4IL6H

Structure of sr-substituted photosystem ii
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
63
structure length
63
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Structure of Sr-substituted photosystem II at 2.1 A resolution and its implications in the mechanism of water oxidation
pubmed doi rcsb
molecule tags Electron transport
total genus 13
structure length 63
sequence length 63
chains with identical sequence h
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 4il6H01
3A0HH 3KZIH 5KAFH 5GTHH 4UB6H 1S5LH 4UB8H 4PJ0H 5B5EH 5KAIH 5E79H 5GTIH 5B66H 3JCUH 2AXTH 4IL6H 3WU2H 5H2FH 3A0BH 5TISH
chains in the Genus database with same CATH superfamily
1KTMA 1UIIA 3EWKA 2E76B 3FXDA 3B5NB 3WUUA 1NTKD 2MKVA 1FJKA 2D2CD 3FWLA 2C0XA 1L2PA 3IF4A 1BGYD 3QWOC 2AEFA 1BSHA 2N1TA 3CWBD 3TNUA 5KLVG 3CXHE 1M1JB 4U7JA 1OW8A 1SQQD 1IFPA 1Q82Q 1NAFA 5BVZA 5GTHE 1URQA 3II6A 2GA1A 1IO4A 3PH0A 3AE8C 1J1EC 1S1CX 5B66E 3L71G 1OVUA 1RF1A 1IFDA 1M1JC 3KQGA 1PP9D 4RO0A 3H1LE 1VQ9P 3HUSB 1FZCB 3RL0B 4M3LA 2BCCJ 1IZNB 3BATA 1CZQA 1QVGO 4ASWA 1YTZT 3HE4B 2KP8A 1VQ8P 2H89C 3U59A 1VF5B 1HVVA 3MUDA 3V4WA 3H1JJ 1HUCA 1VQPP 2Q3EA 2FFDB 1GK6A 3L70D 2FXOA 5B5EE 3WU2H 2YKPA 4CPGA 4DJGA 1T2KC 1NTZD 2Y9ZA 1MKMA 4IL6X 3CCSP 3SWKA 1G2CB 1VQOP 5APSA 5AW9B 5APXA 2FYNB 4OGQD 2XKMA 5TISE 5B5EH 3Q5SA 2N9YB 1N73A 4ZMDA 1J1DB 1OW6A 1VQ5P 1S3JA 1A02J 4I7ZC 1QL2A 3L74D 3RBXA 2FYNC 2E75B 1BCCG 2N1TB 4UB6H 1JCDA 1QLED 4GODA 1W5CE 2E5TA 2O1JA 3H1KE 1MFZA 1NKZB 2E75C 4QMAA 2N1TC 3OJAB 1RF1B 3LW5J 2M5AB 3CCQP 3AE5C 1LT1A 5CJ4A 1KV4A 1URQC 1D7MA 4JYBA 2QSIA 4XE5B 2WSFJ 2P10A 3D70A 3H1HE 2D2CB 1RF1C 3H1JD 3PRJA 1JM0A 1NTKK 3A0BE 3TSIA 4JPZB 2AXCA 2O01N 1GL2D 3AE7C 3TGUG 1VQMP 3PHLA 1ZRTE 1SQBG 1N7SD 3SFEC 1VQ4P 1SQPG 2NPSA 5CCGA 3BCCJ 2WPVB 1SQQK 1Z56A 1X79B 2FYUK 1YTZI 3L75G 1PL5A 3JCUE 1NTMD 2WPRA 1VDFA 1SP4A 3T97A 1LT9B 3Q5PA 3HE5B 1LTSC 3CI9A 5EFWB 5C39A 1KILA 1N73B 5GTIE 3MP7B 2K1AA 4DOJA 1EXJA 1EDKA 2YKOA 1L0NG 4HKZH 1G1JA 3H25A 2ZAEB 1SQQE 1HTLC 2KNCB 4N3YB 3RK3E 1HWTC 2CPBA 3BRVB 1N73C 4K3AA 2FYUE 5APUA 3WUVA 1KYOD 4YPCA 1FS0E 3O8ZA 3CXHD 1NTZK 2OYHC 2QJPC 1ZN5A 3ITKA 3O6QA 1SQXG 1Y8AA 3JC22 1L0LG 2JR8A 2A45I 4OGQB 1GW3A 1EXIA 2WSCH 3H1KJ 2IYPA 2KUBA 4KT0J 3AE4C 1VQKP 1T8ZA 1S5LX 3GLMA 2ZT9C 1IFIA 1FBMA 2B87A 4XA4A 2NRGA 2RH0A 5AW5B 4C7NA 4O9BA 5APWA 1JY3O 5AVRB 4ZKPA 2B89A 1QX8A 5M1BA 2QIWA 3BCCD 3AEFC 3H1HJ 3MIWA 1IK9A 1CW5A 1KC8Q 3CX5I 1NTZE 1PV3A 3IAOA 1OVVA 1L4AA 1EZVI 3VP9A 4N6JA 4EI2A 2OYOA 2W83C 2NPSC 5CCGC 3LIEA 3H32A 1BE3G 2I1KA 3D71A 2JWDA 3M9BA 1PGQA 1IFJA 1JNMA 2RKLA 2UWJE 3CLQA 1JUNA 2BEQD 1NJIQ 2WPSA 3L74E 4LGDE 1GL2B 1IC2A 2KZJA 3RK2C 1JTHA 1N7SB 3EFGA 3IFMA 2E74D 1X0TA 1AQTA 1K8AQ 4PV1C 1H0TA 2FY8A 1VPCA 1KILC 