4IL6Z

Structure of sr-substituted photosystem ii
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
61
structure length
61
Chain Sequence
TILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Structure of Sr-substituted photosystem II at 2.1 A resolution and its implications in the mechanism of water oxidation
pubmed doi rcsb
molecule tags Electron transport
total genus 24
structure length 61
sequence length 61
chains with identical sequence z
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 4il6Z00
4UB8Z 5KAFZ 5E79Z 5B5EZ 5H2FZ 3KZIZ 4IL6Z 4UB6Z 3A0HZ 5KAIZ 5B66Z 3JCUZ 5TISZ 2AXTZ 4PJ0Z 3WU2Z 3A0BZ 1S5LZ 5GTIZ 5GTHZ
chains in the Genus database with same CATH superfamily
3ZRWA 3DGEA 3ABMB 3VQXA 4EKWA 3E89A 5L3EA 2W0XA 4IHJA 4MSWC 2CK3G 1Q6UA 3X2QC 2NN4A 3L74H 3DXRA 3SJCC 5J9PC 3VBBA 4FZ1A 3GVMA 2IBZH 3RYFB 1Q6IA 2H8PC 4GT1A 5D5QA 3MD0A 2DN9A 1TVKB 5B1BB 2G38A 5IWAO 4X62O 1XMOO 1PV0A 1PP9H 2B5UA 3OEEG 4HZ3A 2ZNIA 1QHTA 3K58A 1UPGA 3MHSC 5KAIZ 3JAMN 3S3WA 3K9AA 3ASOC 2F1MA 3E22A 4GKKB 5EIBD 1QLNA 1GKFA 1D5AA 4X64O 4N23A 3ZIAG 2JGUA 3MHHC 4F4LA 1IDSA 1KKDA 4NTYA 3NR7A 3QNEA 2DOSA 2GDSA 3MDSA 3BY6A 2LO1A 1DK1A 2IJJA 4X88A 2CUGA 1SQFA 5LYJA 5B1NA 1AR5A 2YI9A 2Q7GA 1XEQA 3JARA 4YJ3B 5JJEB 2ARHA 2IW5A 4P9PA 2QE7G 3BA9A 1YXBA 2V7QG 3D36A 2VQFB 1JPXA 2E76B 1WP8A 4JPRA 5A9GA 1Y74B 2L6LA 4QE7A 1IBLO 1NR1A 2YICA 1ENVA 5DM6V 3QVNA 5CMUA 2F93B 3CRAA 3WU2Z 2IJIA 3BAAA 5JJNB 3RBZA 4PV1B 5IWAB 5BR8B 4AHCA 4K3AA 4X62B 1LNQA 1VQOV 3H1HH 1K92A 2PGGA 3ASNC 3ZRVA 1KQSU 4OX9O 2WA3A 4R8CA 3RGBA 2CTWA 2P90A 1S77D 3CCRV 1K4DC 5BZBA 3ETEA 1OCZB 1JOYA 1PKXA 2Q4PA 1WA8B 4LC1A 1URFA 1WNSA 2QWPB 1W0KG 3OTFA 4FLWA 3AG1B 2R9RB 3ZS8C 4UV9A 2JGDB 4MW3A 2OT5A 5EK0A 4BW5A 1MOFA 5H6RA 1VQ7V 1M4UA 5LP6A 4H13B 4O2BB 2KSDA 2W6JG 1TUBB 4GUNA 1WPXA 4FM1A 5LHGA 4I50B 2N74A 4X65O 2JDIG 3B40A 3EXAA 2EINB 2YEVB 2ADPA 3G71V 1IBLB 1JVMA 4JI1B 1BS3A 5H9CA 1VQMV 3G80A 1OJHA 2D2CB 4JI2O 2UXBO 5BMVB 2HEPA 2Q8VA 2Y48A 1E1RG 4PA6A 4CS3A 1COWG 2X0LA 1F23A 3RYHA 2PTMA 2OIGA 4NXNO 1ORQC 4OX9B 1BSMA 2P4KA 4LF5B 3QO7A 3SPCA 2ITCC 1AR4A 4FLUA 2QWRB 4KUMA 4TUYA 4JI0O 4MVQA 2CAZC 1NU1H 4JAVA 4PA9A 1PL4A 2A3QA 1NQTA 2YI8A 1JFFA 4JV5B 4I4TB 5BY1A 2FMLA 2JEXA 3OUSA 3HB3B 5H6QA 4FFBB 3RWRD 1GM9A 1K7DA 1N4CA 1YHQV 4JYBA 4B7KA 3EVKA 1F4NA 4CC6A 1ZUQA 4B08A 1PPJH 3LDCA 4Z2WA 1YI2V 4J42A 4X65B 4E4EA 1MA1A 1B3QA 1CXZB 1L0NH 1MG1A 2B1GA 1HNZB 3BVOA 3M7MX 3JAWB 5KX5A 1Y76A 4UB6Z 3CC7V 3D8CA 4QPKA 1AJQA 3WB2A 3JD4A 1LR1A 4JI2B 2UXBB 2JK5C 4TV9A 1QBZA 2Y0IA 1SKVA 1H38A 1EN4A 5JVDB 4NXNB 3B4SA 3OMIB 2Y4TA 2YXYA 4X8AA 3CE2A 4DR7B 4JI0B 1IBKO 3U10A 1BL8A 2YDEA 2ZD9A 2ZT9B 1M9NA 3SPJA 1OCRC 4TOIA 1XUQA 1NS1A 1XNQB 4DV1O 5EC1C 2Z3YA 1N33O 4LFBO 3K0DA 4NKGB 3ZRXA 1HR0O 2E75B 3CCMV 2DQ3A 2RDCA 3AG2B 4OXSA 1GN2A 2YIAA 1M56B 3B8MA 2IU0A 4FLTA 3K79A 4MTOA 3JALB 1CPYA 4G27B 3K04A 2HVKC 4ZOLB 3TJTA 4TSFG 2X6AA 3J80N 3KKYA 3IAYA 4DR1O 2Q67A 3CMEV 1XNRB 4YHHO 1NZ6A 2LFRA 3QO8A 3H1KH 3OR7C 4G28B 4LF8O 1M57B 3SPGA 1JMKC 2R72A 4FFKA 1V54B 4E2LA 2M7WA 1P4RA 3UM7A 1SF9A 1V9PA 3ABLB 1WLEA 4ZHQB 3ZJZA 5CA0B 1IBKB 2VRZA 5GONA 5HFLA 2PYLA 4G2KA 3Q4HB 1WB7A 2Q5ZA 3LNMB 1NTKH 1YVWA 4DK0A 1KBHA 4TT3G 1VARA 5JQGB 4JI3O 4DV1B 4TV8B 1N33B 1YJ9V 1V55B 5GTIZ 1G6UA 5KAFZ 2OCHA 5B3SB 1NTMH 3JATA 1XREA 2H94A 4PI2A 2WLIA 1HP8A 3UO2A 2KG7B 2M6YA 2B9ZA 2BOCC 1P84F 3BRCA 2CDYA 2IU3A 4YXWG 1GMGA 3TK1A 1X4TA 4RUEA 1RSOB 5FL7G 1YTFD 3A0BZ 2ETNA 3DTUB 1R3LC 5JCOA 3TGUH 2XAFA 2BE3A 4CH3A 2AHZA 3RT3C 2CTPA 1FS0G 5B1BC 4UV8A 1OCOB 2CGNA 4MVSA 2V1DA 2YIDA 2FKXA 2MW2B 4CH4A 5IYDO 3CHXA 3P30A 4O4JB 4CC5A 1Y6XA 4A5UB 4LF8B 5FPOA 2EJRA 4IYIA 2AZ0A 1SERA 4DV3B 3FD9A 4DW0A 5CBGA 3AG3C 1SZTA 3ZN0A 2WLJA 1N0NA 2XOKG 1QLEB 3UKMA 5CBFA 1FFXB 3PJSK 4FK5C 4XDKA 2P67A 5LGNA 1FXKC 