4IL4A

The pentameric ligand-gated ion channel glic in complex with se-ddm
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for ion permeation mechanism in pentameric ligand-gated ion channels.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
total genus 98
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4il4A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4il4A01
4A98A 4QH5A 4A97A 5AFJA 3UU8A 2WNJA 2XQ6A 4LMJA 3TLTA 4NPPA 3JADA 3TLWA 5IUXA 3JAEA 4TWHA 2XNVA 4LMLA 2XQAA 3WTLA 4QACA 3SQ6A 2WZYA 2X00A 2QC1B 3P4WA 4IREA 2Y7YA 3GUAA 3IGQA 2M6BA 2XNUA 4UXUA 2LKHA 4HFDA 4ILCA 4UY2A 2LKGA 4AFHA 4X5TA 3U8MA 4HFHA 1OEDA 4F8HA 3U8KA 3C79A 5CO5A 3WTIA 3RIFA 3T4MA 3TLSA 3U8JA 5HEJA 5AFHA 2BR7A 4IL4A 2BG9C 4HFEA 4QH4A 4ZJSA 2YMDA 5J5IA 3UU5A 5J5GA 2BG9A 2YOEA 3WTKA 3WTMA 4ZRUA 4IL9A 1OEDB 3SQ9A 2XQ7A 3SIOA 2XQ4A 3ZKRA 2XQ9A 3RHWA 5L4HA 1UX2A 3WTHA 4XHEA 4TNWA 3PMZA 2BYPA 4Z91A 2Y58A 5HEOA 4ZK4A 4ZZBA 3PEOA 2YKSA 2BYSA 4DBMA 3U8LA 5AFMA 5AFLA 2ZJUA 4HQPA 4AFGA 2WNCA 4XK9A 4EZ1A 5L47A 3EI0A 3EHZA 3WTJA 3SH1A 4HFBA 4HFIA 2XNTA 3WTNA 5JMEA 2MAWA 2YN6A 2YMEA 1OEDE 5KE4A 3EAMA 5SYOA 2XQ3A 4LMKA 3UUBA 2PH9A 3UQ7A 3P50A 2W8GA 4QABA 2XQ8A 2XYSA 4ILBA 2BYRA 3U8NA 5KZUA 4ZK1A 4ZJTA 3RQWA 2Y57A 1UW6A 4ZZCA 5BRXA 5AFKA 3ZDHA 4FRRA 2XYTA 2WNLA 3RI5A 3RQUA 4NZBA 4PIRA 4TWDA 3UU4A 2W8FA 2Y54A 5AFNA 5LXBA 4UM3A 3RIAA 3WTOA 2BR8A 5HCJA 2Y56A 5J0ZA 3ZDGA 3WIPA 3TLVA 5J5HA 5HEUA 2BJ0A 5TVCA 4QAAA 2X00D 5J5FA 5BP0A 3UU6A 2BYNA 3C84A 2ZJVA 5LG3A 2UZ6A 4HFCA 4BQTA 5BW2A 2LM2A 2BYQA 5CFBA 2PGZA 3UQ4A 4QH1A 5HEHA 4D01A 5HCMA 2VL0A 4TNVA 4AFTA 4ILAA 4UM3S 3UU3A 4ZR6A 2BG9B 1OEDC 1I9BA 2WN9A 5FJVA 5AINA 4WV9A 2M6IA 3LSVA 2XZ6A 3TLUA 4BFQA 2LLYA 2BG9E 4ALXA 5L4EA 3JAFA 2KSRA 1UV6A 2C9TA 4TWFA 2XQ5A 4UM3P 4B5DA 4COFA 2XZ5A 5AFMB 4UM1A 5HEGA 4Z90A
chains in the Genus database with same CATH superfamily
3RYIE 2WNJA 2XQ6A 5AQSB 3JADA 3AA6B 4LMLA 2CPTA 2FJBA 1J5ET 2XNUA 4PJMA 4YT0A 5KMGP 2I6HA 3CX6B 5FXXA 4P1NA 5L3EB 3U8KA 3DJBA 3U78A 5JTGA 2WWVA 3AEDA 5LP6E 3VRAA 2I59A 4IL4A 1WFDA 2W61A 5J5GA 1NWMX 4QXCB 5AQJB 1ZKEA 5LYJE 5AQNB 4ZXLA 3PMZA 1FEWA 4UIGA 1I6ZA 3ZMZB 3CQXC 5AFLA 3PV0F 3E08A 4JI4T 4HFBA 2WWUA 4ERRA 4JI1T 2Q9QB 2WDQA 4IT4A 3CIRA 2ZM8A 2F4VT 1QSDA 2XYSA 3ZPOA 2CXFA 5HXRA 3RKGA 3AE9A 4I0UA 2W62A 2WCAA 4TWDA 3CWZB 5LXBA 3ZDGA 3QB5A 4PFOA 5AQGB 2Q9QC 3VRBA 4ZI3C 4ADZA 4HFCA 2N2NA 4OYKA 2NP9A 5FXVA 4U31A 3L39A 2VL0A 2BG9B 3WI3A 2BS3A 2JRKA 4HEAA 2CBJA 4KHZF 4E7ZA 3EDVA 5J2UE 3JAEA 2XNVA 3O4XE 3SS1A 2V5DA 3SQ6A 4ILCA 2VB6A 2LKGA 4UVAB 1OEDA 3O1JA 3ZJ1A 5HEJA 3AEBA 5J5IA 2KMFA 4NUUA 3ZKRA 2CWOA 2LEHA 2W0GA 2XQ4A 4QXBB 4IGUA 5LMUT 4HWDA 4ZEYA 1MNDA 4B3MT 3W15B 5L47A 3EHZA 4NXNT 5FP3A 3DTOA 2L9QA 3SOLA 4YHJA 3CVRA 5AQRB 3U8NA 4MLKA 3OBVE 2WAUA 2Y57A 5BRXA 3RKOA 2LHRA 3ZDHA 1HTJF 3RIUC 2XYTA 1D1AA 1LRZA 4YTNA 2EHOC 3MK7C 4IDNA 1N34T 3ABVA 3G06A 2C5IT 2BYNA 4DV4T 2PGZA 3QNUA 4AQFC 1NAFA 3N9MA 4CQIA 3PDYA 4KHPT 4UM3S 2KT9A 2XZ6A 1N36T 3AB3B 2JMKA 4PW8A 3UUMA 3ZC0A 2HN2A 4EB6E 4UM3P 3L3PA 3WTLA 3KV6A 5IUXA 5JDFA 4LFBT 3ZMTB 2V7MA 3QOFA 3IGQA 3FXEB 2RA1A 2H88A 4LF5T 4YXDA 1X79A 2N1GA 5L2LA 1D1CA 5H6QB 3PUXF 3Q5WA 3WTMA 4UEMA 2H7VC 3HKEE 3PUAA 3MKDA 2Y58A 2Y6XA 4YTMA 2IC6A 3PJAJ 3ETUA 3C4WA 4WNKA 4OK0A 4B3ST 4LMKA 4IE0A 2E9XD 4QABA 2XQ8A 3FZLB 3RQWA 5KX5E 4Q25A 2CCQA 2WNLA 2HPJA 4NZBA 2WM9A 2WU5A 2V6XA 5L3DB 3KBUA 1ZV4X 3RIAA 2P9BA 1L0VA 2DI4A 4HWCA 3Q5EA 4DR1T 2BJ0A 2D0UA 4HKAA 4HWHA 2CBIA 5AQOB 2MBGA 2K48A 4KP3C 5FXZA 3ZN1B 1OEDC 5ADXL 2MOZA 2C0SA 5JRCA 1U5PA 2V6YA 4EEDA 2X51A 4L5GA 2XZEA 1HCIA 4U7IA 3PUQA 3ZYLA 2I0MA 1S35A 1SUMB 5EZYE 2XQAA 4QHOA 2UXCT 3B13A 3HI2A 5AQLB 3L8RA 4AFHA 4X5TA 3ZMVB 1BR1A 3N9QA 3T4MA 2UXBT 3X1DA 1US7B 1ZOYA 3PTRB 4U7YA 2BR7A 4TZ4C 2BG9C 2Q9QA 4DR7T 2FJAA 3WAJA 