4IL6H

Structure of sr-substituted photosystem ii
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
63
structure length
63
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Sr-substituted photosystem II at 2.1 A resolution and its implications in the mechanism of water oxidation
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein
total genus 13
structure length 63
sequence length 63
chains with identical sequence h
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 4il6H01
3JCUH 5KAFH 2AXTH 4IL6H 4PJ0H 4UB6H 5B66H 5GTHH 1S5LH 5TISH 3WU2H 5GTIH 3KZIH 3A0HH 5E79H 4UB8H 5KAIH 5H2FH 5B5EH 3A0BH
chains in the Genus database with same CATH superfamily
2KZIA 1KB9H 3HE5B 3GMAA 1BE3J 1FDOA 1NTMG 2YKOA 4U3FE 1FJPA 2N1TA 3CCQP 2C9NY 1W5CE 1EDKA 2QRXA 1FZAA 2YXRB 3C1LA 2WSCJ 3M0DA 3MGNA 1VQ5P 4Y28J 2FYZA 1GU4A 1FS0E 3B5ND 3H25A 1KB9E 1QEXA 5APUA 3L71G 1JY2O 1IFMA 4MN4C 4OGQB 3A0BH 2DW3A 1GL2C 5AVVB 5APSA 1M57D 1RE4A 1S2EA 3U1AA 1KB9I 1U7JA 2L5GB 2ZT9B 4WB4A 5L8RJ 3L35A 1KYOH 5AW8B 1IJDB 2POHA 2FYUG 3A7OA 2FYNC 3A0HH 3NMDA 5AVRB 4IFMA 3TDKA 1W2BO 3A2AA 3IAOA 3JCUH 4WWIA 3L72E 3RK3D 1FZFA 2HYNA 2R44A 4JYCA 1HGZA 1MUUA 1JNMA 4ASWA 5GTIH 5E79H 1SQVD 1SQXG 3RK3B 2JWDA 3R2PA 2D2CD 1PZQA 3ZDMA 4N78E 2I1JA 1NKNA 1NTME 2O01J 5C39A 3V5BA 1QL2A 1UIXA 3FX0A 2FXOA 4YXDC 3U1CA 1VQNP 1ZW0A 2W27A 5TISH 2I1KA 1SFCC 2JP3A 1FZCA 2HFED 1OVRA 2RMZA 4LC1A 1VF5B 3MUDA 4PJ0H 5AVQB 3Q5RA 3RL0B 2LXCB 1Q81Q 3S1KA 3CCEP 3AECC 1N86A 1M8OB 2VRSA 1Q82Q 1AVYA 5AVUB 2XV5A 3V2NA 3M0DC 3VMZA 1QVFO 1SQQK 4AUWA 1L0NG 5BU8B 1ZP0C 3CD6P 4C7NB 2KK7A 2KLVA 3NTNA 3OAKA 3I55P 2PAJA 4R4LA 3N7NA 1GZLA 1GL2D 4U3FD 4H13B 2JR8A 5AW0B 1JY2P 2B89A 3V4QA 2QA4P 3TNUB 1NHLA 2K1AA 2M3EA 2OYOA 1L0NJ 1N7SB 1SQBK 2ITAA 2K88A 1SQPD 2NPSC 2O3JA 2XDJA 3N4XA 2N9BA 4JBZA 1HWTC 1R5SA 3W68A 2IBZI 1LTGC 4BXLA 2E75C 1IFJA 2PP6A 2YIUC 4IL6E 4Y99C 1CSBA 3HD7C 3L74D 5B5EH 1XTCC 5CCHD 1DIPA 3O6QB 1LTJA 3B71A 1PGPA 1KB9D 2ZT9D 3RGUA 1N73A 1SFCA 3M9HA 3SWYA 1L4AB 2KP8A 2FYUD 3W67A 1PP9J 1N7SC 2AXCA 1NAYA 2E76C 3AEEC 2CK3H 2YO3A 3EFFK 1X0TA 2WSFH 2ZFCA 3CXHD 3H1JG 1NTMK 3A0BE 1ZN5A 5KTBA 1G2CA 3BATA 1Q86Q 1K73Q 1RF1A 1L0NE 1VQ8P 1SQQE 2KI7B 1HJBA 1OW6A 3BVHA 2NZ2A 1LWUA 2B9BA 3Q3DA 2Q7CA 1LWUC 2QJYC 2Q9IA 1U57A 2HLOA 3PH0A 1YJNP 1UIIA 1Q90D 5KLIB 2KXPB 3T97A 4ZMDA 2IZ1A 3IFMA 5CMZA 3SFDC 1N7SA 1J2JB 1KMIZ 4QMAA 2FKWB 3CC7P 3L71E 3P32A 4PD4D 5GTHH 2OARA 2M5AB 3AE7C 3RK3E 3D70A 1YI2P 4NPDA 1YYCA 2PRRA 3VP8A 1L0LK 1L4AC 1NU1D 3AE9C 4WY4B 5KKZB 2E43A 5AVYB 3L74J 1RF0C 2WSEJ 1G1JA 3AEBC 4HKZH 4O9BA 1AV1A 1FDIA 1L4AA 3I56P 1JUNA 5KAIE 1SQVJ 4HB1A 1Y9BA 2HG5D 1S9KD 1N2DC 3CCLP 2C0WA 3L72J 1MKMA 1URQB 1S72P 1EZVI 1VQ9P 1KTMA 1VF5D 1LJ2A 2LKMA 1PGOA 3E1IA 4A7PA 3MHVA 