI6 A;  5JVD E;  3VR9 A;  2CWY A;  5LOV E;  1LKX A;  5JDH A;  2DL1 A;  2VKH A;  3PUW F;  5JR9 C;  2A9U A;  4Q25 A;  3LFM A;  1FJG T;  4TV8 E;  3C50 A;  4GKJ T;  4H9S E;  3SRZ A;  4YTM A;  1HCI A;  3T1Y T;  2BDE A;  4TWF A;  2WB5 A;  3Q5W A;  3VHL A;  3F31 A;  3KFW X;  1QUU A;  3SS1 A;  2H7V C;  2N9D A;  1VOM A;  5C3J A;  3HKC E;  5J2T E;  2MBG A;  2I59 A;  3RQW A;  2H3R A;  4LF4 T;  3RQU A;  4IDZ A;  2ZM8 A;  3UT5 E;  5EZY E;  5HEO A;  3ZC0 A;  2LRL A;  4ZI2 C;  2EHO A;  5BRX A;  2LSJ A;  2KLQ A;  3AE3 A;  3WTM A;  1NEK A;  2Y57 A;  4UM1 A;  4ZJT A;  3PJA A;  5LJN A;  2XNU A;  2MOZ A;  2VQE T;  2WNC A;  3LSV A;  4CI1 B;  4MAL A;  1ZEE A;  2ZMA A;  5ADX L;  2WMN A;  4CQI A;  5HCJ A;  3FB2 A;  5KDM C;  4DV3 T;  3K8P C;  2FJE A;  4UV9 B;  3IBP A;  3SH1 A;  3I9Y A;  2VVN A;  5IHY A;  5F5W A;  2MYS A;  5LMU T;  4JI3 T;  3RIA A;  3DJB A;  4B3M T;  1BR2 A;  3L8R A;  1I94 T;  4AKI A;  4OFZ A;  5LBQ B;  1US7 B;  1MMD A;  2BS3 A;  3GWH A;  3U8L A;  3ZYM A;  4HEA A;  5KXJ A;  4AQY T;  2NWB A;  4GYR A;  2WNJ A;  5JME A;  1D0Y A;  4DV5 T;  5HCM A;  3PUV F;  4EIW A;  4PK6 A;  2V5D A;  4PK4 A;  4JBW F;  2XHE B;  2WWU A;  3K3O A;  3RKG A;  4XAX B;  2XAH B;  3AB3 B;  4IDO A;  4DUY T;  2IUB A;  3EVY A;  5FVK A;  3GN5 A;  2XAJ B;  4EZH A;  2VK9 A;  1SE7 A;  5J0Z A;  3C4X A;  2A72 A;  2BBH A;  3ZN0 B;  3UUN A;  1QSD A;  2UXX B;  1DU2 A;  4I43 B;  2LLY A;  2V7L A;  2YDQ A;  4BAY B;  5JRE A;  4B3T T;  4AKG A;  4DMW A;  3FBL A;  4H63 H;  3FZF B;  4EGW A;  5AQN B;  4I55 E;  2Y48 B;  1BR4 A;  4IT4 A;  3KV5 A;  2D0U A;  5DJQ C;  5AQT B;  3NWI A;  4HWI B;  3A8Y C;  5J5I A;  3AED A;  2VUR A;  3RYH E;  3WTJ A;  2E8I A;  3Q5E A;  4ZZC A;  4YJ2 E;  4HFC A;  3ZCI A;  3FBZ A;  3Q5D A;  3P4S A;  5LJM A;  4X1I E;  3LBX B;  4ERR A;  3WTH A;  2NR4 A;  4DR5 T;  5ETW A;  3SFD A;  3MXZ A;  4JI6 T;  4MFR A;  3HA4 A;  3PU8 A;  4OYK A;  3UU4 A;  1J5W A;  3UUX B;  2E9X B;  3OBV E;  5L3B B;  4L9I A;  2FJB A;  2YEV C;  4ZS2 A;  