3ESLA 4IE4A 4Z91A 4ZZBA 2HPLA 2VK9A 3I0OA 4Z8XA 2LT3A 3SH1A 4U72A 2YN6A 4CI3B 1YW0A 5IYZE 2X67A 5JR9A 4AXPA 2IHR1 3UQ7A 5TAOA 3KVAA 4ZJTA 2FUPA 4ASKA 5FVLA 3SFEA 4FRRA 2V1DB 4DBRA 5JR9B 4DV7T 1VRBA 2YU1A 4TUYE 3VKHA 1MIWA 5LGTB 3ZT5A 1HG2A 3C64A 3ZYMA 5CFBA 3IF8B 1UGOA 5CJ5A 3P4PA 4BFQA 2MYSA 3Q9DA 2PTFA 3RYFE 5JDNA 3OYXA 4XZCA 4DV1T 2VKDA 4A98A 2W67A 3UU8A 3ZEFB 4O4LE 1WLXA 1Y64B 3AVSA 1GQEA 3P4WA 4HFVA 4I50E 2XUEA 4KX6A 3D0TA 4EYYR 2K9AA 5AQMB 5AQKB 1IBMT 4DR3T 2LRKA 2XASB 1EZ3A 3PJAA 3U8JA 1B7TA 2K24A 2YMDA 1I94T 2YK0A 2UUCT 2LSIA 2CE7A 4IL9A 1VCTA 3SIOA 4AKLA 3CPZA 2V8SV 1XWMA 5AFMA 4DR2T 2V7IA 2ZJUA 5JDGA 5AQHB 3WTJA 5ABGA 2XNTA 4I55E 1LVKA 3QK6A 2JIWA 3N9PA 5AQIB 5M4YA 2BYRA 1S94A 2LE8A 3GWHA 3ONXA 4GKJT 2X9HA 5LMNT 2DWKA 2V7LA 5AFNA 3WTOA 1T72A 2D0TA 4DMVA 4X62T 3Q5XA 2X9XA 3UFGA 3N9LA 3B5MA 3UU3A 4U2YA 5LB7B 3NZPA 3OJAA 4ALXA 5CGMA 2XQ5A 4DVDA 1JNZA 4UXUA 4QH5A 3TLTA 4JI6T 3AAAB 2WP9A 1FMWA 4HFDA 2RPAA 3IA3A 3KINB 4U33A 2C5KT 2MTQA 2KNDA 1BR4A 2KLQA 3GN5B 3NVOA 3MZKB 3UU5A 5AQPB 4JLEA 2BG9A 5F8PA 3AE4A 4J2CA 2HHHT 4K0UA 2BS2A 3E0ZA 4WW0A 4EAHA 4A5XA 1JNRA 1OXZA 3KDSE 3ZLIA 5A1LA 2IMLA 5L3GB 3KV5A 4HE8A 2WNCA 1WYBA 3KV9A 5FY0A 3WTNA 3GN5A 2CRBA 5F5WA 1LKXA 4LF6T 2WDRA 3C98B 1HNWT 3AE7A 3IHRA 1HF8A 3AEFA 3AA0B 3LFMA 4YSYA 1O3XA 2JQKA 5JDMA 1E2AA 4JUYA 4O2BE 5ETWA 2D5UA 5JDQA 1IAPA 4KBMB 2CEAA 1UX4A 3ONJA 4E7SA 2BBJA 2DWGA 3IBPA 4AKIA 3I1AA 4DR4T 4EV6A 3OTOT 3C84A 4V1Av 3PUGA 5JQGE 4MBQA 2LM2A 4CXWA 1QUUA 3AA1B 2NOXA 2LSYA 3J7Yq 3L09A 5H6RB 4DMWA 3CQGB 2BG9E 4GKKT 3BK9A 1KF6A 5ABFB 2KSRA 1T8BA 4TWFA 4Z90A 4DV5T 2BVLA 4IREA 2XAJB 1FIOA 4A56A 2LKHA 5JDHA 2BVMA 1FJGT 3K8PC 4CN1A 4UXNB 3I0QA 4ZOLE 3V5UA 1WRDA 3AEAA 4UVCB 2BBHA 2H3RA 4CI2B 4AISA 4BJMA 4AIUA 3FBZA 3EUHA 5BR8T 1ZHCA 1SHZC 4HFIA 2E5LT 2YMEA 5KE4A 3ZMSB 2XQ3A 3N9OA 4OFZA 4F6RC 2AXDS 4X1KE 3N5LA 5AQVB 4PJNA 3LG7A 2CLYC 3RI5A 4TX5A 1XNRT 4PK5A 2W8FA 5ABHA 4DUYT 3AAIA 4X1IE 4IDOA 3RYHE 2CWYA 4L0RA 5BW2A 2WSSV 1W0BA 2BDEA 2NTXA 5LGNB 3AE2A 4LF4T 4TNVA 2V26A 2YDRA 2G0UA 3T1YT 5AINA 3O1HA 4IIJE 1YKEB 2KWHA 3ZCJA 2W63A 5L4EA 1D1BA 4MALA 5HEGA 3UT5E 2XM1A 5JH7E 4X20E 4BA9A 5KXJA 1MMNA 2EHOB 3GUAA 2M6BA 1MMGA 3OVUA 3V5SA 2WB5A 3PU3A 4X65T 4QWNB 2IC9A 2QVAA 5LXTE 1CHUA 2KINB 5E0OA 3RIFA 4MHCA 3TLSA 1W0AA 3UFEA 3P8CD 2WQYA 2XHEB 5AQQB 1QLBA 5HXEA 5FMNA 2D9DA 4XHEA 3FZFB 2QGSA 4AI6A 4H63V 2X0HA 4O4HE 4UV9B 2XQYA 3BQLA 3ZYKA 1OEDE 1KK7A 1IBLT 3LK2B 1SE7A 2ACZA 3P50A 5FYMA 4H9SE 1HS7A 5DQWA 2ZM0A 2LOPA 3MJXA 5LJNA 3RQUA 3UU4A 4EXTA 3A8YC 2BR8A 3WIPA 4ZHQE 2ZMAA 5LNKA 1LVFA 2W4XA 1N33T 5HAXA 4DV6T 4H9RC 3F31A 4P0AA 1I9BA 3PUVF 2N9DA 5FJVA 2M6IA 2WZIA 3ZN0B 4PJJA 1KEYA 1T7SA 3BQKA 4I4TE 3RH3A 4LF7T 3ZC1A 3NWIA 1M7KA 4LMJA 4NPPA 3TLWA 4UV8B 3AECA 4C91A 4YLHA 1YQ4A 2XY8B 4TV9E 2SPCA 3N9NA 4EZ4A 3OYZA 4NXMT 4IDZA 2OLTA 2E2AA 4QX8B 4IE6A 2H89A 2DL1A 4MFRA 2CA5A 5DABA 5CA1E 2VL8A 5HXSA 2X68A 1ZP0A 1UX2A 5L4HA 2E8IA 2VVNA 1G8XA 2NW8A 1XZYA 5HEOA 2WU2A 3U8LA 3OPCA 4AFGA 3EI0A 3PE0A 5JMEA 4JI8T 2K3WA 3K3OA 2XM2A 4JV5T 1IZNB 3EVYA 2ZLYA 4ILUA 2WMOA 3CX8B 2UXDT 3HR0A 2QRXA 5F3JA 3ANWA 1HG5A 1HX8A 4PK4A 3ZJ2A 5LHIB 5J5FA 5ABFA 1E7PA 4UR9A 5LG3A 4BQTA 4QX7B 4DUZT 5HEHA 4YTPA 2X0YA 1M62A 2DNXA 3SWHA 3AXJB 2LRLA 2WS3A 3LBXA 4L9IA 4O4IE 4B3TT 2L8KA 2XAGB 2Y7YA 2IW5B 5FY1A 2ZM2A 4WBOA 2WY2A 4QKNA 4TV8E 3HKDE 3C79A 1DU2A 5LJMA 4HWIB 2W2UA 5LGUB 3DP7A 3C50A 3K1SA 2V5CA 5JREA 4DBQA 4I43B 4C90A 4ZK4A 5FL0A 2WZHA 4OYJA 1XMQT 2NR4A 3JC6C 1WR6A 2XTLA 4O2AE 4CZZB 3BQIA 2ODVA 1ZEEA 4WZXA 4ILBA 3UUXB 2X0LB 4NIQA 3K3QC 2V7KA 1U4QA 4ZS2A 4JI5T 4DV2T 5L3CB 4WYVA 2CXDA 2XJ7A 4U74A 3GMIA 5HCJA 3TLVA 1R8IA 3PU8A 3PUSA 1MIYA 4FJOA 1D0ZA 5LG4A 2BKPA 1G73A 1XMOT 2NW7A 3UQ4A 4X64T 2ES0A 3T8OA 4AFTA 4ILAA 1AJ3A 4ZR6A 3SFDA 3KV4A 3N2GE 4JI7T 2VQET 2JQQA 