5FNVB 3S3XA 1I5YA 1THZA 3HKEB 2ZQMA 3CB2A 4JI3B 4B3TO 1NH2D 1KYOF 1AB3A 1ZSPA 4R50A 1OV9A 3ML0A 3C3TA 4DR4B 3OMNB 2IH1C 3ABTA 3HKCB 3TXSA 3G6BA 2WSSG 4UFZA 1JR9A 5C93A 4GX0A 5EYPB 1D5NA 2RQ6A 4W4LA 4DR6O 4LFAO 2NNUA 1S5JA 1ZL8B 2DMXA 2Y69C 2YSUB 2XNDG 3N2KA 4ICGA 4F6RB 2HHHB 3CRRA 1MNGA 1W59A 3F7VC 3W7WA 2YIBA 3JD3A 3A0HZ 4XDJA 2YIBD 2Z0AA 3GWKC 3K3WA 4X1IB 1I7FA 2ZKOA 4JAAA 1N0JA 1RP3B 3OE7G 3OT7A 3W7UA 4R6ZA 4OPHA 1VQ5V 1TUEB 1XQ8A 1OCZC 3M8AA 2WA4A 4UB8Z 2VWKA 5EC2C 4OGQB 1XOUA 1NJIW 4IIJB 3JD2A 2AHYA 1L8DA 4Q20A 2FB5A 1KKCA 1IXMA 3BHPA 2EILB 4B3TB 1DF5A 3AG4C 1AI4A 1O9HA 4JI8O 1WP7A 2F4VB 2WLHA 1SQGA 2RCVA 3P32A 1OHHG 1XL6A 2HJDA 4NTXA 3ZHVA 4IGGA 2ZXWC 1RPRA 4O4HB 2P22C 4JI4O 3L70H 4I55B 5JH7B 2Z5UA 2RNBA 4DR5O 2WLLA 4DR6B 2AW9A 3ZRWB 3VQVA 1K9MW 4LFAB 3LSUA 4LNUA 3IJ4A 3DC6A 4IHJB 5J2UA 1XDCA 3J81N 3ETGA 4U7NA 3CCVV 2AXTZ 1OCCB 5IY5B 4YJ2A 4BIOA 2ADQB 1UJWB 1IVSA 4O4IA 4YIPA 3WG7C 3ZEDA 1Q3EA 2LW7A 3K5OA 5KMGA 2IJKA 4JZGA 2ZE6A 4LH6A 5LHIA 2VQFO 4J7KA 1QCEA 4WBNA 3RYCA 1S72V 5IT9N 3ZRSA 1QR8A 1ZX3A 4TQFA 1FXHA 1Q90D 4FZ0A 1K5SA 1R3JC 2DE0X 4MVUA 1L0LH 2JVDA 1N36O 1P7BA 3U0ZA 1SQBH 4NXMO 1H2MA 5BR8O 5CB4A 3W7XA 3E86A 2DWDC 4JI8B 1VF7A 4WF9V 2GUZB 3E2EA 3OW2U 4U3FH 1VQKV 2LFSA 2DYSB 5LYJB 2KB1A 4LFCO 1VQNV 4JI4B 4DR5B 4FLZA 2P06A 3KZIZ 3M99B 2HR3A 1ZTEA 4NTWA 1VP7A 3CXHF 3J7AU 4IT5A 4EB6A 1H2GA 4WFFA 4GX5A 5HFMA 3JCUZ 4K8XA 4FIPC 5TISZ 4FLYA 1D2DA 2WLNA 3H9VA 2OTJV 5LA6A 5AG2A 1FYJA 3H01A 2ZE5A 3K5MA 4JI7O 3RYIA 3KG2A 1HW7A 5IJ0A 4LF4B 2ODMA 2VS0A 1PD3A 3ETQA 4JI1O 3EFFK 3UQ8A 1N36B 2Q0AA 4NXMB 3T1YO 1FXKA 1PNMA 1BHAA 4MVMA 4TQDA 5B1OA 4W4KA 2CH7A 4P30A 4LP8A 1HNWB 4PELA 3ZHTA 2A9HA 2QWNB 1SQXH 4LF5O 2EIMB 1U97A 5LP6B 1AILA 4RUFA 4LFCB 4DV4O 2E74B 2QA4V 1FKAO 3OAAG 4PA3A 5GTHZ 3H1LH 1T5EA 4WFBV 4BIUA 4X9QA 4DUYB 1XL4A 4B3SO 1IX9A 1JJOA 4DR3O 1Z5WA 4K0KB 2PI5A 4JV5O 2OYQA 3CPWU 4JYAO 5LBQA 2GBOA 3D3IA 4NR1A 4KHPB 4RQEA 1M57C 1B06A 3ZBHA 1GH6A 4DYLA 2YXLA 4WCEV 5LMNO 1V54C 4UVBA 4JI7B 1CEZA 1Q8IA 3UCSC 4O4LB 1K34A 4DUZO 3L72H 5DN6G 3OR6C 3RYHB 1VMGA 2XASA 1HNZO 4DV0O 2ZM6B 4D7SA 2F23A 2ZIMA 5LGUA 4I5SA 4NB5A 1KUQA 3A2FA 1YSCA 1P49A 2QM8A 3G4SV 3T1YB 4TUYB 3FB5C 2FTKA 3C90A 5KHIA 2HP8A 3N2GB 4ABMA 3G67A 5C8YA 4WFHA 5B3SC 1HNXO 1JFFB 2QKSA 4FJCC 5CA1B 1KMIZ 4QNHB 2HG5C 3JASB 4X20B 4DR7O 5KUMA 4DV4B 3ABKC 1JQ0A 5J2TA 2DWEC 4RWUA 2F95B 4B3SB 3K57A 4JF3A 5L3DA 4DR3B 1I08A 3OMAB 3EHBB 4PA4A 5B1AB 1XNQO 2X7RB 1BZKA 3P3PA 3X2QB 2ZDIC 4JYAB 2OCCB 4CS4A 1Y76B 2IM9A 4FVMA 3E83A 3JYCA 5LMNB 1CP9A 4TV9B 4DUZB 5B5EZ 4PHZA 4DV0B 1YDXA 5KA6A 1XBLA 1PM9A 2Y0PA 1XNRO 4EFBA 1GK9A 1N32B 1G8MA 2WWWA 1NKDA 4GKJO 4I4TA 3CMAV 5IE9A 1VQ8V 2DJVA 4J41A 3F5WC 3RVZA 3CC4V 4I9QA 1HNXB 2P7TC 2EIJB 2UXCO 2OWOA 1WN7A 2QKAA 4FLXA 2P5OA 1K3EA 3OEHG 5L3BA 1IURA 3KCXA 3FAVA 3LSQA 4PDRA 3STZC 3HKDB 3JAWA 2RN9A 4KFMA 3SYOA 1FD9A 1MZEA 1HWYA 2Q9LA 2WAMA 3BCCH 2WPDG 1FJGB 4LH7A 3MAQA 3RFRA 2N05A 2ZR2A 3JAKA 4JI6B 1NI8A 2K1EA 1W0JG 1I94B 1FFTB 2ZE8A 4KL1A 4RQFA 4D6TH 4BIZA 1NR7A 4ZBMA 4ZI7A 2JS3A 4R7CA 1XHZA 4X1KB 3HKBB 4J7ZA 5GONB 1XMQO 4I0XB 4GKJB 5DEDA 2IH3C 1R6NA 4DV3O 2A7WA 3KCYA 3E8HA 3K03A 4UVAA 1R3IC 1KU9A 2UXCB 2QGNA 3ZHSA 2E5LB 3JALA 3CRMA 2XAJA 3CXCU 2QSAA 2ZE7A 1E1QG 4ZOLA 4ZIBA 4F6EA 3SJBC 4UCTA 5IYZB 4B7EA 1UFIA 2AGAA 3CSXA 1QR9A 3CJHB 3L73H 1KP3A 4HBNA 2UUCO 3ABMC 5GW7A 4LCUC 2KQXA 4DR4O 2HLDG 1Q82W 1KB9F 2BOBC 1EM1A 4JTAB 2CTQA 4KXRA 4BW9A 1GO3F 4H33A 1BQZA 2BTQA 2EULA 3OD4A 3H1IH 1F51A 2NLJC 3VQWA 3F5TA 2HHHO 4JASA 3FFQA 3DSQA 5KHHA 1XMQB 5JQGA 3CX5F 4UUJC 2P4VA 3T2MA 3P3NA 4U3JA 3CWBH 4GZRB 2DYSC 4K8ZA 4EFEA 5LOVA 5CBHA 2EX3A 1SA0A 1B6QA 4LBEC 1S76D 2Q6AA 1K33A 2UXDO 4AILC 3SYPA 1Q86W 5IJ9B 4LWSB 3HPLC 1XILA 1HDJA 4JYYA 4X66O 4DRXA 5A2QN 1M93A 4PD4F 2F4VO 3K59A 2ZDIA 1IXBA 3L71H 