4GDOA 2SPZA 5H2FE 1R5SA 1KFMA 3HTKA 3RGUA 1IK7A 3FXEA 4GKGA 1SQQJ 1X9VA 1JEKA 3O6QB 3CXHI 3H1KD 1NTMK 2P58A 2FYUJ 3IR9A 1Y9BA 1EDLA 1K04A 2BCCG 2P2UA 3V4QA 2FYZA 3AEAC 3WMM0 3PJSK 3H1IG 2B87B 3AECC 5KJ7D 2A45H 3KYQA 2OTJP 4IFFA 3CC2P 4JQ0D 1VL2A 1T6AA 2V4HA 1JOCA 1S72P 3G6EP 4UB8H 1P84D 2ZYDA 2IBZG 3CMEP 3AEBC 5AW0B 1LWUC 1LTJA 3L72J 2QEXP 3IN6A 1FDOA 1RE3A 3MHVA 1EZVG 1NTME 1QVFO 1JY2N 2WT7B 3C8VA 4PD4D 3E1RA 3CX5H 4Y99B 1NTZJ 2OQQA 1PPJG 1VQLP 5DJUB 4R4MA 1L4AC 3D6ZA 1AJYA 4L76A 4HYTB 1SFCD 2JKVA 1S4XA 3GF3A 2MJZA 1JTHB 5CCHD 2ZVOB 2KSEA 1H0TB 1Q90D 1KYOE 3ABVC 4IL6E 2Y0DA 2E76C 3L74J 2AEJA 2M3BA 4BRYA 3G71P 3B5NC 1M1KQ 1NU1D 3B71A 1YJNP 5APVA 4PJ0H 1MZ9A 3HTKB 1VQ7P 3RK3D 1R8EA 1KD1Q 2A06D 1U57A 5E79E 1LTTC 2FYUD 2LR2A 2WTYA 3TK1A 2M5AA 5AVYB 4WVZA 5KLIB 2GM4A 2K3RA 2JJLA 2JEEA 3KHUA 3GW6A 1OVRA 5KAIE 2W6AA 1JY2O 3CXHH 3LW5H 3V6IA 2E74B 3L73J 3SFDC 3BCCE 3H1LG 3HUSC 1FZCC 5GTHH 3RL0C 1W2EA 1RF0A 2YO3A 3VMZA 3A0HE 1RQUA 4ZKUA 3V2RA 3A7OA 2WSFH 2XU6A 1DEEG 5B66H 3L72D 1KN7A 2OGUA 3RBZA 2PGDA 1LTJB 1MUUA 1VF5C 1SQVD 2YO2A 3CL3D 2XZRA 4L74A 2ZYAA 3KZIE 2KSJA 3GHGB 4ASVA 2BEZF 1S9KD 2FFDC 3VMXA 3A3YB 1X22A 5KKZB 4DCKA 1DEBA 4JBZA 2IZ1A 1ZXGA 1RE3C 4PD4I 1LT9A 4D6TG 1U7MA 1NTMJ 2LXBA 3GG2A 4U3FG 3HE5A 2OARA 1YBKA 1H8AA 1K05A 3W68A 1PFIA 3QH9A 1LTBC 5AVTB 2OYIA 3U1CA 2KNCA 1H88A 4BRYB 4H13D 2IDBA 1YI2P 1J1DC 1CI6B 1JMBA 4NPFX 2M8RA 1W2BO 1PGPA 4NPEA 1GU5A 5TISH 4RESB 2XV5A 3L35A 2HPCB 1Q86Q 5AW2B 3HD7D 1NH4A 3L73D 1GZLA 3Q1MA 3KXDA 2V7QJ 3AEEC 5AW8B 3VOPA 2N9BA 2PRRA 1LTIC 1P84E 2QE7H 3FGAD 2QA4P 1SQBE 2D2CC 3H1HG 1YHQP 2IYOA 3RK3B 1NU1K 2HLOA 1UIXA 3MUDC 1RF0C 1GTWA 4PD4E 4LC1A 1S5LE 1JMMA 1KQLA 3N7NA 4N78D 3L75E 1ZV8A 2I1JA 2OTKE 3OA7A 2L5GB 3KDPB 1JY3N 3A0BH 3CCEP 3AE6C 1DH3A 4I6MC 2BASA 3V5BA 2R5DA 2M0BA 3NFQA 2Q1KA 1GL2A 1EC5A 1N7SA 1LT9C 1NU1E 1OIPA 2OYIB 2ZXEB 1NTKG 3VYIA 2FBWC 1OFCX 2C0WA 3JCUH 2J58A 2A06E 1BGYG 1SQVK 3TF5A 1NKNA 3CWBG 1FOSF 1FOSE 3F5HA 1WT6A 5KLVD 4H44D 1ZP0C 2OYIC 4H0LD 5AW6B 1SQQG 2J59M 1J2JB 4GIFA 1HGZA 1GMJA 3BRTB 1OW7A 3WUTA 3PLNA 4RKUJ 2QJYB 2Q7CA 5GTIH 2ZXXA 4I1LA 2QVAA 3L71D 2K9YA 5AW1B 1PP9G 3E7KA 2VRSA 2XNDH 3NMDA 3MD0A 2QJYC 4KHXA 1E79H 1RH5B 3M9QA 3L72E 4OGQC 4WB4A 3B4SA 1ZLLA 4H13B 2H7HA 1SQVE 4R4LA 2R3CA 5APTA 3HRNA 5KTBA 1NGMB 1S9KE 1NOHA 3CMAP 2YNYA 3L70G 1MV8A 3VMYA 4C46A 2ZVNB 1SQBJ 5AW7B 2AXTE 3VMAA 2WT7A 1AQ5A 4W80A 2IFMA 1M8OB 1T3UA 3HD7B 1BE3E 5KAFE 1BSNA 1E5WA 1NTZG 5CBNA 2J5UA 1VQNP 2QM8A 2FXMA 2HYNA 1U7JA 3L75J 3G4SP 2W27A 1KB9E 4K35A 4AUWA 2K88A 1FAVA 4W7ZA 2G8YA 1LNQA 2CK3H 2IX7C 1GL2C 3L74G 2YIUB 1BCCD 1N7SC 4Z1MH 5AW3B 3AE3C 1NU1J 3L4FA 1RE4A 2K37A 1KYOI 2HFED 4A7PA 1T2KD 2YIUC 3L73E 3H6PA 2A45G 1YIJP 1XTGB 2WSCJ 5AVXB 3CCJP 3P7KA 3VP8A 