3AAE B;  5DQV A;  3KVA A;  4ZI3 D;  2BG9 B;  2UXN B;  3K1S A;  4UF0 B;  1XDP A;  2QRX A;  2IHR 1;  2DI4 A;  1WFD A;  1UX5 A;  3FXE B;  2FJD A;  4GYS A;  4N78 D;  5ABH A;  2YK0 A;  1OWA A;  3AVR A;  3VRA A;  2PTF A;  1IJ6 A;  4ISS A;  4AFT A;  5LG4 A;  1XDO A;  1J1J A;  2W61 A;  2WCA A;  1KF6 A;  5HXS A;  2UUC T;  3P7I A;  2ES0 A;  3U78 A;  2XQ6 A;  4WYV A;  1HS7 A;  4OK0 A;  3P8C D;  4ZS3 A;  2RA1 A;  3RYF E;  4O4H E;  4EB6 E;  3SQ9 A;  4H9N C;  1IBL T;  3LK2 B;  4PAG A;  4X64 T;  4U2Z A;  2V6Y B;  4COF A;  4NIQ A;  2XNT A;  3HL6 A;  5CB4 E;  2LRK A;  2BYR A;  5LMN T;  2D0T A;  5HYA A;  5J5F A;  5IWA T;  1VRB A;  2JIW A;  1Z0P A;  3TLS A;  3PE0 A;  4X5T A;  2KZ7 B;  3CQC B;  4QKN A;  5JRC A;  4ADZ A;  4YLH A;  4XK9 A;  2ACX A;  3B57 A;  2XUE A;  3AE6 A;  4HWD A;  3BQK A;  4A56 A;  5AQH B;  3KV4 A;  3QOF A;  2MTQ A;  2X67 A;  2KWI B;  2BKN A;  3CVR A;  2YKS A;  2D2S A;  3UUB A;  4C90 A;  1ZKE A;  4XHE A;  3OYX A;  2UXD T;  2CCQ A;  2K48 A;  5AQL B;  2VAS A;  4QX7 B;  2OV9 A;  2E9X D;  4NXM T;  3AE8 A;  1D1C A;  4YT0 A;  2D5U A;  2CRB A;  5AFK A;  3FZK B;  2CE7 A;  4WZX A;  5JTG A;  2F4V T;  4IE6 A;  5LA6 E;  5HEU A;  4ILB A;  3NVO A;  4XZC A;  2E9X C;  2UXB T;  3UQ4 A;  3LJC A;  1ZHC A;  2K5B B;  3H3A A;  3E22 E;  3EAB A;  2C9T A;  4JI7 T;  3ANW A;  2NW9 A;  1BR0 A;  5L3G B;  4TZ4 C;  5J1G A;  4G63 A;  5LYJ E;  2QC1 B;  5AQR B;  3IEE A;  2LSY A;  4DID B;  2PH9 A;  2UUA T;  2CXF A;  3ZT5 A;  2NW7 A;  3K3Q C;  3KV9 A;  3BK9 A;  2BKP A;  2IDO B;  2W4X A;  3PUS A;  4HWF A;  4GOU A;  2JMK A;  3RIU C;  5AQV B;  3ZPO A;  3T8O A;  3HR0 A;  5LGT B;  3N9L A;  2KSR A;  2XNV A;  4ALX A;  4CXX A;  4ZEY A;  1G73 A;  1ZOY A;  2R6G F;  3PUY F;  5ABF B;  4DV1 T;  2J1D G;  2DWK A;  2NW8 A;  2K24 A;  1HX1 B;  2PG8 A;  4CXY A;  3GUA A;  5L47 A;  4QHO A;  1Y01 A;  4QXB B;  4U33 A;  4KHP T;  4F8H A;  3AEC A;  2GK9 A;  5AQG B;  3WIP A;  1YW0 A;  3RH3 A;  3AEG A;  3RI5 A;  2V7I A;  5TVC A;  2DLR A;  3O1H A;  