1M7LA 4U3FG 2MJZA 2PFXA 3H1LJ 5M1BA 3EWKA 1LTBC 1H88A 2WWWA 3CX5I 1FZBA 1VQKP 1X79B 4H44D 2O1KA 1SQBG 3A0HE 3L71D 2Y0DA 3BCCE 2E42A 3L72D 2HODB 3H1IG 5B66E 3MUDC 5APQA 3OW2O 3FWNA 3B5NA 4YPCA 4GIFA 3B4SA 3WUVA 2E75B 1AQ5A 1EQ7A 2OYHA 1T3UA 2LR2A 2GA1A 2XNXA 5KKZC 1H0TB 2WPSA 1BSHA 3KYQA 1L0LE 2Y0EA 1EDIA 4YTPC 1SQQG 1N73B 4EOTA 1SFCB 3GLMA 5TISE 1XTGB 3RK2C 2QSIA 3CMAP 4JF7A 4ZKUA 1T2KC 1FU1A 3L75G 3V2QA 2R5DA 3H1HE 1S1CX 1NKZB 1KYOE 3GHGB 3LW5H 1J1EC 1PPJG 1MV8A 1G2CB 1KFNA 1FBMA 3WU2H 1GDTA 2A45I 1PFIA 2N1TB 5CCGC 3JCUE 4D6TD 1NU1G 1OFCX 1JM0A 1JTHA 2ZYDA 3IN6A 1LNQA 1P84I 1L0LG 4OWFA 1MFTA 2E75D 4D6TG 5CBNA 1URQA 2A45G 2R3CA 2ZXXA 3BRVB 2QM7A 1CI6B 3AE1C 5E79E 4ASVA 1WMKA 1PP9E 2B87B 1KQFB 3BRTB 2NPSD 3VP9A 3VTPC 1QVGO 4U3FJ 3NFQA 1VQ4P 1YQ4C 1M90Q 1GL2B 1U7MA 1NOHA 2WPVB 3G6EP 1VQLP 3VN0A 1A02F 1VQ7P 3V2PA 3VOPA 2N1TC 3L73J 4KT0J 2Q3EA 4GDOA 1WT6A 1SQVG 3B5NB 1SQVE 1BCCJ 1URQD 3USSA 1L2PA 2A45H 4I2LC 4IL6H 4L75A 4WBAA 3M0AA 3A5TA 5B5EE 3RK2B 4EI2A 1S4XA 2W90A 2YMKA 2V7QH 1AJYA 3V2RA 3KXDA 1X22A 5AVTB 2OTLP 1IFDA 4GKGA 1MFZA 1RHZB 2QJPB 2QJPC 3PTZA 5APYA 1DH3A 3H1JJ 1SFCD 4W7ZA 2QJKC 2CPSA 1BCCD 3CCRP 3CC4P 1DD3A 3GHGA 1Q2NA 1SVFA 1KZUB 2R3SA 3K5BA 1GK6A 1HVVA 1KQGB 1PIXA 2K9JB 2J58A 3VMXA 3CCVP 4D6TJ 3CX5E 1OMIA 2SPZA 1IFIA 2OQQA 3OJAB 5B66H 2Q1KA 2NRGA 3D6ZA 1NTMD 2P1JA 5H2FE 1VQ6P 2WPRA 5AW9B 1FOSE 1RE3A 5KLVG 3M91A 3P7KA 1GL2A 1J1DB 2GUVA 3FGAD 3H1KJ 1DX7A 3H1HJ 3GW6A 1N8RQ 2E5YA 1LTTC 1T3JA 3AEAC 2WVRA 3VMAA 2H8PD 5GTIE 2QE7H 4Y99B 2R32A 2B88A 4HYTB 4KJMA 4WY4C 1P84H 1LP1A 2XNDH 4K35A 3D6YA 1JMMA 1SQBE 1ZR2A 3CLQA 2WSCH 3HRNA 3AE3C 5KLVE 4H0LD 1QL1A 3H1IJ 1HH0A 2OGUA 1OIPA 4N3YB 4BWNA 1YIJP 1IFNA 1WRGA 2YMYA 1KILE 1GW4A 3L36A 5TJHA 3PLNA 3P8MC 1SS1A 3LW5J 1HGVA 1P84E 1OVVA 3RK2D 1ZRTE 3BCCJ 3O8ZA 4PV1D 2W6AA 1NU1K 1NH4A 1T2KD 1IK9A 1RF1B 3HUSA 4GODA 1M1KQ 1RF1C 1EXJA 3ABVC 3GF7A 4XA4A 3V6IA 3H1LG 1IO4A 1EDJA 4PV1C 1VPCA 3G3ZA 3SFEC 1X9VA 2UWJE 1NTKD 1NTZG 1LTIC 2FFDC 1DEBA 2JDIH 3H1KD 1DEEG 3BCCD 1LT9A 4H13D 5KJ7A 1NTKJ 4DCKA 2QEXP 3H1HG 4WVZA 4XFJA 3T97B 2PGDA 4N6JA 1YITP 5CCHA 2KNCB 1QGKB 1IFPA 3C8VA 1NAFA 3VYIA 2ZVOB 1SQPG 2V4HA 1PL5A 2A06G 4GOEA 1ZXGA 3H1ID 2IBZE 2A06D 4JPZB 3TGUE 1K04A 5KLVK 1YJWP 2MKVA 3FXDA 5AW7B 2OYIC 2Z4EA 1BCCG 3KDPB 4IOIH 1KILC 2IYPA 1R5LA 4EDFA 1RQVA 2WTYA 1NJIQ 3RBXA 2QJKB 2OYIB 2FYNB 4GOFA 3L37A 1PV3A 3Q5PA 2Q3IA 1OXZA 2KSEA 2KS1A 3AE5C 4NPFX 1ZRTD 1KYOI 2G8YA 2K9JA 3V4WA 2D2CB 4DJGA 1USDA 1FDMA 1D7MA 1Y47A 1LT1A 1YJ9P 2YNYA 4PD4E 2RKLA 2KOGA 1PPJE 4UB6E 1VQPP 1M1JC 1VDFA 4XE5B 2JJLA 1S5LH 2AEMA 2BCCE 2J5UA 4C7NA 1QX8A 3TGUJ 5KAFE 1SLQA 2BASA 4NPEA 1N7LA 2WSSH 4OVNF 1NTZD 1NTKG 2FXPA 4HH2A 5BU5A 2QM8A 1VF5C 4UB6H 1PP9G 3RL0C 3TNUA 1H89A 2C9LY 2A06E 1GW3A 