3L36A 1IFMA 2WITA 3CCVP 3B8EB 3P8MC 4EIJA 4YXDC 5H2FH 5CBOA 3NXSA 3MTUE 3M9HA 3H1JG 1ZR4A 5TJHA 1HJ0A 5AVWB 1SS1A 5CMZA 2IBZE 4DZOA 3OW2O 2R44A 4H44B 4MN4C 3TGUD 4H0LB 4N78E 1SQBD 1SQPD 1USEA 5KLVK 2Q3IA 1SQVJ 2C9NY 2ZYGA 2KOGA 3GHGA 5AVUB 3TDKA 2I8DA 1JO5A 4L75A 4H0LC 4I2LC 1FDIA 3L75D 1FU1A 1N8RQ 5KJ7A 1NTMG 1RHZB 1URQD 1EDJA 4Y99C 1BE3J 2O3JA 1VQ6P 2LKMA 5AVVB 3CCMP 2KYVA 1QL1A 2WSEJ 2KS1B 5BU8B 2P67A 4TLFA 1L0ND 5KLVE 1ZW0A 1OXZA 1NAYA 1CI6A 5L8RJ 2JP3A 2W8ZA 4GOFA 1YITP 3L37A 4RJTA 2W6BA 3TYYA 1J1EB 1JY2P 4GT1A 3L71E 1AV1A 3S9OA 2HPCA 1GU4A 2HODB 1SQXD 4IFDK 4WBAA 1RE4C 1SFCA 3R2PA 1PZQA 1L0LD 1KYOH 1G1IA 4IL6H 1FC2C 4HJGH 2ZFCA 4IOIH 2XDJA 1JCCA 5CCHA 4EOTA 3WU2E 4HB1A 1KQSO 3I56P 5KLIC 2K9JB 3C1LA 2KLVA 1FZEA 2WSSH 3CPWO 5E79H 1ZR2A 1NVOA 3H1IJ 2V7QH 2E74C 5K5GB 2Z5IA 2WVRA 3AEGC 3PP5A 5APQA 3BCCG 1TU3F 2R3SA 1P84I 3FX0A 4EDFA 2Q5UA 5KAIH 4B86A 1GD2E 3RL0g 1LTJC 2O01J 1N2DC 3A0HH 1AA0A 3CD6P 4D6TE 2IPPA 2YKQA 1LTGC 4U3FE 1DD3A 1BE3D 3GHGC 3JSVC 1FJPA 1LJ2A 4UB6E 5KKZC 2KK7A 2ZT9D 1AVOA 1SLQA 2DW3A 3R4YA 4I7ZB 1KB9D 3KZIH 5KJ7C 1BCCE 2WMMA 2P7JA 2RMZA 3Q3DA 1OWAA 2PP6A 1FZFA 1LGHB 1SQBK 3FWNA 4JF7A 3VN0A 1SQPK 3SSUA 3A2AA 1YYCA 2YMKA 3U1AA 1NYHA 2HR3A 1M7LA 1KQFB 2OYHA 3TNUB 5KLVJ 1M90Q 4XFJA 3Q2YA 1DD4A 2KB7P 1YQ4C 1URQB 2NPSD 3UIAA 5CCGD 3H1KG 1SFCB 1YJ9P 3F89A 2HG5D 1FDMA 3L71J 2G3AA 3EFFK 2BCCD 2KZIA 3P8CD 1OMIA 4AQRD 1ZMEC 3K5BA 3GMAA 3H1ID 2C9LY 2ITAA 1SFCC 3TGUE 2Y0CA 1BDDA 1WMKA 3RK2D 2R5BA 1SQPE 4JYCA 1L0NK 2P1JA 2Q9IA 1EDIA 5CCHC 1GK4A 2W6JH 3H1LJ 1XTCC 1M56D 4PV1D 4WY4D 1X8YA 2IFNA 1HF9A 1KILD 2IBZD 4BXLA 1K73Q 3I55P 1SVFA 4AYCA 3CX5D 1KORA 1K9MQ 3PTZA 4DT0A 4OVNF 1FZGA 3RK3C 1EZVD 2PAJA 5BU5A 2IZ0A 1P84H 1JB0J 2FXPA 3HD7A 1PGJA 1AFOA 1SQXK 3SWFA 3GF7A 5AVZB 2L91A 1L0LK 4OWFA 1H89A 1PPJD 1KFNA 3LIDA 2H43A 3AE2C 2OTLP 1WRGA 1IJDB 2M3EA 3AE1C 1Q7YQ 4PD4H 1L0NE 1S5LH 4D6TJ 1Y47A 4GOEA 1LP1A 1DX7A 4U3FJ 1NTKE 2FKWB 4WY4A 5AVQB 4YTPC 1KB9I 2KIKA 1BGYE 2GUVA 2QM7A 1HBWA 1KZUB 2WQYC 3CWBE 2GUSA 1GW4A 1OX3A 1NU1G 2QRXA 1BCCJ 3CCLP 3BASA 3MZWB 3V2QA 2JDIH 2OYHB 2QJPB 4Y28J 4OH8B 1SQXE 1JY3P 3W67A 2R32A 2A06G 1L0LE 1NWQA 2FYUG 1PGOA 3A5TA 3S4RA 1EQ7A 3CCRP 1PP9E 2ZJSE 3V2NA 4BWNA 2ZT9B 3E1IA 1S2EA 1L4AD 2Z5HA 5AW4B 2LXCB 3M0DA 3I5CA 3G9RA 1HJBA 3CCUP 3S1KA 3M91A 3H1LD 2WWWA 1NHLA 4YXWH 4W7YA 4LLHA 1LWUA 2WZ7A 1KQGB 2E76D 3L72G 3KPEA 2O1KA 3L70E 3B5ND 1R5LA 4H13C 3TGUJ 1RY3A 3VTPC 1SQVG 1SQPJ 1AVYA 1FZAA 4TT3H 2IBZI 2NPSB 1NO4A 1N7LA 3P32A 1IFNA 2Q6QA 4L73A 1RQVA 2H88C 2E42A 2PFXA 1T3JA 2Y9YA 4D6TD 5APYA 2RN0A 3HD7C 4ZNCA 4U3FD 3RK2B 3T97B 2QG4A 1PIXA 3V2PA 1QEXA 3MGNA 1LP1B 1YQ3C 1N86A 2H8PD 2KS1A 2AXTH 3RL0D 1ZOYC 2QJKB 4PV1B 2Y0EA 4WY4B 1YJWP 1KILB 5AVSB 3B5NA 4IFMA 2CPSA 5CHXA 5KAFH 