4IL6Z

Structure of sr-substituted photosystem ii
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
61
structure length
61
Chain Sequence
TILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Sr-substituted photosystem II at 2.1 A resolution and its implications in the mechanism of water oxidation
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein
total genus 24
structure length 61
sequence length 61
chains with identical sequence z
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 4il6Z00
5GTIZ 5GTHZ 4UB8Z 5TISZ 3WU2Z 3A0BZ 4UB6Z 5B66Z 5KAFZ 5E79Z 4PJ0Z 5B5EZ 5H2FZ 5KAIZ 4IL6Z 1S5LZ 3A0HZ 3KZIZ 3JCUZ 2AXTZ
chains in the Genus database with same CATH superfamily
2ITCC 3E86A 1EFRG 3ZRWB 1KKDA 4B3MB 2UXBB 3SYCA 1I94B 5L3CA 1B3QA 2PI4A 2FL4A 3KCYA 4ZI7A 1R3LC 4LF5O 2IM9A 3AG4C 3BABA 3SJBC 4YIOA 1LUWA 3JASA 3DXRB 1TUEB 3CRCA 5B1AB 1S5HC 3TK1A 2Q4PA 4YHHB 3CRRA 1SERA 3ZRSA 4X89A 4BW5A 4FLWA 3BFRA 4JF3A 4DR5O 4ICGA 4DV4O 4X20B 4TV8A 3DC6A 3UT5A 4B3SO 3X2QC 2WA4A 1XUQA 4JI0O 5JQGA 4IIJB 3T1HO 1FPOA 3CRAA 3E8FA 4CS4A 4PA7A 2ZINA 5LBQA 2P7TC 2UUAB 1VQ5V 3PN1A 5GW7A 4B08A 3FYEB 1XQ8A 3MHHC 2ZNIA 1NKDA 3VQWA 3CJHA 3JASB 2D3OW 4A5UB 2R72A 2ZE7A 5KA6A 1QHTA 1FXVA 4TT3G 4LF7B 3JCUZ 4P30A 1F4NA 3T1YO 2N04A 1MZFA 3FB8C 1BHBA 1X4TA 4LNUA 4XDLA 2ZIMA 4O4JB 2BOBC 4R8CA 3WG7C 3M7MX 4R7CA 4YY3B 3FB5C 1CP9A 3HPLC 5LP6A 5H6RA 1IBMB 2ADPA 2YEVA 3TGUH 1EN6A 2QM4A 4JI3B 2Q9LA 3K0GA 2QKSA 4UCVA 4LWSA 3EHBB 4DR4B 2E5LB 1QVFU 5B1BC 3APOA 5E79Z 1XNRB 2JDIG 3CWBH 4MTXA 1VQNV 1GN6A 1GH6A 2DWDC 1YJNV 1P7BA 1JJ2U 1GM9A 3SJAC 1N32O 4K8ZA 4O4HA 3STLC 1FXHA 4KUMA 5H5NA 4B7KA 1Q86W 3QO5A 1KU9A 2QE7G 4AI8A 2LGWA 4BW9A 3HKBA 2N74A 4LBEC 3O65A 4DV5B 4JI6B 4AQYO 4J9YB 1IXMA 4GKJB 1SC5B 3WB2A 4QE7A 1XMOB 4NVPA 3K59A 2EIMB 1XNQB 1I94O 4J41A 4NB5A 1K4DC 3ABTA 3TETA 4WCEV 4UB6Z 2YXYA 2WLNA 4DRXB 3FFQA 5B1BB 4GUNA 1SESA 5B3SB 4LF4O 3AG3C 4FPPA 1FYJA 4X1KB 4Z2WA 4GKJO 1H2KA 4EB6A 3CCQV 1Q5OA 1ENVA 1SQXH 3LSQA 5H6QA 4WFFA 3I5DA 5LXTA 1VQ4V 1SQQH 4I5SA 3JCZA 4FLTA 4DUZO 3RWRD 1QR9A 2HJDA 3CX5F 3H1IH 1VQPV 3F7YC 3K03A 1LNQA 1ZLZA 2X0LA 3HKDB 1FJGB 4UUJC 1NVPB 1EBOA 1N36O 3GB7C 4YY3O 1YTFB 2FTKA 3E35A 2JGDB 5CA0B 2BSKB 4GCZA 1W2BU 4N23A 2B9ZA 4DR3O 1TGOA 1YVWA 1FD9A 4JTCB 4DK0A 4LF4B 3QTCA 1BQZA 4MW3A 1CXZB 2Z0AA 2ATKC 3JAKB 1R6NA 2CK3G 5IYDO 2RCVA 1KUQA 2X6BA 1WP8A 4N21A 2P4VA 4RUEA 4UVAA 1WNSA 4GX0A 1JX9A 2DWEC 4MVRA 2XOKG 4CH5A 2PGGA 2CUGA 4YIPA 1MNGA 3HKCB 4O4LA 4PI0A 2YI9A 4NR1A 2ZR3A 4QIWF 4L87A 2IJIA 2JIZG 3K79A 1UFIA 3SJQC 3ZS8C 3SGIA 4TQFA 2F23A 1J5EO 4ASUG 4P9PA 2IJKA 1GAXA 3T4ZA 1Q7YW 5IJ0A 3JATB 1PNLA 3JYCA 1G8MA 4B3SB 2EILB 3J80N 2ZNJA 2L6LA 4G28B 2F43G 1S0VA 3OTOO 1NTMH 5LMUO 4UCRA 1J95A 1BZKA 1J5EB 2YEVB 3OGCC 1HWYA 1N34O 2X6CA 1JCHA 3ABKC 2CH7B 4W4LA 2GUZB 1YDXA 1KP3A 4DRXA 3VQXA 2IW5A 2CTWA 3SYOA 3JAWB 2IH3C 3WB0A 4FJCC 4EB6B 1LUVA 1YF2A 2UU9B 2ODMA 2R9RB 2QTSA 1QU7A 2AW9A 2GDSA 3W7WA 4O4LB 1VQ7V 1PL0A 4JYCA 1F23A 2EJ7A 3C90A 1WAZA 5KHHA 4O4HB 3ZX6A 1OCRB 2PI5A 1DTOA 2ZE5A 3OTFA 3TXQA 3AG2C 4GLXA 1BE3H 3FAVB 2EZOA 4PELA 5JQGB 2A79B 4JPRA 3TJTA 3P3NA 4EEQA 5L3EA 3D3IA 3GWKC 4DV1O 5LHIA 1TA8A 5F2VO 3OM3B 5IJ9A 2PY5A 3P30A 2QWPB 2CE4A 4LC1A 3AK3A 3ZMTA 5KHIA 2E76B 4DR6B 2A06H 3A0HZ 1Y76B 4MVOA 5CA0A 1BGYH 5LYJB 3ZMZA 4J11A 1GO3F 1HDJA 1VARA 1PD3A 2XNDG 2UUCO 4UCUA 3I56V 2ZKOA 3I55V 3AG2B 1N34B 2Q69A 1ROPA 3OEEG 1Y66A 5LA6B 3QO8A 4I0XA 5EBMC 5IDJA 1WB7A 3D36C 2AZ2A 4NTYA 1Y67A 3WU2Z 5CA1B 1AR4A 4LF7O 3SYQA 2UXXA 1IZ3A 1TUBA 2XAJA 3JARA 4JI4O 4U3FH 4PDRA 1OZ0A 2E75B 4R50A 4PI2A 5LL6Y 1F7YA 4OX9B 3W7XA 1S76D 2CGOA 4U7NA 1ZAUA 2UXDB 1XBLA 4DK1A 3CCJV 1Z5VA 1VQOV 2LFRA 1VF6C 4P9OA 1BS3A 4NTWA 2EIKC 2DYSC 3HKCA 4WBNB 3ZBHA 4X9QA 2QM7A 3WFVA 3CSXA 4DV5O 1BL8A 1VP7A 4O4IB 5J2TA 3IC9A 2KG7B 2A3QA 1YCIA 2WSSG 3BHPA 4X1IB 3BEHA 4K0KO 1VMGA 3E8GA 3UT5B 5CBFA 5LGUA 3B40A 1VQLV 4DV6O 4JI6O 4BIOA 4MSWC 1Q6IA 2OIEA 4IYIA 2ZDIA 2VS0A 4NXNO 4PV1B 4HAMA 2HVKC 3OR6C 2WLIB 5IYBO 3JARB 2VWKA 3RFRA 3ASOB 2Q5ZA 1SA0A 3UQ8A 4H13B 5EBLC 4FM2A 3DC5A 3K04A 2DYSB 3J7AU 4DV2O 1BT8A 3SR2C 5BMVA 2EBOA 5E1AC 1XL4A 2JS3A 5D5QA 1KB9F 4DR1B 1JJOA 5LHHA 1EZVH 4J80A 2CH7A 4G2KA 4IHJA 4H44B 2DJVA 5C8YB 1YTFD 3IJ4A 3OAAG 1B6QA 5JJEB 1M9NA 3CMAV 1YI2V 3WG7B 1AI5A 3OGIB 2ITDC 1AROP 1GMGA 5KUMA 3ZHSA 4I55A 2WPDG 4F4LA 5IWAB 1VQKV 3S3XA 4FIPC 2P67A 4JI2O 3LUTB 4X62O 4U3JB 1SRYA 4B3MO 5EIBC 2W0FC 4JI5B 3ZMSA 5LGTA 1PNMA 2LJ2A 3JAMN 1VF7A 1GN2A 1GM8A 1RPRA 2H3OA 1XMOO 1WP7A 3L9DA 2FB5A 5FNVB 3SPGA 4DR5B 5KA5A 1H2MA 2DQ0A 3J81N 1SETA 1Q3EA 4PD4F 1AJQA 1K7DA 5DN6G 5EZYB 3CEIA 5DECA 4LF5B 2AZ0A 1XREA 3CE2A 2W6JG 5C93A 1ZTEA 2Q0OC 2QWNB 2DN9A 2JGDA 3SDLA 4DR7B 1X59A 4QPKA 1L8DA 4I7ZB 5L3GA 4DUZB 4YJ3A 4DW1A 4QGPA 5BZBA 3AK2A 5J9PC 3MDSA 2R9AA 1KKCA 1HNXO 1WLEA 1US6A 5LOVB 3QO7A 4B3RO 3OD4A 1RM1C 4LF8B 1ZWIC 3HKEB 3ZHVA 4LR3A 1XMQO 3U10A 3BA8A 2EX3A 1SQFA 4I55B 5KMGA 1DLBA 1XILA 1HW7A 3K06A 1GKFA 5KX5A 2NNUA 3JALB 3L70H 5JCOC 4TUYB 1YIJV 2DOSA 1AI4A 2PF4E 3FD9A 4G27B 3VQVA 1Y74A 3LNMB 4MW8A 4RO2A 1N0NA 2BTQB 4JI5O 1K73W 1H8EG 4I4TA 1S5LZ 2HJFC 3VBBA 1F51A 4O4IA 5J2TB 5FLXN 1RM1B 5HFMA 1QBZA 3OMNB 1MG1A 5EK0A 2IU0A 1B06A 2WLJA 1AVMA 3K57A 3ZHUA 1S3JA 3FAVA 1N32B 1URFA 3F5TA 2Y4UA 1DK1A 5K1XA 3T4DA 3CCLV 3L74H 3H9VA 3VQYA 1Q8IA 2UUAO 3R65A 5JVDA 1WPBA 4LF8O 1I0HA 2RDCA 4L8JA 4MVMA 1JMKC 1VQMV 4DV7O 3OFNG 1G4YB 1RSOA 4OPAA 4RAIA 1K4CC 5CB4B 1Q6UA 4JI1B 4FFKA 2HR3A 3IGAC 4DV1B 3JALA 3CHXA 4GZRB 3IC7A 1KYOF 4FZ0A 4FM0A 1XOUA 3D3QA 1IX9A 3CMEV 1NZ6A 2EJRA 5LYJA 3WB1A 1XI1A 2HHHO 1YJ9V 1Y76A 1PPJH 3M8AA 3CC7V 3RYCB 3Q4HA 5DM6V 3MAQA 1VIBA 4KP4A 4TWKA 2UUCB 1AP6A 3SPHA 3S3WA 4J7JA 1OV9A 2X7RB 3JATA 1FAFA 1H2GA 3FYIB 1R6TA 1N4CA 1I08A 5EC1C 2CTRA 5CB4A 2ZE6A 1RSOB 4XBFA 3L72H 1ORQC 3H01A 5KHKA 2Q0AA 2ZIOA 3CP1A 2BCCH 4WBNA 2NN4A 1YJWV 1Q43A 2XAGA 5FNVA 1JPXA 3VOUA 3QF7A 4O2AA 2LFSA 1K8AW 1PNKA 2KG7A 5CN0A 3UO3A 2WAMA 3MD0A 1Z5WA 3CCEV 1DF4A 4X62B 2BSKA 4DR6O 4JV5O 1H2NA 4UVBA 1HNWB 1BMFG 1W0KG 2ZCEA 2AHYA 3IAYA 1OCRC 2L35A 1HNZB 5KLVH 3OE7G 1EZJA 4MT8A 3ZHQA 1SKVA 3R66A 1QVGU 1A32A 4UFZA 2OT5A 4LWSB 4ZBMA 1H2SB 2NLJC 2O57A 1HNXB 2VQEO 4TV9B 5GONA 2YUAA 3K5MA 3RYFB 4DUYB 4DR4O 2IJJA 3DTUB 1UPGA 2HEPA 3G4SV 3TXSA 2ETNA 2W0XA 3N2KB 4LF9B 2WLKA 2XAHA 3RYCA 2ILMA 1R3IC 4TUYA 2IJHA 2F95B 4CS2A 1GN3A 4DV7B 4TV9A 3AG1C 4CH6A 2UU9O 1N8RW 5IJ9B 4F6RB 4UV9A 4JI2B 4JTDB 2OCHA 1NVPD 3BRCA 3FB7C 4GKKB 4FLXA 4HNAA 1WN7A 3K0DA 4I50A 1H38A 4JI3O 2YIAA 2QTOA 1AR5A 2BE3A 4MTOA 4NXMO 2QKAA 5JCOA 3L73H 3CJHB 5LP6C 3UCSC 2P90A 3T1CA 1RPOA 4BAYA 3P3PA 4H33A 4KXRA 1WJZA 4WFBV 2ZDIC 3U11A 4TQDA 1FFXB 2HFEC 1JOYA 2CTQA 3STZC 2EIKB 5EYPB 1KECA 2QWOB 4I50B 3ABMB 5BXZA 1MOFA 1XHZA 2JJ2G 3RYIB 5KUKA 1GTOA 4F6RA 3K5LA 3PJSK 4UB8Z 2N05A 1Z2GA 3HB3B 2MK3A 1OCZC 3KCXA 1VQ9V 4J9ZB 4RUFA 1PKXA 4LP8A 3OR7C 1N0JA 2QGNA 5LP6B 3SYPA 2Q7HA 1V55C 2PZSA 1XEQA 3JD3A 5BMVB 2CTPA 1GN4A 4LFBB 4LFAB 4R6ZA 4O4JA 2LW1A 2HHHB 3ASOC 1R3KC 2JVDA 3K3WA 5KAIZ 3C3SA 2QWQB 5LOVA 5FPRA 1O9GA 1R3JC 1THZA 3ZIAG 5KX5B 3ABMC 5TISZ 1NTZH 2GBOA 4FK5C 4GX1A 4B3TO 1MSDA 1T5EA 5L3FA 5LMNB 3FX7A 1MABG 2WWWA 1MA1A 4BWAA 2EULA 4XDKA 3UKMA 1KBHA 2B1IA 1OCZB 2K1EA 1NT2B 5K1PA 3W7SA 1OJHA 2RQ6A 2ZE8A 1SZTA 1ZUQA 1M93A 2JEUA 4HYOA 4KL1A 4DR3B 3RN4A 4O2AB 1VF6A 2QKCA 5KHGA 5BR8B 2V1DA 4GYCB 4UCTA 1XL6A 3ASNC 5B66Z 4GKKO 1NS1A 3JSLA 4JI0B 2PUSA 2XAFA 4LF6O 1OHHG 1FJGO 4NXMB 2KKWA 2YXLA 1KC8W 2PYJA 1E1QG 2OCCC 2FKXA 4ZI7B 4WFGA 1PP9H 2DMXA 1YHQV 1KP2A 1PV0A 2VRZA 4OXSA 2D2CB 1D2DA 1QR8A 1Q82W 4GT1A 5CA1A 3UM7A 1UJWB 1R6KA 2F66C 1NH2D 4I9WA 1IXBA 3HKDA 1MSWD 1NR1A 1GM7A 