4PDVA 3OTOB 5K1PA 2UUCB 3N2KB 5DECA 2LGQA 4HNAA 4L87A 4J9ZB 5LXTB 4PDMA 2Q0OC 2JRIA 4PI0A 3AK2A 4DXWA 1JJ2U 1RM1B 1A32A 3JD1A 1S0VA 2QTOA 5EZYA 1I5XA 1S3JA 4IYHA 1PNKA 2QJ1A 1FFXA 2PF4E 5KA5A 2DW4A 3APOA 1QU7A 1KECA 1H8EG 3HKEA 2F66C 2Q7HA 4UCOA 5IYCO 4DK1A 3CRCA 4HAMA 1Z2GA 3CCQV 1GN6A 3T1HB 2W0FC 1OCRB 2LW1A 2EIMC 1BQ0A 3TCUA 3AG7A 1NVPB 5JJJB 2HFEC 2XUMA 5EYPA 2UXDB 3TETA 2ZCEA 1GAXA 3AG1C 4L8JA 3L75H 1OZ0A 1H2SB 1QVGU 4X66B 4MVZA 4B3RO 2ILMA 3FYEB 4LNUB 5LGTA 3ZCCA 5J2UB 2QKCA 1VEWA 4H37A 2A79B 3LUTB 5H2FZ 4YJ2B 2EINC 4U7OA 4GCZA 2ZNJA 4AI8A 1N34B 4JI5O 3CCUV 2C2AA 3ABUA 1BMFG 3STLC 3ZMTA 1IBMO 3ZX6A 4H44B 4WBNB 2BSKA 1M90W 3DXRB 2GHYA 2PZSA 4X89A 5LMUO 2ZINA 1YITV 4X1YA 1VQ6V 3LDDA 1GN3A 3TXQA 4O2AA 4UCVA 4DR2O 1WJZA 2PUSA 1FXVA 4LF4O 3IFXA 1R1BA 3JSNA 3UT5A 4MVRA 1K5QA 5K1XA 3C3SA 1K4CC 4O4HA 5ITZA 3QG5A 3E22B 5E79Z 4DV2B 4MVOA 3BPZA 4I9WA 5B1AC 4MTXA 1PL0A 4B3RB 2OCCC 4FMTA 3NXSA 3LSSA 1HNWO 5B66Z 4YY3B 2V4DA 4WFGA 4FLVA 4CH5A 3PN1A 4EB6B 1SS3A 4J11A 4QPJA 2PI4A 4GX2A 3CCSV 2Y4UA 4MS2A 5EBWC 3CCJV 3E35A 1YJWV 2LP7A 4J10A 1M1KW 4JYCA 3JARB 4H0LB 2UUAB 3RN4A 1NT2B 1QQCA 5LA6B 1VF5B 1JCHA 4GX1A 4IL6Z 4JI5B 4DUYO 3RYIB 3RYFA 1IBMB 5IJ0B 4K0KO 2QEXV 3RVYA 3ZMSA 3FYIB 1YCIA 1VIBA 3AG3B 5E1AC 4PJ0Z 1TVKA 5LMUB 4KHPO 1Q7YW 1BGYH 1SQQH 4DR2B 1FAFA 4DV5O 1FXKB 3JSLA 3O9OA 4LF6O 2EIJC 2GUZA 2CH7B 1Q5OA 5KLVH 1Y66A 4K35A 3SYCA 1B04A 3SYAA 2UXXA 2ZM6O 4EEQA 1EN5A 1BT8A 4DV6O 2EIKB 3B8NA 4PA7A 4JAUA 4QJFB 3QO5A 2JIZG 3GWOA 2DQ0A 4I7ZB 1R73A 4FPPA 4DV7O 2PYJA 2QWQB 3AG2C 3ZMZA 1M56C 4QGPA 1F7YA 1BE3H 1Q43A 4YJ3A 2Y69B 1DTOA 3W7SA 4N21A 5D5PA 2KKWA 1VQ9V 1WB8A 4LF7O 1XMOB 1DLBA 2VWJA 1Y74A 2DYRB 3K06A 3B2EE 3CEIA 2W6IG 3ETDA 3OGIB 2YC0A 2IJHA 4X64B 3K5LA 3WFVA 2CTRA 4DV5B 1P7GA 4GLXA 4LF6B 5L3GA 2Q68A 3FKSG 3ABLC 3ZHRA 1H2KA 3N27A 5C8YB 3FB7C 3JD0A 4WFEA 5KHJA 2A0LA 3AG4B 2X6CA 1EBOA 3B77A 4DV6B 1O9GA 1WA8A 4BR6A 3APQA 1ZWIC 4QIWF 2FL4A 2Q69A 3K9SA 3SDLA 1N32O 2ZXWB 1NTZH 5J2TB 2JGDA 4DV7B 1V55C 2NR5A 2QM7A 4MW8A 4O2BA 5JCOC 4J80A 1TUBA 3BEHA 3SR2C 3QF7A 4BAYA 4I50A 4MT8A 4LF7B 4O4LA 2YEVA 5EBMC 3WG7B 3ICXA 4UCUA 1SC5B 2WLMA 3SJQC 5KHKA 1OCOC 4YIOA 4UXNA 4P9OA 1RFYA 1ZAUA 5BMVA 3CS5A 5KX5B 1JX9A 1AR1B 5JWPA 1FJGO 1KP2A 1TAEA 2ZIOA 3N2GA 3AEIA 1AJPA 4JI6O 1I94O 3T4DA 5LL6Y 3OUFA 4RAIA 3ZHUA 1XHXA 3WB0A 2HVJC 5CA1A 3IGAC 2RMKB 1AI5A 1QLEC 3JASA 4UCRA 1H2NA 4X20A 1GRJA 4Z1VA 1LUVA 1YF2A 3ASOB 2MK3A 1TA8A 2P6JA 1AVMA 2GSMB 2UU9O 4LR3A 4HYOA 3W7TA 1SRYA 3FAVB 3CD6V 5FPRA 4FFBA 1EZVH 2ZR3A 1AP6A 3O65A 2PY5A 3SYQA 2HKOA 3LDEA 2E5LO 1BHBA 2Q73A 1K8AW 2R70A 1RM1C 1R6TA 1QNMA 2XTAA 2B1IA 4JTDB 3VQYA 4NVPA 5CN0A 3G6EV 2A06H 3JAKB 2D3OW 3FX7A 3D3QA 5EBLC 5KUKA 1DF4A 1Q81W 2EBOA 3OFNG 4JZ2A 3CYOA 4Q6GA 5IDJA 1JA8A 4TWKA 4MTGA 3ZHQA 4ZI7B 3CCEV 2JJ1G 1VF6C 5JVDA 1SQPH 3DC5A 1MSWD 3HR0A 1N8RW 1ZLZA 2X6BA 3ASNB 2Q7EA 1F4MA 5L3FA 4XDLA 2YS8A 1AP5A 2UU9B 2EILC 3HKDA 1Z5VA 3CC2V 3FB8C 1WPBA 2YXHA 2K9PA 1H8HG 2XHBA 1AI6A 3K0GA 1J5EO 1VQLV 3JATB 2EZPA 2WLIB 1X59A 2LGWA 1SETA 3ZN1A 2JEUA 4P2ZA 1S5LZ 1YTFB 1OCCC 1M5IA 1LUWA 2BTQB 5IY5C 3BFRA 5KHGA 4X1KA 3OTOO 3HKBA 1H2LA 5H5NA 5BXZA 4JGSA 4I0XA 2XAGA 1VQPV 1W2BU 4J9YB 3QTCA 1SESA 3ZMUA 2JJ2G 3H1JH 4LFBB 5EIBC 3CRQA 4NYKA 1HR0B 4U3JB 3K5NA 4ZHQA 3F7YC 5CA0A 1SZXA 2GV9A 5LOVB 1WAZA 4D7TA 3Q4HA 3OGCC 1SA0B 4OPAA 1ROPA 2H3OA 2HJFC 4Z1MG 5IYZA 1KC8W 4LF9O 3ABKB 4XBFA 4TV8A 2EJ7A 3CJHA 2QWOB 3R66A 4QE9A 2XT9A 3T1HO 1NH2B 3SGIA 2BTOA 1EN6A 1G1XB 3T1CA 4DR1B 4DRXB 4FM2A 1US6A 2KG7A 1QVFU 3E8GA 1L1FA 4YHHB 2LQTA 4GYCB 3SPHA 3B09A 4CZZA 1J5EB 4RO2A 4HNAB 1SQVH 3THOA 1U96A 1YJNV 4C7UA 1KD1W 3D36C 2QM4A 1RSOA 3AK3A 1MABG 4FM0A 1YEWA 1PNLA 1R3KC 5EZYB 1NBMG 2WLKA 3IC9A 1S5HC 2VQEO 3IC7A 1MMMA 4AQYO 4O4JA 1EFRG 1VQ4V 2UUBO 5CA3A 2JS5A 4B3MO 5LHHA 1TGOA 2L35A 