2W6BA 1S5LE 2E74C 1YBKA 1BDDA 2V7QJ 1IZNB 1BE3D 1LP1B 2K9YA 2P7JA 3KPEA 4I1LA 5AVSB 3SWKA 1T6AA 3OA7A 5AW6B 1SQPJ 3GG2A 1HTLC 2FY8A 2P58A 4GT1A 4C7RA 2OYHC 1EC5A 2KSJA 1DD4A 2E74D 3L70J 4PJ0E 2M3BA 4DZOA 2L91A 3ITKA 4I7ZC 4I6MC 5CJ4A 3AEFC 1KYOD 1KILD 4IL6X 4L74A 2KZJA 3H6PA 1VQOP 1M56D 2O01H 3RL0g 2HPCB 5APTA 2FFDA 1TU3F 2Y0CA 2W8ZA 2E74B 2KS1B 1NVOA 3FWLA 3L75J 3L73D 3PJSK 1SQXE 2RN0A 3QWOC 3L74E 1S9KE 3AE8C 3HUSC 3E1RA 3KZIH 3MTUE 4BRYA 1SQXD 1LT9C 1HUCA 2WT7A 4PV1B 1H8AA 2WSEH 3NXSA 4UB8E 1LT9B 2JEEA 1LWUB 2QJYB 2Z5IA 2Z5HA 5CHXA 3BCCG 1SQBJ 3CL3D 4H13C 3FXEA 1M1JB 3H32B 3I5CA 1T8ZA 2KUBA 2YXQB 3CWBE 1RQUA 1ZR4A 5CCGA 1PGJA 1AVOA 4W80A 4R4MA 2FYUJ 2BCCG 2BEQD 3WUTA 3SSUA 3UIAA 3II6A 2JKVA 3LIEA 1R8EA 5AW5B 4OH8B 1NO4A 3L73G 2C0XA 2I8DA 4PD4H 4TT3H 1JEKA 5DJUB 4EIJA 2ZJSE 1NTKE 1NGMB 2AXTE 4EYYQ 1PP9D 2WZ7A 1BGYD 2XKMA 2WITA 1JOCA 3F89A 4H44C 4H44B 1Q7YQ 1RE3C 2IFNA 5KJ7D 5APXA 1L0NK 3TSIA 3WUUA 1FZGA 3WU2E 5CCHC 3GF3A 2ZXEB 1L0LJ 2KYVA 3AEDC 4L73A 1GK4A 1FAVA 1ZOYC 3HTKA 3H1KG 4OGQD 1G1IA 1ZV8A 1FE6A 3L71J 1S5LX 3M9QA 1KV4A 2IZ0A 2WSFJ 2WMMA 3Q1MA 2YO2A 1JCCA 2Y9ZA 3CPWO 3H1JE 2H88C 2QIWA 1K05A 3RBZA 4PD4I 3LIDA 4JQ0D 2K3RA 1HBWA 4CPGA 2Q6QA 1NTMJ 4W7YA 1BGYG 1JY3N 1AA0A 2M8RA 3AEGC 4RKUJ 2E5TA 1FZEA 1YQ3C 4AQRD 4C46A 2OYIA 1NTKK 1EDLA 1NTZE 2HODA 4H0LC 3TGUG 2M5AA 4L76A 1PGQA 3KZIE 3TF5A 1MZ9A 2G3AA 3CI9A 4D6TE 2IX7C 3CWBJ 5AVWB 1A02J 1PPJD 3SWFA 1NYHA 1SP4A 3C9IA 2YKQA 1H0TA 3WMM0 3H1JD 3CWBD 3IR9A 4TLFA 2FYUE 2QG4A 1FJKA 3PHLA 4I7ZB 1OVUA 3CXHI 4RO0A 5AW2B 2AEFA 3CX5H 2IDBA 1FZCB 2FBWC 2IPPA 5KLVD 5CJ0A 4UB8H 3IF4A 3G4SP 5H2FH 2KB7P 2O01N 4B86A 4IFDK 1URQC 3HUSB 2WT7B 3H1LD 1KC8Q 1K8AQ 3G71P 1CZQA 1JTHB 5APWA 3AE4C 3R4YA 2N1TD 2W6JH 1GD2E 1M1JA 2XU6A 2IBZD 4N78D 4DOJA 3TGUD 1FC2C 2B87A 3G9RA 4OGQC 2WPQA 1L4AD 2ZYAA 3L75E 5AW3B 3MIWA 3M9BA 2E76B 3HD7B 3HE4A 1SQVK 4K3AA 1KQSO 4DT0A 3VMYA 2Q5UA 1OX3A 2HR3A 1OW8A 1QLED 3GHGC 2AXTH 3M06A 1KD1Q 3CC2P 1GMJA 2KNCA 5AVZB 1SQQJ 5AW4B 2OTKE 2YKPA 2P2UA 2GM4A 2J59M 3JSVC 1BE3G 1NTZK 3E7KA 3L4FA 1K9MQ 1E79H 1W2EA 2OTJP 5DJTB 1OZHA 1KFMA 1LTJB 1VL2A 2FXMA 1JY3O 1JMBA 2ZAEB 3BASA 2BCCJ 5KLIC 3S9OA 5CBOA 1KILB 1YTZI 2IFMA 4LLHA 3KHUA 5KAFH 1SQQD 1ZLLA 2GUSA 3HTKB 4HJGH 2E76D 3HD7D 1VQMP 1RE4C 2ZYGA 3CXHE 2NPSA 3AE2C 3MP7B 3B5NC 4YXWH 5BVZA 3HE5A 1J1DC 1P84D 5APVA 1BDCA 1EZVE 1EZVG 1FOSF 2BEZF 3CCUP 1CI6A 1JO5A 1RY3A 3QH9A 3EFGA 2K37A 3L72G 3CMEP 5KAIH 3CCMP 1SQBD 3MD0A 1SQPK 5CCGD 3D71A 3Q2YA 2M0BA 3CWBG 3P8CE 3Q5SA 1RF0A 1BGYE 4M3LA 2AEJA 1X8YA 4WY4D 1SQXK 3P8CD 2LXBA 1KN7A 2Y9YA 1ZMEC 5KLVJ 2IBZG 3B8EB 1FZCC 4RESB 1NU1J 3L74G 2FYUK 1LGHB 2BCCD 1EZVD 1LTAC 4U7JA 4IFFA 1BGYJ 1OWAA 1LTSC 4WY4A 3CX5D 3RL0D 1YTZT 1NTZJ 3H1HD 3A3YB 1JY2N 3PRJA 3CCJP 1KILA 