3M0AA 1HH0A 1L0NJ 1DIPA 2JWAA 4C7RA 2WSEH 3EQ2A 5CJ0A 1NTKJ 1VF5D 2KI7B 2AEMA 2QJKC 4WWIA 4WY4C 1KB9H 3AEDC 3C9IA 1BGYJ 1M1JA 1BDCA 3SWYA 1FZBA 3CWBJ 1LTAC 2BCCE 2WPQA 2HODA 3P8CE 3H1IE 4UB8E 3BVHA 3OAKA 1SQXJ 3ZDMA 1L0LJ 1Q2NA 3L73G 3HUSA 2JO1A 1FZCA 2XNXA 1USDA 2K9JA 2NZ2A 3H1JE 1PP9J 3NTNA 1FE6A 1KILE 4EYYQ 1GDTA 3HE4A 4C7NB 2KXPB 3M0DC 3CX5E 1LWUB 2E5YA 2B9BA 1KMIZ 3H1HD 1EZVE 4KJMA 1MFTA 3CC7P 1OZHA 2FFDA 3N4XA 4H44C 1M57D 2POHA 2E75D 1ZRTD 2N1TD 3D6YA 2B88A 1CSBA 1PPJE 3L70J 1Q81Q 2E43A 3M06A 3G3ZA 1L4AB 2YXQB 2Z4EA 4HH2A 3USSA 3AE9C 3H32B 5DJTB 2O01H 2YXRB 2KLUA 4PJ0E 1G2CA 1A02F 3Q5RA 4NPDA 2YMYA 2W90A 1HGVA 1QGKB 3CC4P
chains in the Genus database with same CATH topology
3A0HH 3KZIH 5KAFH 5GTHH 4UB6H 1S5LH 4UB8H 4PJ0H 5B5EH 5KAIH 5E79H 5GTIH 5B66H 3JCUH 2AXTH 4IL6H 3WU2H 5H2FH 3A0BH 5TISH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0H H;  3KZI H;  5KAF H;  5GTH H;  4UB6 H;  1S5L H;  4UB8 H;  4PJ0 H;  5B5E H;  5KAI H;  5E79 H;  5GTI H;  5B66 H;  3JCU H;  2AXT H;  4IL6 H;  3WU2 H;  5H2F H;  3A0B H;  5TIS H; 
#chains in the Genus database with same CATH topology
 1KTM A;  1UII A;  3EWK A;  2E76 B;  3FXD A;  3B5N B;  3WUU A;  1NTK D;  2MKV A;  1FJK A;  2D2C D;  3FWL A;  2C0X A;  1L2P A;  3IF4 A;  1BGY D;  3QWO C;  2AEF A;  1BSH A;  2N1T A;  3CWB D;  3TNU A;  5KLV G;  3CXH E;  1M1J B;  4U7J A;  1OW8 A;  1SQQ D;  1IFP A;  1Q82 Q;  1NAF A;  5BVZ A;  5GTH E;  1URQ A;  3II6 A;  2GA1 A;  1IO4 A;  3PH0 A;  3AE8 C;  1J1E C;  1S1C X;  5B66 E;  3L71 G;  1OVU A;  1RF1 A;  1IFD A;  1M1J C;  3KQG A;  1PP9 D;  4RO0 A;  3H1L E;  1VQ9 P;  3HUS B;  1FZC B;  3RL0 B;  4M3L A;  2BCC J;  1IZN B;  3BAT A;  1CZQ A;  1QVG O;  4ASW A;  1YTZ T;  3HE4 B;  2KP8 A;  1VQ8 P;  2H89 C;  3U59 A;  1VF5 B;  1HVV A;  3MUD A;  3V4W A;  3H1J J;  1HUC A;  1VQP P;  2Q3E A;  2FFD B;  1GK6 A;  3L70 D;  2FXO A;  5B5E E;  3WU2 H;  2YKP A;  4CPG A;  4DJG A;  1T2K C;  1NTZ D;  2Y9Z A;  1MKM A;  4IL6 X;  3CCS P;  3SWK A;  1G2C B;  1VQO P;  5APS A;  5AW9 B;  5APX A;  2FYN B;  4OGQ D;  2XKM A;  5TIS E;  5B5E H;  3Q5S A;  2N9Y B;  1N73 A;  4ZMD A;  1J1D B;  1OW6 A;  1VQ5 P;  1S3J A;  1A02 J;  4I7Z C;  1QL2 A;  3L74 D;  3RBX A;  2FYN C;  2E75 B;  1BCC G;  2N1T B;  4UB6 H;  1JCD A;  1QLE D;  4GOD A;  1W5C E;  2E5T A;  2O1J A;  3H1K E;  1MFZ A;  1NKZ B;  2E75 C;  4QMA A;  2N1T C;  3OJA B;  1RF1 B;  3LW5 J;  2M5A B;  3CCQ P;  3AE5 C;  1LT1 A;  5CJ4 A;  1KV4 A;  1URQ C;  1D7M A;  4JYB A;  2QSI A;  4XE5 B;  2WSF J;  2P10 A;  3D70 A;  3H1H E;  2D2C B;  1RF1 C;  3H1J D;  3PRJ A;  1JM0 A;  1NTK K;  3A0B E;  3TSI A;  4JPZ B;  2AXC A;  2O01 N;  1GL2 D;  3AE7 C;  3TGU G;  1VQM P;  3PHL A;  1ZRT E;  1SQB G;  1N7S D;  3SFE C;  1VQ4 P;  1SQP G;  