2E3CA 3T4ZA 4UCSA 3CCLV 2CGOA 1N34O 1K97A 1Y4MA 1MZFA 3SJAC 3GB7C 3K08A 2ITDC 2EIKC 3BABA 4DW1A 3E8FA 4DO2A 5FNVA 1G4YB 5IJ9A 4UVCA 4LWSA 3CP1A 3UO3A 1GN4A 3AK1A 2RJZA 2GTAA 3A8TA 4LF9B 4CS2A 4BWAA 1I0HA 5FLXN 1FPOA 2FYUH 1Q6HA 4ASUG 5LP6C 5F2VO 5LXTA 2QDOA 3HKCA 2AZ2A 4J7JA 1AROP 1AJNA 4JTCB 5IYBO 2DYRC 4DV2O 1E79G 2QR4A 3RW0A 3I56V 2R9IA 2XAQA 3A0RA 3VOUA 3JCZA 2ATKC 1ZL8A 2OTLV 2BCCH 3OM3B 2WLLB 2UXNA 1J95A 4ZKIA 4F6RA 1EZJA 4YY3O 1YZBA 2F43G 2VQEB 1BCCH 3I55V 2BSKB 3LNNA 4AQYB 1DGSA 2R9AA 2UUBB 3R65A 4B3MB 1AI7A 1VF6A 4WFAV 1R6KA 3U11A 4PDLA 5L3CA 2QTSA 2UUAO 4X1IA 4X1YB 4O4IB 1GM7A 1GM8A 1K73W 3BA8A 4MTFA 4O2AB 5KMGB 2OIEA 3ZMVA 2YUAA 1RPOA 3RYCB 1NVPD 3UT5B 4CH6A 4GKKO 4KP4A 2O57A 1IZ3A 2CE4A 4IIJA 5ITZB 3WB1A 1GTOA 2EZOA 3L9DA 2XAHA 4CBCA 2LJ2A 1XI1A 5CB4B 2N04A 3E8BA 3FB6C 2GTSA 3SPIA 1Y67A 3I5DA 4I55A 1MSDA 5JH7A 1YIJV
chains in the Genus database with same CATH topology
4UB8Z 5KAFZ 5E79Z 5B5EZ 5H2FZ 3KZIZ 4IL6Z 4UB6Z 3A0HZ 5KAIZ 5B66Z 3JCUZ 5TISZ 2AXTZ 4PJ0Z 3WU2Z 3A0BZ 1S5LZ 5GTIZ 5GTHZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB8 Z;  5KAF Z;  5E79 Z;  5B5E Z;  5H2F Z;  3KZI Z;  4IL6 Z;  4UB6 Z;  3A0H Z;  5KAI Z;  5B66 Z;  3JCU Z;  5TIS Z;  2AXT Z;  4PJ0 Z;  3WU2 Z;  3A0B Z;  1S5L Z;  5GTI Z;  5GTH Z; 
#chains in the Genus database with same CATH topology
 3ZRW A;  3DGE A;  3ABM B;  3VQX A;  4EKW A;  3E89 A;  5L3E A;  2W0X A;  4IHJ A;  4MSW C;  2CK3 G;  1Q6U A;  3X2Q C;  2NN4 A;  3L74 H;  3DXR A;  3SJC C;  5J9P C;  3VBB A;  4FZ1 A;  3GVM A;  2IBZ H;  3RYF B;  1Q6I A;  2H8P C;  4GT1 A;  5D5Q A;  3MD0 A;  2DN9 A;  1TVK B;  5B1B B;  2G38 A;  5IWA O;  4X62 O;  1XMO O;  1PV0 A;  1PP9 H;  2B5U A;  3OEE G;  4HZ3 A;  2ZNI A;  1QHT A;  3K58 A;  1UPG A;  3MHS C;  5KAI Z;  3JAM N;  3S3W A;  3K9A A;  3ASO C;  2F1M A;  3E22 A;  4GKK B;  5EIB D;  1QLN A;  1GKF A;  1D5A A;  4X64 O;  4N23 A;  3ZIA G;  2JGU A;  3MHH C;  4F4L A;  1IDS A;  1KKD A;  4NTY A;  3NR7 A;  3QNE A;  2DOS A;  2GDS A;  3MDS A;  3BY6 A;  2LO1 A;  1DK1 A;  2IJJ A;  4X88 A;  2CUG A;  1SQF A;  5LYJ A;  5B1N A;  1AR5 A;  2YI9 A;  2Q7G A;  1XEQ A;  3JAR A;  4YJ3 B;  5JJE B;  2ARH A;  2IW5 A;  4P9P A;  2QE7 G;  3BA9 A;  1YXB A;  2V7Q G;  3D36 A;  2VQF B;  1JPX A;  2E76 B;  1WP8 A;  4JPR A;  5A9G A;  1Y74 B;  2L6L A;  4QE7 A;  1IBL O;  1NR1 A;  2YIC A;  1ENV A;  5DM6 V;  3QVN A;  5CMU A;  2F93 B;  3CRA A;  3WU2 Z;  2IJI A;  3BAA A;  5JJN B;  3RBZ A;  4PV1 B;  5IWA B;  5BR8 B;  4AHC A;  4K3A A;  4X62 B;  1LNQ A;  1VQO V;  3H1H H;  1K92 A;  2PGG A;  3ASN C;  3ZRV A;  1KQS U;  4OX9 O;  2WA3 A;  4R8C A;  3RGB A;  2CTW A;  2P90 A;  1S77 D;  3CCR V;  1K4D C;  5BZB A;  3ETE A;  1OCZ B;  1JOY A;  1PKX A;  2Q4P A;  1WA8 B;  4LC1 A;  1URF A;  1WNS A;  2QWP B;  1W0K G;  3OTF A;  4FLW A;  3AG1 B;  2R9R B;  3ZS8 C;  4UV9 A;  2JGD B;  4MW3 A;  2OT5 A;  5EK0 A;  4BW5 A;  1MOF A;  5H6R A;  1VQ7 V;  1M4U A;  5LP6 A;  4H13 B;  4O2B B;  2KSD A;  2W6J G;  1TUB B;  4GUN A;  1WPX A;  4FM1 A;  5LHG A;  4I50 B;  2N74 A;  4X65 O;  2JDI G;  3B40 A;  3EXA A;  2EIN B;  2YEV B;  2ADP A;  3G71 V;  1IBL B;  1JVM A;  4JI1 B;  1BS3 A;  5H9C A;  1VQM V;  3G80 A;  1OJH A;  2D2C B;  4JI2 O;  2UXB O;  5BMV B;  2HEP A;  2Q8V A;  2Y48 A;  1E1R G;  4PA6 A;  4CS3 A;  1COW G;  2X0L A;  1F23 A;  3RYH A;  2PTM A;  2OIG A;  4NXN O;  1ORQ C;  4OX9 B;  1BSM A;  2P4K A;  4LF5 B;  3QO7 A;  3SPC A;  2ITC C;  1AR4 A;  4FLU A;  2QWR B;  4KUM A;  4TUY A;  4JI0 O;  4MVQ A;  2CAZ C;  1NU1 H;  4JAV A;  4PA9 A;  1PL4 A;  2A3Q A;  1NQT A;  2YI8 A;  1JFF A;  4JV5 B;  4I4T B;  5BY1 A;  2FML A;  2JEX A;  3OUS A;  3HB3 B;  5H6Q A;  4FFB B;  3RWR D;  1GM9 A;  1K7D A;  1N4C A;  1YHQ V;  4JYB A;  4B7K A;  3EVK A;  1F4N A;  4CC6 A;  1ZUQ A;  4B08 A;  1PPJ H;  3LDC A;  4Z2W A;  1YI2 V;  4J42 A;  4X65 B;  4E4E A;  1MA1 A;  1B3Q A;  1CXZ B;  1L0N H;  1MG1 A;  2B1G A;  1HNZ B;  3BVO A;  3M7M X;  3JAW B;  5KX5 A;  1Y76 A;  4UB6 Z;  3CC7 V;  3D8C A;  4QPK A;  1AJQ A;  3WB2 A;  3JD4 A;  1LR1 A;  4JI2 B;  2UXB B;  2JK5 C;  4TV9 A;  1QBZ A;  2Y0I A;  1SKV A;  1H38 A;  1EN4 A;  5JVD B;  4NXN B;  3B4S A;  3OMI B;  2Y4T A;  2YXY A;  4X8A A;  3CE2 A;  4DR7 B;  4JI0 B;  1IBK O;  3U10 A;  1BL8 A;  2YDE A;  2ZD9 A;  2ZT9 B;  1M9N A;  3SPJ A;  1OCR C;  4TOI A;  1XUQ A;  1NS1 A;  1XNQ B;  4DV1 O;  5EC1 C;  2Z3Y A;  1N33 O;  4LFB O;  3K0D A;  4NKG B;  3ZRX A;  1HR0 O;  2E75 B;  3CCM V;  2DQ3 A;  2RDC A;  3AG2 B;  4OXS A;  1GN2 A;  2YIA A;  1M56 B;  3B8M A;  2IU0 A;  4FLT A;  3K79 A;  4MTO A;  3JAL B;  1CPY A;  4G27 B;  3K04 A;  2HVK C;  4ZOL B;  3TJT A;  4TSF G;  2X6A A;  3J80 N;  3KKY A;  3IAY A;  4DR1 O;  2Q67 A;  3CME V;  1XNR B;  4YHH O;  1NZ6 A;  2LFR A;  3QO8 A;  3H1K H;  3OR7 C;  4G28 B;  4LF8 O;  1M57 B;  3SPG A;  1JMK C;  2R72 A;  4FFK A;  1V54 B;  4E2L A;  2M7W A;  1P4R A;  3UM7 A;  1SF9 A;  1V9P A;  3ABL B;  1WLE A;  4ZHQ B;  3ZJZ A;  5CA0 B;  1IBK B;  2VRZ A;  5GON A;  5HFL A;  2PYL A;  4G2K A;  3Q4H B;  1WB7 A;  2Q5Z A;  3LNM B;  1NTK H;  1YVW A;  4DK0 A;  1KBH A;  4TT3 G;  1VAR A;  5JQG B;  4JI3 O;  4DV1 B;  4TV8 B;  1N33 B;  1YJ9 V;  1V55 B;  5GTI Z;  1G6U A;  5KAF Z;  2OCH A;  5B3S B;  1NTM H;  3JAT A;  1XRE A;  2H94 A;  4PI2 A;  2WLI A;  1HP8 A;  3UO2 A;  2KG7 B;  2M6Y A;  2B9Z A;  2BOC C;  1P84 F;  3BRC A;  2CDY A;  2IU3 A;  4YXW G;  1GMG A;  3TK1 A;  1X4T A;  4RUE A;  1RSO B;  5FL7 G;  1YTF D;  3A0B Z;  2ETN A;  3DTU B;  1R3L C;  5JCO A;  3TGU H;  2XAF A;  2BE3 A;  4CH3 A;  2AHZ A;  3RT3 C;  2CTP A;  1FS0 G;  5B1B C;  4UV8 A;  1OCO B;  2CGN A;  4MVS A;  2V1D A;  2YID A;  2FKX A;  2MW2 B;  4CH4 A;  5IYD O;  3CHX A;  3P30 A;  4O4J B;  4CC5 A;  1Y6X A;  4A5U B;  4LF8 B;  5FPO A;  2EJR A;  4IYI A;  2AZ0 A;  1SER A;  4DV3 B;  3FD9 A;  4DW0 A;  5CBG A;  3AG3 C;  1SZT A;  3ZN0 A;  2WLJ A;  1N0N A;  2XOK G;  1QLE B;  3UKM A;  5CBF A;  1FFX B;  3PJS K;  4FK5 C;  4XDK A;  2P67 A;  5LGN A;  1FXK C;  5FNV B;  3S3X A;  1I5Y A;  1THZ A;  3HKE B;  2ZQM A;  3CB2 A;  4JI3 B;  4B3T O;  1NH2 D;  1KYO F;  1AB3 A;  1ZSP A;  4R50 A;  1OV9 A;  3ML0 A;  3C3T A;  4DR4 B;  3OMN B;  2IH1 C;  3ABT A;  3HKC B;  3TXS A;  3G6B A;  2WSS G;  4UFZ A;  1JR9 A;  5C93 A;  4GX0 A;  5EYP B;  1D5N A;  2RQ6 A;  4W4L A;  4DR6 O;  4LFA O;  2NNU A;  1S5J A;  1ZL8 B;  2DMX A;  2Y69 C;  2YSU B;  2XND G;  3N2K A;  4ICG A;  4F6R B;  2HHH B;  3CRR A;  1MNG A;  1W59 A;  3F7V C;  3W7W A;  2YIB A;  3JD3 A;  3A0H Z;  4XDJ A;  2YIB D;  2Z0A A;  3GWK C;  3K3W A;  4X1I B;  1I7F A;  2ZKO A;  4JAA A;  1N0J A;  1RP3 B;  3OE7 G;  3OT7 A;  3W7U A;  4R6Z A;  4OPH A;  1VQ5 V;  1TUE B;  1XQ8 A;  1OCZ C;  3M8A A;  2WA4 A;  4UB8 Z;  2VWK A;  5EC2 C;  4OGQ B;  1XOU A;  1NJI W;  4IIJ B;  3JD2 A;  2AHY A;  1L8D A;  4Q20 A;  2FB5 A;  1KKC A;  1IXM A;  3BHP A;  2EIL B;  4B3T B;  1DF5 A;  3AG4 C;  1AI4 A;  1O9H A;  4JI8 O;  1WP7 A;  2F4V B;  2WLH A;  1SQG A;  2RCV A;  3P32 A;  1OHH G;  1XL6 A;  2HJD A;  4NTX A;  3ZHV A;  4IGG A;  2ZXW C;  1RPR A;  4O4H B;  2P22 C;  4JI4 O;  3L70 H;  4I55 B;  5JH7 B;  2Z5U A;  2RNB A;  4DR5 O;  2WLL A;  4DR6 B;  2AW9 A;  3ZRW B;  3VQV A;  1K9M W;  4LFA B;  3LSU A;  4LNU A;  3IJ4 A;  3DC6 A;  4IHJ B;  5J2U A;  1XDC A;  3J81 N;  3ETG A;  4U7N A;  3CCV V;  2AXT Z;  1OCC B;  5IY5 B;  4YJ2 A;  4BIO A;  2ADQ B;  1UJW B;  1IVS A;  4O4I A;  4YIP A;  3WG7 C;  3ZED A;  1Q3E A;  2LW7 A;  3K5O A;  5KMG A;  2IJK A;  4JZG A;  2ZE6 A;  4LH6 A;  5LHI A;  2VQF O;  4J7K A;  1QCE A;  4WBN A;  3RYC A;  1S72 V;  5IT9 N;  3ZRS A;  1QR8 A;  1ZX3 A;  4TQF A;  1FXH A;  