4IL6H

Structure of sr-substituted photosystem ii
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
63
structure length
63
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Sr-substituted photosystem II at 2.1 A resolution and its implications in the mechanism of water oxidation
pubmed doi rcsb
molecule keywords Photosystem Q(B) protein
molecule tags Electron transport
total genus 13
structure length 63
sequence length 63
chains with identical sequence h
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 4il6H01
1S5LH 3A0HH 3WU2H 4UB8H 5KAFH 5GTIH 4IL6H 5B66H 3KZIH 4UB6H 4PJ0H 3JCUH 5E79H 5B5EH 5KAIH 5GTHH 5TISH 5H2FH 3A0BH 2AXTH
chains in the Genus database with same CATH superfamily
2D2CB 2OYHA 3A0HH 5APXA 5KKZB 1BSNA 1J2JB 2IBZD 1AA0A 3BCCJ 3CX5D 3VP9A 2WPVB 1KILB 1XTGB 1ZR2A 2H7HA 1VQ5P 1P84E 1P84I 3TK1A 3AECC 2Q7CA 3RBXA 5KLVE 3HUSC 2M3BA 1MFTA 1NTMJ 2I1KA 3RL0C 1AVOA 1U7MA 3L75E 2OYIA 3NXSA 2N1TA 3JCUH 4H44D 3CXHH 3KZIE 2WSFJ 1EDKA 1FJKA 4JPZB 1SFCD 2BCCJ 3H1JE 1L0NG 1KB9D 5AVTB 3FWLA 1X8YA 2XU6A 2HPCB 4UB8H 2NZ2A 3E7KA 4L76A 2HPCA 4Y99B 2FYUJ 1DD3A 2I8DA 3HE5A 1LT9A 4W7YA 5GTHH 4BXLA 1HGVA 3G3ZA 1N7LA 3AEAC 1NTMK 2QVAA 2KNCB 5EFWB 3IN6A 1LNQA 2JJLA 2Q6QA 1OVUA 1M8OB 1ZOYC 3L70G 2M3EA 1EZVI 1L0LJ 1N73A 1M1JC 1VQMP 3A7OA 3EWKA 1WRGA 4HKZH 2ZJSE 5KTBA 3PLNA 4EYYQ 1OVRA 3CCSP 2KSEA 3FWNA 5AVWB 1FZGA 2Z4EA 2J59M 3L72J 1R5LA 2YMYA 3AEGC 2E43A 1DX7A 4IL6H 1NGMB 3QH9A 3H1IJ 4PD4D 3O8ZA 1IFMA 3OA7A 5APUA 1FZCC 2P67A 5KLVG 4IOIH 3CWBD 2N1TD 3L75G 2O1JA 1T3UA 2IX7C 4O9BA 1OVVA 1P84H 5AVXB 1ZN5A 4C7RA 2ZXXA 3H1JG 1G1JA 1SQXE 1H0TA 1NTZJ 3S9OA 5CBNA 4BRYA 1G2CB 4GDOA 2HG5D 1M1KQ 1L4AC 1G2CA 2ZYAA 3RL0D 1L0ND 1NTKE 1M57D 3T97B 2FFDA 2KLUA 3UIAA 3ZDMA 1SQPJ 5CCHA 1Q2NA 3A2AA 1QGKB 3LW5H 4TT3H 1YIJP 2L5GB 1KYOE 1KYOI 1EZVG 1GL2C 1OWAA 1NTZK 1OFCX 1VPCA 1VQPP 5AVQB 1JY3O 1D7MA 3AE8C 2K9YA 1JO5A 1KQLA 1BGYE 3D70A 5CHXA 3L70D 2K9JB 3AE2C 2JDIH 1JUNA 3GLMA 4H13B 1SQPK 1CW5A 4H0LC 3BASA 3B71A 4XA4A 1LTAC 3L74J 1NU1J 4NPFX 1OW8A 3WUUA 3HTKB 2CPSA 3K5BA 1PPJD 2W6JH 3NMDA 4EIJA 2Q3EA 2IBZE 4GKGA 2IBZI 2ZFCA 1SQVD 1T3JA 3L73D 1FDIA 5L8RJ 1BE3D 2WWWA 1IFNA 1HJBA 2WPRA 1CZQA 1J1EB 5KLVD 1QX8A 1SQXG 1NHLA 5AW3B 4K3AA 2QJPB 2W83C 2Y0DA 3L4FA 1T2KC 3H1KG 3VMXA 2HLOA 1KB9E 1VQ6P 3CCMP 3H1LD 4WY4C 1NTKG 1GU5A 5CCHD 1G1IA 3VP8A 1FDOA 3IAOA 1JB0J 2FBWC 5KAFH 3N4XA 2G3AA 4M3LA 3GG2A 3I5CA 3CD6P 3AEDC 2E76D 3KDPB 2M5AA 2Z5IA 2WVRA 3CCEP 1EDLA 2QJKC 1PP9J 2V7QJ 3G71P 1BGYG 2ZT9B 1EZVD 3BCCE 3M0DC 2YIUC 4JYCA 2PRRA 1JCDA 1N7SA 3USSA 1KV4A 1ZRTD 3RK3E 1S72P 1DEEG 1RQUA 3E1IA 4IL6X 2WSEJ 4OGQB 3CCJP 3FXDA 2WQYC 1IO4A 3BATA 4DOJA 2HR3A 1PGQA 2A45H 3WU2E 2IBZG 4OWFA 2FXOA 4IFDK 2QIWA 5DJTB 4PD4E 3H32B 4PD4I 2KZJA 3HD7C 