2NPS A;  5CCG A;  3BCC J;  2WPV B;  1SQQ K;  1Z56 A;  1X79 B;  2FYU K;  1YTZ I;  3L75 G;  1PL5 A;  3JCU E;  1NTM D;  2WPR A;  1VDF A;  1SP4 A;  3T97 A;  1LT9 B;  3Q5P A;  3HE5 B;  1LTS C;  3CI9 A;  5EFW B;  5C39 A;  1KIL A;  1N73 B;  5GTI E;  3MP7 B;  2K1A A;  4DOJ A;  1EXJ A;  1EDK A;  2YKO A;  1L0N G;  4HKZ H;  1G1J A;  3H25 A;  2ZAE B;  1SQQ E;  1HTL C;  2KNC B;  4N3Y B;  3RK3 E;  1HWT C;  2CPB A;  3BRV B;  1N73 C;  4K3A A;  2FYU E;  5APU A;  3WUV A;  1KYO D;  4YPC A;  1FS0 E;  3O8Z A;  3CXH D;  1NTZ K;  2OYH C;  2QJP C;  1ZN5 A;  3ITK A;  3O6Q A;  1SQX G;  1Y8A A;  3JC2 2;  1L0L G;  2JR8 A;  2A45 I;  4OGQ B;  1GW3 A;  1EXI A;  2WSC H;  3H1K J;  2IYP A;  2KUB A;  4KT0 J;  3AE4 C;  1VQK P;  1T8Z A;  1S5L X;  3GLM A;  2ZT9 C;  1IFI A;  1FBM A;  2B87 A;  4XA4 A;  2NRG A;  2RH0 A;  5AW5 B;  4C7N A;  4O9B A;  5APW A;  1JY3 O;  5AVR B;  4ZKP A;  2B89 A;  1QX8 A;  5M1B A;  2QIW A;  3BCC D;  3AEF C;  3H1H J;  3MIW A;  1IK9 A;  1CW5 A;  1KC8 Q;  3CX5 I;  1NTZ E;  1PV3 A;  3IAO A;  1OVV A;  1L4A A;  1EZV I;  3VP9 A;  4N6J A;  4EI2 A;  2OYO A;  2W83 C;  2NPS C;  5CCG C;  3LIE A;  3H32 A;  1BE3 G;  2I1K A;  3D71 A;  2JWD A;  3M9B A;  1PGQ A;  1IFJ A;  1JNM A;  2RKL A;  2UWJ E;  3CLQ A;  1JUN A;  2BEQ D;  1NJI Q;  2WPS A;  3L74 E;  4LGD E;  1GL2 B;  1IC2 A;  2KZJ A;  3RK2 C;  1JTH A;  1N7S B;  3EFG A;  3IFM A;  2E74 D;  1X0T A;  1AQT A;  1K8A Q;  4PV1 C;  1H0T A;  2FY8 A;  1VPC A;  1KIL C;  4GDO A;  2SPZ A;  5H2F E;  1R5S A;  1KFM A;  3HTK A;  3RGU A;  1IK7 A;  3FXE A;  4GKG A;  1SQQ J;  1X9V A;  1JEK A;  3O6Q B;  3CXH I;  3H1K D;  1NTM K;  2P58 A;  2FYU J;  3IR9 A;  1Y9B A;  1EDL A;  1K04 A;  2BCC G;  2P2U A;  3V4Q A;  2FYZ A;  3AEA C;  3WMM 0;  3PJS K;  3H1I G;  2B87 B;  3AEC C;  5KJ7 D;  2A45 H;  3KYQ A;  2OTJ P;  4IFF A;  3CC2 P;  4JQ0 D;  1VL2 A;  1T6A A;  2V4H A;  1JOC A;  1S72 P;  3G6E P;  4UB8 H;  1P84 D;  2ZYD A;  2IBZ G;  3CME P;  3AEB C;  5AW0 B;  1LWU C;  1LTJ A;  3L72 J;  2QEX P;  3IN6 A;  1FDO A;  1RE3 A;  3MHV A;  1EZV G;  1NTM E;  1QVF O;  1JY2 N;  2WT7 B;  3C8V A;  4PD4 D;  3E1R A;  3CX5 H;  4Y99 B;  1NTZ J;  2OQQ A;  1PPJ G;  1VQL P;  5DJU B;  4R4M A;  1L4A C;  3D6Z A;  1AJY A;  4L76 A;  4HYT B;  1SFC D;  2JKV A;  1S4X A;  3GF3 A;  2MJZ A;  1JTH B;  5CCH D;  2ZVO B;  2KSE A;  1H0T B;  1Q90 D;  1KYO E;  3ABV C;  4IL6 E;  2Y0D A;  2E76 C;  3L74 J;  2AEJ A;  2M3B A;  4BRY A;  3G71 P;  3B5N C;  1M1K Q;  1NU1 D;  3B71 A;  1YJN P;  5APV A;  4PJ0 H;  1MZ9 A;  3HTK B;  1VQ7 P;  3RK3 D;  1R8E A;  1KD1 Q;  2A06 D;  1U57 A;  5E79 E;  1LTT C;  2FYU D;  2LR2 A;  2WTY A;  3TK1 A;  2M5A A;  5AVY B;  4WVZ A;  5KLI B;  2GM4 A;  2K3R A;  2JJL A;  2JEE A;  3KHU A;  3GW6 A;  1OVR A;  5KAI E;  2W6A A;  