1Q90 D;  4FZ0 A;  1K5S A;  1R3J C;  2DE0 X;  4MVU A;  1L0L H;  2JVD A;  1N36 O;  1P7B A;  3U0Z A;  1SQB H;  4NXM O;  1H2M A;  5BR8 O;  5CB4 A;  3W7X A;  3E86 A;  2DWD C;  4JI8 B;  1VF7 A;  4WF9 V;  2GUZ B;  3E2E A;  3OW2 U;  4U3F H;  1VQK V;  2LFS A;  2DYS B;  5LYJ B;  2KB1 A;  4LFC O;  1VQN V;  4JI4 B;  4DR5 B;  4FLZ A;  2P06 A;  3KZI Z;  3M99 B;  2HR3 A;  1ZTE A;  4NTW A;  1VP7 A;  3CXH F;  3J7A U;  4IT5 A;  4EB6 A;  1H2G A;  4WFF A;  4GX5 A;  5HFM A;  3JCU Z;  4K8X A;  4FIP C;  5TIS Z;  4FLY A;  1D2D A;  2WLN A;  3H9V A;  2OTJ V;  5LA6 A;  5AG2 A;  1FYJ A;  3H01 A;  2ZE5 A;  3K5M A;  4JI7 O;  3RYI A;  3KG2 A;  1HW7 A;  5IJ0 A;  4LF4 B;  2ODM A;  2VS0 A;  1PD3 A;  3ETQ A;  4JI1 O;  3EFF K;  3UQ8 A;  1N36 B;  2Q0A A;  4NXM B;  3T1Y O;  1FXK A;  1PNM A;  1BHA A;  4MVM A;  4TQD A;  5B1O A;  4W4K A;  2CH7 A;  4P30 A;  4LP8 A;  1HNW B;  4PEL A;  3ZHT A;  2A9H A;  2QWN B;  1SQX H;  4LF5 O;  2EIM B;  1U97 A;  5LP6 B;  1AIL A;  4RUF A;  4LFC B;  4DV4 O;  2E74 B;  2QA4 V;  1FKA O;  3OAA G;  4PA3 A;  5GTH Z;  3H1L H;  1T5E A;  4WFB V;  4BIU A;  4X9Q A;  4DUY B;  1XL4 A;  4B3S O;  1IX9 A;  1JJO A;  4DR3 O;  1Z5W A;  4K0K B;  2PI5 A;  4JV5 O;  2OYQ A;  3CPW U;  4JYA O;  5LBQ A;  2GBO A;  3D3I A;  4NR1 A;  4KHP B;  4RQE A;  1M57 C;  1B06 A;  3ZBH A;  1GH6 A;  4DYL A;  2YXL A;  4WCE V;  5LMN O;  1V54 C;  4UVB A;  4JI7 B;  1CEZ A;  1Q8I A;  3UCS C;  4O4L B;  1K34 A;  4DUZ O;  3L72 H;  5DN6 G;  3OR6 C;  3RYH B;  1VMG A;  2XAS A;  1HNZ O;  4DV0 O;  2ZM6 B;  4D7S A;  2F23 A;  2ZIM A;  5LGU A;  4I5S A;  4NB5 A;  1KUQ A;  3A2F A;  1YSC A;  1P49 A;  2QM8 A;  3G4S V;  3T1Y B;  4TUY B;  3FB5 C;  2FTK A;  3C90 A;  5KHI A;  2HP8 A;  3N2G B;  4ABM A;  3G67 A;  5C8Y A;  4WFH A;  5B3S C;  1HNX O;  1JFF B;  2QKS A;  4FJC C;  5CA1 B;  1KMI Z;  4QNH B;  2HG5 C;  3JAS B;  4X20 B;  4DR7 O;  5KUM A;  4DV4 B;  3ABK C;  1JQ0 A;  5J2T A;  2DWE C;  4RWU A;  2F95 B;  4B3S B;  3K57 A;  4JF3 A;  5L3D A;  4DR3 B;  1I08 A;  3OMA B;  3EHB B;  4PA4 A;  5B1A B;  1XNQ O;  2X7R B;  1BZK A;  3P3P A;  3X2Q B;  2ZDI C;  4JYA B;  2OCC B;  4CS4 A;  1Y76 B;  2IM9 A;  4FVM A;  3E83 A;  3JYC A;  5LMN B;  1CP9 A;  4TV9 B;  4DUZ B;  5B5E Z;  4PHZ A;  4DV0 B;  1YDX A;  5KA6 A;  1XBL A;  1PM9 A;  2Y0P A;  1XNR O;  4EFB A;  1GK9 A;  1N32 B;  1G8M A;  2WWW A;  1NKD A;  4GKJ O;  4I4T A;  3CMA V;  5IE9 A;  1VQ8 V;  2DJV A;  4J41 A;  3F5W C;  3RVZ A;  3CC4 V;  4I9Q A;  1HNX B;  2P7T C;  2EIJ B;  2UXC O;  2OWO A;  1WN7 A;  2QKA A;  4FLX A;  2P5O A;  1K3E A;  3OEH G;  5L3B A;  1IUR A;  3KCX A;  3FAV A;  3LSQ A;  4PDR A;  3STZ C;  3HKD B;  3JAW A;  2RN9 A;  4KFM A;  3SYO A;  1FD9 A;  1MZE A;  1HWY A;  2Q9L A;  2WAM A;  3BCC H;  2WPD G;  1FJG B;  4LH7 A;  3MAQ A;  3RFR A;  2N05 A;  2ZR2 A;  3JAK A;  4JI6 B;  1NI8 A;  2K1E A;  1W0J G;  1I94 B;  1FFT B;  2ZE8 A;  4KL1 A;  4RQF A;  4D6T H;  4BIZ A;  1NR7 A;  4ZBM A;  4ZI7 A;  2JS3 A;  4R7C A;  1XHZ A;  4X1K B;  3HKB B;  4J7Z A;  5GON B;  1XMQ O;  4I0X B;  4GKJ B;  5DED A;  2IH3 C;  1R6N A;  4DV3 O;  2A7W A;  3KCY A;  3E8H A;  3K03 A;  4UVA A;  1R3I C;  1KU9 A;  2UXC B;  2QGN A;  3ZHS A;  2E5L B;  3JAL A;  3CRM A;  2XAJ A;  3CXC U;  2QSA A;  2ZE7 A;  1E1Q G;  4ZOL A;  4ZIB A;  4F6E A;  3SJB C;  4UCT A;  5IYZ B;  4B7E A;  1UFI A;  2AGA A;  3CSX A;  1QR9 A;  3CJH B;  3L73 H;  1KP3 A;  4HBN A;  2UUC O;  3ABM C;  5GW7 A;  4LCU C;  2KQX A;  4DR4 O;  2HLD G;  1Q82 W;  1KB9 F;  2BOB C;  1EM1 A;  4JTA B;  2CTQ A;  4KXR A;  4BW9 A;  1GO3 F;  4H33 A;  1BQZ A;  2BTQ A;  2EUL A;  3OD4 A;  3H1I H;  1F51 A;  2NLJ C;  3VQW A;  3F5T A;  2HHH O;  4JAS A;  3FFQ A;  3DSQ A;  5KHH A;  1XMQ B;  5JQG A;  3CX5 F;  4UUJ C;  2P4V A;  3T2M A;  3P3N A;  4U3J A;  3CWB H;  4GZR B;  2DYS C;  4K8Z A;  4EFE A;  