3CKDA 4IE5A 3S4UA 2BS4A 4P0BA 3H3MA 1VOMA 5J1GA 4PJLA 3AA7B 2BYQA 2CHOA 3NZQA 3UUNA 4JI2T 1HNZT 2UXXB 4ZI2D 1HX1B 4JEUB 5CO5A 5FY7A 2A3DA 3F2EA 4DR5T 2BZBA 3FB2A 3SQ9A 4PFPA 2CXLA 5HYAA 4EIWA 5JRCB 4JYAT 4DNDA 3MACA 3AEEA 3I9WA 5LBQB 3CK6A 5JDLA 4DV0T 4YSXA 4FI5A 5KZUA 3PUYF 3TKLB 4ZZCA 1CUNA 4XAXB 1KNZA 3EABA 3R6NA 3CQCB 3HKCE 5C2TA 2NTYA 2WDVA 5CA0E 2Y54A 3VHLA 2KWIB 3VR8A 4UF0B 2IAKA 2Y56A 3AE8A 2CMRA 3FZKB 5TVCA 2XAQB 2NW9A 4LF8T 2E9XB 2QA7A 3CMLA 4LF9T 3HL6A 4UF0A 5IWAT 3RC8A 4WV9A 1HR0T 3OKQA 1XNQT 4CN4A 4B5DA 4UM1A 1HNXT 5KDMC 5AFJA 3ZT6A 3RGLA 3P4RA 3NRXA 2E5VA 3LK3B 4CXXA 2QC1B 4UY2A 4ANJA 3AEGA 4ISTA 4PK6A 4YSZA 2RP4A 2M67A 4F8HA 3Q5DA 2VASA 4O8SA 3RRWA 4IE7A 3N2OA 2Q9QD 1W09A 5AFHA 4QH4A 4GK5E 2B1EA 4IDPA 4IDQA 4QXHB 5JVDE 2YOEA 4EYUA 2HH7A 3K3NA 2XPKA 1UURA 3KVBA 3LK42 4TNWA 5FL1A 2BYPA 3KFWX 3ONLC 4DR6T 4EZ1A 1UCUA 5J2TE 3NRYA 3ANWB 5SYOA 1E1HB 3A5XA 3QUJA 3F57A 1H7CA 2V6YB 2ODUA 3IEEA 5FVKA 1UW6A 5LA6E 4ZI3D 2MPKA 2CHNA 2ZM6T 4UM3A 1IBKT 3FZMB 5FXWA 2UUBT 1UK5A 3AXJA 1MMAA 2WBLA 3J9X1 2UZ6A 4D01A 5HCMA 1Y01A 5C8YE 1WCRA 4GYSA 5CB4E 3EDUA 3ZT7A 3U3IA 5C3JA 3JAFA 2L3LA 3PUWF 2XZ5A 2BKNA 2JJ9A 3C4XA 1NENA 2LM9A 1MNEA 4OX9T 1VCSA 1YQ3A 2VKHA 3RPUA 4KMCA 2ACXA 3NBXX 5HXHA 4ZJSA 2W00A 2FBWA 4YFSA 3ZSSA 2J4GA 3WTKA 5L3FB 4AQYT 4ZRUA 2EHOD 2XQ7A 2YDQA 2XQ9A 3RHWA 3WTHA 3H3AA 3GA8A 3P7IA 4BJNA 1KFYA 2BYSA 2BKOA 4ZI7E 4UVBB 1WR0A 3ZSTA 3VR9A 2YDSA 3EAMA 2PH9A 1SA0E 4OHFA 3AE6A 5EK4A 4ZS3A 1WYCA 1IJ6A 5DQVA 2K5BB 4B6XA 4DO0A 3A7MA 2VURA 5J0ZA 4HWFA 2Z6EA 3PURA 4GK0E 2PBIA 3MA9A 5EK2A 3WAKA 3UU6A 3PUZF 2VWAA 1Z0PA 2LOSA 4H9QC 3LSVA 4WBNE 2LLYA 5AQFB 4P09A 4AKRB 5AFMB 4H9OC 3PEOA 4HN9A 4O4JE 4TWHA 4EGWA 3RYCE 4JEHB 2IUBA 3C51A 3U8MA 4EZHA 3AAEB 4HFHA 3QC9A 5HWYA 5FNVE 1J5WA 2VQFT 4IHJE 3WTIA 1BR0A 3Q2MA 2FJEA 2C5JA 2J47A 2KXPB 1T98A 2IDOB 4AKHA 3N2KE 5HWXA 3LBXB 2JMHA 4CXYA 2Y8DA 4K0KT 4CN6A 2DHRA 4AQFA 4XK9A 3T1HT 1W9RA 2VKJA 1FMVA 2J62A 1BR2A 3ETVA 3UUBA 4EEBA 5JR9C 1HFAA 5LHGB 4JI3T 3AE3A 3C4ZA 3O9XA 3RX6A 3P4SA 4KI0F 3R84B 1KNRA 4NUVA 4U2ZA 3MXZA 4H9NC 4HTEA 1X9BA 3LDQB 2LJLA 3AVRA 5AQTB 2B76A 3UTKA 2X00D 4HGAA 5BP0A 2YEVC 3E22E 1UUSA 5AFUL 4YHHT 2YINA 4B3RT 3AE5A 3TLUA 5DJQC 4N78D 1UV6A 2C9TA 3ZCIA 3RRCA 1YKHB 3RC3A 3VU7H 4M1PA 4QACA 2W66A 5IHYA 3JC6D 2X9YA 2X66A 2AE9A 4JBWF 2OV9A 5ABEA 2H7OA 3ZMUB 2LHNA 3H37A 4UELA 4H9PC 1OEDB 2GK9A 2YKSA 3P4QA 3FXDB 2DLRA 4DIDB 1XDOA 1IJ5A 4JI0T 2W8GA 2KZ7B 4ZI2C 2XSAA 4YJ2E 5AFKA 4PNIA 1YD8G 2NWBA 2LSJA 4ISSA 5J5HA 5HEUA 4AQGA 1NEKA 4QAAA 2ZJVA 2XAHB 4QH1A 4KUMB 2VKOA 3M3ZB 3O1IA 2WN9A 2WMNA 4AKGA 4U3CA 1MIVA 1UX5A 4CI1B 2DCFA 1OWAA 1KNPA 2A2FX 3HKBE 4A97A 2V7JA 2WZYA 2X00A 4X66T 3QB5K 3CX7B 1D0YA 1D0XA 1J1JA 5BMVE 3FHNA 2LSGA 4G2AA 3JCFA 2JQ9A 2E9XA 4LFAT 1MMDA 2PFVA 4HFEA 2Y48B 2R6GF 2XAFB 4GYRA 4LFCT 1N32T 3KBTA 3RLFF 3M65A 2E9XC 5LCYA 2XSBA 3I9YA 4DBMA 3FBLA 2J1DG 2A9UA 4HQPA 4DV3T 1V9DA 2MAWA 3HA4A 5AQUB 2JQHA 5EK3A 3AE1A 4X1YE 2HN1A 4YJ3E 2X9WA 3UULA 4ZK1A 4GIWA 5LOVE 3NKZA 2IIUA 2A72A 2PJQA 4XBFB 1YXRA 5LBMA 2EHOA 4YY3T 2LSKA 4PIRA 2OA5A 2YU2A 4GOUA 4H63H 3SRZA 5L3BB 5HXCA 2QYWA 2UU9T 2D2SA 2VVSA 4BAYB 2UXNB 3LJCA 2JPFA 2FJDA 1Z8UA 4EOZB 3RF1A 3B57A 1XDPA 2PG8A 3VKGA 4TN7B 2CM0A 2UUAT 4PAGA 5GONE 3FZHB 5LHHB 3RIUA 5FKYA 2CLYB 4COFA 4G63A
chains in the Genus database with same CATH topology
