4IL6Z

Structure of sr-substituted photosystem ii
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
61
structure length
61
Chain Sequence
b'TILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Structure of Sr-substituted photosystem II at 2.1 A resolution and its implications in the mechanism of water oxidation
pubmed doi rcsb
molecule tags Electron transport
total genus 24
structure length 61
sequence length 61
chains with identical sequence z
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 4il6Z00
3KZIZ 1S5LZ 3JCUZ 5GTIZ 5KAFZ 5E79Z 4UB6Z 4UB8Z 3A0HZ 2AXTZ 3A0BZ 5KAIZ 5B66Z 4PJ0Z 5B5EZ 3WU2Z 4IL6Z 5H2FZ 5GTHZ 5TISZ
chains in the Genus database with same CATH superfamily
1XNRO 1L0LH 1Q81W 4X1IA 4XDLA 4I9WA 1AJNA 2EIJB 1FS0G 1N33O 1XNQB 2DN9A 2P22C 3UO3A 4E2LA 1RM1B 2K1EA 2M6YA 3UKMA 4KXRA 5L3BA 4ZBMA 2XAGA 3Q4HB 2YXHA 4I0XB 4I7ZB 5FPRA 1NS1A 3H1JH 2QJ1A 4WFEA 1YI2V 3UO2A 4LF4B 2B9ZA 4N21A 4WF9V 1XUQA 2DMXA 1I94B 3A8TA 4IYIA 2MK3A 5CA0B 4IHJA 4O4LA 4JI6O 1UJWB 2YDEA 1AROP 4RO2A 1N34B 4MTFA 3TGUH 1SS3A 4OGQB 3ABMC 4G2KA 1URFA 1WPBA 1GAXA 2Q0OC 2A79B 3ABKC 4MSWC 5KHGA 2FMLA 2Q7GA 3PJSK 5B3SB 5IYZA 5LA6A 2KG7A 4OX9O 1GM8A 4UUJC 3OMNB 4KP4A 4O4HB 4DR2B 1I5XA 3OR7C 1Y66A 2ZCEA 2O57A 2B1GA 3IAYA 3AK2A 1H2GA 2XOKG 4P2ZA 2CTRA 3HKCA 2F43G 3ZN0A 1T5EA 4X65B 4H37A 5KHKA 2GTSA 2W0FC 1D5AA 5EC1C 1Q90D 2H8PC 2YS8A 4KL1A 4IHJB 2YSUB 4DR4O 5EZYA 2QKSA 4QJFB 4ZIBA 2EJRA 2ZD9A 3KCYA 2HP8A 4EB6A 4XBFA 3CP1A 5EIBC 3CPWU 1IZ3A 4UVAA 2WPDG 2RDCA 5E1AC 4PA3A 3ZHVA 3A0RA 4MVMA 4LC1A 3H9VA 3ML0A 1XMQB 5LMUB 5IYZB 1M57B 1Y67A 1GMGA 4HBNA 2JK5C 3OGCC 4LF6O 4GYCB 2BOCC 3CCJV 2QSAA 3RT3C 1SQVH 5LP6A 4YY3O 5CB4A 1BHAA 3CCLV 2PI4A 3WB1A 1Y4MA 2LW1A 3P30A 4R50A 3J80N 4FFBA 4UB8Z 2HHHO 3IGAC 2P5OA 1AI4A 2DWEC 1PD3A 3PN1A 3KG2A 4NXMO 2Q73A 2QTOA 3ASOC 5DECA 2IJJA 2Q68A 4K0KO 5EZYB 3E8GA 1SZTA 3WG7C 5A9GA 2GBOA 1AI7A 2LQTA 4JAVA 1G6UA 5C93A 1NH2D 3CRRA 4FLYA 3DC6A 1ROPA 2P6JA 1BMFG 3T4DA 1AR5A 3EFFK 2VQEO 3IC7A 4AI8A 3H1HH 4D6TH 3ABUA 2W0XA 3ASNC 4LWSA 1WA8A 3P3PA 3CRAA 3N2KA 4NYKA 2F95B 4FM2A 4GT1A 3CJHA 4LF8B 3L71H 5CB4B 5BXZA 1NR1A 3OGIB 2NN4A 1JA8A 3TK1A 1S5JA 4HZ3A 2KKWA 2DYSC 2D3OW 2AXTZ 5B1AB 2MW2B 1BZKA 4F6EA 2JS5A 2UUAO 5TISZ 1NI8A 1E1RG 3LSUA 2BTQA 1M5IA 1V54C 3LUTB 2PYJA 2Y0IA 2Y69B 4F6RA 1Y76A 2Q9LA 1CPYA 1VARA 3G80A 4J11A 3JAMN 3JALA 5GW7A 2OCHA 5JVDB 4DW1A 4FK5C 1H2KA 1HWYA 4JGSA 2JDIG 4WFGA 