2IBZH 4DW0A 1I5YA 1R73A 4TSFG 4OPHA 2P22C 1TUBB 1S5JA 3T1HB 4HNAB 2KSDA 3JAWA 4WFAV 4UCOA 5IYZA 3ASNB 1HP8A 5EC2C 3BVOA 3ZCCA 4FLUA 2YI8A 4QNHB 4LH6A 2OTLV 5AG2A 2QEXV 5IJ0B 5L3BA 4DV6B 4JYAO 3ABUA 2WLHA 2ZM6B 1NTKH 3C3TA 2OCCB 2WLIA 3G71V 4X88A 5ITZA 1V54C 4X64B 5J2UA 1BHAA 3F5WC 4DYLA 1OCCC 1YXBA 5EIBD 2M6YA 4RQFA 4E2LA 4YXWG 3RGBA 4X65O 4EFBA 1WA8A 3CCSV 5IYZB 2OYQA 4DV0B 1IBKB 2VWJA 3NXSA 3G6EV 2Y48A 4X1IA 5JWPA 2YICA 2ZM6O 2UUBO 1NBMG 3CC4V 4Q6GA 2CDYA 3CRMA 3OT7A 3ZRVA 4NXNB 1E79G 4KHPO 2B5UA 2KB1A 2XHBA 4O2BB 4OX9O 3CC2V 3RBZA 2LW7A 4C7UA 4MTGA 1XHXA 3RYIA 2X6AA 1XNQO 3KKYA 2QJ1A 3D36A 2GTSA 5BY1A 5JH7A 2P5OA 3BCCH 3EXAA 2VQFB 3APQA 1M5IA 5CBHA 4CH3A 1CEZA 3N2GA 2P4KA 5IY5C 2C2AA 3FKSG 1NH2B 1NJIW 3A0BZ 3A0RA 2E3CA 1ZL8A 3JAKA 1OCCB 2HKOA 4X8AA 2PYLA 2FMLA 1XDCA 1K5QA 2QWRB 1Y74B 4X64O 5J2UB 3AK1A 1EN4A 1FXKB 4UCSA 3E8BA 1S72V 2LQTA 3MHSC 1OCOB 1N33O 3ABLC 3ZN1A 3EVKA 3K9AA 1AR1B 4IHJB 2A9HA 3ZRWA 1FFTB 1MZEA 2JK5C 3HR0A 1K92A 2LP7A 3TCUA 2Y4TA 3N2KA 3CD6V 1Y6XA 3OMAB 1D5AA 1L0LH 3SPCA 4BIUA 2IU3A 4DV3B 5CMUA 5LA6A 4JV5B 1Q90D 4CC5A 2H8PC 4HZ3A 3E22A 4JYBA 5IY5B 1K34A 1FXKA 3E83A 1YEWA 5LGNA 2B1GA 2R9IA 1AP5A 3OTOB 4PDLA 1YITV 4ZHQB 2QDOA 3K08A 3CCRV 4CBCA 3CCUV 4WFHA 2Q68A 2RJZA 1M56C 1TVKA 2JEXA 1OCOC 3E89A 2DW4A 3BPZA 3ABLB 1FFXA 4K8XA 4PDMA 2GHYA 1BQ0A 3U0ZA 1FKAO 3SJCC 3L75H 4Z1MG 1DGSA 3K5OA 4X65B 1DF5A 1IBLO 3KZIZ 4IT5A 2K9PA 2YSUB 3H1JH 1YZBA 4K3AA 4E4EA 2Q7EA 5EYPA 4B3TB 1K9MW 2EIJC 3CB2A 3B77A 3ETQA 4DV4B 1CPYA 2ZXWB 4ABMA 3HKBB 2RNBA 1JVMA 4DR2B 2BTQA 3W7TA 1NQTA 5LHGA 4ZHQA 5JJJB 2F4VO 4LFAO 4NYKA 4LFCB 4JI8B 5GTIZ 4ZKIA 1L0NH 3E22B 1TVKB 4DV0O 1IBKO 4PA6A 3B8MA 5HFLA 4I4TB 1VEWA 5C8YA 2GTAA 3BAAA 4U3JA 2P6JA 2JJ1G 2W6IG 4F6EA 4RWUA 1LR1A 3RT3C 4I0XB 4DXWA 1ZSPA 4JI1O 3F7VC 4BR6A 4FFBB 3ZMUA 4EKWA 4FVMA 2EIJB 4PA9A 4IYHA 1WB8A 1GK9A 1WPXA 4MS2A 1N36B 4YJ3B 4FZ1A 1HR0O 1RFYA 1QLEB 2YC0A 4OGQB 5CA3A 2ADQB 2YIBA 3AG1B 5B1AC 3GWOA 5LXTB 1D5NA 2BOCC 3RYFA 1NI8A 4LF6B 2UUBB 2Y69C 5JJNB 5FL7G 1FS0G 1F4MA 4GX2A 2A0LA 1JR9A 3JD0A 2R70A 3ETDA 3D8CA 5JVDB 1YSCA 1W59A 2NR5A 3JSNA 1KQSU 4D7SA 3RYHA 2OWOA 2GV9A 1Q6HA 3SYAA 4D7TA 4W4KA 4AQYB 1EN5A 1SZXA 2ZR2A 5B1NA 4WF9V 5JH7B 3QG5A 4QJFB 3CS5A 1U96A 5IT9N 4JAAA 1QLEC 1XMQB 4CS3A 3LDDA 1M57C 4AILC 2BTOA 2GUZA 4X66B 2HP8A 2Q8VA 3THOA 2AHZA 3AG7A 3DSQA 2UXNA 4QE9A 2Y69B 3ZN0A 4CH4A 1SF9A 4Q20A 2V4DA 1N33B 1Y4MA 1QCEA 1VF5B 2WA3A 1SS3A 2P06A 3CCVV 3LDEA 1P84F 1V55B 3OEHG 4D6TH 3G6BA 3G67A 3AEIA 3FB6C 4MVZA 1U97A 2IH1C 2DE0X 4UXNA 4X1KA 4CC6A 4B7EA 5B1OA 2WLMA 3SPIA 3OW2U 1P7GA 1M57B 4JI7B 3ZJZA 1IDSA 3ETEA 2ZD9A 1EM1A 2F4VB 1VQ6V 5GONB 2AXTZ 4KHPB 2YS8A 5LMUB 1SQGA 5GTHZ 4J7ZA 3EFFK 4MVUA 1G1XB 3G80A 4X20A 2LO1A 5D5PA 3SPJA 2DQ3A 2EIMC 4EFEA 1IVSA 3N2GB 3E2EA 4PA4A 4PHZA 2Q7GA 5L3DA 5BR8O 5IYCO 1AILA 5B3SC 3AG3B 4JYYA 3UO2A 2WLLB 1RP3B 4ZOLA 1TAEA 5KAFZ 3QNEA 4O2BA 4J42A 4PDVA 4NKGB 3LNNA 3CPWU 3W7UA 2ARHA 3ZEDA 1VQ8V 4PA3A 1K3EA 4JGSA 2JGUA 2VQFO 3M99B 2GSMB 3L71H 1Q81W 4JAUA 3HKEA 3ETGA 1MMMA 3Q4HB 3LDCA 4DV3O 3H1KH 2V7QG 4MVSA 2Q6AA 1E1RG 4FM1A 4X1YB 1BSMA 3OUSA 3BA9A 4JI8O 4LFCO 4AHCA 3LSUA 1H2LA 2WLLA 4J10A 2H94A 4DR1O 1HR0B 2UXBO 2YIBD 4JI7O 1V54B 2DYRB 2ZT9B 4IL6Z 3H1HH 1JFFB 1I7FA 2XTAA 2A7WA 2RN9A 3E8HA 4TOIA 1M4UA 4X66O 4JAVA 4GX5A 5DEDA 4FMTA 1QLNA 5EZYA 4IIJA 2M7WA 3ZRXA 1B04A 3RYHB 2Q73A 2CGNA 1HNWO 3RVZA 3H1LH 4B3RB 4UV8A 2Y0PA 3A8TA 1IBLB 3T2MA 2XAQA 5LMNO 3DXRA 1M1KW 3JD2A 3JD4A 1JFFA 4JYAB 2UXCO 3K5NA 4IGGA 2EINC 4TV8B 3IFXA 3CRQA 4P2ZA 4FLVA 4DR2O 1R1BA 4H0LB 4K35A 2DYRC 4JZ2A 4KFMA 1V9PA 2EILC 4I9QA 4YJ2A 2HVJC 5ITZB 5A2QN 3ZHTA 4NTXA 2QSAA 4PJ0Z 4U7OA 2PTMA 2JS5A 1JQ0A 5H9CA 1IURA 1FXKC 1NU1H 1K33A 1SQBH 3N27A 4ZIBA 2HLDG 5H2FZ 1COWG 3ABKB 2YXHA 1PL4A 5IE9A 1JA8A 3KG2A 2UXDO 1L1FA 4DR7O 