4A98A 4QH5A 4A97A 5AFJA 3UU8A 2WNJA 2XQ6A 4LMJA 3TLTA 4NPPA 3JADA 3TLWA 5IUXA 3JAEA 4TWHA 2XNVA 4LMLA 2XQAA 3WTLA 4QACA 3SQ6A 2WZYA 2X00A 2QC1B 3P4WA 4IREA 2Y7YA 3GUAA 3IGQA 2M6BA 2XNUA 4UXUA 2LKHA 4HFDA 4ILCA 4UY2A 2LKGA 4AFHA 4X5TA 3U8MA 4HFHA 1OEDA 4F8HA 3U8KA 3C79A 5CO5A 3WTIA 3RIFA 3T4MA 3TLSA 3U8JA 5HEJA 5AFHA 2BR7A 4IL4A 2BG9C 4HFEA 4QH4A 4ZJSA 2YMDA 5J5IA 3UU5A 5J5GA 2BG9A 2YOEA 3WTKA 3WTMA 4ZRUA 4IL9A 1OEDB 3SQ9A 2XQ7A 3SIOA 2XQ4A 3ZKRA 2XQ9A 3RHWA 5L4HA 1UX2A 3WTHA 4XHEA 4TNWA 3PMZA 2BYPA 4Z91A 2Y58A 5HEOA 4ZK4A 4ZZBA 3PEOA 2YKSA 2BYSA 4DBMA 3U8LA 5AFMA 5AFLA 2ZJUA 4HQPA 4AFGA 2WNCA 4XK9A 4EZ1A 5L47A 3EI0A 3EHZA 3WTJA 3SH1A 4HFBA 4HFIA 2XNTA 3WTNA 5JMEA 2MAWA 2YN6A 2YMEA 1OEDE 5KE4A 3EAMA 5SYOA 2XQ3A 4LMKA 3UUBA 2PH9A 3UQ7A 3P50A 2W8GA 4QABA 2XQ8A 2XYSA 4ILBA 2BYRA 3U8NA 5KZUA 4ZK1A 4ZJTA 3RQWA 2Y57A 1UW6A 4ZZCA 5BRXA 5AFKA 3ZDHA 4FRRA 2XYTA 2WNLA 3RI5A 3RQUA 4NZBA 4PIRA 4TWDA 3UU4A 2W8FA 2Y54A 5AFNA 5LXBA 4UM3A 3RIAA 3WTOA 2BR8A 5HCJA 2Y56A 5J0ZA 3ZDGA 3WIPA 3TLVA 5J5HA 5HEUA 2BJ0A 5TVCA 4QAAA 2X00D 5J5FA 5BP0A 3UU6A 2BYNA 3C84A 2ZJVA 5LG3A 2UZ6A 4HFCA 4BQTA 5BW2A 2LM2A 2BYQA 5CFBA 2PGZA 3UQ4A 4QH1A 5HEHA 4D01A 5HCMA 2VL0A 4TNVA 4AFTA 4ILAA 4UM3S 3UU3A 4ZR6A 2BG9B 1OEDC 1I9BA 2WN9A 5FJVA 5AINA 4WV9A 2M6IA 3LSVA 2XZ6A 3TLUA 4BFQA 2LLYA 2BG9E 4ALXA 5L4EA 3JAFA 2KSRA 1UV6A 2C9TA 4TWFA 2XQ5A 4UM3P 4B5DA 4COFA 2XZ5A 5AFMB 4UM1A 5HEGA 4Z90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A98 A;  4QH5 A;  4A97 A;  5AFJ A;  3UU8 A;  2WNJ A;  2XQ6 A;  4LMJ A;  3TLT A;  4NPP A;  3JAD A;  3TLW A;  5IUX A;  3JAE A;  4TWH A;  2XNV A;  4LML A;  2XQA A;  3WTL A;  4QAC A;  3SQ6 A;  2WZY A;  2X00 A;  2QC1 B;  3P4W A;  4IRE A;  2Y7Y A;  3GUA A;  3IGQ A;  2M6B A;  2XNU A;  4UXU A;  2LKH A;  4HFD A;  4ILC A;  4UY2 A;  2LKG A;  4AFH A;  4X5T A;  3U8M A;  4HFH A;  1OED A;  4F8H A;  3U8K A;  3C79 A;  5CO5 A;  3WTI A;  3RIF A;  3T4M A;  3TLS A;  3U8J A;  5HEJ A;  5AFH A;  2BR7 A;  4IL4 A;  2BG9 C;  4HFE A;  4QH4 A;  4ZJS A;  2YMD A;  5J5I A;  3UU5 A;  5J5G A;  2BG9 A;  2YOE A;  3WTK A;  3WTM A;  4ZRU A;  4IL9 A;  1OED B;  3SQ9 A;  2XQ7 A;  3SIO A;  2XQ4 A;  3ZKR A;  2XQ9 A;  3RHW A;  5L4H A;  1UX2 A;  3WTH A;  4XHE A;  4TNW A;  3PMZ A;  2BYP A;  4Z91 A;  2Y58 A;  5HEO A;  4ZK4 A;  4ZZB A;  3PEO A;  2YKS A;  2BYS A;  4DBM A;  3U8L A;  5AFM A;  5AFL A;  2ZJU A;  4HQP A;  4AFG A;  2WNC A;  4XK9 A;  4EZ1 A;  5L47 A;  3EI0 A;  3EHZ A;  3WTJ A;  3SH1 A;  4HFB A;  4HFI A;  2XNT A;  3WTN A;  5JME A;  2MAW A;  2YN6 A;  2YME A;  1OED E;  5KE4 A;  3EAM A;  5SYO A;  2XQ3 A;  4LMK A;  3UUB A;  2PH9 A;  3UQ7 A;  3P50 A;  2W8G A;  4QAB A;  2XQ8 A;  2XYS A;  4ILB A;  2BYR A;  3U8N A;  5KZU A;  4ZK1 A;  4ZJT A;  3RQW A;  2Y57 A;  1UW6 A;  4ZZC A;  5BRX A;  5AFK A;  3ZDH A;  4FRR A;  2XYT A;  2WNL A;  3RI5 A;  3RQU A;  4NZB A;  4PIR A;  4TWD A;  3UU4 A;  2W8F A;  2Y54 A;  5AFN A;  5LXB A;  4UM3 A;  3RIA A;  3WTO A;  2BR8 A;  5HCJ A;  2Y56 A;  5J0Z A;  3ZDG A;  3WIP A;  3TLV A;  5J5H A;  5HEU A;  2BJ0 A;  5TVC A;  4QAA A;  2X00 D;  5J5F A;  5BP0 A;  3UU6 A;  2BYN A;  3C84 A;  2ZJV A;  5LG3 A;  2UZ6 A;  4HFC A;  4BQT A;  5BW2 A;  2LM2 A;  2BYQ A;  5CFB A;  2PGZ A;  3UQ4 A;  4QH1 A;  5HEH A;  4D01 A;  5HCM A;  2VL0 A;  4TNV A;  4AFT A;  4ILA A;  4UM3 S;  3UU3 A;  4ZR6 A;  2BG9 B;  1OED C;  1I9B A;  2WN9 A;  5FJV A;  5AIN A;  4WV9 A;  2M6I A;  3LSV A;  2XZ6 A;  3TLU A;  4BFQ A;  2LLY A;  2BG9 E;  4ALX A;  5L4E A;  3JAF A;  2KSR A;  1UV6 A;  2C9T A;  4TWF A;  2XQ5 A;  4UM3 P;  4B5D A;  4COF A;  2XZ5 A;  5AFM B;  4UM1 A;  5HEG A;  4Z90 A; 
#chains in the Genus database with same CATH topology