3RK2C 2G8YA 1PL5A 1JTHB 3CWBE 2QE7H 3CX5H 4C46A 1SQQD 1LT1A 1LWUC 3L35A 1JCCA 2JO1A 2R5BA 2RKLA 1GTWA 4I6MC 1R5SA 4RESB 1YYCA 2OARA 1SQXD 1LTJC 4H44B 3P8CD 2B89A 3B4SA 1K73Q 1SFCB 2NPSA 3H1KD 1KB9H 4ZKUA 1L0NE 2IZ1A 1NOHA 2ITAA 1M56D 2FY8A 3OAKA 1IC2A 5AW1B 3TGUG 2P58A 2QM8A 3M0AA 1RF1A 3HE4B 3G9RA 5AW0B 2FXPA 1JNMA 3TYYA 2QJYC 1BCCD 3B8EB 1OMIA 4DT0A 2O1KA 1USEA 1A02F 1URQC 3BCCG 1N7SD 5AW5B 5GTIE 4NPEA 2RMZA 2K3RA 4PJ0E 4C7NB 3O6QA 1MFZA 1OIPA 3H1HD 1FZFA 3SWKA 3CLQA 1YQ3C 2D2CC 1GW3A 3MD0A 4U3FD 3B5NA 3RK3B 3F89A 5AW9B 1VF5D 5KKZC 2KI7B 2OYHB 1KILC 5CCGA 1PPJE 2Q5UA 1FJPA 5H2FE 1PV3A 3WU2H 2OYOA 1NKNA 3CWBG 1SQVE 2FYUG 5KLIB 2DW3A 3L73E 2YKOA 1BE3E 5AVUB 2P1JA 2LKMA 4ZKPA 4D6TD 3TNUA 2BEQD 2OYIB 2N1TB 5AW8B 1GMJA 1Q90D 2NPSD 3Q5SA 1S1CX 4W7ZA 1OW6A 4Y99C 5TISH 3H1LE 1NYHA 4I7ZB 1L0LG 2QSIA 1KN7A 1OW7A 1HUCA 1Q82Q 1X9VA 3HE5B 1LT9B 1FZBA 3HUSB 1SQBJ 3RL0B 1HBWA 3HUSA 3V2PA 3IFMA 3RGUA 3JSVC 1NU1E 3H1IG 4K35A 3TGUD 1OZHA 2N9YB 2AEFA 2K37A 3C9IA 1RQVA 1J1DB 2IFNA 2YXQB 1HGZA 1IK7A 2XNDH 1EZVE 2ZYDA 3PRJA 5CJ0A 1N73B 4HH2A 3B5ND 1ZRTE 1K04A 3BCCD 4PV1D 3SWYA 2E75D 5GTIH 1YBKA 3RK3D 1JOCA 4PJ0H 3AEFC 1LTIC 5CCGD 1SQBK 1N86A 1NTMD 1PPJG 5K5GB 1RE3C 4KT0J 1SQVG 1KFNA 4KHXA 2B88A 3L73G 3AE9C 5AW2B 1BE3G 2BCCD 1K05A 1RE4C 2GM4A 1SQQE 1JY3N 1JMMA 5AVZB 1M1JA 2QEXP 1HVVA 2IPPA 1X0TA 2XKMA 2HODA 2FYUD 3MZWB 3A5TA 2A06E 1CI6A 1LTGC 1AVYA 4L75A 3H1LG 1H0TB 2NRGA 1L0NK 4BRYB 2LXCB 2FYNB 1EQ7A 3P8CE 1Y9BA 2W8ZA 1VQ9P 3AE4C 3H1KE 3KZIH 1GD2E 2HYNA 3H6PA 3CXHD 1FZCA 2C9LY 2FFDB 1L0LD 4WVZA 5KJ7C 3SFDC 1PFIA 1XTCC 3HRNA 1NU1G 3GHGC 1BCCE 1LTSC 5M1BA 1JM0A 1VL2A 1H88A 1ZXGA 1FBMA 3P7KA 2E76B 4LLHA 1ZR4A 3L72D 5AW7B 3BRTB 1KC8Q 3L37A 1PIXA 1JMBA 1GDTA 4N78D 3H1ID 3L75J 4H13C 1IFPA 3OJAB 1NH4A 2E74C 3MUDC 1IJDB 3H1HE 3CC7P 4N6JA 1L4AA 4BWNA 1VQKP 2OTKE 4U3FE 3E1RA 3H1JJ 3R4YA 1YJ9P 2H8PD 2WITA 3IR9A 3U1CA 1E5WA 5BU5A 1GK4A 3D71A 2KK7A 1S4XA 4NPDA 1GL2A 3LW5J 1VDFA 4CPGA 3NTNA 2O01H 1X22A 1NTZD 1SQQG 5KLVK 2KUBA 1J1EC 2H43A 3L71J 2QJPC 2SPZA 1USDA 2A06G 4U7JA 4D6TE 1FZEA 3GW6A 1SQPD 1Q81Q 1H89A 2M8RA 3VMYA 1DD4A 2FYZA 1H8AA 1KFMA 2JWDA 1N2DC 1Z56A 2KXPB 3VMAA 1YQ4C 3CCUP 2PP6A 2KS1A 1BCCG 5B5EE 4YXDC 4YPCA 3VOPA 3II6A 2XNXA 2M5AB 5B66E 2ZT9C 3TGUE 1X79B 3SFEC 4ZNCA 2CPBA 3L74D 1NU1D 1L4AD 3H1HG 3BVHA 5TJHA 1KYOH 4WY4A 1L2PA 2YO3A 2KOGA 4HJGH 1N7SB 4OGQC 2AXCA 3R2PA 4U3FG 1YTZT 1FOSE 1YITP 1DH3A 2M0BA 1IK9A 3L71D 4IFMA 2AXTE 1NTME 3VN0A 1GL2D 3U1AA 1HJ0A 2WTYA 2WSCH 3MGNA 1SS1A 3TF5A 1S2EA 1NTKJ 3CMEP 1RH5B 1VF5B 3TDKA 2W6BA 2BCCE 4RO0A 3C1LA 2YIUB 3A0BE 4D6TG 5C39A 5AVRB 2PFXA 5APQA 3M0DA 1FOSF 1KD1Q 4LGDE 3A0HE 2IZ0A 5DJUB 3V2QA 1EXJA 4H0LD 4AYCA 3JC22 2K88A 4B86A 2FYUE 1SQXK 1NO4A 4Y28J 1YI2P 4H44C 3AE7C 2JEEA 2A06D 