1Q86W 5LOVA 1X59A 3SPGA 4YIOA 1KECA 2Y4TA 4QIWF 2ARHA 5BMVA 1KBHA 4DV7O 1SZXA 5EBWC 4LFAO 1A32A 2FL4A 1VQ7V 1SF9A 5FL7G 3T1CA 5KA5A 2IBZH 1FXHA 2W6JG 4X64B 2H94A 1THZA 4RQFA 1NKDA 3BCCH 1X4TA 1CP9A 1BSMA 3AG2B 4PELA 4RUFA 4UVCA 3VQWA 1AJPA 4PDMA 4JYYA 5KHIA 1Y76B 2A06H 1UFIA 3C90A 3JALB 2JIZG 2CE4A 2Q69A 3OUFA 3UT5B 3IFXA 4GKKO 1VQ8V 4MVUA 1MOFA 1N4CA 4TWKA 1M93A 3FD9A 3RYIA 4B3MO 4AQYB 2WLIA 3SYOA 3AK1A 1D5NA 4HAMA 1H38A 1AB3A 3F5WC 4J7JA 1KD1W 3T1YO 1XREA 3BPZA 1AR1B 3E8HA 2DW4A 1P4RA 4TV8B 2YC0A 3ZRVA 5J2UA 2Q5ZA 1GH6A 1B6QA 1U96A 2IH1C 3RN4A 3CC7V 1EN6A 1K3EA 1AVMA 4WBNB 1L1FA 1FAFA 5KMGB 4BW5A 4FMTA 3K5MA 1VQKV 2DE0X 2QKAA 3K9AA 4LP8A 3DSQA 2QWNB 2DQ0A 3RYCA 3MHHC 3M7MX 4O4IA 3L75H 3AG3B 4ICGA 1PL4A 3FB7C 3RYIB 3HKBB 4JI0B 3X2QB 2WLIB 3UM7A 4LFCO 3RYFB 5LXTB 1YTFD 2A3QA 1PP9H 4DR5O 1FJGO 4MT8A 4DR6B 4JI2O 2UU9O 4KHPB 3B4SA 5JH7B 5FNVB 4WFBV 4PHZA 2D2CB 1HNZB 1NBMG 2GTAA 1W0JG 3E8FA 4JI3O 1LUVA 1QLEB 3FB6C 4R6ZA 3AK3A 4JI1B 5IWAB 2ZQMA 2JS3A 4FZ0A 4KFMA 5IY5C 2EULA 1V9PA 3T1HO 2ZR2A 3BA8A 4PI0A 3T4ZA 4MVOA 1NQTA 2X6BA 2ODMA 3RYCB 2Z3YA 4FM1A 1Q6IA 1N32B 3BFRA 4J80A 4WCEV 5GONA 3OMIB 4K35A 1FXKA 2X0LA 4A5UB 1KQSU 2BSKB 1MZFA 1EM1A 5C8YA 1I7FA 1H8HG 5EYPA 4FJCC 3OAAG 1ENVA 1QU7A 4MVZA 1MABG 1KKCA 1H2NA 4DR7B 4JI7B 2E5LB 1K73W 4X1YA 4YXWG 2ZKOA 3B8NA 4IT5A 3TCUA 2EINB 3RWRD 1OCRB 3K57A 4F4LA 3OR6C 3R65A 3WB0A 1K4DC 1VEWA 4LH7A 3ABTA 4NB5A 2ZXWC 4TOIA 2NLJC 4Z2WA 3QO8A 5BZBA 2JRIA 2RN9A 1LUWA 2JGDA 3R66A 1W0KG 1S76D 3CE2A 3CXHF 4UCVA 4LF7B 1K5QA 4RWUA 1Q43A 3P3NA 3U0ZA 5H6QA 5CBHA 4I9QA 1SA0A 3FX7A 3OEEG 1DF5A 1VP7A 3BABA 4Q6GA 5KX5B 1B04A 3FAVB 2P06A 2Z0AA 1RPRA 1VQLV 2QWRB 5A2QN 4HYOA 4X1YB 3LDDA 3AG4C 1XNQO 4FLUA 3J7AU 4DW0A 3HKEA 4X1KB 4GX0A 1JVMA 5IJ0B 3SJAC 4DV2B 2WLNA 5JJNB 4DRXA 3WU2Z 2AGAA 3Q4HA 1FFXB 4I0XA 4LF4O 2Y0PA 1JCHA 1GO3F 2RCVA 5BY1A 3RVYA 2ITDC 1I94O 4GX2A 1SA0B 4ZOLA 4JTDB 4MTOA 3W7SA 1YSCA 3G71V 1PL0A 5JCOC 1N34O 1WP7A 1PKXA 1N8RW 4FLTA 1BHBA 4QE9A 1QHTA 3L9DA 5K1PA 1RSOB 2ZE5A 1OCZB 2GUZA 3VQXA 4TQFA 3SR2C 1AR4A 3CRMA 3JARB 3HKEB 1KYOF 2ATKC 1JFFB 4FVMA 5KLVH 1XMOO 3ABMB 2UXNA 4PDRA 2P90A 4DR2O 4OXSA 2QWQB 2WWWA 4LF5B 1VQ5V 1OJHA 4DRXB 4O4HA 4NXNO 2Q7EA 2C2AA 4AILC 4JV5B 3OTOB 2HEPA 1QR8A 4ZOLB 4DV4B 1O9HA 4DR3B 1NJIW 3ZS8C 4DR1O 2HLDG 4BAYA 2ETNA 4CS4A 2M7WA 2H3OA 2PYLA 2WAMA 4DXWA 4RQEA 1JJOA 3RYHA 1XL4A 2L6LA 1KP2A 4DV3B 4B3RB 2F23A 3N27A 2GUZB 3UCSC 2EZPA 