 3RYI E;  2WNJ A;  2XQ6 A;  5AQS B;  3JAD A;  3AA6 B;  4LML A;  2CPT A;  2FJB A;  1J5E T;  2XNU A;  4PJM A;  4YT0 A;  5KMG P;  2I6H A;  3CX6 B;  5FXX A;  4P1N A;  5L3E B;  3U8K A;  3DJB A;  3U78 A;  5JTG A;  2WWV A;  3AED A;  5LP6 E;  3VRA A;  2I59 A;  4IL4 A;  1WFD A;  2W61 A;  5J5G A;  1NWM X;  4QXC B;  5AQJ B;  1ZKE A;  5LYJ E;  5AQN B;  4ZXL A;  3PMZ A;  1FEW A;  4UIG A;  1I6Z A;  3ZMZ B;  3CQX C;  5AFL A;  3PV0 F;  3E08 A;  4JI4 T;  4HFB A;  2WWU A;  4ERR A;  4JI1 T;  2Q9Q B;  2WDQ A;  4IT4 A;  3CIR A;  2ZM8 A;  2F4V T;  1QSD A;  2XYS A;  3ZPO A;  2CXF A;  5HXR A;  3RKG A;  3AE9 A;  4I0U A;  2W62 A;  2WCA A;  4TWD A;  3CWZ B;  5LXB A;  3ZDG A;  3QB5 A;  4PFO A;  5AQG B;  2Q9Q C;  3VRB A;  4ZI3 C;  4ADZ A;  4HFC A;  2N2N A;  4OYK A;  2NP9 A;  5FXV A;  4U31 A;  3L39 A;  2VL0 A;  2BG9 B;  3WI3 A;  2BS3 A;  2JRK A;  4HEA A;  2CBJ A;  4KHZ F;  4E7Z A;  3EDV A;  5J2U E;  3JAE A;  2XNV A;  3O4X E;  3SS1 A;  2V5D A;  3SQ6 A;  4ILC A;  2VB6 A;  2LKG A;  4UVA B;  1OED A;  3O1J A;  3ZJ1 A;  5HEJ A;  3AEB A;  5J5I A;  2KMF A;  4NUU A;  3ZKR A;  2CWO A;  2LEH A;  2W0G A;  2XQ4 A;  4QXB B;  4IGU A;  5LMU T;  4HWD A;  4ZEY A;  1MND A;  4B3M T;  3W15 B;  5L47 A;  3EHZ A;  4NXN T;  5FP3 A;  3DTO A;  2L9Q A;  3SOL A;  4YHJ A;  3CVR A;  5AQR B;  3U8N A;  4MLK A;  3OBV E;  2WAU A;  2Y57 A;  5BRX A;  3RKO A;  2LHR A;  3ZDH A;  1HTJ F;  3RIU C;  2XYT A;  1D1A A;  1LRZ A;  4YTN A;  2EHO C;  3MK7 C;  4IDN A;  1N34 T;  3ABV A;  3G06 A;  2C5I T;  2BYN A;  4DV4 T;  2PGZ A;  3QNU A;  4AQF C;  1NAF A;  3N9M A;  4CQI A;  3PDY A;  4KHP T;  4UM3 S;  2KT9 A;  2XZ6 A;  1N36 T;  3AB3 B;  2JMK A;  4PW8 A;  3UUM A;  3ZC0 A;  2HN2 A;  4EB6 E;  4UM3 P;  3L3P A;  3WTL A;  3KV6 A;  5IUX A;  5JDF A;  4LFB T;  3ZMT B;  2V7M A;  3QOF A;  3IGQ A;  3FXE B;  2RA1 A;  2H88 A;  4LF5 T;  4YXD A;  1X79 A;  2N1G A;  5L2L A;  1D1C A;  5H6Q B;  3PUX F;  3Q5W A;  3WTM A;  4UEM A;  2H7V C;  3HKE E;  3PUA A;  3MKD A;  2Y58 A;  2Y6X A;  4YTM A;  2IC6 A;  3PJA J;  3ETU A;  3C4W A;  4WNK A;  4OK0 A;  4B3S T;  4LMK A;  4IE0 A;  2E9X D;  4QAB A;  2XQ8 A;  3FZL B;  3RQW A;  5KX5 E;  4Q25 A;  2CCQ A;  2WNL A;  2HPJ A;  4NZB A;  2WM9 A;  2WU5 A;  2V6X A;  5L3D B;  3KBU A;  1ZV4 X;  3RIA A;  2P9B A;  1L0V A;  2DI4 A;  4HWC A;  3Q5E A;  4DR1 T;  2BJ0 A;  2D0U A;  4HKA A;  4HWH A;  2CBI A;  5AQO B;  2MBG A;  2K48 A;  4KP3 C;  5FXZ A;  3ZN1 B;  1OED C;  5ADX L;  2MOZ A;  2C0S A;  5JRC A;  1U5P A;  2V6Y A;  4EED A;  2X51 A;  4L5G A;  2XZE A;  1HCI A;  4U7I A;  3PUQ A;  3ZYL A;  2I0M A;  1S35 A;  1SUM B;  5EZY E;  2XQA A;  4QHO A;  2UXC T;  3B13 A;  3HI2 A;  5AQL B;  3L8R A;  4AFH A;  4X5T A;  3ZMV B;  1BR1 A;  3N9Q A;  3T4M A;  2UXB T;  3X1D A;  1US7 B;  1ZOY A;  3PTR B;  4U7Y A;  2BR7 A;  4TZ4 C;  2BG9 C;  2Q9Q A;  4DR7 T;  2FJA A;  3WAJ A;  3ESL A;  4IE4 A;  4Z91 A;  4ZZB A;  2HPL A;  2VK9 A;  3I0O A;  4Z8X A;  2LT3 A;  3SH1 A;  4U72 A;  2YN6 A;  4CI3 B;  1YW0 A;  5IYZ E;  2X67 A;  5JR9 A;  4AXP A;  2IHR 1;  3UQ7 A;  5TAO A;  3KVA A;  4ZJT A;  2FUP A;  4ASK A;  5FVL A;  3SFE A;  4FRR A;  2V1D B;  4DBR A;  5JR9 B;  4DV7 T;  1VRB A;  2YU1 A;  4TUY E;  3VKH A;  1MIW A;  5LGT B;  3ZT5 A;  1HG2 A;  3C64 A;  3ZYM A;  5CFB A;  3IF8 B;  1UGO A;  5CJ5 A;  3P4P A;  4BFQ A;  2MYS A;  3Q9D A;  2PTF A;  3RYF E;  5JDN A;  3OYX A;  4XZC A;  4DV1 T;  2VKD A;  4A98 A;  2W67 A;  3UU8 A;  3ZEF B;  4O4L E;  1WLX A;  1Y64 B;  3AVS A;  1GQE A;  3P4W A;  4HFV A;  4I50 E;  2XUE A;  4KX6 A;  3D0T A;  4EYY R;  2K9A A;  5AQM B;  5AQK B;  1IBM T;  4DR3 T;  2LRK A;  2XAS B;  1EZ3 A;  3PJA A;  3U8J A;  1B7T A;  2K24 A;  2YMD A;  1I94 T;  2YK0 A;  2UUC T;  2LSI A;  2CE7 A;  4IL9 A;  1VCT A;  3SIO A;  4AKL A;  3CPZ A;  2V8S V;  1XWM A;  5AFM A;  4DR2 T;  2V7I A;  2ZJU A;  5JDG A;  5AQH B;  3WTJ A;  5ABG A;  2XNT A;  4I55 E;  1LVK A;  3QK6 A;  2JIW A;  3N9P A;  5AQI B;  5M4Y A;  2BYR A;  1S94 A;  2LE8 A;  3GWH A;  3ONX A;  4GKJ T;  2X9H A;  5LMN T;  2DWK A;  2V7L A;  5AFN A;  3WTO A;  1T72 A;  2D0T A;  4DMV A;  4X62 T;  3Q5X A;  2X9X A;  3UFG A;  3N9L A;  3B5M A;  3UU3 A;  4U2Y A;  5LB7 B;  3NZP A;  3OJA A;  4ALX A;  5CGM A;  2XQ5 A;  4DVD A;  1JNZ A;  4UXU A;  4QH5 A;  3TLT A;  4JI6 T;  3AAA B;  2WP9 A;  1FMW A;  4HFD A;  2RPA A;  3IA3 A;  3KIN B;  4U33 A;  2C5K T;  2MTQ A;  2KND