3MTUE 1S5LE 2ZVOB 1BGYJ 1SFCC 1EXIA 5AVVB 1NTKK 2MKVA 2WPQA 1QVGO 3Q2YA 2NPSB 3HD7A 3V5BA 1PP9D 3CXHE 3CXHI 2Q1KA 3ITKA 1OX3A 1L0LE 1WMKA 2JKVA 3S4RA 3PP5A 3CCQP 1RF1B 1GK6A 2GUVA 1LWUA 4UB8E 3CL3D 1M7LA 2R44A 1T2KD 5B5EH 4RJTA 3KXDA 3MIWA 1KTMA 4WY4D 5GTHE 1U7JA 1IZNB 1LTJB 3P8MC 4GODA 1LP1A 3L72E 1QEXA 3QWOC 5B66H 3N7NA 1LTJA 2KB7P 4N78E 3H1IE 3O6QB 1NAYA 1RF0C 2QG4A 2YKPA 4MN4C 1NTMG 1HWTC 3B5NB 4PV1B 2OYHC 2E75B 3M91A 2B87A 1KMIZ 5BU8B 1Y8AA 2ZXEB 2BCCG 3V4QA 4JF7A 1QL1A 4I2LC 4L73A 5KLIC 3CC4P 1FAVA 1S9KD 1NTZE 1URQA 3GF3A 3FGAD 1LJ2A 3LIDA 3CMAP 1NVOA 1VQ4P 2QA4P 3W68A 2AEJA 1TU3F 4XE5B 2WSFH 4PD4H 2OGUA 2OYIC 2N1TC 1JEKA 2RH0A 2UWJE 4XFJA 1E79H 3TNUB 3A0BH 4YXWH 4L74A 1VQLP 1K9MQ 1SQPE 3A3YB 2GA1A 1W2EA 2RN0A 4I7ZC 1FDMA 2R3CA 2PAJA 1JY3P 3HD7D 3RK2D 1KILA 1ZW0A 1LT9C 1S5LH 1OXZA 3WMM0 2W90A 4WB4A 2VRSA 2AEMA 3PTZA 1ZV8A 4YTPC 1U57A 1M90Q 3RBZA 2I1JA 4JBZA 1HF9A 1J1DC 1K8AQ 2OQQA 1UIXA 4DJGA 2O01N 4LC1A 2P10A 3L72G 1Q86Q 3CC2P 1N73C 4HYTB 3L74E 3CWBJ 3MHVA 3SSUA 1GW4A 1QLED 3I56P 3U59A 2H89C 2P2UA 5E79E 3GF7A 3CCVP 1IFIA 2KNCA 2JWAA 1A02J 3L71E 1NKZB 2OTLP 2Y9ZA 1URQD 2JP3A 4GOEA 1NTZG 1JY2N 5BVZA 1L0NJ 2Q3IA 2GUSA 4AUWA 1ZMEC 2FYUK 3C8VA 4RKUJ 1RY3A 4ASWA 2LXBA 2D2CD 5H2FH 1M1JB 1SQPG 3W67A 3V2NA 2HODB 2LR2A 1CI6B 1KILD 1SQBD 2IYPA 4DZOA 2FYNC 3Q5RA 1VQ7P 3H25A 1LTBC 1NWQA 3L70J 4Z1MH 1L0LK 2FFDC 1AQ5A 1PGOA 1RE3A 4GOFA 3D6YA 1MZ9A 5CCHC 4HB1A 3KPEA 4DCKA 1PP9E 1S3JA 1FZCB 2R3SA 1RHZB 2YKQA 3G4SP 1RE4A 1T6AA 2Y0CA 2PGDA 1Y47A 1JY2O 3L74G 3Q5PA 2E76C 1N8RQ 1KQGB 1SQVJ 2IDBA 2QM7A 1SVFA 3L73J 5KAFE 3M9QA 1BE3J 1AFOA 2WSSH 4UB6E 5KLVJ 3T97A 3L71G 1L4AB 3CPWO 1BSHA 4GIFA 5AVYB 2L91A 3ABVC 5KJ7A 5E79H 3H1LJ 3GHGB 3AEBC 3EFGA 4IFFA 3GHGA 2QRXA 3CCRP 1SLQA 1SQVK 3NFQA 2CK3H 4QMAA 4R4LA 2WMMA 1GL2B 2Y0EA 4A7PA 1DEBA 1FS0E 1S9KE 1HH0A 3KYQA 3FX0A 2ZVNB 2A45I 3CI9A 2WZ7A 2K9JA 4WBAA 2E74B 1GZLA 3AE5C 1KQFB 3MUDA 1GU4A 3M9BA 5APVA 1S5LX 4H0LB 3CX5E 2ZYGA 3CX5I 3HTKA 1YJNP 2HFED 2OTJP 1PP9G 2XV5A 1P84D 1MUUA 1BDCA 3L36A 1EDJA 3PHLA 1FZAA 4OVNF 2KS1B 3PH0A 2Z5HA 4EDFA 2O01J 3S1KA 2V7QH 3L75D 5KAIE 1NU1K 2W6AA 1YHQP 3P32A 1KB9I 1NAFA 4KJMA 2E5TA 2WPSA 3H1JD 3WUTA 3V2RA 1VQOP 2YXRB 2KIKA 3CCLP 1ZP0C 1N7SC 1SQQJ 2FKWB 5AVSB 2WSEH 4WY4B 2R32A 1PGPA 3M06A 4OH8B 4WWIA 2IFMA 5KJ7D 2B9BA 3GMAA 4UB6H 3G6EP 1CSBA 1KORA 4N3YB 2E42A 1SQXJ 1QL2A 1EC5A 5CMZA 3I55P 3AEEC 2FXMA 3MP7B 1VF5C 2C9NY 3H1KJ 2POHA 1LTTC 5APTA 3OW2O 5APSA 2A45G 1Q7YQ 1YJWP 1LGHB 2QJKB 4H13D 1SQQK 5AW6B 2YO2A 3V6IA 2E74D 4JQ0D 2E5YA 2XZRA 1UIIA 3VYIA 1BCCJ 1KQSO 3EQ2A 5CJ4A 1QVFO 5AW4B 2J5UA 1KZUB 1YTZI 3AE1C 3KQGA 4TLFA 3BRVB 4EOTA 3RL0g 2N9BA 2MJZA 4R4MA 1WT6A 1KILE 1SQBE 2KP8A 2JR8A 3H32A 2NPSC 3TSIA 3H1HJ 3V4WA 1IFDA 3HD7B 4U3FJ 5APWA 