1JY2 O;  3CXH H;  3LW5 H;  3V6I A;  2E74 B;  3L73 J;  3SFD C;  3BCC E;  3H1L G;  3HUS C;  1FZC C;  5GTH H;  3RL0 C;  1W2E A;  1RF0 A;  2YO3 A;  3VMZ A;  3A0H E;  1RQU A;  4ZKU A;  3V2R A;  3A7O A;  2WSF H;  2XU6 A;  1DEE G;  5B66 H;  3L72 D;  1KN7 A;  2OGU A;  3RBZ A;  2PGD A;  1LTJ B;  1MUU A;  1VF5 C;  1SQV D;  2YO2 A;  3CL3 D;  2XZR A;  4L74 A;  2ZYA A;  3KZI E;  2KSJ A;  3GHG B;  4ASV A;  2BEZ F;  1S9K D;  2FFD C;  3VMX A;  3A3Y B;  1X22 A;  5KKZ B;  4DCK A;  1DEB A;  4JBZ A;  2IZ1 A;  1ZXG A;  1RE3 C;  4PD4 I;  1LT9 A;  4D6T G;  1U7M A;  1NTM J;  2LXB A;  3GG2 A;  4U3F G;  3HE5 A;  2OAR A;  1YBK A;  1H8A A;  1K05 A;  3W68 A;  1PFI A;  3QH9 A;  1LTB C;  5AVT B;  2OYI A;  3U1C A;  2KNC A;  1H88 A;  4BRY B;  4H13 D;  2IDB A;  1YI2 P;  1J1D C;  1CI6 B;  1JMB A;  4NPF X;  2M8R A;  1W2B O;  1PGP A;  4NPE A;  1GU5 A;  5TIS H;  4RES B;  2XV5 A;  3L35 A;  2HPC B;  1Q86 Q;  5AW2 B;  3HD7 D;  1NH4 A;  3L73 D;  1GZL A;  3Q1M A;  3KXD A;  2V7Q J;  3AEE C;  5AW8 B;  3VOP A;  2N9B A;  2PRR A;  1LTI C;  1P84 E;  2QE7 H;  3FGA D;  2QA4 P;  1SQB E;  2D2C C;  3H1H G;  1YHQ P;  2IYO A;  3RK3 B;  1NU1 K;  2HLO A;  1UIX A;  3MUD C;  1RF0 C;  1GTW A;  4PD4 E;  4LC1 A;  1S5L E;  1JMM A;  1KQL A;  3N7N A;  4N78 D;  3L75 E;  1ZV8 A;  2I1J A;  2OTK E;  3OA7 A;  2L5G B;  3KDP B;  1JY3 N;  3A0B H;  3CCE P;  3AE6 C;  1DH3 A;  4I6M C;  2BAS A;  3V5B A;  2R5D A;  2M0B A;  3NFQ A;  2Q1K A;  1GL2 A;  1EC5 A;  1N7S A;  1LT9 C;  1NU1 E;  1OIP A;  2OYI B;  2ZXE B;  1NTK G;  3VYI A;  2FBW C;  1OFC X;  2C0W A;  3JCU H;  2J58 A;  2A06 E;  1BGY G;  1SQV K;  3TF5 A;  1NKN A;  3CWB G;  1FOS F;  1FOS E;  3F5H A;  1WT6 A;  5KLV D;  4H44 D;  1ZP0 C;  2OYI C;  4H0L D;  5AW6 B;  1SQQ G;  2J59 M;  1J2J B;  4GIF A;  1HGZ A;  1GMJ A;  3BRT B;  1OW7 A;  3WUT A;  3PLN A;  4RKU J;  2QJY B;  2Q7C A;  5GTI H;  2ZXX A;  4I1L A;  2QVA A;  3L71 D;  2K9Y A;  5AW1 B;  1PP9 G;  3E7K A;  2VRS A;  2XND H;  3NMD A;  3MD0 A;  2QJY C;  4KHX A;  1E79 H;  1RH5 B;  3M9Q A;  3L72 E;  4OGQ C;  4WB4 A;  3B4S A;  1ZLL A;  4H13 B;  2H7H A;  1SQV E;  4R4L A;  2R3C A;  5APT A;  3HRN A;  5KTB A;  1NGM B;  1S9K E;  1NOH A;  3CMA P;  2YNY A;  3L70 G;  1MV8 A;  3VMY A;  4C46 A;  2ZVN B;  1SQB J;  5AW7 B;  2AXT E;  3VMA A;  2WT7 A;  1AQ5 A;  4W80 A;  2IFM A;  1M8O B;  1T3U A;  3HD7 B;  1BE3 E;  5KAF E;  1BSN A;  1E5W A;  1NTZ G;  5CBN A;  2J5U A;  1VQN P;  2QM8 A;  2FXM A;  2HYN A;  1U7J A;  3L75 J;  3G4S P;  2W27 A;  1KB9 E;  4K35 A;  4AUW A;  2K88 A;  1FAV A;  4W7Z A;  2G8Y A;  1LNQ A;  2CK3 H;  2IX7 C;  1GL2 C;  3L74 G;  2YIU B;  1BCC D;  1N7S C;  4Z1M H;  5AW3 B;  3AE3 C;  1NU1 J;  3L4F A;  1RE4 A;  2K37 A;  1KYO I;  2HFE D;  4A7P A;  1T2K D;  2YIU C;  3L73 E;  3H6P