4KHXA 2RH0A 2JWAA 2N9YB 4ZNCA 2HPCA 2FFDB 1IC2A 1JY3P 4H0LB 3S4RA 2ZVNB 3AE6C 4AYCA 4RJTA 1USEA 1KORA 1Y8AA 1CW5A 3L70E 1BCCE 3L70G 2H7HA 1RH5B 2P67A 2WQYC 2H89C 1KQLA 3EQ2A 4BRYB 2KLUA 1HJ0A 1L0ND 2P10A 2W83C 3U59A 2H43A 1NU1E 3L73E 1GTWA 1SQPE 3PP5A 2QVAA 3TYYA 1OW7A 1YHQP 3JC22 3HD7A 3HE4B 1HF9A 2O1JA 1S3JA 3H1IE 5KJ7C 3H32A 2XZRA 4LGDE 1AFOA 2D2CC 1IK7A 2IYOA 3L75D 1BSNA 3F5HA 5EFWB 1NWQA 4ZKPA 1L0LD 1JCDA 2KIKA 5AVXB 3RK3C 2R5BA 4JYBA 1EXIA 1JB0J 5GTHE 1SQXJ 1BE3E 2OYHB 3MZWB 1E5WA 3H1LE 4Z1MH 3H1KE 5AW1B 3L70D 1N73C 1N7SD 3CXHH 1AQTA 2YIUB 2JO1A 1LTJC 3TK1A 2CPBA 5K5GB 3KQGA 3CCSP 2ZT9C 1GU5A 3O6QA 1J1EB 2NPSB 1Z56A
chains in the Genus database with same CATH topology
3JCUH 5KAFH 2AXTH 4IL6H 4PJ0H 4UB6H 5B66H 5GTHH 1S5LH 5TISH 3WU2H 5GTIH 3KZIH 3A0HH 5E79H 4UB8H 5KAIH 5H2FH 5B5EH 3A0BH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCU H;  5KAF H;  2AXT H;  4IL6 H;  4PJ0 H;  4UB6 H;  5B66 H;  5GTH H;  1S5L H;  5TIS H;  3WU2 H;  5GTI H;  3KZI H;  3A0H H;  5E79 H;  4UB8 H;  5KAI H;  5H2F H;  5B5E H;  3A0B H; 
#chains in the Genus database with same CATH topology
 2KZI A;  1KB9 H;  3HE5 B;  3GMA A;  1BE3 J;  1FDO A;  1NTM G;  2YKO A;  4U3F E;  1FJP A;  2N1T A;  3CCQ P;  2C9N Y;  1W5C E;  1EDK A;  2QRX A;  1FZA A;  2YXR B;  3C1L A;  2WSC J;  3M0D A;  3MGN A;  1VQ5 P;  4Y28 J;  2FYZ A;  1GU4 A;  1FS0 E;  3B5N D;  3H25 A;  1KB9 E;  1QEX A;  5APU A;  3L71 G;  1JY2 O;  1IFM A;  4MN4 C;  4OGQ B;  3A0B H;  2DW3 A;  1GL2 C;  5AVV B;  5APS A;  1M57 D;  1RE4 A;  1S2E A;  3U1A A;  1KB9 I;  1U7J A;  2L5G B;  2ZT9 B;  4WB4 A;  5L8R J;  3L35 A;  1KYO H;  5AW8 B;  1IJD B;  2POH A;  2FYU G;  3A7O A;  2FYN C;  3A0H H;  3NMD A;  5AVR B;  4IFM A;  3TDK A;  1W2B O;  3A2A A;  3IAO A;  3JCU H;  4WWI A;  3L72 E;  3RK3 D;  1FZF A;  2HYN A;  2R44 A;  4JYC A;  1HGZ A;  1MUU A;  1JNM A;  4ASW A;  5GTI H;  5E79 H;  1SQV D;  1SQX G;  3RK3 B;  2JWD A;  3R2P A;  2D2C D;  1PZQ A;  3ZDM A;  4N78 E;  2I1J A;  1NKN A;  1NTM E;  2O01 J;  5C39 A;  3V5B A;  1QL2 A;  1UIX A;  3FX0 A;  2FXO A;  4YXD C;  3U1C A;  1VQN P;  1ZW0 A;  2W27 A;  5TIS H;  2I1K A;  1SFC C;  2JP3 A;  1FZC A;  2HFE D;  1OVR A;  2RMZ A;  4LC1 A;  1VF5 B;  3MUD A;  4PJ0 H;  5AVQ B;  3Q5R A;  3RL0 B;  2LXC B;  1Q81 Q;  3S1K A;  3CCE P;  3AEC C;  1N86 A;  1M8O B;  2VRS A;  1Q82 Q;  1AVY A;  5AVU B;  2XV5 A;  3V2N A;  3M0D C;  3VMZ A;  1QVF O;  1SQQ K;  4AUW A;  1L0N G;  5BU8 B;  1ZP0 C;  3CD6 P;  4C7N B;  2KK7 A;  2KLV A;  3NTN A;  3OAK A;  3I55 P;  2PAJ A;  4R4L A;  3N7N A;  1GZL A;  1GL2 D;  4U3F D;  4H13 B;  2JR8 A;  5AW0 B;  1JY2 P;  2B89 A;  3V4Q A;  2QA4 P;  3TNU B;  1NHL A;  2K1A A;  2M3E A;  2OYO A;  1L0N J;  1N7S B;  1SQB K;  2ITA A;  2K88 A;  