5LHI B;  4YJ3 E;  2AXD S;  4DVD A;  3ONX A;  1S35 A;  3V5U A;  3KVB A;  2KT9 A;  2IML A;  2WDV A;  3PUG A;  5CJ5 A;  1WLX A;  1N33 T;  3TLU A;  3VU7 H;  5LG3 A;  4ILU A;  2E5L T;  2XAF B;  3N9Q A;  4PJL A;  4PK5 A;  3C4W A;  2G0U A;  4KP3 C;  2KND A;  2BJ0 A;  2XJ7 A;  3RGL A;  4KI0 F;  5FVL A;  3AEB A;  1Y64 B;  4ILC A;  3L3P A;  4NUV A;  2VB6 A;  2AE9 A;  5L4E A;  2BR7 A;  2WSS V;  2WU2 A;  4PW8 A;  5LP6 E;  4LMJ A;  2PBI A;  4P0A A;  2CXL A;  2LOS A;  3UUL A;  1GQE A;  4JYA T;  2X9X A;  4GK5 E;  2VL0 A;  4ZZB A;  1T98 A;  1MNE A;  5L3C B;  4MLK A;  4U2Y A;  4CI2 B;  1X9B A;  2ODV A;  1UW6 A;  1D1B A;  5E0O A;  3ZJ2 A;  2K3W A;  4LF5 T;  2ZJU A;  3R6N A;  1WRD A;  4ZI2 D;  4FJO A;  1X79 A;  3E0Z A;  4EV6 A;  5M4Y A;  3ZMU B;  3TLT A;  4CZZ B;  2CHO A;  3MK7 C;  1XNR T;  3SIO A;  2H89 A;  2Q9Q C;  3A5X A;  3PU3 A;  4XBF B;  5J2U E;  1YQ3 A;  5AFM B;  4J2C A;  3UTK A;  2MAW A;  4P09 A;  4MBQ A;  1LRZ A;  3MJX A;  4YTP A;  5AQP B;  1WR6 A;  5AFJ A;  5GON E;  2JJ9 A;  2W2U A;  3ZMT B;  4UEM A;  2DCF A;  2XQ7 A;  4X65 T;  4KBM B;  4I50 E;  3UFE A;  3PUX F;  3CPZ A;  5F3J A;  5KX5 E;  4IL9 A;  2YME A;  2HPL A;  4UV8 B;  2WNL A;  2W8G A;  3S4U A;  3TKL B;  4UY2 A;  3N9N A;  1N34 T;  4HKA A;  2WQY A;  4DND A;  2LHN A;  5AQF B;  5H6R B;  4AQG A;  2WBL A;  3PJA J;  2HH7 A;  2X0Y A;  4HWC A;  3HI2 A;  5FL1 A;  1D0X A;  2CWO A;  3ZLI A;  4QAC A;  1FEW A;  5FJV A;  3P50 A;  3FZL B;  3I9W A;  5FY1 A;  4DR6 T;  4KX6 A;  1EZ3 A;  2V7J A;  2NTX A;  1I9B A;  4JV5 T;  3M65 A;  4DV7 T;  3J7Y q;  5CFB A;  3P4Q A;  3SOL A;  2V7K A;  1B7T A;  3U8M A;  5KE4 A;  3AA1 B;  2WN9 A;  2XYS A;  4EZ4 A;  3CX7 B;  4AQF A;  2H7O A;  4E7S A;  2VL8 A;  1W9R A;  4LFA T;  5C2T A;  2N1G A;  2WU5 A;  4IHJ E;  5LXB A;  5HWY A;  2CHN A;  4TN7 B;  4A97 A;  3J9X 1;  3OTO T;  2V1D B;  2WY2 A;  2X9Y A;  3N2K E;  3ZEF B;  2CM0 A;  4HFB A;  2UZ6 A;  3RHW A;  4UEL A;  3MAC A;  5JH7 E;  1T8B A;  1ZV4 X;  2XTL A;  3RX6 A;  2XQA A;  