A;  2A45 G;  1YIJ P;  1XTG B;  2WSC J;  5AVX B;  3CCJ P;  3P7K A;  3VP8 A;  3L36 A;  1IFM A;  2WIT A;  3CCV P;  3B8E B;  3P8M C;  4EIJ A;  4YXD C;  5H2F H;  5CBO A;  3NXS A;  3MTU E;  3M9H A;  3H1J G;  1ZR4 A;  5TJH A;  1HJ0 A;  5AVW B;  1SS1 A;  5CMZ A;  2IBZ E;  4DZO A;  3OW2 O;  2R44 A;  4H44 B;  4MN4 C;  3TGU D;  4H0L B;  4N78 E;  1SQB D;  1SQP D;  1USE A;  5KLV K;  2Q3I A;  1SQV J;  2C9N Y;  2ZYG A;  2KOG A;  3GHG A;  5AVU B;  3TDK A;  2I8D A;  1JO5 A;  4L75 A;  4H0L C;  4I2L C;  1FDI A;  3L75 D;  1FU1 A;  1N8R Q;  5KJ7 A;  1NTM G;  1RHZ B;  1URQ D;  1EDJ A;  4Y99 C;  1BE3 J;  2O3J A;  1VQ6 P;  2LKM A;  5AVV B;  3CCM P;  2KYV A;  1QL1 A;  2WSE J;  2KS1 B;  5BU8 B;  2P67 A;  4TLF A;  1L0N D;  5KLV E;  1ZW0 A;  1OXZ A;  1NAY A;  1CI6 A;  5L8R J;  2JP3 A;  2W8Z A;  4GOF A;  1YIT P;  3L37 A;  4RJT A;  2W6B A;  3TYY A;  1J1E B;  1JY2 P;  4GT1 A;  3L71 E;  1AV1 A;  3S9O A;  2HPC A;  1GU4 A;  2HOD B;  1SQX D;  4IFD K;  4WBA A;  1RE4 C;  1SFC A;  3R2P A;  1PZQ A;  1L0L D;  1KYO H;  1G1I A;  4IL6 H;  1FC2 C;  4HJG H;  2ZFC A;  4IOI H;  2XDJ A;  1JCC A;  5CCH A;  4EOT A;  3WU2 E;  4HB1 A;  1KQS O;  3I56 P;  5KLI C;  2K9J B;  3C1L A;  2KLV A;  1FZE A;  2WSS H;  3CPW O;  5E79 H;  1ZR2 A;  1NVO A;  3H1I J;  2V7Q H;  2E74 C;  5K5G B;  2Z5I A;  2WVR A;  3AEG C;  3PP5 A;  5APQ A;  3BCC G;  1TU3 F;  2R3S A;  1P84 I;  3FX0 A;  4EDF A;  2Q5U A;  5KAI H;  4B86 A;  1GD2 E;  3RL0 g;  1LTJ C;  2O01 J;  1N2D C;  3A0H H;  1AA0 A;  3CD6 P;  4D6T E;  2IPP A;  2YKQ A;  1LTG C;  4U3F E;  1DD3 A;  1BE3 D;  3GHG C;  3JSV C;  1FJP A;  1LJ2 A;  4UB6 E;  5KKZ C;  2KK7 A;  2ZT9 D;  1AVO A;  1SLQ A;  2DW3 A;  3R4Y A;  4I7Z B;  1KB9 D;  3KZI H;  5KJ7 C;  1BCC E;  2WMM A;  2P7J A;  2RMZ A;  3Q3D A;  1OWA A;  2PP6 A;  1FZF A;  1LGH B;  1SQB K;  3FWN A;  4JF7 A;  3VN0 A;  1SQP K;  3SSU A;  3A2A A;  1YYC A;  2YMK A;  3U1A A;  1NYH A;  2HR3 A;  1M7L A;  1KQF B;  2OYH A;  3TNU B;  5KLV J;  1M90 Q;  4XFJ A;  3Q2Y A;  1DD4 A;  2KB7 P;  1YQ4 C;  1URQ B;  2NPS D;  3UIA A;  5CCG D;  3H1K G;  1SFC B;  1YJ9 P;  3F89 A;  2HG5 D;  1FDM A;  3L71 J;  2G3A A;  3EFF K;  2BCC D;  2KZI A;  3P8C D;  1OMI A;  4AQR D;  1ZME C;  3K5B A;  3GMA A;  3H1I D;  2C9L Y;  2ITA A;  1SFC C;  3TGU E;  2Y0C A;  1BDD A;  1WMK A;  3RK2 D;  2R5B A;  1SQP E;  4JYC A;  1L0N K;  2P1J A;  2Q9I A;  1EDI A;  5CCH C;  1GK4 A;  2W6J H;  3H1L J;  1XTC C;  1M56 D;  4PV1 D;  4WY4 D;  1X8Y A;  2IFN A;  1HF9 A;  1KIL D;  2IBZ D;  4BXL A;  1K73 Q;  3I55 P;  1SVF A;  4AYC A;  3CX5 D;  1KOR A;  1K9M Q;  3PTZ A;  4DT0 A;  4OVN F;  1FZG A;  3RK3 C;  1EZV D;  2PAJ A;  5BU5 A;  2IZ0 A;  1P84 H;  1JB0 J;  2FXP A;  3HD7 A;  1PGJ A;  1AFO A;  1SQX K;  3SWF A;  3GF7 A;  5AVZ B;  2L91 