5LOV A;  5CBH A;  2EX3 A;  1SA0 A;  1B6Q A;  4LBE C;  1S76 D;  2Q6A A;  1K33 A;  2UXD O;  4AIL C;  3SYP A;  1Q86 W;  5IJ9 B;  4LWS B;  3HPL C;  1XIL A;  1HDJ A;  4JYY A;  4X66 O;  4DRX A;  5A2Q N;  1M93 A;  4PD4 F;  2F4V O;  3K59 A;  2ZDI A;  1IXB A;  3L71 H;  4PDV A;  3OTO B;  5K1P A;  2UUC B;  3N2K B;  5DEC A;  2LGQ A;  4HNA A;  4L87 A;  4J9Z B;  5LXT B;  4PDM A;  2Q0O C;  2JRI A;  4PI0 A;  3AK2 A;  4DXW A;  1JJ2 U;  1RM1 B;  1A32 A;  3JD1 A;  1S0V A;  2QTO A;  5EZY A;  1I5X A;  1S3J A;  4IYH A;  1PNK A;  2QJ1 A;  1FFX A;  2PF4 E;  5KA5 A;  2DW4 A;  3APO A;  1QU7 A;  1KEC A;  1H8E G;  3HKE A;  2F66 C;  2Q7H A;  4UCO A;  5IYC O;  4DK1 A;  3CRC A;  4HAM A;  1Z2G A;  3CCQ V;  1GN6 A;  3T1H B;  2W0F C;  1OCR B;  2LW1 A;  2EIM C;  1BQ0 A;  3TCU A;  3AG7 A;  1NVP B;  5JJJ B;  2HFE C;  2XUM A;  5EYP A;  2UXD B;  3TET A;  2ZCE A;  1GAX A;  3AG1 C;  4L8J A;  3L75 H;  1OZ0 A;  1H2S B;  1QVG U;  4X66 B;  4MVZ A;  4B3R O;  2ILM A;  3FYE B;  4LNU B;  5LGT A;  3ZCC A;  5J2U B;  2QKC A;  1VEW A;  4H37 A;  2A79 B;  3LUT B;  5H2F Z;  4YJ2 B;  2EIN C;  4U7O A;  4GCZ A;  2ZNJ A;  4AI8 A;  1N34 B;  4JI5 O;  3CCU V;  2C2A A;  3ABU A;  1BMF G;  3STL C;  3ZMT A;  1IBM O;  3ZX6 A;  4H44 B;  4WBN B;  2BSK A;  1M90 W;  3DXR B;  2GHY A;  2PZS A;  4X89 A;  5LMU O;  2ZIN A;  1YIT V;  4X1Y A;  1VQ6 V;  3LDD A;  1GN3 A;  3TXQ A;  4O2A A;  4UCV A;  4DR2 O;  1WJZ A;  2PUS A;  1FXV A;  4LF4 O;  3IFX A;  1R1B A;  3JSN A;  3UT5 A;  4MVR A;  1K5Q A;  5K1X A;  3C3S A;  1K4C C;  4O4H A;  5ITZ A;  3QG5 A;  3E22 B;  5E79 Z;  4DV2 B;  4MVO A;  3BPZ A;  4I9W A;  5B1A C;  4MTX A;  1PL0 A;  4B3R B;  2OCC C;  4FMT A;  3NXS A;  3LSS A;  1HNW O;  5B66 Z;  4YY3 B;  2V4D A;  4WFG A;  4FLV A;  4CH5 A;  3PN1 A;  4EB6 B;  1SS3 A;  4J11 A;  4QPJ A;  2PI4 A;  4GX2 A;  3CCS V;  2Y4U A;  4MS2 A;  5EBW C;  3CCJ V;  3E35 A;  1YJW V;  2LP7 A;  4J10 A;  1M1K W;  4JYC A;  3JAR B;  4H0L B;  2UUA B;  3RN4 A;  1NT2 B;  1QQC A;  5LA6 B;  1VF5 B;  1JCH A;  4GX1 A;  4IL6 Z;  4JI5 B;  4DUY O;  3RYI B;  3RYF A;  1IBM B;  5IJ0 B;  4K0K O;  2QEX V;  3RVY A;  3ZMS A;  3FYI B;  1YCI A;  1VIB A;  3AG3 B;  5E1A C;  4PJ0 Z;  1TVK A;  5LMU B;  4KHP O;  1Q7Y W;  1BGY H;  1SQQ H;  4DR2 B;  1FAF A;  4DV5 O;  1FXK B;  3JSL A;  3O9O A;  4LF6 O;  2EIJ C;  2GUZ A;  2CH7 B;  1Q5O A;  5KLV H;  1Y66 A;  4K35 A;  3SYC A;  1B04 A;  3SYA A;  2UXX A;  2ZM6 O;  4EEQ A;  1EN5 A;  1BT8 A;  4DV6 O;  2EIK B;  3B8N A;  4PA7 A;  4JAU A;  4QJF B;  3QO5 A;  2JIZ G;  3GWO A;  2DQ0 A;  4I7Z B;  1R73 A;  4FPP A;  4DV7 O;  2PYJ A;  2QWQ B;  3AG2 C;  3ZMZ A;  1M56 C;  4QGP A;  1F7Y A;  1BE3 H;  1Q43 A;  4YJ3 A;  2Y69 B;  1DTO A;  3W7S A;  4N21 A;  5D5P A;  2KKW A;  1VQ9 V;  1WB8 A;  4LF7 O;  1XMO B;  1DLB A;  2VWJ A;  1Y74 A;  2DYR B;  3K06 A;  3B2E E;  3CEI A;  2W6I G;  3ETD A;  3OGI B;  2YC0 A;  2IJH A;  4X64 B;  3K5L A;  3WFV A;  2CTR A;  4DV5 B;  1P7G A;  4GLX A;  4LF6 B;  5L3G A;  2Q68 A;  3FKS G;  3ABL C;  3ZHR A;  1H2K A;  3N27 A;  5C8Y B;  3FB7 C;  3JD0 A;  4WFE A;  5KHJ A;  2A0L A;  3AG4 B;  2X6C A;  1EBO A;  3B77 A;  4DV6 B;  1O9G A;  1WA8 A;  4BR6 A;  3APQ A;  1ZWI C;  4QIW F;  2FL4 A;  2Q69 A;  3K9S A;  3SDL A;  1N32 O;  2ZXW B;  1NTZ H;  5J2T B;  2JGD A;  4DV7 B;  1V55 C;  2NR5 A;  2QM7 A;  4MW8 A;  4O2B A;  5JCO C;  4J80 A;  1TUB A;  3BEH A;  3SR2 C;  3QF7 A;  4BAY A;  4I50 A;  4MT8 A;  4LF7 B;  4O4L A;  2YEV A;  5EBM C;  3WG7 B;  3ICX A;  4UCU A;  1SC5 B;  2WLM A;  3SJQ C;  5KHK A;  1OCO C;  4YIO A;  4UXN A;  4P9O A;  1RFY A;  1ZAU A;  5BMV A;  3CS5 A;  5KX5 B;  1JX9 A;  1AR1 B;  5JWP A;  1FJG O;  1KP2 A;  1TAE A;  2ZIO A;  3N2G A;  3AEI A;  1AJP A;  4JI6 O;  1I94 O;  3T4D A;  5LL6 Y;  3OUF A;  4RAI A;  3ZHU A;  1XHX A;  3WB0 A;  2HVJ C;  5CA1 A;  