3H1KH 3FFQA 3VOUA 2K9PA 4JYAO 4PA6A 1NH2B 3L73H 4YHHB 1XMQO 2WLHA 5LMUO 3L74H 5AG2A 4B7KA 4X66O 1S0VA 1WAZA 3STZC 3H01A 2WLMA 2N05A 4IGGA 3RFRA 4DV0B 2ZE6A 1TAEA 2EIJC 1OCCC 1V55B 3E86A 2VQFB 1RM1C 3BA9A 1RP3B 1DF4A 3ZX6A 1HR0B 4LF9B 1GRJA 3F7VC 5EC2C 3O9OA 3CD6V 2B5UA 1QVFU 1ORQC 2LP7A 4JTCB 4J7KA 2R9AA 1BQ0A 5JJJB 1KC8W 4DV1O 3APOA 3RYHB 2ADPA 2CTPA 4DV6B 2LJ2A 2RNBA 4DUZO 4TV9B 3LNNA 3L70H 4UXNA 2ZINA 1F4MA 1U97A 1DGSA 4LF8O 3E22B 3AG1C 4G27B 2Q0AA 3G67A 2ZM6B 3K58A 3IC9A 1Z2GA 4YJ3A 3RW0A 3JD1A 2QA4V 4Z1MG 2CH7B 4J9ZB 1GN3A 1GKFA 1P84F 1SETA 2P4VA 2AZ2A 3DXRB 4PJ0Z 4L8JA 1IBKO 5HFLA 2UXCB 2YIDA 1JMKC 2DYSB 2WLJA 1BQZA 4FZ1A 3W7WA 1H2MA 2F1MA 3OM3B 1HNWO 2OCCB 1XBLA 1M90W 2PI5A 4R8CA 2OIEA 1FYJA 1QNMA 1XHXA 2WLLA 5EIBD 2F4VB 5CA1B 3G4SV 1BS3A 1V54B 1PV0A 1YXBA 3ICXA 3K03A 4X20B 5JVDA 4DYLA 1WLEA 3D8CA 4YJ3B 1M57C 5LGNA 4K8XA 5EBLC 2CDYA 4JYCA 3CCVV 1PNLA 2JGUA 5B1BB 2YXYA 4DV5O 4U7NA 2AZ0A 4HNAB 1JX9A 1K7DA 1K92A 5LMNO 2XAFA 4TQDA 5LGTA 3F5TA 4IYHA 2XT9A 2EILC 2VS0A 2LFRA 1S77D 3CXCU 2N74A 4LNUB 4PA4A 4MW8A 2WLLB 4TUYB 1WJZA 2LGWA 1S5HC 3ZHSA 5IE9A 4O2BA 3RVZA 5KA6A 3UT5A 4K0KB 2XHBA 5LL6Y 1D2DA 2EX3A 2Q7HA 4AQYO 2OT5A 2ZDIA 1R6TA 1PM9A 4JI5B 3THOA 5LP6C 1EN4A 2CTQA 5J2TA 1Y6XA 1YTFB 3W7UA 4JYBA 3QVNA 4G28B 2A7WA 4JPRA 1YHQV 3D36A 3QNEA 4TV8A 1VMGA 2GHYA 3OE7G 5KAFZ 2FKXA 1ZL8B 3ZHTA 3U11A 4R7CA 3A2FA 3ZHQA 3QTCA 3SYQA 5L3DA 1GK9A 1GN2A 5KHHA 1B3QA 3JD3A 4WBNA 2Y69C 1H8EG 4O2BB 1DTOA 2OWOA 3JAWA 5KMGA 3JSLA 1TVKB 4UVBA 1Z5WA 5GTIZ 2EBOA 1LR1A 5J9PC 4PDVA 2DQ3A 3G6EV 3K0DA 1XEQA 2R9RB 1OV9A 4CH5A 2N04A 4JI4B 1VF7A 3HKBA 2EIKB 2E74B 1XILA 2XASA 1BGYH 1RPOA 3RYFA 5LXTA 5J2TB 1NT2B 3ZMVA 4KHPO 5B1OA 3K79A 4EKWA 3BY6A 1SRYA 4W4KA 1XL6A 5L3GA 1SERA 3OEHG 5JH7A 2YICA 4UFZA 5FNVA 3K04A 2DOSA 3MAQA 3S3XA 1Y74B 3HKDA 4J41A 4DV7B 2QKCA 4GKJO 4LFAB 3AG2C 4I50A 2HJFC 2LFSA 3CWBH 2UXDB 1KU9A 1Q82W 3CRQA 5ITZA 2AHZA 1P7BA 1SC5B 3B40A 5LHHA 4GX5A 2UXBB 2CAZC 3JAWB 1NVPB 3ZHRA 2HJDA 5BR8B 5IY5B 1DLBA 3CMAV 4K3AA 1GM7A 1XOUA 3JD0A 2E3CA 2IJIA 2LGQA 4LH6A 3ZBHA 2UUBB 4KUMA 3OMAB 4GLXA 4J10A 4WFAV 4FIPC 3D3QA 1SQPH 1FD9A 4PD4F 3AEIA 5CBGA 2BSKA 4CS3A 5E79Z 3ZEDA 2KB1A 1W2BU 2ADQB 4X62B 1QLNA 1N0NA 3HKDB 4DR7O 5EK0A 1HP8A 4B3TB 4I50B 4UCRA 4B3MB 5ITZB 1Z5VA 4UCTA 1ZUQA 2P4KA 5JWPA 1CEZA 4J7ZA 1NTKH 2LO1A 2V1DA 5H5NA 3T1YB 4QE7A 2QEXV 2UUCO 5L3FA 2CTWA 1HNXB 2OTJV 1M4UA 2ZXWB 4IL6Z 1AP6A 1YEWA 3LDEA 1K34A 