A;  1L0L K;  4OWF A;  1H89 A;  1PPJ D;  1KFN A;  3LID A;  2H43 A;  3AE2 C;  2OTL P;  1WRG A;  1IJD B;  2M3E A;  3AE1 C;  1Q7Y Q;  4PD4 H;  1L0N E;  1S5L H;  4D6T J;  1Y47 A;  4GOE A;  1LP1 A;  1DX7 A;  4U3F J;  1NTK E;  2FKW B;  4WY4 A;  5AVQ B;  4YTP C;  1KB9 I;  2KIK A;  1BGY E;  2GUV A;  2QM7 A;  1HBW A;  1KZU B;  2WQY C;  3CWB E;  2GUS A;  1GW4 A;  1OX3 A;  1NU1 G;  2QRX A;  1BCC J;  3CCL P;  3BAS A;  3MZW B;  3V2Q A;  2JDI H;  2OYH B;  2QJP B;  4Y28 J;  4OH8 B;  1SQX E;  1JY3 P;  3W67 A;  2R32 A;  2A06 G;  1L0L E;  1NWQ A;  2FYU G;  1PGO A;  3A5T A;  3S4R A;  1EQ7 A;  3CCR P;  1PP9 E;  2ZJS E;  3V2N A;  4BWN A;  2ZT9 B;  3E1I A;  1S2E A;  1L4A D;  2Z5H A;  5AW4 B;  2LXC B;  3M0D A;  3I5C A;  3G9R A;  1HJB A;  3CCU P;  3S1K A;  3M91 A;  3H1L D;  2WWW A;  1NHL A;  4YXW H;  4W7Y A;  4LLH A;  1LWU A;  2WZ7 A;  1KQG B;  2E76 D;  3L72 G;  3KPE A;  2O1K A;  3L70 E;  3B5N D;  1R5L A;  4H13 C;  3TGU J;  1RY3 A;  3VTP C;  1SQV G;  1SQP J;  1AVY A;  1FZA A;  4TT3 H;  2IBZ I;  2NPS B;  1NO4 A;  1N7L A;  3P32 A;  1IFN A;  2Q6Q A;  4L73 A;  1RQV A;  2H88 C;  2E42 A;  2PFX A;  1T3J A;  2Y9Y A;  4D6T D;  5APY A;  2RN0 A;  3HD7 C;  4ZNC A;  4U3F D;  3RK2 B;  3T97 B;  2QG4 A;  1PIX A;  3V2P A;  1QEX A;  3MGN A;  1LP1 B;  1YQ3 C;  1N86 A;  2H8P D;  2KS1 A;  2AXT H;  3RL0 D;  1ZOY C;  2QJK B;  4PV1 B;  2Y0E A;  4WY4 B;  1YJW P;  1KIL B;  5AVS B;  3B5N A;  4IFM A;  2CPS A;  5CHX A;  5KAF H;  3M0A A;  1HH0 A;  1L0N J;  1DIP A;  2JWA A;  4C7R A;  2WSE H;  3EQ2 A;  5CJ0 A;  1NTK J;  1VF5 D;  2KI7 B;  2AEM A;  2QJK C;  4WWI A;  4WY4 C;  1KB9 H;  3AED C;  3C9I A;  1BGY J;  1M1J A;  1BDC A;  3SWY A;  1FZB A;  3CWB J;  1LTA C;  2BCC E;  2WPQ A;  2HOD A;  3P8C E;  3H1I E;  4UB8 E;  3BVH A;  3OAK A;  1SQX J;  3ZDM A;  1L0L J;  1Q2N A;  3L73 G;  3HUS A;  2JO1 A;  1FZC A;  2XNX A;  1USD A;  2K9J A;  2NZ2 A;  3H1J E;  1PP9 J;  3NTN A;  1FE6 A;  1KIL E;  4EYY Q;  1GDT A;  3HE4 A;  4C7N B;  2KXP B;  3M0D C;  3CX5 E;  1LWU B;  2E5Y A;  2B9B A;  1KMI Z;  3H1H D;  1EZV E;  4KJM A;  1MFT A;  3CC7 P;  1OZH A;  2FFD A;  3N4X A;  4H44 C;  1M57 D;  2POH A;  2E75 D;  1ZRT D;  2N1T D;  3D6Y A;  2B88 A;  1CSB A;  1PPJ E;  3L70 J;  1Q81 Q;  2E43 A;  3M06 A;  3G3Z A;  1L4A B;  2YXQ B;  2Z4E A;  4HH2 A;  3USS A;  3AE9 C;  3H32 B;  5DJT B;  2O01 H;  2YXR B;  2KLU A;  4PJ0 E;  1G2C A;  1A02 F;  3Q5R A;  4NPD A;  2YMY A;  2W90 A;  1HGV A;  1QGK B;  3CC4 P; 
#chains in the Genus database with same CATH homology
 3A0H H;  3KZI H;  5KAF H;  5GTH H;  4UB6 H;  1S5L H;  4UB8 H;  4PJ0 H;  5B5E H;  5KAI H;  5E79 H;  5GTI H;  5B66 H;  3JCU H;  2AXT H;  4IL6 H;  3WU2 H;  5H2F H;  3A0B H;  5TIS H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...