1G6UA 3B2EE 3QVNA 4LCUC 3RW0A 2Z3YA 4JASA 3GVMA 3ZMVA 1SQVH 1KD1W 4YJ2B 1AJPA 5CBGA 1I5XA 4JZGA 2F93B 1PM9A 2EINB 2E5LO 2OIGA 3ICXA 4QPJA 4Z1VA 1ZL8B 1SA0B 3ML0A 3NR7A 4WFEA 4RQEA 1XNRO 1M90W 2LGQA 4JI4B 3B8NA 2YIDA 3OUFA 3RVYA 2E74B 3BY6A 4DO2A 3O9OA 2CAZC 1M56B 4ZOLB 1GRJA 4LH7A 3CCMV 4UVCA 5B5EZ 3B09A 2UXCB 1IBMO 3LSSA 2Y0IA 1W0JG 3A2FA 1K97A 3OMIB 2QA4V 3T1YB 3DGEA 2G38A 3CYOA 5FPOA 2MW2B 2VQEB 5IWAO 4YHHO 1AI7A 4MTFA 4J7KA 1NR7A 2KQXA 3CXCU 3JD1A 1P4RA 4HBNA 1ZX3A 1WA8B 2ZQMA 3B4SA 2XUMA 1KMIZ 1QQCA 2Z5UA 1O9HA 2ZXWC 4LF9O 1K5SA 4DV2B 3K58A 4X1YA 1AI6A 2AGAA 2JRIA 5EBWC 2XT9A 3AG4B 2HG5C 4FLYA 1SQPH 5A9GA 2F1MA 1HNZO 2XASA 2QR4A 2YDEA 2EZPA 4MVQA 1H8HG 4LNUB 3CXHF 3X2QB 4CZZA 1P49A 2Q67A 3P32A 4H37A 1AB3A 4K0KB 4JTAB 1AJNA 1BCCH 2QM8A 4DUYO 4XDJA 4FLZA 4FFBA 5KHJA 1QNMA 2FYUH 4LFBO 1S77D 2OTJV 3ZHRA 2RMKB 5KMGB 3K9SA 4BIZA
chains in the Genus database with same CATH topology
5GTIZ 5GTHZ 4UB8Z 5TISZ 3WU2Z 3A0BZ 4UB6Z 5B66Z 5KAFZ 5E79Z 4PJ0Z 5B5EZ 5H2FZ 5KAIZ 4IL6Z 1S5LZ 3A0HZ 3KZIZ 3JCUZ 2AXTZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GTI Z;  5GTH Z;  4UB8 Z;  5TIS Z;  3WU2 Z;  3A0B Z;  4UB6 Z;  5B66 Z;  5KAF Z;  5E79 Z;  4PJ0 Z;  5B5E Z;  5H2F Z;  5KAI Z;  4IL6 Z;  1S5L Z;  3A0H Z;  3KZI Z;  3JCU Z;  2AXT Z; 
#chains in the Genus database with same CATH topology
 2ITC C;  3E86 A;  1EFR G;  3ZRW B;  1KKD A;  4B3M B;  2UXB B;  3SYC A;  1I94 B;  5L3C A;  1B3Q A;  2PI4 A;  2FL4 A;  3KCY A;  4ZI7 A;  1R3L C;  4LF5 O;  2IM9 A;  3AG4 C;  3BAB A;  3SJB C;  4YIO A;  1LUW A;  3JAS A;  3DXR B;  1TUE B;  3CRC A;  5B1A B;  1S5H C;  3TK1 A;  2Q4P A;  4YHH B;  3CRR A;  1SER A;  3ZRS A;  4X89 A;  4BW5 A;  4FLW A;  3BFR A;  4JF3 A;  4DR5 O;  4ICG A;  4DV4 O;  4X20 B;  4TV8 A;  3DC6 A;  3UT5 A;  4B3S O;  3X2Q C;  2WA4 A;  1XUQ A;  4JI0 O;  5JQG A;  4IIJ B;  3T1H O;  1FPO A;  3CRA A;  3E8F A;  4CS4 A;  4PA7 A;  2ZIN A;  5LBQ A;  2P7T C;  2UUA B;  1VQ5 V;  3PN1 A;  5GW7 A;  4B08 A;  3FYE B;  1XQ8 A;  3MHH C;  2ZNI A;  1NKD A;  3VQW A;  3CJH A;  3JAS B;  2D3O W;  4A5U B;  2R72 A;  2ZE7 A;  5KA6 A;  1QHT A;  1FXV A;  4TT3 G;  4LF7 B;  3JCU Z;  4P30 A;  1F4N A;  3T1Y O;  2N04 A;  1MZF A;  3FB8 C;  1BHB A;  1X4T A;  4LNU A;  4XDL A;  2ZIM A;  4O4J B;  2BOB C;  4R8C A;  3WG7 C;  3M7M X;  4R7C A;  4YY3 B;  3FB5 C;  1CP9 A;  3HPL C;  5LP6 A;  5H6R A;  1IBM B;  2ADP A;  2YEV A;  3TGU H;  1EN6 A;  2QM4 A;  4JI3 B;  2Q9L A;  3K0G A;  2QKS A;  4UCV A;  4LWS A;  3EHB B;  4DR4 B;  2E5L B;  1QVF U;  5B1B C;  3APO A;  5E79 Z;  1XNR B;  2JDI G;  3CWB H;  4MTX A;  1VQN V;  1GN6 A;  1GH6 A;  2DWD C;  1YJN V;  1P7B A;  1JJ2 U;  1GM9 A;  3SJA C;  1N32 O;  4K8Z A;  4O4H A;  3STL C;  1FXH A;  4KUM A;  5H5N A;  4B7K A;  1Q86 W;  3QO5 A;  1KU9 A;  2QE7 G;  4AI8 A;  2LGW A;  4BW9 A;  3HKB A;  2N74 A;  4LBE C;  3O65 A;  4DV5 B;  4JI6 B;  4AQY O;  4J9Y B;  1IXM A;  4GKJ B;  1SC5 B;  3WB2 A;  4QE7 A;  1XMO B;  4NVP A;  3K59 A;  2EIM B;  1XNQ B;  1I94 O;  4J41 A;  4NB5 A;  1K4D C;  3ABT A;  3TET A;  4WCE V;  4UB6 Z;  2YXY A;  2WLN A;  4DRX B;  3FFQ A;  5B1B B;  4GUN A;  1SES A;  5B3S B;  4LF4 O;  3AG3 C;  4FPP A;  1FYJ A;  4X1K B;  4Z2W A;  4GKJ O;  1H2K A;  4EB6 A;  3CCQ V;  1Q5O A;  1ENV A;  1SQX H;  3LSQ A;  5H6Q A;  4WFF A;  3I5D A;  5LXT A;  1VQ4 V;  1SQQ H;  4I5S A;  3JCZ A;  4FLT A;  4DUZ O;  3RWR D;  1QR9 A;  2HJD A;  3CX5 F;  3H1I H;  1VQP V;  3F7Y C;  3K03 A;  1LNQ A;  1ZLZ A;  2X0L A;  3HKD B;  1FJG B;  4UUJ C;  1NVP B;  1EBO A;  1N36 O;  3GB7 C;  4YY3 O;  1YTF B;  2FTK A;  3E35 A;  2JGD B;  5CA0 B;  2BSK B;  4GCZ A;  1W2B U;  4N23 A;  2B9Z A;  4DR3 O;  1TGO A;  1YVW A;  1FD9 A;  4JTC B;  4DK0 A;  4LF4 B;  3QTC A;  1BQZ A;  4MW3 A;  1CXZ B;  2Z0A A;  2ATK C;  3JAK B;  1R6N A;  2CK3 