2WSCJ 1JTHA 4ASVA 1VQ8P 1DIPA 1RF1C 3RK2B 1BDDA 3JCUE 3Q1MA 2BASA 1VQNP 1W5CE 5TISE 2Y9YA 5CBOA 1LWUB 1R8EA 2YNYA 1ZLLA 3AE6C 3WUVA 2H88C 5KAIH 3SWFA 3EFFK 2V4HA 1W2BO 4AQRD 4JYBA 1EDIA 1LP1B 2R5DA 1MKMA 3LIEA 4ZMDA 3AE3C 1SFCA 2P7JA 2K1AA 1AJYA 4D6TJ 2KSJA 2O3JA 1NTKD 3D6ZA 2C0WA 4I1LA 3B5NC 3VTPC 2KYVA 1MV8A 2J58A 4PV1C 2E75C 1T8ZA 3F5HA 3PJSK 1PZQA 1PGJA 3HE4A 3RK3C 2C0XA 1SP4A 2KLVA 5CCGC 1IFJA 2WT7B 3IF4A 1KYOD 2ZT9D 2B87B 4GT1A 3Q3DA 2KZIA 2QJYB 2BEZF 2WT7A 3FXEA 1HTLC 2Q9IA 1NJIQ 3KHUA 2AXTH 3L70E 1URQB 1AV1A 4OGQD 1BGYD 4C7NA 2IYOA 2W27A 5APYA 2ZAEB 1FC2C 1FU1A 4EI2A 1JY2P 3VMZA 1AQTA 3TGUJ 1RF0A 4IL6E 1SQBG 4W80A 3M9HA 2YMKA 2XDJA 1FE6A
chains in the Genus database with same CATH topology
1S5LH 3A0HH 3WU2H 4UB8H 5KAFH 5GTIH 4IL6H 5B66H 3KZIH 4UB6H 4PJ0H 3JCUH 5E79H 5B5EH 5KAIH 5GTHH 5TISH 5H2FH 3A0BH 2AXTH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5L H;  3A0H H;  3WU2 H;  4UB8 H;  5KAF H;  5GTI H;  4IL6 H;  5B66 H;  3KZI H;  4UB6 H;  4PJ0 H;  3JCU H;  5E79 H;  5B5E H;  5KAI H;  5GTH H;  5TIS H;  5H2F H;  3A0B H;  2AXT H; 
#chains in the Genus database with same CATH topology
 2D2C B;  2OYH A;  3A0H H;  5APX A;  5KKZ B;  1BSN A;  1J2J B;  2IBZ D;  1AA0 A;  3BCC J;  3CX5 D;  3VP9 A;  2WPV B;  1KIL B;  1XTG B;  1ZR2 A;  2H7H A;  1VQ5 P;  1P84 E;  1P84 I;  3TK1 A;  3AEC C;  2Q7C A;  3RBX A;  5KLV E;  3HUS C;  2M3B A;  1MFT A;  1NTM J;  2I1K A;  3RL0 C;  1AVO A;  1U7M A;  3L75 E;  2OYI A;  3NXS A;  2N1T A;  3JCU H;  4H44 D;  3CXH H;  3KZI E;  2WSF J;  1EDK A;  1FJK A;  4JPZ B;  1SFC D;  2BCC J;  3H1J E;  1L0N G;  1KB9 D;  5AVT B;  3FWL A;  1X8Y A;  2XU6 A;  2HPC B;  4UB8 H;  2NZ2 A;  3E7K A;  4L76 A;  2HPC A;  4Y99 B;  2FYU J;  1DD3 A;  2I8D A;  3HE5 A;  1LT9 A;  4W7Y A;  5GTH H;  4BXL A;  1HGV A;  3G3Z A;  1N7L A;  3AEA C;  1NTM K;  2QVA A;  2KNC B;  5EFW B;  3IN6 A;  1LNQ A;  2JJL A;  2Q6Q A;  1OVU A;  1M8O B;  1ZOY C;  3L70 G;  2M3E A;  1EZV I;  1L0L J;  1N73 A;  1M1J C;  1VQM P;  3A7O A;  3EWK A;  1WRG A;  4HKZ H;  2ZJS E;  5KTB A;  3PLN A;  4EYY Q;  1OVR A;  3CCS P;  2KSE A;  3FWN A;  5AVW B;  1FZG A;  2Z4E A;  2J59 M;  3L72 J;  1R5L A;  2YMY A;  3AEG C;  2E43 A;  1DX7 A;  4IL6 H;  1NGM B;  3QH9 A;  3H1I J;  4PD4 D;  3O8Z A;  1IFM A;  3OA7 A;  5APU A;  1FZC C;  2P67 A;  5KLV G;  4IOI H;  3CWB D;  2N1T D;  3L75 G;  2O1J A;  1T3U A;  2IX7 C;  4O9B A;  1OVV A;  1P84 H;  5AVX B;  1ZN5 A;  4C7R A;  2ZXX A;  3H1J G;  1G1J A;  1SQX E;  1H0T A;  1NTZ J;  3S9O A;  5CBN A;  4BRY A;  1G2C B;  4GDO A;  2HG5 D;  1M1K Q;  1L4A C;  1G2C A;  2ZYA A;  3RL0 D;  1L0N D;  1NTK E;  1M57 D;  3T97 B;  2FFD A;  2KLU A;  3UIA A;  3ZDM A;  1SQP J;  5CCH A;  1Q2N A;  3A2A A;  1QGK B;  3LW5 H;  4TT3 H;  