4MW3A 2XNDG 1QVGU 1W59A 4Z1VA 3OW2U 4MVQA 2X6CA 3JCUZ 5KX5A 3UQ8A 3FKSG 4CZZA 4UB6Z 3EXAA 3FAVA 1SQGA 1HW7A 1I0HA 5B5EZ 5CN0A 3CCSV 1K97A 2XAJA 5H2FZ 2QR4A 3E35A 1IXMA 2BE3A 3ZCCA 2FTKA 3FB5C 2UXXA 5KUMA 2VRZA 3ABLC 4U3FH 3ETQA 1R3LC 4DR5B 1NVPD 1N0JA 1Q5OA 3SJBC 1FJGB 2Y48A 4DV2O 4X1KA 2UU9B 4I5SA 2QWPB 3OUSA 4CH3A 1XDCA 3AG4B 3JCZA 3O65A 5IJ0A 2GDSA 4MTXA 4YJ2A 1J5EB 3ZMSA 1FFXA 1VQ9V 2CGNA 3CS5A 1SQXH 1YJNV 4UCUA 3SPHA 2E76B 4PDLA 2EIMC 1KMIZ 3CCQV 5H9CA 1Q7YW 4W4LA 5IYDO 3J81N 3W7XA 3I56V 5LBQA 1O9GA 1RSOA 4BR6A 1TA8A 3M8AA 3P32A 5JQGA 1MNGA 3H1IH 3JARA 3L72H 3JAKB 1JFFA 3JD4A 1KUQA 5IT9N 2NNUA 4JTAB 1YF2A 4LF5O 2ITCC 1IXBA 3CYOA 2EINC 3ZMTA 5KAIZ 4YJ2B 3SDLA 1Q3EA 4QPKA 3ZMZA 3HR0A 4JI8B 4JV5O 2GSMB 1YZBA 4IIJB 3ETDA 4DV4O 3E2EA 1IBLB 1IDSA 2YUAA 4B7EA 1L0NH 2PUSA 5B1NA 3ETGA 4ASUG 1G8MA 1LNQA 3B77A 1FFTB 4LBEC 2ZE7A 4X89A 4FPPA 3CX5F 3STLC 3SJQC 1FXKC 1TUEB 4DV3O 1E79G 1NU1H 1ZTEA 4CC6A 1GN6A 3HB3B 3JYCA 5GTHZ 1BL8A 3JATB 4J42A 3CMEV 4YHHO 1QQCA 3JSNA 5KUKA 1R1BA 3TXQA 5JQGB 1H2LA 2CUGA 4GCZA 2FB5A 4JF3A 2WA4A 4DUYB 2IJKA 4JAAA 1IBMB 2VQFO 3E8BA 2P7TC 1GN4A 1YDXA 1VQOV 4B3SB 1HR0O 3ABKB 4O2AB 5LGUA 3MD0A 1N36B 4ZHQB 3K9SA 1OCOC 3OD4A 1P49A 4X65O 1WN7A 3KZIZ 4MS2A 1OCCB 2BTOA 3JD2A 2CK3G 4I55B 5LHGA 2WSSG 4DV6O 2HR3A 1M56C 1DK1A 2XAHA 2IH3C 3OTFA 3C3SA 4FLWA 5D5QA 2YIAA 2DYRC 5D5PA 4TV9A 1MA1A 1VIBA 1R6NA 2YEVB 3M99B 1NTZH 1YIJV 2ILMA 1OCZC 3KCXA 1AI6A 1QR9A 2ZM6O 3E22A 2VWJA 1RFYA 2L35A 1IX9A 3NXSA 3K5NA 4LFBB 3H1LH 1MG1A 4NTXA 3AG1B 4X1IB 5DN6G 2CH7A 4WFFA 1XNRB 4K8ZA 2UXCO 1MSDA 3SPIA 1XMOB 2IW5A 3DXRA 1N33B 3DTUB 3TETA 5H6RA 2HFEC 3APQA 1QCEA 4UCSA 1WNSA 3DGEA 3EVKA 3ZN1A 2RJZA 4NXNB 3VQVA 1NR7A 4PI2A 4C7UA 3ASOB 1JOYA 2F4VO 3CCRV 3CC2V 1WPXA 5F2VO 3WG7B 4DK1A 1YVWA 2WA3A 2HG5C 1G1XB 4O4LB 5CA1A 3T2MA 4DR1B 3LSQA 2BOBC 2QDOA 4X20A 4U7OA 3SYAA 4AHCA 4JI6B 4ZKIA 1S3JA 3K3WA 2KQXA 2ZE8A 3BEHA 3ASNB 5B3SC 2Q6AA 3ZMUA 3K0GA 4JZGA 3MDSA 2G38A 4XDJA 1V55C 4JYAB 1YJWV 2R9IA 1B06A 4HNAA 4X66B 2QM8A 5LA6B 2YIBD 1K8AW 1R3JC 1SQBH 2KG7B 3DC5A 4D7SA 1HDJA 3W7TA 4NKGB 4OX9B 1OHHG 2EJ7A 4RUEA 3HKCB 5KHJA 4LNUA 2EILB 4TUYA 2PTMA 1WB7A 3CCEV 2BCCH 4E4EA 4GX1A 4X9QA 4CH4A 1M9NA 4FM0A 4UCOA 1WP8A 4DR4B 4EB6B 4DV1B 1PNMA 2V7QG 4JI5O 4DUZB 2FYUH 2XAQA 3FB8C 4PA7A 3GB7C 1JPXA 2IJHA 4X64O 3CCUV 4QGPA 1JR9A 2ZIMA 4EEQA 1TGOA 5LP6B 1K33A 4GZRB 3SYPA 4H33A 3QO7A 4LF6B 3BAAA 4YY3B 1ZL8A 1WB8A 4FFBB 