G;  5IYD O;  2RCV A;  1KUQ A;  2X6B A;  1WP8 A;  4N21 A;  2P4V A;  4RUE A;  4UVA A;  1WNS A;  4GX0 A;  1JX9 A;  2DWE C;  4MVR A;  2XOK G;  4CH5 A;  2PGG A;  2CUG A;  4YIP A;  1MNG A;  3HKC B;  4O4L A;  4PI0 A;  2YI9 A;  4NR1 A;  2ZR3 A;  4QIW F;  4L87 A;  2IJI A;  2JIZ G;  3K79 A;  1UFI A;  3SJQ C;  3ZS8 C;  3SGI A;  4TQF A;  2F23 A;  1J5E O;  4ASU G;  4P9P A;  2IJK A;  1GAX A;  3T4Z A;  1Q7Y W;  5IJ0 A;  3JAT B;  1PNL A;  3JYC A;  1G8M A;  4B3S B;  2EIL B;  3J80 N;  2ZNJ A;  2L6L A;  4G28 B;  2F43 G;  1S0V A;  3OTO O;  1NTM H;  5LMU O;  4UCR A;  1J95 A;  1BZK A;  1J5E B;  2YEV B;  3OGC C;  1HWY A;  1N34 O;  2X6C A;  1JCH A;  3ABK C;  2CH7 B;  4W4L A;  2GUZ B;  1YDX A;  1KP3 A;  4DRX A;  3VQX A;  2IW5 A;  2CTW A;  3SYO A;  3JAW B;  2IH3 C;  3WB0 A;  4FJC C;  4EB6 B;  1LUV A;  1YF2 A;  2UU9 B;  2ODM A;  2R9R B;  2QTS A;  1QU7 A;  2AW9 A;  2GDS A;  3W7W A;  4O4L B;  1VQ7 V;  1PL0 A;  4JYC A;  1F23 A;  2EJ7 A;  3C90 A;  1WAZ A;  5KHH A;  4O4H B;  3ZX6 A;  1OCR B;  2PI5 A;  1DTO A;  2ZE5 A;  3OTF A;  3TXQ A;  3AG2 C;  4GLX A;  1BE3 H;  3FAV B;  2EZO A;  4PEL A;  5JQG B;  2A79 B;  4JPR A;  3TJT A;  3P3N A;  4EEQ A;  5L3E A;  3D3I A;  3GWK C;  4DV1 O;  5LHI A;  1TA8 A;  5F2V O;  3OM3 B;  5IJ9 A;  2PY5 A;  3P30 A;  2QWP B;  2CE4 A;  4LC1 A;  3AK3 A;  3ZMT A;  5KHI A;  2E76 B;  4DR6 B;  2A06 H;  3A0H Z;  1Y76 B;  4MVO A;  5CA0 A;  1BGY H;  5LYJ B;  3ZMZ A;  4J11 A;  1GO3 F;  1HDJ A;  1VAR A;  1PD3 A;  2XND G;  2UUC O;  4UCU A;  3I56 V;  2ZKO A;  3I55 V;  3AG2 B;  1N34 B;  2Q69 A;  1ROP A;  3OEE G;  1Y66 A;  5LA6 B;  3QO8 A;  4I0X A;  5EBM C;  5IDJ A;  1WB7 A;  3D36 C;  2AZ2 A;  4NTY A;  1Y67 A;  3WU2 Z;  5CA1 B;  1AR4 A;  4LF7 O;  3SYQ A;  2UXX A;  1IZ3 A;  1TUB A;  2XAJ A;  3JAR A;  4JI4 O;  4U3F H;  4PDR A;  1OZ0 A;  2E75 B;  4R50 A;  4PI2 A;  5LL6 Y;  1F7Y A;  4OX9 B;  3W7X A;  1S76 D;  2CGO A;  4U7N A;  1ZAU A;  2UXD B;  1XBL A;  4DK1 A;  3CCJ V;  1Z5V A;  1VQO V;  2LFR A;  1VF6 C;  4P9O A;  1BS3 A;  4NTW A;  2EIK C;  2DYS C;  3HKC A;  4WBN B;  3ZBH A;  4X9Q A;  2QM7 A;  3WFV A;  3CSX A;  4DV5 O;  1BL8 A;  1VP7 A;  4O4I B;  5J2T A;  3IC9 A;  2KG7 B;  2A3Q A;  1YCI A;  2WSS G;  3BHP A;  4X1I B;  3BEH A;  4K0K O;  1VMG A;  3E8G A;  3UT5 B;  5CBF A;  5LGU A;  3B40 A;  1VQL V;  4DV6 O;  4JI6 O;  4BIO A;  4MSW C;  1Q6I A;  2OIE A;  4IYI A;  2ZDI A;  2VS0 A;  4NXN O;  4PV1 B;  4HAM A;  2HVK C;  3OR6 C;  2WLI B;  5IYB O;  3JAR B;  2VWK A;  3RFR A;  3ASO B;  2Q5Z A;  1SA0 A;  3UQ8 A;  4H13 B;  5EBL C;  4FM2 A;  3DC5 A;  3K04 A;  2DYS B;  3J7A U;  4DV2 O;  1BT8 A;  3SR2 C;  5BMV A;  2EBO A;  5E1A C;  1XL4 A;  2JS3 A;  5D5Q A;  1KB9 F;  4DR1 B;  1JJO A;  5LHH A;  1EZV H;  4J80 A;  2CH7 A;  4G2K A;  4IHJ A;  4H44 B;  2DJV A;  5C8Y B;  1YTF D;  3IJ4 A;  3OAA G;  1B6Q A;  5JJE B;  1M9N A;  3CMA V;  1YI2 V;  3WG7 B;  1AI5 A;  3OGI B;  2ITD C;  1ARO P;  1GMG A;  5KUM A;  3ZHS A;  4I55 A;  2WPD G;  4F4L A;  5IWA B;  1VQK V;  3S3X A;  4FIP C;  2P67 A;  4JI2 O;  3LUT B;  4X62 O;  4U3J B;  1SRY A;  4B3M O;  5EIB C;  2W0F C;  4JI5 B;  3ZMS A;  5LGT A;  1PNM A;  2LJ2 A;  3JAM N;  1VF7 A;  1GN2 A;  1GM8 A;  1RPR A;  2H3O A;  1XMO O;  1WP7 A;  3L9D A;  2FB5 A;  5FNV B;  3SPG A;  4DR5 B;  5KA5 A;  1H2M A;  2DQ0 A;  3J81 N;  1SET A;  1Q3E A;  4PD4 F;  1AJQ A;  1K7D A;  5DN6 G;  5EZY B;  3CEI A;  5DEC A;  4LF5 B;  2AZ0 A;  1XRE A;  3CE2 A;  2W6J G;  5C93 A;  1ZTE A;  2Q0O C;  2QWN B;  2DN9 A;  2JGD A;  3SDL A;  4DR7 B;  1X59 A;  4QPK A;  1L8D A;  4I7Z B;  5L3G A;  4DUZ B;  4YJ3 A;  4DW1 A;  4QGP A;  5BZB A;  3AK2 A;  5J9P C;  3MDS A;  2R9A A;  1KKC A;  1HNX O;  1WLE A;  1US6 A;  5LOV B;  3QO7 A;  4B3R O;  3OD4 A;  1RM1 C;  4LF8 B;  1ZWI C;  3HKE B;  3ZHV A;  4LR3 A;  1XMQ O;  3U10 A;  3BA8 