1T7S A;  3L09 A;  3B5M A;  1MIV A;  1W0B A;  3HKD E;  3ZYL A;  2X68 A;  3NBX X;  2KXP B;  2L9Q A;  5FY7 A;  3EHZ A;  4GKK T;  4UVB B;  2PGZ A;  3GMI A;  1YXR A;  5JDG A;  1SUM B;  3VRB A;  3WI3 A;  3CX6 B;  4L5G A;  1VCT A;  2B76 A;  3AE1 A;  2WZH A;  4U74 A;  3F2E A;  4B6X A;  1KK7 A;  1E7P A;  2BBJ A;  3RC8 A;  4PJM A;  4O4I E;  3LBX A;  3N9M A;  4HFV A;  4BJN A;  4E7Z A;  2LJL A;  1XWM A;  1FIO A;  3EI0 A;  3RPU A;  2IAK A;  3AA0 B;  5IYZ E;  2IC9 A;  3H37 A;  3HKE E;  4QXH B;  1OED E;  2E9X A;  3WTK A;  3IGQ A;  4TV9 E;  4EZ1 A;  4M1P A;  2DNX A;  2CBJ A;  2BG9 A;  3JAD A;  4IRE A;  4UM3 P;  5LHH B;  2D9D A;  1OED B;  2IC6 A;  3CQG B;  1BR1 A;  4H63 V;  3N5L A;  3OPC A;  2XM2 A;  4UXU A;  4NZB A;  2ZM2 A;  4KHZ F;  3AAI A;  4EYU A;  3JC6 C;  4EYY R;  4DBM A;  5AIN A;  3ZSS A;  3AA6 B;  3CX8 B;  3PUA A;  3V5S A;  2Y56 A;  2LSK A;  4IL4 A;  2XQ9 A;  3EUH A;  2HN2 A;  2JMH A;  2QGS A;  4BJM A;  1MMG A;  5AQK B;  2CEA A;  5IUX A;  4P0B A;  2QVA A;  2W62 A;  2OLT A;  3ZST A;  5AQM B;  1HF8 A;  2C5J A;  5HWX A;  2V6Y A;  1KNP A;  3AE9 A;  4HFI A;  1AJ3 A;  2XQ8 A;  2X9W A;  2YOE A;  1KFY A;  3ZMZ B;  4U31 A;  1YQ4 A;  5KMG P;  2XQ5 A;  3QUJ A;  4ASK A;  1OXZ A;  5LXT E;  5AFL A;  2I0M A;  2OA5 A;  4HGA A;  4DR1 T;  3ETV A;  4JI8 T;  5F8P A;  1NWM X;  4LFB T;  3QNU A;  2M67 A;  4CN6 A;  1T72 A;  3OJA A;  1U5P A;  3AEE A;  4LF6 T;  5SYO A;  3BQL A;  1D0Z A;  4MHC A;  3CIR A;  3RYI E;  2LKH A;  4IDP A;  3K3N A;  2VVS A;  4BA9 A;  4QX8 B;  5HAX A;  3JAE A;  4LML A;  3A7M A;  4YSZ A;  2KMF A;  3FZH B;  2WP9 A;  2X00 A;  4DR2 T;  3FZM B;  1MIW A;  1UUR A;  2X9H A;  3CML A;  3U8K A;  3I1A A;  4ZXL A;  2BYP A;  3FHN A;  1FMV A;  2XZ5 A;  2CPT A;  1I6Z A;  5HXE A;  1LVF A;  3PEO A;  4UR9 A;  5AQJ B;  1HG2 A;  3UFG A;  5JR9 A;  3OYZ A;  3NKZ A;  3JCF A;  2W67 A;  5LNK A;  3O9X A;  1J5E T;  2YDR A;  4I0U A;  1OED C;  3BQI A;  3ZT6 A;  3LK4 2;  2FJA A;  3PV0 F;  3ETU A;  5ABG A;  4K0U A;  2WWV A;  