1YIJ P;  2L5G B;  1KYO E;  1KYO I;  1EZV G;  1GL2 C;  1OWA A;  1NTZ K;  1OFC X;  1VPC A;  1VQP P;  5AVQ B;  1JY3 O;  1D7M A;  3AE8 C;  2K9Y A;  1JO5 A;  1KQL A;  1BGY E;  3D70 A;  5CHX A;  3L70 D;  2K9J B;  3AE2 C;  2JDI H;  1JUN A;  3GLM A;  4H13 B;  1SQP K;  1CW5 A;  4H0L C;  3BAS A;  3B71 A;  4XA4 A;  1LTA C;  3L74 J;  1NU1 J;  4NPF X;  1OW8 A;  3WUU A;  3HTK B;  2CPS A;  3K5B A;  1PPJ D;  2W6J H;  3NMD A;  4EIJ A;  2Q3E A;  2IBZ E;  4GKG A;  2IBZ I;  2ZFC A;  1SQV D;  1T3J A;  3L73 D;  1FDI A;  5L8R J;  1BE3 D;  2WWW A;  1IFN A;  1HJB A;  2WPR A;  1CZQ A;  1J1E B;  5KLV D;  1QX8 A;  1SQX G;  1NHL A;  5AW3 B;  4K3A A;  2QJP B;  2W83 C;  2Y0D A;  3L4F A;  1T2K C;  3H1K G;  3VMX A;  2HLO A;  1KB9 E;  1VQ6 P;  3CCM P;  3H1L D;  4WY4 C;  1NTK G;  1GU5 A;  5CCH D;  1G1I A;  3VP8 A;  1FDO A;  3IAO A;  1JB0 J;  2FBW C;  5KAF H;  3N4X A;  2G3A A;  4M3L A;  3GG2 A;  3I5C A;  3CD6 P;  3AED C;  2E76 D;  3KDP B;  2M5A A;  2Z5I A;  2WVR A;  3CCE P;  1EDL A;  2QJK C;  1PP9 J;  2V7Q J;  3G71 P;  1BGY G;  2ZT9 B;  1EZV D;  3BCC E;  3M0D C;  2YIU C;  4JYC A;  2PRR A;  1JCD A;  1N7S A;  3USS A;  1KV4 A;  1ZRT D;  3RK3 E;  1S72 P;  1DEE G;  1RQU A;  3E1I A;  4IL6 X;  2WSE J;  4OGQ B;  3CCJ P;  3FXD A;  2WQY C;  1IO4 A;  3BAT A;  4DOJ A;  2HR3 A;  1PGQ A;  2A45 H;  3WU2 E;  2IBZ G;  4OWF A;  2FXO A;  4IFD K;  2QIW A;  5DJT B;  4PD4 E;  3H32 B;  4PD4 I;  2KZJ A;  3HD7 C;  3RK2 C;  2G8Y A;  1PL5 A;  1JTH B;  3CWB E;  2QE7 H;  3CX5 H;  4C46 A;  1SQQ D;  1LT1 A;  1LWU C;  3L35 A;  1JCC A;  2JO1 A;  2R5B A;  2RKL A;  1GTW A;  4I6M C;  1R5S A;  4RES B;  1YYC A;  2OAR A;  1SQX D;  1LTJ C;  4H44 B;  3P8C D;  2B89 A;  3B4S A;  1K73 Q;  1SFC B;  2NPS A;  3H1K D;  1KB9 H;  4ZKU A;  1L0N E;  2IZ1 A;  1NOH A;  2ITA A;  1M56 D;  2FY8 A;  3OAK A;  1IC2 A;  5AW1 B;  3TGU G;  2P58 A;  2QM8 A;  3M0A A;  1RF1 A;  3HE4 B;  3G9R A;  5AW0 B;  2FXP A;  1JNM A;  3TYY A;  2QJY C;  1BCC D;  3B8E B;  1OMI A;  4DT0 A;  2O1K A;  1USE A;  1A02 F;  1URQ C;  3BCC G;  1N7S D;  5AW5 B;  5GTI E;  4NPE A;  2RMZ A;  2K3R A;  4PJ0 E;  4C7N B;  3O6Q A;  1MFZ A;  1OIP A;  3H1H D;  1FZF A;  3SWK A;  3CLQ A;  1YQ3 C;  2D2C C;  1GW3 A;  3MD0 A;  4U3F D;  3B5N A;  3RK3 B;  3F89 A;  5AW9 B;  1VF5 D;  5KKZ C;  2KI7 B;  2OYH B;  1KIL C;  5CCG A;  1PPJ E;  2Q5U A;  1FJP A;  5H2F E;  1PV3 A;  3WU2 H;  2OYO A;  1NKN A;  3CWB G;  1SQV E;  2FYU G;  5KLI B;  2DW3 A;  3L73 E;  2YKO A;  1BE3 E;  5AVU B;  2P1J A;  2LKM A;  4ZKP A;  4D6T D;  3TNU A;  2BEQ D;  2OYI B;  2N1T B;  5AW8 B;  1GMJ A;  1Q90 D;  2NPS D;  3Q5S A;  1S1C X;  4W7Z A;  1OW6 A;  4Y99 C;  5TIS H;  3H1L E;  1NYH A;  4I7Z B;  1L0L G;  2QSI A;  1KN7 A;  1OW7 A;  1HUC A;  1Q82 Q;  1X9V A;  3HE5 B;  1LT9 B;  