A;  2EX3 A;  1SQF A;  4I55 B;  5KMG A;  1DLB A;  1XIL A;  1HW7 A;  3K06 A;  1GKF A;  5KX5 A;  2NNU A;  3JAL B;  3L70 H;  5JCO C;  4TUY B;  1YIJ V;  2DOS A;  1AI4 A;  2PF4 E;  3FD9 A;  4G27 B;  3VQV A;  1Y74 A;  3LNM B;  4MW8 A;  4RO2 A;  1N0N A;  2BTQ B;  4JI5 O;  1K73 W;  1H8E G;  4I4T A;  1S5L Z;  2HJF C;  3VBB A;  1F51 A;  4O4I A;  5J2T B;  5FLX N;  1RM1 B;  5HFM A;  1QBZ A;  3OMN B;  1MG1 A;  5EK0 A;  2IU0 A;  1B06 A;  2WLJ A;  1AVM A;  3K57 A;  3ZHU A;  1S3J A;  3FAV A;  1N32 B;  1URF A;  3F5T A;  2Y4U A;  1DK1 A;  5K1X A;  3T4D A;  3CCL V;  3L74 H;  3H9V A;  3VQY A;  1Q8I A;  2UUA O;  3R65 A;  5JVD A;  1WPB A;  4LF8 O;  1I0H A;  2RDC A;  4L8J A;  4MVM A;  1JMK C;  1VQM V;  4DV7 O;  3OFN G;  1G4Y B;  1RSO A;  4OPA A;  4RAI A;  1K4C C;  5CB4 B;  1Q6U A;  4JI1 B;  4FFK A;  2HR3 A;  3IGA C;  4DV1 B;  3JAL A;  3CHX A;  4GZR B;  3IC7 A;  1KYO F;  4FZ0 A;  4FM0 A;  1XOU A;  3D3Q A;  1IX9 A;  3CME V;  1NZ6 A;  2EJR A;  5LYJ A;  3WB1 A;  1XI1 A;  2HHH O;  1YJ9 V;  1Y76 A;  1PPJ H;  3M8A A;  3CC7 V;  3RYC B;  3Q4H A;  5DM6 V;  3MAQ A;  1VIB A;  4KP4 A;  4TWK A;  2UUC B;  1AP6 A;  3SPH A;  3S3W A;  4J7J A;  1OV9 A;  2X7R B;  3JAT A;  1FAF A;  1H2G A;  3FYI B;  1R6T A;  1N4C A;  1I08 A;  5EC1 C;  2CTR A;  5CB4 A;  2ZE6 A;  1RSO B;  4XBF A;  3L72 H;  1ORQ C;  3H01 A;  5KHK A;  2Q0A A;  2ZIO A;  3CP1 A;  2BCC H;  4WBN A;  2NN4 A;  1YJW V;  1Q43 A;  2XAG A;  5FNV A;  1JPX A;  3VOU A;  3QF7 A;  4O2A A;  2LFS A;  1K8A W;  1PNK A;  2KG7 A;  5CN0 A;  3UO3 A;  2WAM A;  3MD0 A;  1Z5W A;  3CCE V;  1DF4 A;  4X62 B;  2BSK A;  4DR6 O;  4JV5 O;  1H2N A;  4UVB A;  1HNW B;  1BMF G;  1W0K G;  2ZCE A;  2AHY A;  3IAY A;  1OCR C;  2L35 A;  1HNZ B;  5KLV H;  3OE7 G;  1EZJ A;  4MT8 A;  3ZHQ A;  1SKV A;  3R66 A;  1QVG U;  1A32 A;  4UFZ A;  2OT5 A;  4LWS B;  4ZBM A;  1H2S B;  2NLJ C;  2O57 A;  1HNX B;  2VQE O;  4TV9 B;  5GON A;  2YUA A;  3K5M A;  3RYF B;  4DUY B;  4DR4 O;  2IJJ A;  3DTU B;  1UPG A;  2HEP A;  3G4S V;  3TXS A;  2ETN A;  2W0X A;  3N2K B;  4LF9 B;  2WLK A;  2XAH A;  3RYC A;  2ILM A;  1R3I C;  4TUY A;  2IJH A;  2F95 B;  4CS2 A;  1GN3 A;  4DV7 B;  4TV9 A;  3AG1 C;  4CH6 A;  2UU9 O;  1N8R W;  5IJ9 B;  4F6R B;  4UV9 A;  4JI2 B;  4JTD B;  2OCH A;  1NVP D;  3BRC A;  3FB7 C;  4GKK B;  4FLX A;  4HNA A;  1WN7 A;  3K0D A;  4I50 A;  1H38 A;  4JI3 O;  2YIA A;  2QTO A;  1AR5 A;  2BE3 A;  4MTO A;  4NXM O;  2QKA A;  5JCO A;  3L73 H;  3CJH B;  5LP6 C;  3UCS C;  2P90 A;  3T1C A;  1RPO A;  4BAY A;  3P3P A;  4H33 A;  4KXR A;  1WJZ A;  4WFB V;  2ZDI C;  3U11 A;  4TQD A;  1FFX B;  2HFE C;  1JOY A;  2CTQ A;  3STZ C;  2EIK B;  5EYP B;  1KEC A;  2QWO B;  4I50 B;  3ABM B;  5BXZ A;  1MOF A;  1XHZ A;  2JJ2 G;  3RYI B;  5KUK A;  1GTO A;  4F6R A;  3K5L A;  3PJS K;  4UB8 Z;  2N05 A;  1Z2G A;  3HB3 B;  2MK3 A;  1OCZ C;  3KCX A;  1VQ9 V;  4J9Z B;  4RUF A;  1PKX A;  4LP8 A;  3OR7 C;  1N0J A;  2QGN A;  5LP6 B;  3SYP A;  2Q7H A;  1V55 C;  2PZS A;  1XEQ A;  3JD3 A;  5BMV B;  2CTP A;  1GN4 A;  4LFB B;  4LFA B;  4R6Z A;  4O4J A;  2LW1 A;  2HHH B;  3ASO C;  1R3K C;  2JVD A;  3K3W A;  5KAI Z;  3C3S A;  2QWQ B;  5LOV A;  5FPR A;  1O9G A;  1R3J C;  1THZ A;  3ZIA G;  5KX5 B;  3ABM C;  5TIS Z;  1NTZ H;  2GBO A;  4FK5 C;  4GX1 A;  4B3T O;  1MSD A;  1T5E A;  5L3F A;  5LMN B;  3FX7 A;  1MAB G;  2WWW A;  1MA1 A;  4BWA A;  2EUL A;  4XDK A;  3UKM A;  1KBH A;  2B1I A;  1OCZ B;  2K1E A;  1NT2 B;  5K1P A;  3W7S A;  1OJH A;  2RQ6 A;  2ZE8 A;  1SZT A;  1ZUQ A;  1M93 A;  2JEU A;  4HYO A;  4KL1 A;  4DR3 B;  3RN4 A;  4O2A B;  1VF6 A;  2QKC A;  5KHG A;  5BR8 B;  2V1D A;  4GYC B;  4UCT A;  1XL6 A;  3ASN C;  5B66 Z;  4GKK O;  1NS1 A;  3JSL A;  4JI0 B;  2PUS A;  2XAF A;  4LF6 O;  1OHH G;  1FJG O;  4NXM B;  2KKW A;  2YXL A;  1KC8 W;  