1SQP D;  2NPS C;  2O3J A;  2XDJ A;  3N4X A;  2N9B A;  4JBZ A;  1HWT C;  1R5S A;  3W68 A;  2IBZ I;  1LTG C;  4BXL A;  2E75 C;  1IFJ A;  2PP6 A;  2YIU C;  4IL6 E;  4Y99 C;  1CSB A;  3HD7 C;  3L74 D;  5B5E H;  1XTC C;  5CCH D;  1DIP A;  3O6Q B;  1LTJ A;  3B71 A;  1PGP A;  1KB9 D;  2ZT9 D;  3RGU A;  1N73 A;  1SFC A;  3M9H A;  3SWY A;  1L4A B;  2KP8 A;  2FYU D;  3W67 A;  1PP9 J;  1N7S C;  2AXC A;  1NAY A;  2E76 C;  3AEE C;  2CK3 H;  2YO3 A;  3EFF K;  1X0T A;  2WSF H;  2ZFC A;  3CXH D;  3H1J G;  1NTM K;  3A0B E;  1ZN5 A;  5KTB A;  1G2C A;  3BAT A;  1Q86 Q;  1K73 Q;  1RF1 A;  1L0N E;  1VQ8 P;  1SQQ E;  2KI7 B;  1HJB A;  1OW6 A;  3BVH A;  2NZ2 A;  1LWU A;  2B9B A;  3Q3D A;  2Q7C A;  1LWU C;  2QJY C;  2Q9I A;  1U57 A;  2HLO A;  3PH0 A;  1YJN P;  1UII A;  1Q90 D;  5KLI B;  2KXP B;  3T97 A;  4ZMD A;  2IZ1 A;  3IFM A;  5CMZ A;  3SFD C;  1N7S A;  1J2J B;  1KMI Z;  4QMA A;  2FKW B;  3CC7 P;  3L71 E;  3P32 A;  4PD4 D;  5GTH H;  2OAR A;  2M5A B;  3AE7 C;  3RK3 E;  3D70 A;  1YI2 P;  4NPD A;  1YYC A;  2PRR A;  3VP8 A;  1L0L K;  1L4A C;  1NU1 D;  3AE9 C;  4WY4 B;  5KKZ B;  2E43 A;  5AVY B;  3L74 J;  1RF0 C;  2WSE J;  1G1J A;  3AEB C;  4HKZ H;  4O9B A;  1AV1 A;  1FDI A;  1L4A A;  3I56 P;  1JUN A;  5KAI E;  1SQV J;  4HB1 A;  1Y9B A;  2HG5 D;  1S9K D;  1N2D C;  3CCL P;  2C0W A;  3L72 J;  1MKM A;  1URQ B;  1S72 P;  1EZV I;  1VQ9 P;  1KTM A;  1VF5 D;  1LJ2 A;  2LKM A;  1PGO A;  3E1I A;  4A7P A;  3MHV A;  1M7L A;  4U3F G;  2MJZ A;  2PFX A;  3H1L J;  5M1B A;  3EWK A;  1LTB C;  1H88 A;  2WWW A;  3CX5 I;  1FZB A;  1VQK P;  1X79 B;  4H44 D;  2O1K A;  1SQB G;  3A0H E;  3L71 D;  2Y0D A;  3BCC E;  2E42 A;  3L72 D;  2HOD B;  3H1I G;  5B66 E;  3MUD C;  5APQ A;  3OW2 O;  3FWN A;  3B5N A;  4YPC A;  4GIF A;  3B4S A;  3WUV A;  2E75 B;  1AQ5 A;  1EQ7 A;  2OYH A;  1T3U A;  2LR2 A;  2GA1 A;  2XNX A;  5KKZ C;  1H0T B;  2WPS A;  1BSH A;  3KYQ A;  1L0L E;  2Y0E A;  1EDI A;  4YTP C;  1SQQ G;  1N73 B;  4EOT A;  1SFC B;  3GLM A;  5TIS E;  1XTG B;  3RK2 C;  2QSI A;  3CMA P;  4JF7 A;  4ZKU A;  1T2K C;  1FU1 A;  3L75 G;  3V2Q A;  2R5D A;  3H1H E;  1S1C X;  1NKZ B;  1KYO E;  3GHG B;  3LW5 H;  1J1E C;  1PPJ G;  1MV8 A;  1G2C B;  1KFN A;  1FBM A;  3WU2 H;  1GDT A;  2A45 I;  1PFI A;  2N1T B;  5CCG C;  3JCU E;  4D6T D;  1NU1 G;  1OFC X;  1JM0 A;  1JTH A;  2ZYD A;  3IN6 A;  1LNQ A;  1P84 I;  1L0L G;  4OWF A;  1MFT A;  2E75 D;  4D6T G;  5CBN A;  1URQ A;  2A45 G;  2R3C A;  2ZXX A;  3BRV B;  2QM7 A;  1CI6 B;  3AE1 C;  5E79 E;  4ASV A;  1WMK A;  1PP9 E;  2B87 B;  1KQF B;  3BRT B;  2NPS D;  3VP9 A;  3VTP C;  1QVG O;  4U3F J;  3NFQ A;  1VQ4 P;  1YQ4 C;  1M90 Q;  1GL2 B;  1U7M A;  1NOH A;  2WPV B;  3G6E P;  1VQL P;  3VN0 A;  1A02 F;  1VQ7 P;  3V2P A;  3VOP