A;  1BR4 A;  2KLQ A;  3GN5 B;  3NVO A;  3MZK B;  3UU5 A;  5AQP B;  4JLE A;  2BG9 A;  5F8P A;  3AE4 A;  4J2C A;  2HHH T;  4K0U A;  2BS2 A;  3E0Z A;  4WW0 A;  4EAH A;  4A5X A;  1JNR A;  1OXZ A;  3KDS E;  3ZLI A;  5A1L A;  2IML A;  5L3G B;  3KV5 A;  4HE8 A;  2WNC A;  1WYB A;  3KV9 A;  5FY0 A;  3WTN A;  3GN5 A;  2CRB A;  5F5W A;  1LKX A;  4LF6 T;  2WDR A;  3C98 B;  1HNW T;  3AE7 A;  3IHR A;  1HF8 A;  3AEF A;  3AA0 B;  3LFM A;  4YSY A;  1O3X A;  2JQK A;  5JDM A;  1E2A A;  4JUY A;  4O2B E;  5ETW A;  2D5U A;  5JDQ A;  1IAP A;  4KBM B;  2CEA A;  1UX4 A;  3ONJ A;  4E7S A;  2BBJ A;  2DWG A;  3IBP A;  4AKI A;  3I1A A;  4DR4 T;  4EV6 A;  3OTO T;  3C84 A;  4V1A v;  3PUG A;  5JQG E;  4MBQ A;  2LM2 A;  4CXW A;  1QUU A;  3AA1 B;  2NOX A;  2LSY A;  3J7Y q;  3L09 A;  5H6R B;  4DMW A;  3CQG B;  2BG9 E;  4GKK T;  3BK9 A;  1KF6 A;  5ABF B;  2KSR A;  1T8B A;  4TWF A;  4Z90 A;  4DV5 T;  2BVL A;  4IRE A;  2XAJ B;  1FIO A;  4A56 A;  2LKH A;  5JDH A;  2BVM A;  1FJG T;  3K8P C;  4CN1 A;  4UXN B;  3I0Q A;  4ZOL E;  3V5U A;  1WRD A;  3AEA A;  4UVC B;  2BBH A;  2H3R A;  4CI2 B;  4AIS A;  4BJM A;  4AIU A;  3FBZ A;  3EUH A;  5BR8 T;  1ZHC A;  1SHZ C;  4HFI A;  2E5L T;  2YME A;  5KE4 A;  3ZMS B;  2XQ3 A;  3N9O A;  4OFZ A;  4F6R C;  2AXD S;  4X1K E;  3N5L A;  5AQV B;  4PJN A;  3LG7 A;  2CLY C;  3RI5 A;  4TX5 A;  1XNR T;  4PK5 A;  2W8F A;  5ABH A;  4DUY T;  3AAI A;  4X1I E;  4IDO A;  3RYH E;  2CWY A;  4L0R A;  5BW2 A;  2WSS V;  1W0B A;  2BDE A;  2NTX A;  5LGN B;  3AE2 A;  4LF4 T;  4TNV A;  2V26 A;  2YDR A;  2G0U A;  3T1Y T;  5AIN A;  3O1H A;  4IIJ E;  1YKE B;  2KWH A;  3ZCJ A;  2W63 A;  5L4E A;  1D1B A;  4MAL A;  5HEG A;  3UT5 E;  2XM1 A;  5JH7 E;  4X20 E;  4BA9 A;  5KXJ A;  1MMN A;  2EHO B;  3GUA A;  2M6B A;  1MMG A;  3OVU A;  3V5S A;  2WB5 A;  3PU3 A;  4X65 T;  4QWN B;  2IC9 A;  2QVA A;  5LXT E;  1CHU A;  2KIN B;  5E0O A;  3RIF A;  4MHC A;  3TLS A;  1W0A A;  3UFE A;  3P8C D;  2WQY A;  2XHE B;  5AQQ B;  1QLB A;  5HXE A;  5FMN A;  2D9D A;  4XHE A;  3FZF B;  2QGS A;  4AI6 A;  4H63 V;  2X0H A;  4O4H E;  4UV9 B;  2XQY A;  3BQL A;  3ZYK A;  1OED E;  1KK7 A;  1IBL T;  3LK2 B;  1SE7 A;  2ACZ A;  3P50 A;  5FYM A;  4H9S E;  1HS7 A;  5DQW A;  2ZM0 A;  2LOP A;  3MJX A;  5LJN A;  3RQU A;  3UU4 A;  4EXT A;  3A8Y C;  2BR8 A;  3WIP A;  4ZHQ E;  2ZMA A;  5LNK A;  1LVF A;  2W4X A;  1N33 T;  5HAX A;  4DV6 T;  4H9R C;  3F31 A;  4P0A A;  1I9B A;  3PUV F;  2N9D A;  5FJV A;  2M6I A;  2WZI A;  3ZN0 B;  4PJJ A;  1KEY A;  1T7S A;  3BQK A;  4I4T E;  3RH3 A;  4LF7 T;  3ZC1 A;  3NWI A;  1M7K A;  4LMJ A;  4NPP A;  3TLW A;  4UV8 B;  3AEC A;  4C91 A;  4YLH A;  1YQ4 A;  2XY8 B;  4TV9 E;  2SPC A;  3N9N A;  4EZ4 A;  3OYZ A;  4NXM T;  4IDZ A;  2OLT A;  2E2A A;  4QX8 B;  4IE6 A;  2H89 A;  2DL1 A;  4MFR A;  2CA5 A;  5DAB A;  5CA1 E;  2VL8 A;  5HXS A;  2X68 A;  1ZP0 A;  1UX2 A;  5L4H A;  2E8I A;  2VVN A;  1G8X A;  2NW8 A;  1XZY A;  5HEO A;  2WU2 A;  3U8L A;  3OPC A;  4AFG A;  3EI0 A;  3PE0 A;  5JME A;  4JI8 T;  2K3W A;  3K3O A;  2XM2 A;  4JV5 T;  1IZN B;  3EVY A;  2ZLY A;  4ILU A;  2WMO A;  3CX8 B;  2UXD T;  3HR0 A;  2QRX A;  5F3J A;  3ANW A;  1HG5 A;  1HX8 A;  4PK4 A;  3ZJ2 A;  5LHI B;  5J5F A;  5ABF A;  1E7P A;  4UR9 A;  5LG3 A;  4BQT A;  4QX7 B;  4DUZ T;  5HEH A;  4YTP A;  2X0Y A;  1M62 A;  2DNX A;  3SWH A;  3AXJ B;  2LRL A;  2WS3 A;  3LBX A;  4L9I A;  4O4I E;  4B3T T;  2L8K A;  2XAG B;  2Y7Y A;  2IW5 B;  5FY1 A;  2ZM2 A;  4WBO A;  2WY2 A;  4QKN A;  4TV8 E;  3HKD E;  3C79 A;  1DU2 A;  5LJM A;  4HWI B;  2W2U A;  5LGU B;  3DP7 A;  3C50 A;  3K1S A;  2V5C A;  5JRE A;  4DBQ A;  4I43 B;  4C90 A;  4ZK4 A;  5FL0 A;  2WZH A;  4OYJ A;  1XMQ T;  2NR4 A;  3JC6 C;  1WR6 A;  2XTL A;  4O2A E;  4CZZ B;  3BQI A;  2ODV A;  1ZEE A;  4WZX A;  4ILB