5L4H A;  1CHU A;  2LSG A;  4PIR A;  2W8F A;  4TNV A;  4HFD A;  3UU5 A;  3W15 B;  4AFH A;  3KBU A;  3ONJ A;  4WW0 A;  3OVU A;  3N2G E;  4EAH A;  2C0S A;  2Q9Q B;  5ABE A;  2XAS B;  5HEH A;  2WZY A;  2NOX A;  1NEN A;  2XM1 A;  1HG5 A;  4Z90 A;  2NP9 A;  4ZI7 E;  4KUM B;  3LK3 B;  4B5D A;  3DTO A;  2V8S V;  2LT3 A;  4WBO A;  1IZN B;  2NTY A;  3IF8 B;  4LF7 T;  2WAU A;  5ABF A;  4PJN A;  4OYJ A;  2XYT A;  3EDV A;  3EDU A;  4AXP A;  2FUP A;  1MND A;  4U7I A;  2J62 A;  3QB5 A;  5FMN A;  3T1H T;  2ZM0 A;  1KNZ A;  5KZU A;  2X00 D;  2W0G A;  5FY0 A;  3UU8 A;  2YIN A;  1IBM T;  4B3S T;  2ODU A;  5L3D B;  3AXJ B;  3P4P A;  5JDF A;  5AQU B;  4OHF A;  1M7K A;  4F6R C;  4PFP A;  4U7Y A;  2JRK A;  5DAB A;  1XNQ T;  2CXD A;  2E5V A;  2WZI A;  3RIF A;  4OX9 T;  1W09 A;  3CWZ B;  1UGO A;  4JI0 T;  2V5C A;  3ABV A;  2Y58 A;  1CUN A;  3RYC E;  3SWH A;  3CK6 A;  3RF1 A;  1ZP0 A;  4JLE A;  4H9Q C;  1Z8U A;  3ZDH A;  4DBR A;  2H88 A;  1G8X A;  4CN1 A;  4ILA A;  3SFE A;  5LGU B;  3FXD B;  4A98 A;  3D0T A;  4YFS A;  5CA1 E;  2K9A A;  4ZOL E;  4D01 A;  3Q9D A;  1KNR A;  5CO5 A;  2FBW A;  2L3L A;  4EXT A;  2BZB A;  3P4W A;  5AFN A;  3N2O A;  5C8Y E;  2Q9Q D;  3SQ6 A;  3B13 A;  4AIS A;  2HHH T;  3AEA A;  3PUZ F;  2JQK A;  4DR3 T;  2IIU A;  4DMV A;  4B3R T;  4HWH A;  1KEY A;  3E08 A;  1D1A A;  4HTE A;  4AKR B;  1JNR A;  2XSB A;  4JI5 T;  4K0K T;  4YTN A;  4YHJ A;  4U3C A;  1MMA A;  2CLY B;  4TWH A;  2B1E A;  4O4L E;  1U4Q A;  2QA7 A;  1HX8 A;  2XAQ B;  2KIN B;  2EHO B;  2LM2 A;  5AFM A;  4EOZ B;  3TLW A;  4DV0 T;  4UXN B;  2XY8 B;  4O2B E;  5DQW A;  2J4G A;  3AE4 A;  2Y8D A;  2ZLY A;  1QLB A;  3MKD A;  4H9O C;  2PFV A;  4O4J E;  5HXC A;  4ANJ A;  2Y6X A;  2UUB T;  4ZK4 A; 
#chains in the Genus database with same CATH homology