A;  2N1T C;  3L73 J;  4KT0 J;  2Q3E A;  4GDO A;  1WT6 A;  1SQV G;  3B5N B;  1SQV E;  1BCC J;  1URQ D;  3USS A;  1L2P A;  2A45 H;  4I2L C;  4IL6 H;  4L75 A;  4WBA A;  3M0A A;  3A5T A;  5B5E E;  3RK2 B;  4EI2 A;  1S4X A;  2W90 A;  2YMK A;  2V7Q H;  1AJY A;  3V2R A;  3KXD A;  1X22 A;  5AVT B;  2OTL P;  1IFD A;  4GKG A;  1MFZ A;  1RHZ B;  2QJP B;  2QJP C;  3PTZ A;  5APY A;  1DH3 A;  3H1J J;  1SFC D;  4W7Z A;  2QJK C;  2CPS A;  1BCC D;  3CCR P;  3CC4 P;  1DD3 A;  3GHG A;  1Q2N A;  1SVF A;  1KZU B;  2R3S A;  3K5B A;  1GK6 A;  1HVV A;  1KQG B;  1PIX A;  2K9J B;  2J58 A;  3VMX A;  3CCV P;  4D6T J;  3CX5 E;  1OMI A;  2SPZ A;  1IFI A;  2OQQ A;  3OJA B;  5B66 H;  2Q1K A;  2NRG A;  3D6Z A;  1NTM D;  2P1J A;  5H2F E;  1VQ6 P;  2WPR A;  5AW9 B;  1FOS E;  1RE3 A;  5KLV G;  3M91 A;  3P7K A;  1GL2 A;  1J1D B;  2GUV A;  3FGA D;  3H1K J;  1DX7 A;  3H1H J;  3GW6 A;  1N8R Q;  2E5Y A;  1LTT C;  1T3J A;  3AEA C;  2WVR A;  3VMA A;  2H8P D;  5GTI E;  2QE7 H;  4Y99 B;  2R32 A;  2B88 A;  4HYT B;  4KJM A;  4WY4 C;  1P84 H;  1LP1 A;  2XND H;  4K35 A;  3D6Y A;  1JMM A;  1SQB E;  1ZR2 A;  3CLQ A;  2WSC H;  3HRN A;  3AE3 C;  5KLV E;  4H0L D;  1QL1 A;  3H1I J;  1HH0 A;  2OGU A;  1OIP A;  4N3Y B;  4BWN A;  1YIJ P;  1IFN A;  1WRG A;  2YMY A;  1KIL E;  1GW4 A;  3L36 A;  5TJH A;  3PLN A;  3P8M C;  1SS1 A;  3LW5 J;  1HGV A;  1P84 E;  1OVV A;  3RK2 D;  1ZRT E;  3BCC J;  3O8Z A;  4PV1 D;  2W6A A;  1NU1 K;  1NH4 A;  1T2K D;  1IK9 A;  1RF1 B;  3HUS A;  4GOD A;  1M1K Q;  1RF1 C;  1EXJ A;  3ABV C;  3GF7 A;  4XA4 A;  3V6I A;  3H1L G;  1IO4 A;  1EDJ A;  4PV1 C;  1VPC A;  3G3Z A;  3SFE C;  1X9V A;  2UWJ E;  1NTK D;  1NTZ G;  1LTI C;  2FFD C;  1DEB A;  2JDI H;  3H1K D;  1DEE G;  3BCC D;  1LT9 A;  4H13 D;  5KJ7 A;  1NTK J;  4DCK A;  2QEX P;  3H1H G;  4WVZ A;  4XFJ A;  3T97 B;  2PGD A;  4N6J A;  1YIT P;  5CCH A;  2KNC B;  1QGK B;  1IFP A;  3C8V A;  1NAF A;  3VYI A;  2ZVO B;  1SQP G;  2V4H A;  1PL5 A;  2A06 G;  4GOE A;  1ZXG A;  3H1I D;  2IBZ E;  2A06 D;  4JPZ B;  3TGU E;  1K04 A;  5KLV K;  1YJW P;  2MKV A;  3FXD A;  5AW7 B;  2OYI C;  2Z4E A;  1BCC G;  3KDP B;  4IOI H;  1KIL C;  2IYP A;  1R5L A;  4EDF A;  1RQV A;  2WTY A;  1NJI Q;  3RBX A;  2QJK B;  2OYI B;  2FYN B;  4GOF A;  3L37 A;  1PV3 A;  3Q5P A;  2Q3I A;  1OXZ A;  2KSE A;  2KS1 A;  3AE5 C;  4NPF X;  1ZRT D;  1KYO I;  2G8Y A;  2K9J A;  3V4W A;  2D2C B;  4DJG A;  1USD A;  1FDM A;  1D7M A;  1Y47 A;  1LT1 A;  1YJ9 P;  2YNY A;  4PD4 E;  2RKL A;  2KOG A;  1PPJ E;  4UB6 E;  1VQP P;  1M1J C;  1VDF A;  4XE5 B;  2JJL A;  1S5L H;  2AEM A;  2BCC E;  2J5U A;  4C7N A;  1QX8 A;  3TGU J;  5KAF E;  1SLQ A;  2BAS A;  4NPE A;  1N7L A;  2WSS H;  4OVN F;  1NTZ D;  1NTK G;  2FXP A;  4HH2 A;  5BU5 A;  2QM8 