A;  3UUX B;  2X0L B;  4NIQ A;  3K3Q C;  2V7K A;  1U4Q A;  4ZS2 A;  4JI5 T;  4DV2 T;  5L3C B;  4WYV A;  2CXD A;  2XJ7 A;  4U74 A;  3GMI A;  5HCJ A;  3TLV A;  1R8I A;  3PU8 A;  3PUS A;  1MIY A;  4FJO A;  1D0Z A;  5LG4 A;  2BKP A;  1G73 A;  1XMO T;  2NW7 A;  3UQ4 A;  4X64 T;  2ES0 A;  3T8O A;  4AFT A;  4ILA A;  1AJ3 A;  4ZR6 A;  3SFD A;  3KV4 A;  3N2G E;  4JI7 T;  2VQE T;  2JQQ A;  3CKD A;  4IE5 A;  3S4U A;  2BS4 A;  4P0B A;  3H3M A;  1VOM A;  5J1G A;  4PJL A;  3AA7 B;  2BYQ A;  2CHO A;  3NZQ A;  3UUN A;  4JI2 T;  1HNZ T;  2UXX B;  4ZI2 D;  1HX1 B;  4JEU B;  5CO5 A;  5FY7 A;  2A3D A;  3F2E A;  4DR5 T;  2BZB A;  3FB2 A;  3SQ9 A;  4PFP A;  2CXL A;  5HYA A;  4EIW A;  5JRC B;  4JYA T;  4DND A;  3MAC A;  3AEE A;  3I9W A;  5LBQ B;  3CK6 A;  5JDL A;  4DV0 T;  4YSX A;  4FI5 A;  5KZU A;  3PUY F;  3TKL B;  4ZZC A;  1CUN A;  4XAX B;  1KNZ A;  3EAB A;  3R6N A;  3CQC B;  3HKC E;  5C2T A;  2NTY A;  2WDV A;  5CA0 E;  2Y54 A;  3VHL A;  2KWI B;  3VR8 A;  4UF0 B;  2IAK A;  2Y56 A;  3AE8 A;  2CMR A;  3FZK B;  5TVC A;  2XAQ B;  2NW9 A;  4LF8 T;  2E9X B;  2QA7 A;  3CML A;  4LF9 T;  3HL6 A;  4UF0 A;  5IWA T;  3RC8 A;  4WV9 A;  1HR0 T;  3OKQ A;  1XNQ T;  4CN4 A;  4B5D A;  4UM1 A;  1HNX T;  5KDM C;  5AFJ A;  3ZT6 A;  3RGL A;  3P4R A;  3NRX A;  2E5V A;  3LK3 B;  4CXX A;  2QC1 B;  4UY2 A;  4ANJ A;  3AEG A;  4IST A;  4PK6 A;  4YSZ A;  2RP4 A;  2M67 A;  4F8H A;  3Q5D A;  2VAS A;  4O8S A;  3RRW A;  4IE7 A;  3N2O A;  2Q9Q D;  1W09 A;  5AFH A;  4QH4 A;  4GK5 E;  2B1E A;  4IDP A;  4IDQ A;  4QXH B;  5JVD E;  2YOE A;  4EYU A;  2HH7 A;  3K3N A;  2XPK A;  1UUR A;  3KVB A;  3LK4 2;  4TNW A;  5FL1 A;  2BYP A;  3KFW X;  3ONL C;  4DR6 T;  4EZ1 A;  1UCU A;  5J2T E;  3NRY A;  3ANW B;  5SYO A;  1E1H B;  3A5X A;  3QUJ A;  3F57 A;  1H7C A;  2V6Y B;  2ODU A;  3IEE A;  5FVK A;  1UW6 A;  5LA6 E;  4ZI3 D;  2MPK A;  2CHN A;  2ZM6 T;  4UM3 A;  1IBK T;  3FZM B;  5FXW A;  2UUB T;  1UK5 A;  3AXJ A;  1MMA A;  2WBL A;  3J9X 1;  2UZ6 A;  4D01 A;  5HCM A;  1Y01 A;  5C8Y E;  1WCR A;  4GYS A;  5CB4 E;  3EDU A;  3ZT7 A;  3U3I A;  5C3J A;  3JAF A;  2L3L A;  3PUW F;  2XZ5 A;  2BKN A;  2JJ9 A;  3C4X A;  1NEN A;  2LM9 A;  1MNE A;  4OX9 T;  1VCS A;  1YQ3 A;  2VKH A;  3RPU A;  4KMC A;  2ACX A;  3NBX X;  5HXH A;  4ZJS A;  2W00 A;  2FBW A;  4YFS A;  3ZSS A;  2J4G A;  3WTK A;  5L3F B;  4AQY T;  4ZRU A;  2EHO D;  2XQ7 A;  2YDQ A;  2XQ9 A;  3RHW A;  3WTH A;  3H3A A;  3GA8 A;  3P7I A;  4BJN A;  1KFY A;  2BYS A;  2BKO A;  4ZI7 E;  4UVB B;  1WR0 A;  3ZST A;  3VR9 A;  2YDS A;  3EAM A;  2PH9 A;  1SA0 E;  4OHF A;  3AE6 A;  5EK4 A;  4ZS3 A;  1WYC A;  1IJ6 A;  5DQV A;  2K5B B;  4B6X A;  4DO0 A;  3A7M A;  2VUR A;  5J0Z A;  4HWF A;  2Z6E A;  3PUR A;  4GK0 E;  2PBI A;  3MA9 A;  5EK2 A;  3WAK A;  3UU6 A;  3PUZ F;  2VWA A;  1Z0P A;  2LOS A;  4H9Q C;  3LSV A;  4WBN E;  2LLY A;  5AQF B;  4P09 A;  4AKR B;  5AFM B;  4H9O C;  3PEO A;  4HN9 A;  4O4J E;  4TWH A;  4EGW A;  3RYC E;  4JEH B;  2IUB A;  3C51 A;  3U8M A;  4EZH A;  3AAE B;  4HFH A;  3QC9 A;  5HWY A;  5FNV E;  1J5W A;  2VQF T;  4IHJ E;  3WTI A;  1BR0 A;  3Q2M A;  2FJE A;  2C5J A;  2J47 A;  2KXP B;  1T98 A;  2IDO B;  4AKH A;  3N2K E;  5HWX A;  3LBX B;  2JMH A;  4CXY A;  2Y8D A;  4K0K T;  4CN6 A;  2DHR A;  4AQF A;  4XK9 A;  3T1H T;  1W9R A;  2VKJ A;  1FMV A;  2J62 A;  1BR2 A;  3ETV A;  3UUB A;  4EEB A;  5JR9 C;  1HFA A;  5LHG B;  4JI3 T;  3AE3 A;  3C4Z A;  3O9X A;  3RX6 A;  3P4S A;  4KI0 F;  3R84 B;  1KNR A;  4NUV A;  4U2Z A;  3MXZ A;  4H9N C;  4HTE A;  1X9B A;  3LDQ B;  2LJL A;  3AVR A;  5AQT B;  2B76 A;  3UTK A;  2X00 D;  4HGA A;  5BP0 A;  2YEV C;  3E22 E;  1UUS A;  5AFU L;  4YHH T;  2YIN A;  4B3R T;  3AE5 A;  3TLU A;  5DJQ C;  4N78 D;  1UV6 A;  2C9T A;  3ZCI A;  3RRC A;  1YKH B;  3RC3 A;  3VU7 