 3RQU A;  5L4H A;  2Y58 A;  4ZRU A;  4HFI A;  2VL0 A;  4PIR A;  4ZZB A;  2W8F A;  4HQP A;  2XQ8 A;  5HEO A;  2BG9 B;  2YOE A;  4BQT A;  4WV9 A;  4TNV A;  4QAC A;  2YKS A;  4HFD A;  3UU5 A;  5FJV A;  4HFH A;  3ZDH A;  4BFQ A;  1UW6 A;  3UUB A;  3TLV A;  4XHE A;  4ZJS A;  4AFH A;  5BRX A;  2Y7Y A;  5HEG A;  2XQ5 A;  3P50 A;  4ILA A;  3GUA A;  5AFL A;  5BP0 A;  2ZJU A;  3C79 A;  4ZR6 A;  3U8N A;  5J0Z A;  3WTM A;  5L47 A;  4QAA A;  4QH5 A;  4A98 A;  2Y57 A;  2BG9 C;  2ZJV A;  3WTN A;  5HEH A;  2WZY A;  4UM1 A;  5AFK A;  3EI0 A;  4TNW A;  4Z91 A;  4D01 A;  4ZJT A;  1I9B A;  4F8H A;  3UQ7 A;  2XQ3 A;  2XNU A;  3TLT A;  5CO5 A;  5J5H A;  4NPP A;  4Z90 A;  2LLY A;  5HEU A;  4QAB A;  4AFT A;  3WTL A;  4ILB A;  4QH1 A;  3WIP A;  1OED E;  5J5G A;  3SIO A;  3WTK A;  2WNC A;  5SYO A;  3LSV A;  5CFB A;  3IGQ A;  4B5D A;  3C84 A;  5AFM B;  3P4W A;  3UQ4 A;  3RI5 A;  5AFN A;  4EZ1 A;  5TVC A;  3U8M A;  3WTO A;  5KE4 A;  2MAW A;  2LKH A;  5HCJ A;  4ZK1 A;  3ZKR A;  3EAM A;  2BG9 A;  3UU3 A;  2WN9 A;  2XQ6 A;  3JAD A;  2XYS A;  3SQ6 A;  4IRE A;  4UM3 P;  2XYT A;  4LML A;  3JAE A;  2C9T A;  2Y54 A;  1OED B;  3SH1 A;  2M6I A;  2X00 A;  3T4M A;  2XQ4 A;  5AFJ A;  4UM3 S;  3RIA A;  3WTI A;  4QH4 A;  3SQ9 A;  2LKG A;  5HEJ A;  4UXU A;  3TLU A;  5LG3 A;  4NZB A;  3U8K A;  2BG9 E;  4COF A;  4DBM A;  2BYP A;  2BYQ A;  2X00 D;  3U8J A;  5AIN A;  5J5I A;  5KZU A;  2XNT A;  5LXB A;  2YN6 A;  4LMK A;  4TWH A;  4A97 A;  2XZ5 A;  2Y56 A;  2XQ7 A;  4HFE A;  2BYR A;  2QC1 B;  3U8L A;  2BYS A;  3WTJ A;  3UU8 A;  5J5F A;  4HFB A;  3UU6 A;  4IL4 A;  2UZ6 A;  2XQ9 A;  3PEO A;  3PMZ A;  3RHW A;  3TLS A;  4ZZC A;  2BJ0 A;  4TWF A;  2PH9 A;  4HFC A;  5BW2 A;  2LM2 A;  1UV6 A;  2WNJ A;  5AFM A;  5JME A;  3TLW A;  4IL9 A;  4X5T A;  5HCM A;  2YME A;  2WNL A;  2XQA A;  2W8G A;  3JAF A;  4ILC A;  3WTH A;  2BYN A;  5AFH A;  4UY2 A;  5L4E A;  5IUX A;  4FRR A;  2BR7 A;  4UM3 A;  1OED A;  4XK9 A;  2M6B A;  2BR8 A;  2XZ6 A;  3UU4 A;  1UX2 A;  1OED C;  4LMJ A;  3RIF A;  3RQW A;  3EHZ A;  2XNV A;  2KSR A;  2PGZ A;  4ALX A;  4AFG A;  2YMD A;  4ZK4 A;  4TWD A;  3ZDG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...