2PYJ A;  1E1Q G;  2OCC C;  2FKX A;  4ZI7 B;  4WFG A;  1PP9 H;  2DMX A;  1YHQ V;  1KP2 A;  1PV0 A;  2VRZ A;  4OXS A;  2D2C B;  1D2D A;  1QR8 A;  1Q82 W;  4GT1 A;  5CA1 A;  3UM7 A;  1UJW B;  1R6K A;  2F66 C;  1NH2 D;  4I9W A;  1IXB A;  3HKD A;  1MSW D;  1NR1 A;  1GM7 A;  2IBZ H;  4DW0 A;  1I5Y A;  1R73 A;  4TSF G;  4OPH A;  2P22 C;  1TUB B;  1S5J A;  3T1H B;  4HNA B;  2KSD A;  3JAW A;  4WFA V;  4UCO A;  5IYZ A;  3ASN B;  1HP8 A;  5EC2 C;  3BVO A;  3ZCC A;  4FLU A;  2YI8 A;  4QNH B;  4LH6 A;  2OTL V;  5AG2 A;  2QEX V;  5IJ0 B;  5L3B A;  4DV6 B;  4JYA O;  3ABU A;  2WLH A;  2ZM6 B;  1NTK H;  3C3T A;  2OCC B;  2WLI A;  3G71 V;  4X88 A;  5ITZ A;  1V54 C;  4X64 B;  5J2U A;  1BHA A;  3F5W C;  4DYL A;  1OCC C;  1YXB A;  5EIB D;  2M6Y A;  4RQF A;  4E2L A;  4YXW G;  3RGB A;  4X65 O;  4EFB A;  1WA8 A;  3CCS V;  5IYZ B;  2OYQ A;  4DV0 B;  1IBK B;  2VWJ A;  3NXS A;  3G6E V;  2Y48 A;  4X1I A;  5JWP A;  2YIC A;  2ZM6 O;  2UUB O;  1NBM G;  3CC4 V;  4Q6G A;  2CDY A;  3CRM A;  3OT7 A;  3ZRV A;  4NXN B;  1E79 G;  4KHP O;  2B5U A;  2KB1 A;  2XHB A;  4O2B B;  4OX9 O;  3CC2 V;  3RBZ A;  2LW7 A;  4C7U A;  4MTG A;  1XHX A;  3RYI A;  2X6A A;  1XNQ O;  3KKY A;  2QJ1 A;  3D36 A;  2GTS A;  5BY1 A;  5JH7 A;  2P5O A;  3BCC H;  3EXA A;  2VQF B;  3APQ A;  1M5I A;  5CBH A;  4CH3 A;  1CEZ A;  3N2G A;  2P4K A;  5IY5 C;  2C2A A;  3FKS G;  1NH2 B;  1NJI W;  3A0B Z;  3A0R A;  2E3C A;  1ZL8 A;  3JAK A;  1OCC B;  2HKO A;  4X8A A;  2PYL A;  2FML A;  1XDC A;  1K5Q A;  2QWR B;  1Y74 B;  4X64 O;  5J2U B;  3AK1 A;  1EN4 A;  1FXK B;  4UCS A;  3E8B A;  1S72 V;  2LQT A;  3MHS C;  1OCO B;  1N33 O;  3ABL C;  3ZN1 A;  3EVK A;  3K9A A;  1AR1 B;  4IHJ B;  2A9H A;  3ZRW A;  1FFT B;  1MZE A;  2JK5 C;  3HR0 A;  1K92 A;  2LP7 A;  3TCU A;  2Y4T A;  3N2K A;  3CD6 V;  1Y6X A;  3OMA B;  1D5A A;  1L0L H;  3SPC A;  4BIU A;  2IU3 A;  4DV3 B;  5CMU A;  5LA6 A;  4JV5 B;  1Q90 D;  4CC5 A;  2H8P C;  4HZ3 A;  3E22 A;  4JYB A;  5IY5 B;  1K34 A;  1FXK A;  3E83 A;  1YEW A;  5LGN A;  2B1G A;  2R9I A;  1AP5 A;  3OTO B;  4PDL A;  1YIT V;  4ZHQ B;  2QDO A;  3K08 A;  3CCR V;  4CBC A;  3CCU V;  4WFH A;  2Q68 A;  2RJZ A;  1M56 C;  1TVK A;  2JEX A;  1OCO C;  3E89 A;  2DW4 A;  3BPZ A;  3ABL B;  1FFX A;  4K8X A;  4PDM A;  2GHY A;  1BQ0 A;  3U0Z A;  1FKA O;  3SJC C;  3L75 H;  4Z1M G;  1DGS A;  3K5O A;  4X65 B;  1DF5 A;  1IBL O;  3KZI Z;  4IT5 A;  2K9P A;  2YSU B;  3H1J H;  1YZB A;  4K3A A;  4E4E A;  2Q7E A;  5EYP A;  4B3T B;  1K9M W;  2EIJ C;  3CB2 A;  3B77 A;  3ETQ A;  4DV4 B;  1CPY A;  2ZXW B;  4ABM A;  3HKB B;  2RNB A;  1JVM A;  4DR2 B;  2BTQ A;  3W7T A;  1NQT A;  5LHG A;  4ZHQ A;  5JJJ B;  2F4V O;  4LFA O;  4NYK A;  4LFC B;  4JI8 B;  5GTI Z;  4ZKI A;  1L0N H;  3E22 B;  1TVK B;  4DV0 O;  1IBK O;  4PA6 A;  3B8M A;  5HFL A;  4I4T B;  1VEW A;  5C8Y A;  2GTA A;  3BAA A;  4U3J A;  2P6J A;  2JJ1 G;  2W6I G;  4F6E A;  4RWU A;  1LR1 A;  3RT3 C;  4I0X B;  4DXW A;  1ZSP A;  4JI1 O;  3F7V C;  4BR6 A;  4FFB B;  3ZMU A;  4EKW A;  4FVM A;  2EIJ B;  4PA9 A;  4IYH A;  1WB8 A;  1GK9 A;  1WPX A;  4MS2 A;  1N36 B;  4YJ3 B;  4FZ1 A;  1HR0 O;  1RFY A;  1QLE B;  2YC0 A;  4OGQ B;  5CA3 A;  2ADQ B;  2YIB A;  3AG1 B;  5B1A C;  3GWO A;  5LXT B;  1D5N A;  2BOC C;  3RYF A;  1NI8 A;  4LF6 B;  2UUB B;  2Y69 C;  5JJN B;  5FL7 G;  1FS0 G;  1F4M A;  4GX2 A;  2A0L A;  1JR9 A;  3JD0 A;  2R70 A;  3ETD A;  3D8C A;  5JVD B;  1YSC A;  1W59 A;  2NR5 A;  3JSN A;  1KQS U;  4D7S A;  3RYH A;  2OWO A;  2GV9 A;  1Q6H A;  3SYA A;  4D7T A;  4W4K A;  4AQY B;  1EN5 A;  1SZX A;  2ZR2 A;  5B1N A;  4WF9 V;  5JH7 B;  3QG5 A;  4QJF B;  3CS5 A;  1U96 A;  5IT9 N;  4JAA A;  1QLE C;  1XMQ B;  4CS3 A;  3LDD A;  1M57 C;  4AIL C;  2BTO A;  2GUZ A;  4X66 B;  2HP8 A;  2Q8V A;  3THO A;  2AHZ A;  3AG7 A;  