A;  1VF5 C;  4UB6 H;  1PP9 G;  3RL0 C;  3TNU A;  1H89 A;  2C9L Y;  2A06 E;  1GW3 A;  2W6B A;  1S5L E;  2E74 C;  1YBK A;  1BDD A;  2V7Q J;  1IZN B;  1BE3 D;  1LP1 B;  2K9Y A;  2P7J A;  3KPE A;  4I1L A;  5AVS B;  3SWK A;  1T6A A;  3OA7 A;  5AW6 B;  1SQP J;  3GG2 A;  1HTL C;  2FY8 A;  2P58 A;  4GT1 A;  4C7R A;  2OYH C;  1EC5 A;  2KSJ A;  1DD4 A;  2E74 D;  3L70 J;  4PJ0 E;  2M3B A;  4DZO A;  2L91 A;  3ITK A;  4I7Z C;  4I6M C;  5CJ4 A;  3AEF C;  1KYO D;  1KIL D;  4IL6 X;  4L74 A;  2KZJ A;  3H6P A;  1VQO P;  1M56 D;  2O01 H;  3RL0 g;  2HPC B;  5APT A;  2FFD A;  1TU3 F;  2Y0C A;  2W8Z A;  2E74 B;  2KS1 B;  1NVO A;  3FWL A;  3L75 J;  3L73 D;  3PJS K;  1SQX E;  2RN0 A;  3QWO C;  3L74 E;  1S9K E;  3AE8 C;  3HUS C;  3E1R A;  3KZI H;  3MTU E;  4BRY A;  1SQX D;  1LT9 C;  1HUC A;  2WT7 A;  4PV1 B;  1H8A A;  2WSE H;  3NXS A;  4UB8 E;  1LT9 B;  2JEE A;  1LWU B;  2QJY B;  2Z5I A;  2Z5H A;  5CHX A;  3BCC G;  1SQB J;  3CL3 D;  4H13 C;  3FXE A;  1M1J B;  3H32 B;  3I5C A;  1T8Z A;  2KUB A;  2YXQ B;  3CWB E;  1RQU A;  1ZR4 A;  5CCG A;  1PGJ A;  1AVO A;  4W80 A;  4R4M A;  2FYU J;  2BCC G;  2BEQ D;  3WUT A;  3SSU A;  3UIA A;  3II6 A;  2JKV A;  3LIE A;  1R8E A;  5AW5 B;  4OH8 B;  1NO4 A;  3L73 G;  2C0X A;  2I8D A;  4PD4 H;  4TT3 H;  1JEK A;  5DJU B;  4EIJ A;  2ZJS E;  1NTK E;  1NGM B;  2AXT E;  4EYY Q;  1PP9 D;  2WZ7 A;  1BGY D;  2XKM A;  2WIT A;  1JOC A;  3F89 A;  4H44 C;  4H44 B;  1Q7Y Q;  1RE3 C;  2IFN A;  5KJ7 D;  5APX A;  1L0N K;  3TSI A;  3WUU A;  1FZG A;  3WU2 E;  5CCH C;  3GF3 A;  2ZXE B;  1L0L J;  2KYV A;  3AED C;  4L73 A;  1GK4 A;  1FAV A;  1ZOY C;  3HTK A;  3H1K G;  4OGQ D;  1G1I A;  1ZV8 A;  1FE6 A;  3L71 J;  1S5L X;  3M9Q A;  1KV4 A;  2IZ0 A;  2WSF J;  2WMM A;  3Q1M A;  2YO2 A;  1JCC A;  2Y9Z A;  3CPW O;  3H1J E;  2H88 C;  2QIW A;  1K05 A;  3RBZ A;  4PD4 I;  3LID A;  4JQ0 D;  2K3R A;  1HBW A;  4CPG A;  2Q6Q A;  1NTM J;  4W7Y A;  1BGY G;  1JY3 N;  1AA0 A;  2M8R A;  3AEG C;  4RKU J;  2E5T A;  1FZE A;  1YQ3 C;  4AQR D;  4C46 A;  2OYI A;  1NTK K;  1EDL A;  1NTZ E;  2HOD A;  4H0L C;  3TGU G;  2M5A A;  4L76 A;  1PGQ A;  3KZI E;  3TF5 A;  1MZ9 A;  2G3A A;  3CI9 A;  4D6T E;  2IX7 C;  3CWB J;  5AVW B;  1A02 J;  1PPJ D;  3SWF A;  1NYH A;  1SP4 A;  3C9I A;  2YKQ A;  1H0T A;  3WMM 0;  3H1J D;  3CWB D;  3IR9 A;  4TLF A;  2FYU E;  2QG4 A;  1FJK A;  3PHL A;  4I7Z B;  1OVU A;  3CXH I;  4RO0 A;  5AW2 B;  2AEF A;  3CX5 H;  2IDB A;  1FZC B;  2FBW C;  2IPP A;  5KLV D;  5CJ0 A;  4UB8 H;  3IF4 A;  3G4S P;  5H2F H;  2KB7 P;  2O01 N;  4B86 A;  4IFD K;  1URQ C;  3HUS B;  2WT7 B;  3H1L D;  1KC8 Q;  1K8A Q;  3G71 P;  1CZQ A;  1JTH B;  5APW A;  3AE4 C;  3R4Y A;  2N1T D;  2W6J H;  1GD2 E;  1M1J A;  2XU6 A;  2IBZ D;  4N78 D;  4DOJ A;  