3IGA C;  2RMK B;  1AI5 A;  1QLE C;  3JAS A;  4UCR A;  1H2N A;  4X20 A;  1GRJ A;  4Z1V A;  1LUV A;  1YF2 A;  3ASO B;  2MK3 A;  1TA8 A;  2P6J A;  1AVM A;  2GSM B;  2UU9 O;  4LR3 A;  4HYO A;  3W7T A;  1SRY A;  3FAV B;  3CD6 V;  5FPR A;  4FFB A;  1EZV H;  2ZR3 A;  1AP6 A;  3O65 A;  2PY5 A;  3SYQ A;  2HKO A;  3LDE A;  2E5L O;  1BHB A;  2Q73 A;  1K8A W;  2R70 A;  1RM1 C;  1R6T A;  1QNM A;  2XTA A;  2B1I A;  4JTD B;  3VQY A;  4NVP A;  5CN0 A;  3G6E V;  2A06 H;  3JAK B;  2D3O W;  3FX7 A;  3D3Q A;  5EBL C;  5KUK A;  1DF4 A;  1Q81 W;  2EBO A;  3OFN G;  4JZ2 A;  3CYO A;  4Q6G A;  5IDJ A;  1JA8 A;  4TWK A;  4MTG A;  3ZHQ A;  4ZI7 B;  3CCE V;  2JJ1 G;  1VF6 C;  5JVD A;  1SQP H;  3DC5 A;  1MSW D;  3HR0 A;  1N8R W;  1ZLZ A;  2X6B A;  3ASN B;  2Q7E A;  1F4M A;  5L3F A;  4XDL A;  2YS8 A;  1AP5 A;  2UU9 B;  2EIL C;  3HKD A;  1Z5V A;  3CC2 V;  3FB8 C;  1WPB A;  2YXH A;  2K9P A;  1H8H G;  2XHB A;  1AI6 A;  3K0G A;  1J5E O;  1VQL V;  3JAT B;  2EZP A;  2WLI B;  1X59 A;  2LGW A;  1SET A;  3ZN1 A;  2JEU A;  4P2Z A;  1S5L Z;  1YTF B;  1OCC C;  1M5I A;  1LUW A;  2BTQ B;  5IY5 C;  3BFR A;  5KHG A;  4X1K A;  3OTO O;  3HKB A;  1H2L A;  5H5N A;  5BXZ A;  4JGS A;  4I0X A;  2XAG A;  1VQP V;  1W2B U;  4J9Y B;  3QTC A;  1SES A;  3ZMU A;  2JJ2 G;  3H1J H;  4LFB B;  5EIB C;  3CRQ A;  4NYK A;  1HR0 B;  4U3J B;  3K5N A;  4ZHQ A;  3F7Y C;  5CA0 A;  1SZX A;  2GV9 A;  5LOV B;  1WAZ A;  4D7T A;  3Q4H A;  3OGC C;  1SA0 B;  4OPA A;  1ROP A;  2H3O A;  2HJF C;  4Z1M G;  5IYZ A;  1KC8 W;  4LF9 O;  3ABK B;  4XBF A;  4TV8 A;  2EJ7 A;  3CJH A;  2QWO B;  3R66 A;  4QE9 A;  2XT9 A;  3T1H O;  1NH2 B;  3SGI A;  2BTO A;  1EN6 A;  1G1X B;  3T1C A;  4DR1 B;  4DRX B;  4FM2 A;  1US6 A;  2KG7 A;  1QVF U;  3E8G A;  1L1F A;  4YHH B;  2LQT A;  4GYC B;  3SPH A;  3B09 A;  4CZZ A;  1J5E B;  4RO2 A;  4HNA B;  1SQV H;  3THO A;  1U96 A;  1YJN V;  4C7U A;  1KD1 W;  3D36 C;  2QM4 A;  1RSO A;  3AK3 A;  1MAB G;  4FM0 A;  1YEW A;  1PNL A;  1R3K C;  5EZY B;  1NBM G;  2WLK A;  3IC9 A;  1S5H C;  2VQE O;  3IC7 A;  1MMM A;  4AQY O;  4O4J A;  1EFR G;  1VQ4 V;  2UUB O;  5CA3 A;  2JS5 A;  4B3M O;  5LHH A;  1TGO A;  2L35 A;  2E3C A;  3T4Z A;  4UCS A;  3CCL V;  2CGO A;  1N34 O;  1K97 A;  1Y4M A;  1MZF A;  3SJA C;  3GB7 C;  3K08 A;  2ITD C;  2EIK C;  3BAB A;  4DW1 A;  3E8F A;  4DO2 A;  5FNV A;  1G4Y B;  5IJ9 A;  4UVC A;  4LWS A;  3CP1 A;  3UO3 A;  1GN4 A;  3AK1 A;  2RJZ A;  2GTA A;  3A8T A;  4LF9 B;  4CS2 A;  4BWA A;  1I0H A;  5FLX N;  1FPO A;  2FYU H;  1Q6H A;  4ASU G;  5LP6 C;  5F2V O;  5LXT A;  2QDO A;  3HKC A;  2AZ2 A;  4J7J A;  1ARO P;  1AJN A;  4JTC B;  5IYB O;  2DYR C;  4DV2 O;  1E79 G;  2QR4 A;  3RW0 A;  3I56 V;  2R9I A;  2XAQ A;  3A0R A;  3VOU A;  3JCZ A;  2ATK C;  1ZL8 A;  2OTL V;  2BCC H;  3OM3 B;  2WLL B;  2UXN A;  1J95 A;  4ZKI A;  4F6R A;  1EZJ A;  4YY3 O;  1YZB A;  2F43 G;  2VQE B;  1BCC H;  3I55 V;  2BSK B;  3LNN A;  4AQY B;  1DGS A;  2R9A A;  2UUB B;  3R65 A;  4B3M B;  1AI7 A;  1VF6 A;  4WFA V;  1R6K A;  3U11 A;  4PDL A;  5L3C A;  2QTS A;  2UUA O;  4X1I A;  4X1Y B;  4O4I B;  1GM7 A;  1GM8 A;  1K73 W;  3BA8 A;  4MTF A;  4O2A B;  5KMG B;  2OIE A;  3ZMV A;  2YUA A;  1RPO A;  3RYC B;  1NVP D;  3UT5 B;  4CH6 A;  4GKK O;  4KP4 A;  2O57 A;  1IZ3 A;  2CE4 A;  4IIJ A;  5ITZ B;  3WB1 A;  1GTO A;  2EZO A;  3L9D A;  2XAH A;  4CBC A;  2LJ2 A;  1XI1 A;  5CB4 B;  2N04 A;  3E8B A;  3FB6 C;  2GTS A;  3SPI A;  1Y67 A;  3I5D A;  4I55 A;  1MSD A;  5JH7 A;  1YIJ V; 
#chains in the Genus database with same CATH homology
 4UB8 Z;  5KAF Z;  5E79 Z;  5B5E Z;  5H2F Z;  3KZI Z;  4IL6 Z;  4UB6 Z;  3A0H Z;  5KAI Z;  5B66 Z;  3JCU Z;  5TIS Z;  2AXT Z;  4PJ0 Z;  3WU2 Z;  3A0B Z;  1S5L Z;  5GTI Z;  5GTH Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...