3ZJZA 2EZOA 2QE7G 2PF4E 4EFBA 4FLXA 2OCCC 1FPOA 2HHHB 1ZAUA 1K4CC 4NXMB 1SQFA 5DM6V 4P9PA 1IBKB 1FXVA 1SESA 1NZ6A 1TVKA 1VQMV 4OPAA 2V4DA 4JI4O 1S5LZ 4CC5A 4N23A 1HNWB 1GTOA 5L3EA 2YI8A 3A0HZ 2PGGA 2JEUA 3BRCA 2R72A 1YCIA 3ETEA 4QNHB 2R70A 1SKVA 3TXSA 4LWSB 1WA8B 2VQEB 1TUBA 3N2KB 1S72V 3TJTA 1L8DA 2B1IA 3CJHB 4CBCA 5B1BC 3SPCA 1KB9F 3VBBA 3CHXA 1M1KW 5B1AC 1MMMA 1NTMH 2HVKC 2X7RB 4I4TA 3K59A 2IM9A 4TSFG 4EFEA 3SYCA 5CMUA 1BCCH 2UXDO 3MHSC 1Y74A 1J95A 2OIGA 1EZVH 2ZR3A 4BIUA 3VQYA 2UXBO 2F66C 1Q6UA 4DV5B 1E1QG 2AHYA 2A9HA 1F51A 1AJQA 3OFNG 5LMNB 5IYBO 5BR8O 1H2SB 1R6KA 2BTQB 3G6BA 2UUAB 4D7TA 1AILA 2A0LA 2UUBO 5CBFA 2ZNIA 3I5DA 4JI0O 1EBOA 4F6RB 3CC4V 1YITV 1KKDA 5K1XA 4DK0A 2QWOB 4JAUA 1ZX3A 4JASA 5L3CA 5HFMA 4DR6O 1TUBB 3F7YC 2E75B 4DO2A 4X62O 5LOVB 1YJ9V 1HNZO 1Q6HA 3BHPA 4I4TB 5BMVB 3C3TA 1VQPV 4ABMA 5FLXN 1G4YB 4B3TO 4JI1O 5IWAO 3IJ4A 1EN5A 1KP3A 3GVMA 4WFHA 2Q67A 1QBZA 2Y4UA 2IU0A 1COWG 2HVJC 3B2EE 4OPHA 5JJEB 1HNXO 3D3IA 2PY5A 1XI1A 2XTAA 1F23A 1N32O 3ZRWA 4FLZA 1VF5B 1EZJA 5CA3A 1Q8IA 1K9MW 1UPGA 2ZDIC 3QO5A 2EIKC 4UV8A 3GWKC 3CSXA 5LYJA 3U10A 4Q20A 3BVOA 4JZ2A 4GKKB 1R3KC 1AP5A 4BW9A 2ZT9B 4LCUC 1P7GA 2E5LO 4JI7O 4RAIA 2LW7A 2GV9A 2Z5UA 3D36C 4L87A 4NVPA 3RGBA 1AI5A 1PNKA 4H0LB 2X6AA 4P30A 5EBMC 4X8AA 4ZI7A 4B08A 1J5EO 2RQ6A 4TT3G 1VF6A 1VQ4V 3QF7A 5J2UB 2OTLV 4LF7O 3AG7A 3ABLB 4J9YB 5DEDA 4YIPA 5B66Z 3ZRWB 3LDCA 4GKJB 1VQ6V 3HPLC 1F7YA 2IU3A 3AG3C 1EFRG 3X2QC 2XUMA 2YXLA 1JQ0A 3WB2A 4BIOA 3ZHUA 5IJ9A 4BIZA 5LYJB 1I5YA 1ZWIC 2EIMB 2QM4A 4NTYA 4O4IB 4PV1B 1F4NA 4NR1A 3GWOA 4UV9A 4H13B 3SJCC 1ZLZA 1XHZA 2DJVA 4CH6A 5JCOA 3E83A 4O4JA 3B8MA 4LFCB 1ZSPA 3LSSA 2JJ1G 1XQ8A 1QLEC 3JAKA 4MVSA 4ZI7B 1I08A 4JI2B 3KKYA 4JI8O 1GM9A 2VWKA 4MTGA 4FFKA 1IBLO 1JJ2U 3K06A 2JJ2G 3N2GA 4IIJA 4JI3B 3E89A 2JVDA 1US6A 2HKOA 3CEIA 1BE3H 4QPJA 3K5LA 3T1HB 2Q8VA 5IJ9B 3A0BZ 3S3WA 4P9OA 3QG5A 2UUCB 3SPJA 4MVRA 3JATA 5IDJA 5GONB 3CCMV 1FXKB 4DUYO 4O4JB 4CS2A 2YI9A 1CXZB 1IBMO 5C8YB 2PZSA 2ZNJA 4U3JA 5EYPB 3JASA 1VQNV 2AW9A 2QTSA 3K5OA 4B3SO 5LHIA 1OCRC 4NTWA 1N36O 2NR5A 1R73A 1VF6C 2ZIOA 3N2GB 4O2AA 3OTOO 3NR7A 4DR3O 4ZHQA 1MZEA 1MSWD 3CB2A 2OYQA 4XDKA 2W6IG 2QM7A 4H44B 2P67A 1R3IC 3WFVA 2F93B 2JGDB 1OCOB 3ZRXA 4I55A 2CGOA 2WLKA 3K08A 4B3RO 1K5SA 2RMKB 1SQQH 2YIBA 1IURA 2Q4PA 4X88A 1M56B 3CRCA 4FLVA 2YEVA 3B09A 3FYEB 2QGNA 4U3JB 1OZ0A 4LR3A 4DV0O 2DYRB 1IVSA 2DWDC 5CA0A 3JASB 1BT8A 1PPJH 3FYIB 4BWAA 3OT7A 3EHBB 3LNMB 5IYCO 3ZIAG 4LFBO 5FPOA 3ZRSA 2KSDA 3SGIA 3RBZA 4LF9O 2JEXA 4PA9A 4GUNA 1FKAO 3I55V