3TGU D;  1FC2 C;  2B87 A;  3G9R A;  4OGQ C;  2WPQ A;  1L4A D;  2ZYA A;  3L75 E;  5AW3 B;  3MIW A;  3M9B A;  2E76 B;  3HD7 B;  3HE4 A;  1SQV K;  4K3A A;  1KQS O;  4DT0 A;  3VMY A;  2Q5U A;  1OX3 A;  2HR3 A;  1OW8 A;  1QLE D;  3GHG C;  2AXT H;  3M06 A;  1KD1 Q;  3CC2 P;  1GMJ A;  2KNC A;  5AVZ B;  1SQQ J;  5AW4 B;  2OTK E;  2YKP A;  2P2U A;  2GM4 A;  2J59 M;  3JSV C;  1BE3 G;  1NTZ K;  3E7K A;  3L4F A;  1K9M Q;  1E79 H;  1W2E A;  2OTJ P;  5DJT B;  1OZH A;  1KFM A;  1LTJ B;  1VL2 A;  2FXM A;  1JY3 O;  1JMB A;  2ZAE B;  3BAS A;  2BCC J;  5KLI C;  3S9O A;  5CBO A;  1KIL B;  1YTZ I;  2IFM A;  4LLH A;  3KHU A;  5KAF H;  1SQQ D;  1ZLL A;  2GUS A;  3HTK B;  4HJG H;  2E76 D;  3HD7 D;  1VQM P;  1RE4 C;  2ZYG A;  3CXH E;  2NPS A;  3AE2 C;  3MP7 B;  3B5N C;  4YXW H;  5BVZ A;  3HE5 A;  1J1D C;  1P84 D;  5APV A;  1BDC A;  1EZV E;  1EZV G;  1FOS F;  2BEZ F;  3CCU P;  1CI6 A;  1JO5 A;  1RY3 A;  3QH9 A;  3EFG A;  2K37 A;  3L72 G;  3CME P;  5KAI H;  3CCM P;  1SQB D;  3MD0 A;  1SQP K;  5CCG D;  3D71 A;  3Q2Y A;  2M0B A;  3CWB G;  3P8C E;  3Q5S A;  1RF0 A;  1BGY E;  4M3L A;  2AEJ A;  1X8Y A;  4WY4 D;  1SQX K;  3P8C D;  2LXB A;  1KN7 A;  2Y9Y A;  1ZME C;  5KLV J;  2IBZ G;  3B8E B;  1FZC C;  4RES B;  1NU1 J;  3L74 G;  2FYU K;  1LGH B;  2BCC D;  1EZV D;  1LTA C;  4U7J A;  4IFF A;  1BGY J;  1OWA A;  1LTS C;  4WY4 A;  3CX5 D;  3RL0 D;  1YTZ T;  1NTZ J;  3H1H D;  3A3Y B;  1JY2 N;  3PRJ A;  3CCJ P;  1KIL A;  4KHX A;  2RH0 A;  2JWA A;  2N9Y B;  4ZNC A;  2HPC A;  2FFD B;  1IC2 A;  1JY3 P;  4H0L B;  3S4R A;  2ZVN B;  3AE6 C;  4AYC A;  4RJT A;  1USE A;  1KOR A;  1Y8A A;  1CW5 A;  3L70 E;  1BCC E;  3L70 G;  2H7H A;  1RH5 B;  2P67 A;  2WQY C;  2H89 C;  1KQL A;  3EQ2 A;  4BRY B;  2KLU A;  1HJ0 A;  1L0N D;  2P10 A;  2W83 C;  3U59 A;  2H43 A;  1NU1 E;  3L73 E;  1GTW A;  1SQP E;  3PP5 A;  2QVA A;  3TYY A;  1OW7 A;  1YHQ P;  3JC2 2;  3HD7 A;  3HE4 B;  1HF9 A;  2O1J A;  1S3J A;  3H1I E;  5KJ7 C;  3H32 A;  2XZR A;  4LGD E;  1AFO A;  2D2C C;  1IK7 A;  2IYO A;  3L75 D;  1BSN A;  3F5H A;  5EFW B;  1NWQ A;  4ZKP A;  1L0L D;  1JCD A;  2KIK A;  5AVX B;  3RK3 C;  2R5B A;  4JYB A;  1EXI A;  1JB0 J;  5GTH E;  1SQX J;  1BE3 E;  2OYH B;  3MZW B;  1E5W A;  3H1L E;  4Z1M H;  3H1K E;  5AW1 B;  3L70 D;  1N73 C;  1N7S D;  3CXH H;  1AQT A;  2YIU B;  2JO1 A;  1LTJ C;  3TK1 A;  2CPB A;  5K5G B;  3KQG A;  3CCS P;  2ZT9 C;  1GU5 A;  3O6Q A;  1J1E B;  2NPS B;  1Z56 A; 
#chains in the Genus database with same CATH homology
 3JCU H;  5KAF H;  2AXT H;  4IL6 H;  4PJ0 H;  4UB6 H;  5B66 H;  5GTH H;  1S5L H;  5TIS H;  3WU2 H;  5GTI H;  3KZI H;  3A0H H;  5E79 H;  4UB8 H;  5KAI H;  5H2F H;  5B5E H;  3A0B H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...