H;  4M1P A;  4QAC A;  2W66 A;  5IHY A;  3JC6 D;  2X9Y A;  2X66 A;  2AE9 A;  4JBW F;  2OV9 A;  5ABE A;  2H7O A;  3ZMU B;  2LHN A;  3H37 A;  4UEL A;  4H9P C;  1OED B;  2GK9 A;  2YKS A;  3P4Q A;  3FXD B;  2DLR A;  4DID B;  1XDO A;  1IJ5 A;  4JI0 T;  2W8G A;  2KZ7 B;  4ZI2 C;  2XSA A;  4YJ2 E;  5AFK A;  4PNI A;  1YD8 G;  2NWB A;  2LSJ A;  4ISS A;  5J5H A;  5HEU A;  4AQG A;  1NEK A;  4QAA A;  2ZJV A;  2XAH B;  4QH1 A;  4KUM B;  2VKO A;  3M3Z B;  3O1I A;  2WN9 A;  2WMN A;  4AKG A;  4U3C A;  1MIV A;  1UX5 A;  4CI1 B;  2DCF A;  1OWA A;  1KNP A;  2A2F X;  3HKB E;  4A97 A;  2V7J A;  2WZY A;  2X00 A;  4X66 T;  3QB5 K;  3CX7 B;  1D0Y A;  1D0X A;  1J1J A;  5BMV E;  3FHN A;  2LSG A;  4G2A A;  3JCF A;  2JQ9 A;  2E9X A;  4LFA T;  1MMD A;  2PFV A;  4HFE A;  2Y48 B;  2R6G F;  2XAF B;  4GYR A;  4LFC T;  1N32 T;  3KBT A;  3RLF F;  3M65 A;  2E9X C;  5LCY A;  2XSB A;  3I9Y A;  4DBM A;  3FBL A;  2J1D G;  2A9U A;  4HQP A;  4DV3 T;  1V9D A;  2MAW A;  3HA4 A;  5AQU B;  2JQH A;  5EK3 A;  3AE1 A;  4X1Y E;  2HN1 A;  4YJ3 E;  2X9W A;  3UUL A;  4ZK1 A;  4GIW A;  5LOV E;  3NKZ A;  2IIU A;  2A72 A;  2PJQ A;  4XBF B;  1YXR A;  5LBM A;  2EHO A;  4YY3 T;  2LSK A;  4PIR A;  2OA5 A;  2YU2 A;  4GOU A;  4H63 H;  3SRZ A;  5L3B B;  5HXC A;  2QYW A;  2UU9 T;  2D2S A;  2VVS A;  4BAY B;  2UXN B;  3LJC A;  2JPF A;  2FJD A;  1Z8U A;  4EOZ B;  3RF1 A;  3B57 A;  1XDP A;  2PG8 A;  3VKG A;  4TN7 B;  2CM0 A;  2UUA T;  4PAG A;  5GON E;  3FZH B;  5LHH B;  3RIU A;  5FKY A;  2CLY B;  4COF A;  4G63 A; 
#chains in the Genus database with same CATH homology
 4A98 A;  4QH5 A;  4A97 A;  5AFJ A;  3UU8 A;  2WNJ A;  2XQ6 A;  4LMJ A;  3TLT A;  4NPP A;  3JAD A;  3TLW A;  5IUX A;  3JAE A;  4TWH A;  2XNV A;  4LML A;  2XQA A;  3WTL A;  4QAC A;  3SQ6 A;  2WZY A;  2X00 A;  2QC1 B;  3P4W A;  4IRE A;  2Y7Y A;  3GUA A;  3IGQ A;  2M6B A;  2XNU A;  4UXU A;  2LKH A;  4HFD A;  4ILC A;  4UY2 A;  2LKG A;  4AFH A;  4X5T A;  3U8M A;  4HFH A;  1OED A;  4F8H A;  3U8K A;  3C79 A;  5CO5 A;  3WTI A;  3RIF A;  3T4M A;  3TLS A;  3U8J A;  5HEJ A;  5AFH A;  2BR7 A;  4IL4 A;  2BG9 C;  4HFE A;  4QH4 A;  4ZJS A;  2YMD A;  5J5I A;  3UU5 A;  5J5G A;  2BG9 A;  2YOE A;  3WTK A;  3WTM A;  4ZRU A;  4IL9 A;  1OED B;  3SQ9 A;  2XQ7 A;  3SIO A;  2XQ4 A;  3ZKR A;  2XQ9 A;  3RHW A;  5L4H A;  1UX2 A;  3WTH A;  4XHE A;  4TNW A;  3PMZ A;  2BYP A;  4Z91 A;  2Y58 A;  5HEO A;  4ZK4 A;  4ZZB A;  3PEO A;  2YKS A;  2BYS A;  4DBM A;  3U8L A;  5AFM A;  5AFL A;  2ZJU A;  4HQP A;  4AFG A;  2WNC A;  4XK9 A;  4EZ1 A;  5L47 A;  3EI0 A;  3EHZ A;  3WTJ A;  3SH1 A;  4HFB A;  4HFI A;  2XNT A;  3WTN A;  5JME A;  2MAW A;  2YN6 A;  2YME A;  1OED E;  5KE4 A;  3EAM A;  5SYO A;  2XQ3 A;  4LMK A;  3UUB A;  2PH9 A;  3UQ7 A;  3P50 A;  2W8G A;  4QAB A;  2XQ8 A;  2XYS A;  4ILB A;  2BYR A;  3U8N A;  5KZU A;  4ZK1 A;  4ZJT A;  3RQW A;  2Y57 A;  1UW6 A;  4ZZC A;  5BRX A;  5AFK A;  3ZDH A;  4FRR A;  2XYT A;  2WNL A;  3RI5 A;  3RQU A;  4NZB A;  4PIR A;  4TWD A;  3UU4 A;  2W8F A;  2Y54 A;  5AFN A;  5LXB A;  4UM3 A;  3RIA A;  3WTO A;  2BR8 A;  5HCJ A;  2Y56 A;  5J0Z A;  3ZDG A;  3WIP A;  3TLV A;  5J5H A;  5HEU A;  2BJ0 A;  5TVC A;  4QAA A;  2X00 D;  5J5F A;  5BP0 A;  3UU6 A;  2BYN A;  3C84 A;  2ZJV A;  5LG3 A;  2UZ6 A;  4HFC A;  4BQT A;  5BW2 A;  2LM2 A;  2BYQ A;  5CFB A;  2PGZ A;  3UQ4 A;  4QH1 A;  5HEH A;  4D01 A;  5HCM A;  2VL0 A;  4TNV A;  4AFT A;  4ILA A;  4UM3 S;  3UU3 A;  4ZR6 A;  2BG9 B;  1OED C;  1I9B A;  2WN9 A;  5FJV A;  5AIN A;  4WV9 A;  2M6I A;  3LSV A;  2XZ6 A;  3TLU A;  4BFQ A;  2LLY A;  2BG9 E;  4ALX A;  5L4E A;  3JAF A;  2KSR A;  1UV6 A;  2C9T A;  4TWF A;  2XQ5 A;  4UM3 P;  4B5D A;  4COF A;  2XZ5 A;  5AFM B;  4UM1 A;  5HEG A;  4Z90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...