chains in the Genus database with same CATH topology
3KZIZ 1S5LZ 3JCUZ 5GTIZ 5KAFZ 5E79Z 4UB6Z 4UB8Z 3A0HZ 2AXTZ 3A0BZ 5KAIZ 5B66Z 4PJ0Z 5B5EZ 3WU2Z 4IL6Z 5H2FZ 5GTHZ 5TISZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZI Z;  1S5L Z;  3JCU Z;  5GTI Z;  5KAF Z;  5E79 Z;  4UB6 Z;  4UB8 Z;  3A0H Z;  2AXT Z;  3A0B Z;  5KAI Z;  5B66 Z;  4PJ0 Z;  5B5E Z;  3WU2 Z;  4IL6 Z;  5H2F Z;  5GTH Z;  5TIS Z; 
#chains in the Genus database with same CATH topology
 1XNR O;  1L0L H;  1Q81 W;  4X1I A;  4XDL A;  4I9W A;  1AJN A;  2EIJ B;  1FS0 G;  1N33 O;  1XNQ B;  2DN9 A;  2P22 C;  3UO3 A;  4E2L A;  1RM1 B;  2K1E A;  2M6Y A;  3UKM A;  4KXR A;  5L3B A;  4ZBM A;  2XAG A;  3Q4H B;  2YXH A;  4I0X B;  4I7Z B;  5FPR A;  1NS1 A;  3H1J H;  2QJ1 A;  4WFE A;  1YI2 V;  3UO2 A;  4LF4 B;  2B9Z A;  4N21 A;  4WF9 V;  1XUQ A;  2DMX A;  1I94 B;  3A8T A;  4IYI A;  2MK3 A;  5CA0 B;  4IHJ A;  4O4L A;  4JI6 O;  1UJW B;  2YDE A;  1ARO P;  4RO2 A;  1N34 B;  4MTF A;  3TGU H;  1SS3 A;  4OGQ B;  3ABM C;  4G2K A;  1URF A;  1WPB A;  1GAX A;  2Q0O C;  2A79 B;  3ABK C;  4MSW C;  5KHG A;  2FML A;  2Q7G A;  3PJS K;  5B3S B;  5IYZ A;  5LA6 A;  2KG7 A;  4OX9 O;  1GM8 A;  4UUJ C;  3OMN B;  4KP4 A;  4O4H B;  4DR2 B;  1I5X A;  3OR7 C;  1Y66 A;  2ZCE A;  2O57 A;  2B1G A;  3IAY A;  3AK2 A;  1H2G A;  2XOK G;  4P2Z A;  2CTR A;  3HKC A;  2F43 G;  3ZN0 A;  1T5E A;  4X65 B;  4H37 A;  5KHK A;  2GTS A;  2W0F C;  1D5A A;  5EC1 C;  1Q90 D;  2H8P C;  2YS8 A;  4KL1 A;  4IHJ B;  2YSU B;  4DR4 O;  5EZY A;  2QKS A;  4QJF B;  4ZIB A;  2EJR A;  2ZD9 A;  3KCY A;  2HP8 A;  4EB6 A;  4XBF A;  3CP1 A;  5EIB C;  3CPW U;  1IZ3 A;  4UVA A;  2WPD G;  2RDC A;  5E1A C;  4PA3 A;  3ZHV A;  3A0R A;  4MVM A;  4LC1 A;  3H9V A;  3ML0 A;  1XMQ B;  5LMU B;  5IYZ B;  1M57 B;  1Y67 A;  1GMG A;  4HBN A;  2JK5 C;  3OGC C;  4LF6 O;  4GYC B;  2BOC C;  3CCJ V;  2QSA A;  3RT3 C;  1SQV H;  5LP6 A;  4YY3 O;  5CB4 A;  1BHA A;  3CCL V;  2PI4 A;  3WB1 A;  1Y4M A;  2LW1 A;  3P30 A;  4R50 A;  3J80 N;  4FFB A;  4UB8 Z;  2HHH O;  3IGA C;  2P5O A;  1AI4 A;  2DWE C;  1PD3 A;  3PN1 A;  3KG2 A;  4NXM O;  2Q73 A;  2QTO A;  3ASO C;  5DEC A;  2IJJ A;  2Q68 A;  4K0K O;  5EZY B;  3E8G A;  1SZT A;  3WG7 C;  5A9G A;  2GBO A;  1AI7 A;  2LQT A;  4JAV A;  1G6U A;  5C93 A;  1NH2 D;  3CRR A;  4FLY A;  