1FZB A;  3HUS B;  1SQB J;  3RL0 B;  1HBW A;  3HUS A;  3V2P A;  3IFM A;  3RGU A;  3JSV C;  1NU1 E;  3H1I G;  4K35 A;  3TGU D;  1OZH A;  2N9Y B;  2AEF A;  2K37 A;  3C9I A;  1RQV A;  1J1D B;  2IFN A;  2YXQ B;  1HGZ A;  1IK7 A;  2XND H;  1EZV E;  2ZYD A;  3PRJ A;  5CJ0 A;  1N73 B;  4HH2 A;  3B5N D;  1ZRT E;  1K04 A;  3BCC D;  4PV1 D;  3SWY A;  2E75 D;  5GTI H;  1YBK A;  3RK3 D;  1JOC A;  4PJ0 H;  3AEF C;  1LTI C;  5CCG D;  1SQB K;  1N86 A;  1NTM D;  1PPJ G;  5K5G B;  1RE3 C;  4KT0 J;  1SQV G;  1KFN A;  4KHX A;  2B88 A;  3L73 G;  3AE9 C;  5AW2 B;  1BE3 G;  2BCC D;  1K05 A;  1RE4 C;  2GM4 A;  1SQQ E;  1JY3 N;  1JMM A;  5AVZ B;  1M1J A;  2QEX P;  1HVV A;  2IPP A;  1X0T A;  2XKM A;  2HOD A;  2FYU D;  3MZW B;  3A5T A;  2A06 E;  1CI6 A;  1LTG C;  1AVY A;  4L75 A;  3H1L G;  1H0T B;  2NRG A;  1L0N K;  4BRY B;  2LXC B;  2FYN B;  1EQ7 A;  3P8C E;  1Y9B A;  2W8Z A;  1VQ9 P;  3AE4 C;  3H1K E;  3KZI H;  1GD2 E;  2HYN A;  3H6P A;  3CXH D;  1FZC A;  2C9L Y;  2FFD B;  1L0L D;  4WVZ A;  5KJ7 C;  3SFD C;  1PFI A;  1XTC C;  3HRN A;  1NU1 G;  3GHG C;  1BCC E;  1LTS C;  5M1B A;  1JM0 A;  1VL2 A;  1H88 A;  1ZXG A;  1FBM A;  3P7K A;  2E76 B;  4LLH A;  1ZR4 A;  3L72 D;  5AW7 B;  3BRT B;  1KC8 Q;  3L37 A;  1PIX A;  1JMB A;  1GDT A;  4N78 D;  3H1I D;  3L75 J;  4H13 C;  1IFP A;  3OJA B;  1NH4 A;  2E74 C;  3MUD C;  1IJD B;  3H1H E;  3CC7 P;  4N6J A;  1L4A A;  4BWN A;  1VQK P;  2OTK E;  4U3F E;  3E1R A;  3H1J J;  3R4Y A;  1YJ9 P;  2H8P D;  2WIT A;  3IR9 A;  3U1C A;  1E5W A;  5BU5 A;  1GK4 A;  3D71 A;  2KK7 A;  1S4X A;  4NPD A;  1GL2 A;  3LW5 J;  1VDF A;  4CPG A;  3NTN A;  2O01 H;  1X22 A;  1NTZ D;  1SQQ G;  5KLV K;  2KUB A;  1J1E C;  2H43 A;  3L71 J;  2QJP C;  2SPZ A;  1USD A;  2A06 G;  4U7J A;  4D6T E;  1FZE A;  3GW6 A;  1SQP D;  1Q81 Q;  1H89 A;  2M8R A;  3VMY A;  1DD4 A;  2FYZ A;  1H8A A;  1KFM A;  2JWD A;  1N2D C;  1Z56 A;  2KXP B;  3VMA A;  1YQ4 C;  3CCU P;  2PP6 A;  2KS1 A;  1BCC G;  5B5E E;  4YXD C;  4YPC A;  3VOP A;  3II6 A;  2XNX A;  2M5A B;  5B66 E;  2ZT9 C;  3TGU E;  1X79 B;  3SFE C;  4ZNC A;  2CPB A;  3L74 D;  1NU1 D;  1L4A D;  3H1H G;  3BVH A;  5TJH A;  1KYO H;  4WY4 A;  1L2P A;  2YO3 A;  2KOG A;  4HJG H;  1N7S B;  4OGQ C;  2AXC A;  3R2P A;  4U3F G;  1YTZ T;  1FOS E;  1YIT P;  1DH3 A;  2M0B A;  1IK9 A;  3L71 D;  4IFM A;  2AXT E;  1NTM E;  3VN0 A;  1GL2 D;  3U1A A;  1HJ0 A;  2WTY A;  2WSC H;  3MGN A;  1SS1 A;  3TF5 A;  1S2E A;  1NTK J;  3CME P;  1RH5 B;  1VF5 B;  3TDK A;  2W6B A;  2BCC E;  4RO0 A;  3C1L A;  2YIU B;  3A0B E;  4D6T G;  5C39 A;  5AVR B;  2PFX A;  5APQ A;  3M0D A;  1FOS F;  1KD1 Q;  4LGD E;  3A0H E;  2IZ0 A;  5DJU B;  3V2Q A;  1EXJ A;  4H0L D;  4AYC A;  3JC2 2;  2K88 A;  4B86 A;  2FYU E;  1SQX K;  1NO4 