3DSQ A;  2UXN A;  4QE9 A;  2Y69 B;  3ZN0 A;  4CH4 A;  1SF9 A;  4Q20 A;  2V4D A;  1N33 B;  1Y4M A;  1QCE A;  1VF5 B;  2WA3 A;  1SS3 A;  2P06 A;  3CCV V;  3LDE A;  1P84 F;  1V55 B;  3OEH G;  4D6T H;  3G6B A;  3G67 A;  3AEI A;  3FB6 C;  4MVZ A;  1U97 A;  2IH1 C;  2DE0 X;  4UXN A;  4X1K A;  4CC6 A;  4B7E A;  5B1O A;  2WLM A;  3SPI A;  3OW2 U;  1P7G A;  1M57 B;  4JI7 B;  3ZJZ A;  1IDS A;  3ETE A;  2ZD9 A;  1EM1 A;  2F4V B;  1VQ6 V;  5GON B;  2AXT Z;  4KHP B;  2YS8 A;  5LMU B;  1SQG A;  5GTH Z;  4J7Z A;  3EFF K;  4MVU A;  1G1X B;  3G80 A;  4X20 A;  2LO1 A;  5D5P A;  3SPJ A;  2DQ3 A;  2EIM C;  4EFE A;  1IVS A;  3N2G B;  3E2E A;  4PA4 A;  4PHZ A;  2Q7G A;  5L3D A;  5BR8 O;  5IYC O;  1AIL A;  5B3S C;  3AG3 B;  4JYY A;  3UO2 A;  2WLL B;  1RP3 B;  4ZOL A;  1TAE A;  5KAF Z;  3QNE A;  4O2B A;  4J42 A;  4PDV A;  4NKG B;  3LNN A;  3CPW U;  3W7U A;  2ARH A;  3ZED A;  1VQ8 V;  4PA3 A;  1K3E A;  4JGS A;  2JGU A;  2VQF O;  3M99 B;  2GSM B;  3L71 H;  1Q81 W;  4JAU A;  3HKE A;  3ETG A;  1MMM A;  3Q4H B;  3LDC A;  4DV3 O;  3H1K H;  2V7Q G;  4MVS A;  2Q6A A;  1E1R G;  4FM1 A;  4X1Y B;  1BSM A;  3OUS A;  3BA9 A;  4JI8 O;  4LFC O;  4AHC A;  3LSU A;  1H2L A;  2WLL A;  4J10 A;  2H94 A;  4DR1 O;  1HR0 B;  2UXB O;  2YIB D;  4JI7 O;  1V54 B;  2DYR B;  2ZT9 B;  4IL6 Z;  3H1H H;  1JFF B;  1I7F A;  2XTA A;  2A7W A;  2RN9 A;  3E8H A;  4TOI A;  1M4U A;  4X66 O;  4JAV A;  4GX5 A;  5DED A;  4FMT A;  1QLN A;  5EZY A;  4IIJ A;  2M7W A;  3ZRX A;  1B04 A;  3RYH B;  2Q73 A;  2CGN A;  1HNW O;  3RVZ A;  3H1L H;  4B3R B;  4UV8 A;  2Y0P A;  3A8T A;  1IBL B;  3T2M A;  2XAQ A;  5LMN O;  3DXR A;  1M1K W;  3JD2 A;  3JD4 A;  1JFF A;  4JYA B;  2UXC O;  3K5N A;  4IGG A;  2EIN C;  4TV8 B;  3IFX A;  3CRQ A;  4P2Z A;  4FLV A;  4DR2 O;  1R1B A;  4H0L B;  4K35 A;  2DYR C;  4JZ2 A;  4KFM A;  1V9P A;  2EIL C;  4I9Q A;  4YJ2 A;  2HVJ C;  5ITZ B;  5A2Q N;  3ZHT A;  4NTX A;  2QSA A;  4PJ0 Z;  4U7O A;  2PTM A;  2JS5 A;  1JQ0 A;  5H9C A;  1IUR A;  1FXK C;  1NU1 H;  1K33 A;  1SQB H;  3N27 A;  4ZIB A;  2HLD G;  5H2F Z;  1COW G;  3ABK B;  2YXH A;  1PL4 A;  5IE9 A;  1JA8 A;  3KG2 A;  2UXD O;  1L1F A;  4DR7 O;  1G6U A;  3B2E E;  3QVN A;  4LCU C;  3RW0 A;  2Z3Y A;  4JAS A;  3GVM A;  3ZMV A;  1SQV H;  1KD1 W;  4YJ2 B;  1AJP A;  5CBG A;  1I5X A;  4JZG A;  2F93 B;  1PM9 A;  2EIN B;  2E5L O;  2OIG A;  3ICX A;  4QPJ A;  4Z1V A;  1ZL8 B;  1SA0 B;  3ML0 A;  3NR7 A;  4WFE A;  4RQE A;  1XNR O;  1M90 W;  2LGQ A;  4JI4 B;  3B8N A;  2YID A;  3OUF A;  3RVY A;  2E74 B;  3BY6 A;  4DO2 A;  3O9O A;  2CAZ C;  1M56 B;  4ZOL B;  1GRJ A;  4LH7 A;  3CCM V;  4UVC A;  5B5E Z;  3B09 A;  2UXC B;  1IBM O;  3LSS A;  2Y0I A;  1W0J G;  3A2F A;  1K97 A;  3OMI B;  2QA4 V;  3T1Y B;  3DGE A;  2G38 A;  3CYO A;  5FPO A;  2MW2 B;  2VQE B;  5IWA O;  4YHH O;  1AI7 A;  4MTF A;  4J7K A;  1NR7 A;  2KQX A;  3CXC U;  3JD1 A;  1P4R A;  4HBN A;  1ZX3 A;  1WA8 B;  2ZQM A;  3B4S A;  2XUM A;  1KMI Z;  1QQC A;  2Z5U A;  1O9H A;  2ZXW C;  4LF9 O;  1K5S A;  4DV2 B;  3K58 A;  4X1Y A;  1AI6 A;  2AGA A;  2JRI A;  5EBW C;  2XT9 A;  3AG4 B;  2HG5 C;  4FLY A;  1SQP H;  5A9G A;  2F1M A;  1HNZ O;  2XAS A;  2QR4 A;  2YDE A;  2EZP A;  4MVQ A;  1H8H G;  4LNU B;  3CXH F;  3X2Q B;  4CZZ A;  1P49 A;  2Q67 A;  3P32 A;  4H37 A;  1AB3 A;  4K0K B;  4JTA B;  1AJN A;  1BCC H;  2QM8 A;  4DUY O;  4XDJ A;  4FLZ A;  4FFB A;  5KHJ A;  1QNM A;  2FYU H;  4LFB O;  1S77 D;  2OTJ V;  3ZHR A;  2RMK B;  5KMG B;  3K9S A;  4BIZ A; 
#chains in the Genus database with same CATH homology
 5GTI Z;  5GTH Z;  4UB8 Z;  5TIS Z;  3WU2 Z;  3A0B Z;  4UB6 Z;  5B66 Z;  5KAF Z;  5E79 Z;  4PJ0 Z;  5B5E Z;  5H2F Z;  5KAI Z;  4IL6 Z;  1S5L Z;  3A0H Z;  3KZI Z;  3JCU Z;  2AXT Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...