3DC6 A;  1ROP A;  2P6J A;  1BMF G;  3T4D A;  1AR5 A;  3EFF K;  2VQE O;  3IC7 A;  4AI8 A;  3H1H H;  4D6T H;  3ABU A;  2W0X A;  3ASN C;  4LWS A;  1WA8 A;  3P3P A;  3CRA A;  3N2K A;  4NYK A;  2F95 B;  4FM2 A;  4GT1 A;  3CJH A;  4LF8 B;  3L71 H;  5CB4 B;  5BXZ A;  1NR1 A;  3OGI B;  2NN4 A;  1JA8 A;  3TK1 A;  1S5J A;  4HZ3 A;  2KKW A;  2DYS C;  2D3O W;  2AXT Z;  5B1A B;  2MW2 B;  1BZK A;  4F6E A;  2JS5 A;  2UUA O;  5TIS Z;  1NI8 A;  1E1R G;  3LSU A;  2BTQ A;  1M5I A;  1V54 C;  3LUT B;  2PYJ A;  2Y0I A;  2Y69 B;  4F6R A;  1Y76 A;  2Q9L A;  1CPY A;  1VAR A;  3G80 A;  4J11 A;  3JAM N;  3JAL A;  5GW7 A;  2OCH A;  5JVD B;  4DW1 A;  4FK5 C;  1H2K A;  1HWY A;  4JGS A;  2JDI G;  4WFG A;  1Q86 W;  5LOV A;  1X59 A;  3SPG A;  4YIO A;  1KEC A;  2Y4T A;  4QIW F;  2ARH A;  5BMV A;  1KBH A;  4DV7 O;  1SZX A;  5EBW C;  4LFA O;  1A32 A;  2FL4 A;  1VQ7 V;  1SF9 A;  5FL7 G;  3T1C A;  5KA5 A;  2IBZ H;  1FXH A;  2W6J G;  4X64 B;  2H94 A;  1THZ A;  4RQF A;  1NKD A;  3BCC H;  1X4T A;  1CP9 A;  1BSM A;  3AG2 B;  4PEL A;  4RUF A;  4UVC A;  3VQW A;  1AJP A;  4PDM A;  4JYY A;  5KHI A;  1Y76 B;  2A06 H;  1UFI A;  3C90 A;  3JAL B;  2JIZ G;  2CE4 A;  2Q69 A;  3OUF A;  3UT5 B;  3IFX A;  4GKK O;  1VQ8 V;  4MVU A;  1MOF A;  1N4C A;  4TWK A;  1M93 A;  3FD9 A;  3RYI A;  4B3M O;  4AQY B;  2WLI A;  3SYO A;  3AK1 A;  1D5N A;  4HAM A;  1H38 A;  1AB3 A;  3F5W C;  4J7J A;  1KD1 W;  3T1Y O;  1XRE A;  3BPZ A;  1AR1 B;  3E8H A;  2DW4 A;  1P4R A;  4TV8 B;  2YC0 A;  3ZRV A;  5J2U A;  2Q5Z A;  1GH6 A;  1B6Q A;  1U96 A;  2IH1 C;  3RN4 A;  3CC7 V;  1EN6 A;  1K3E A;  1AVM A;  4WBN B;  1L1F A;  1FAF A;  5KMG B;  4BW5 A;  4FMT A;  3K5M A;  1VQK V;  2DE0 X;  2QKA A;  3K9A A;  4LP8 A;  3DSQ A;  2QWN B;  2DQ0 A;  3RYC A;  3MHH C;  3M7M X;  4O4I A;  3L75 H;  3AG3 B;  4ICG A;  1PL4 A;  3FB7 C;  3RYI B;  3HKB B;  4JI0 B;  3X2Q B;  2WLI B;  3UM7 A;  4LFC O;  3RYF B;  5LXT B;  1YTF D;  2A3Q A;  1PP9 H;  4DR5 O;  1FJG O;  4MT8 A;  4DR6 B;  4JI2 O;  2UU9 O;  4KHP B;  3B4S A;  5JH7 B;  5FNV B;  4WFB V;  4PHZ A;  2D2C B;  1HNZ B;  1NBM G;  2GTA A;  1W0J G;  3E8F A;  4JI3 O;  1LUV A;  1QLE B;  3FB6 C;  4R6Z A;  3AK3 A;  4JI1 B;  5IWA B;  2ZQM A;  2JS3 A;  4FZ0 A;  4KFM A;  5IY5 C;  2EUL A;  1V9P A;  3T1H O;  2ZR2 A;  3BA8 A;  4PI0 A;  3T4Z A;  4MVO A;  1NQT A;  2X6B A;  2ODM A;  3RYC B;  2Z3Y A;  4FM1 A;  1Q6I A;  1N32 B;  3BFR A;  4J80 A;  4WCE V;  5GON