A;  4Y28 J;  1YI2 P;  4H44 C;  3AE7 C;  2JEE A;  2A06 D;  3MTU E;  1S5L E;  2ZVO B;  1BGY J;  1SFC C;  1EXI A;  5AVV B;  1NTK K;  2MKV A;  2WPQ A;  1QVG O;  3Q2Y A;  2NPS B;  3HD7 A;  3V5B A;  1PP9 D;  3CXH E;  3CXH I;  2Q1K A;  3ITK A;  1OX3 A;  1L0L E;  1WMK A;  2JKV A;  3S4R A;  3PP5 A;  3CCQ P;  1RF1 B;  1GK6 A;  2GUV A;  1LWU A;  4UB8 E;  3CL3 D;  1M7L A;  2R44 A;  1T2K D;  5B5E H;  4RJT A;  3KXD A;  3MIW A;  1KTM A;  4WY4 D;  5GTH E;  1U7J A;  1IZN B;  1LTJ B;  3P8M C;  4GOD A;  1LP1 A;  3L72 E;  1QEX A;  3QWO C;  5B66 H;  3N7N A;  1LTJ A;  2KB7 P;  4N78 E;  3H1I E;  3O6Q B;  1NAY A;  1RF0 C;  2QG4 A;  2YKP A;  4MN4 C;  1NTM G;  1HWT C;  3B5N B;  4PV1 B;  2OYH C;  2E75 B;  3M91 A;  2B87 A;  1KMI Z;  5BU8 B;  1Y8A A;  2ZXE B;  2BCC G;  3V4Q A;  4JF7 A;  1QL1 A;  4I2L C;  4L73 A;  5KLI C;  3CC4 P;  1FAV A;  1S9K D;  1NTZ E;  1URQ A;  3GF3 A;  3FGA D;  1LJ2 A;  3LID A;  3CMA P;  1NVO A;  1VQ4 P;  2QA4 P;  3W68 A;  2AEJ A;  1TU3 F;  4XE5 B;  2WSF H;  4PD4 H;  2OGU A;  2OYI C;  2N1T C;  1JEK A;  2RH0 A;  2UWJ E;  4XFJ A;  1E79 H;  3TNU B;  3A0B H;  4YXW H;  4L74 A;  1VQL P;  1K9M Q;  1SQP E;  3A3Y B;  2GA1 A;  1W2E A;  2RN0 A;  4I7Z C;  1FDM A;  2R3C A;  2PAJ A;  1JY3 P;  3HD7 D;  3RK2 D;  1KIL A;  1ZW0 A;  1LT9 C;  1S5L H;  1OXZ A;  3WMM 0;  2W90 A;  4WB4 A;  2VRS A;  2AEM A;  3PTZ A;  1ZV8 A;  4YTP C;  1U57 A;  1M90 Q;  3RBZ A;  2I1J A;  4JBZ A;  1HF9 A;  1J1D C;  1K8A Q;  2OQQ A;  1UIX A;  4DJG A;  2O01 N;  4LC1 A;  2P10 A;  3L72 G;  1Q86 Q;  3CC2 P;  1N73 C;  4HYT B;  3L74 E;  3CWB J;  3MHV A;  3SSU A;  1GW4 A;  1QLE D;  3I56 P;  3U59 A;  2H89 C;  2P2U A;  5E79 E;  3GF7 A;  3CCV P;  1IFI A;  2KNC A;  2JWA A;  1A02 J;  3L71 E;  1NKZ B;  2OTL P;  2Y9Z A;  1URQ D;  2JP3 A;  4GOE A;  1NTZ G;  1JY2 N;  5BVZ A;  1L0N J;  2Q3I A;  2GUS A;  4AUW A;  1ZME C;  2FYU K;  3C8V A;  4RKU J;  1RY3 A;  4ASW A;  2LXB A;  2D2C D;  5H2F H;  1M1J B;  1SQP G;  3W67 A;  3V2N A;  2HOD B;  2LR2 A;  1CI6 B;  1KIL D;  1SQB D;  2IYP A;  4DZO A;  2FYN C;  3Q5R A;  1VQ7 P;  3H25 A;  1LTB C;  1NWQ A;  3L70 J;  4Z1M H;  1L0L K;  2FFD C;  1AQ5 A;  1PGO A;  1RE3 A;  4GOF A;  3D6Y A;  1MZ9 A;  5CCH C;  4HB1 A;  3KPE A;  4DCK A;  1PP9 E;  1S3J A;  1FZC B;  2R3S A;  1RHZ B;  2YKQ A;  3G4S P;  1RE4 A;  1T6A A;  2Y0C A;  2PGD A;  1Y47 A;  1JY2 O;  3L74 G;  3Q5P A;  2E76 C;  1N8R Q;  1KQG B;  1SQV J;  2IDB A;  2QM7 A;  1SVF A;  3L73 J;  5KAF E;  3M9Q A;  1BE3 J;  1AFO A;  2WSS H;  4UB6 E;  5KLV J;  3T97 A;  3L71 G;  1L4A B;  3CPW O;  1BSH A;  4GIF A;  5AVY B;  2L91 A;  3ABV C;  5KJ7 A;  5E79 H;  3H1L J;  3GHG B;  3AEB C;  3EFG A;  4IFF A;  3GHG A;  2QRX A;  3CCR P;  1SLQ A;  1SQV K;  3NFQ A;  2CK3 H;  4QMA A;  4R4L A;  2WMM A;  1GL2 B;  2Y0E A;  4A7P A;  1DEB A;  1FS0 E;  1S9K E;  1HH0 A;  3KYQ A;  3FX0 A;  2ZVN B;  2A45 I;  3CI9 A;  2WZ7 A;  2K9J A;  4WBA A;  2E74 B;  1GZL A;  3AE5 C;  1KQF B;  3MUD A;  1GU4 A;  3M9B A;  5APV A;  1S5L X;  4H0L B;  3CX5 E;  2ZYG A;  3CX5 I;  3HTK A;  1YJN P;  2HFE D;  2OTJ P;  1PP9 G;  2XV5 A;  1P84 D;  1MUU A;  1BDC A;  3L36 A;  1EDJ A;  3PHL A;  1FZA A;  4OVN F;  2KS1 B;  3PH0 A;  2Z5H A;  4EDF A;  2O01 J;  3S1K A;  2V7Q H;  3L75 D;  5KAI E;  1NU1 K;  2W6A A;  1YHQ P;  3P32 A;  1KB9 I;  1NAF A;  4KJM A;  2E5T A;  2WPS A;  3H1J D;  3WUT A;  3V2R A;  1VQO P;  2YXR B;  2KIK A;  3CCL P;  1ZP0 C;  1N7S C;  1SQQ J;  2FKW B;  5AVS B;  2WSE H;  4WY4 B;  2R32 A;  1PGP A;  3M06 A;  4OH8 B;  4WWI A;  2IFM A;  5KJ7 D;  2B9B A;  3GMA A;  4UB6 H;  3G6E P;  1CSB A;  1KOR A;  4N3Y B;  2E42 A;  1SQX J;  1QL2 A;  1EC5 A;  5CMZ A;  3I55 P;  3AEE C;  2FXM A;  3MP7 B;  1VF5 C;  2C9N Y;  3H1K J;  2POH A;  1LTT C;  5APT A;  3OW2 O;  5APS A;  2A45 G;  1Q7Y Q;  1YJW P;  1LGH B;  2QJK B;  4H13 D;  1SQQ K;  5AW6 B;  2YO2 A;  3V6I A;  2E74 D;  4JQ0 D;  2E5Y A;  2XZR A;  1UII A;  3VYI A;  1BCC J;  1KQS O;  3EQ2 A;  5CJ4 A;  1QVF O;  5AW4 B;  2J5U A;  1KZU B;  1YTZ I;  3AE1 C;  3KQG A;  4TLF A;  3BRV B;  4EOT A;  3RL0 g;  2N9B A;  2MJZ A;  4R4M A;  1WT6 A;  1KIL E;  1SQB E;  2KP8 A;  2JR8 A;  3H32 A;  2NPS C;  3TSI A;  3H1H J;  3V4W A;  1IFD A;  3HD7 B;  4U3F J;  5APW A;  2WSC J;  1JTH A;  4ASV A;  1VQ8 P;  1DIP A;  1RF1 C;  3RK2 B;  1BDD A;  3JCU E;  3Q1M A;  2BAS A;  1VQN P;  1W5C E;  5TIS E;  2Y9Y A;  5CBO A;  1LWU B;  1R8E A;  2YNY A;  1ZLL A;  3AE6 C;  3WUV A;  2H88 C;  5KAI H;  3SWF A;  3EFF K;  2V4H A;  1W2B O;  4AQR D;  4JYB A;  1EDI A;  1LP1 B;  2R5D A;  1MKM A;  3LIE A;  4ZMD A;  3AE3 C;  1SFC A;  2P7J A;  2K1A A;  1AJY A;  4D6T J;  2KSJ A;  2O3J A;  1NTK D;  3D6Z A;  2C0W A;  4I1L A;  3B5N C;  3VTP C;  2KYV A;  1MV8 A;  2J58 A;  4PV1 C;  2E75 C;  1T8Z A;  3F5H A;  3PJS K;  1PZQ A;  1PGJ A;  3HE4 A;  3RK3 C;  2C0X A;  1SP4 A;  2KLV A;  5CCG C;  1IFJ A;  2WT7 B;  3IF4 A;  1KYO D;  2ZT9 D;  2B87 B;  4GT1 A;  3Q3D A;  2KZI A;  2QJY B;  2BEZ F;  2WT7 A;  3FXE A;  1HTL C;  2Q9I A;  1NJI Q;  3KHU A;  2AXT H;  3L70 E;  1URQ B;  1AV1 A;  4OGQ D;  1BGY D;  4C7N A;  2IYO A;  2W27 A;  5APY A;  2ZAE B;  1FC2 C;  1FU1 A;  4EI2 A;  1JY2 P;  3VMZ A;  1AQT A;  3TGU J;  1RF0 A;  4IL6 E;  1SQB G;  4W80 A;  3M9H A;  2YMK A;  2XDJ A;  1FE6 A; 
#chains in the Genus database with same CATH homology
 1S5L H;  3A0H H;  3WU2 H;  4UB8 H;  5KAF H;  5GTI H;  4IL6 H;  5B66 H;  3KZI H;  4UB6 H;  4PJ0 H;  3JCU H;  5E79 H;  5B5E H;  5KAI H;  5GTH H;  5TIS H;  5H2F H;  3A0B H;  2AXT H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...