A;  3OMI B;  4K35 A;  1FXK A;  2X0L A;  4A5U B;  1KQS U;  2BSK B;  1MZF A;  1EM1 A;  5C8Y A;  1I7F A;  1H8H G;  5EYP A;  4FJC C;  3OAA G;  1ENV A;  1QU7 A;  4MVZ A;  1MAB G;  1KKC A;  1H2N A;  4DR7 B;  4JI7 B;  2E5L B;  1K73 W;  4X1Y A;  4YXW G;  2ZKO A;  3B8N A;  4IT5 A;  3TCU A;  2EIN B;  3RWR D;  1OCR B;  3K57 A;  4F4L A;  3OR6 C;  3R65 A;  3WB0 A;  1K4D C;  1VEW A;  4LH7 A;  3ABT A;  4NB5 A;  2ZXW C;  4TOI A;  2NLJ C;  4Z2W A;  3QO8 A;  5BZB A;  2JRI A;  2RN9 A;  1LUW A;  2JGD A;  3R66 A;  1W0K G;  1S76 D;  3CE2 A;  3CXH F;  4UCV A;  4LF7 B;  1K5Q A;  4RWU A;  1Q43 A;  3P3N A;  3U0Z A;  5H6Q A;  5CBH A;  4I9Q A;  1SA0 A;  3FX7 A;  3OEE G;  1DF5 A;  1VP7 A;  3BAB A;  4Q6G A;  5KX5 B;  1B04 A;  3FAV B;  2P06 A;  2Z0A A;  1RPR A;  1VQL V;  2QWR B;  5A2Q N;  4HYO A;  4X1Y B;  3LDD A;  3AG4 C;  1XNQ O;  4FLU A;  3J7A U;  4DW0 A;  3HKE A;  4X1K B;  4GX0 A;  1JVM A;  5IJ0 B;  3SJA C;  4DV2 B;  2WLN A;  5JJN B;  4DRX A;  3WU2 Z;  2AGA A;  3Q4H A;  1FFX B;  4I0X A;  4LF4 O;  2Y0P A;  1JCH A;  1GO3 F;  2RCV A;  5BY1 A;  3RVY A;  2ITD C;  1I94 O;  4GX2 A;  1SA0 B;  4ZOL A;  4JTD B;  4MTO A;  3W7S A;  1YSC A;  3G71 V;  1PL0 A;  5JCO C;  1N34 O;  1WP7 A;  1PKX A;  1N8R W;  4FLT A;  1BHB A;  4QE9 A;  1QHT A;  3L9D A;  5K1P A;  1RSO B;  2ZE5 A;  1OCZ B;  2GUZ A;  3VQX A;  4TQF A;  3SR2 C;  1AR4 A;  3CRM A;  3JAR B;  3HKE B;  1KYO F;  2ATK C;  1JFF B;  4FVM A;  5KLV H;  1XMO O;  3ABM B;  2UXN A;  4PDR A;  2P90 A;  4DR2 O;  4OXS A;  2QWQ B;  2WWW A;  4LF5 B;  1VQ5 V;  1OJH A;  4DRX B;  4O4H A;  4NXN O;  2Q7E A;  2C2A A;  4AIL C;  4JV5 B;  3OTO B;  2HEP A;  1QR8 A;  4ZOL B;  4DV4 B;  1O9H A;  4DR3 B;  1NJI W;  3ZS8 C;  4DR1 O;  2HLD G;  4BAY A;  2ETN A;  4CS4 A;  2M7W A;  2H3O A;  2PYL A;  2WAM A;  4DXW A;  4RQE A;  1JJO A;  3RYH A;  1XL4 A;  2L6L A;  1KP2 A;  4DV3 B;  4B3R B;  2F23 A;  3N27 A;  2GUZ B;  3UCS C;  2EZP A;  3H1K H;  3FFQ A;  3VOU A;  2K9P A;  4JYA O;  4PA6 A;  1NH2 B;  3L73 H;  4YHH B;  1XMQ O;  2WLH A;  5LMU O;  3L74 H;  5AG2 A;  4B7K A;  4X66 O;  1S0V A;  1WAZ A;  3STZ C;  3H01 A;  2WLM A;  2N05 A;  4IGG A;  3RFR A;  4DV0 B;  2ZE6 A;  1TAE A;  2EIJ C;  1OCC C;  1V55 B;  3E86 A;  2VQF B;  1RM1 C;  3BA9 A;  1RP3 B;  1DF4 A;  3ZX6 A;  1HR0 B;  4LF9 B;  1GRJ A;  3F7V C;  5EC2 C;  3O9O A;  3CD6 V;  2B5U A;  1QVF U;  1ORQ C;  2LP7 A;  4JTC B;  4J7K A;  2R9A A;  1BQ0 A;  5JJJ B;  1KC8 W;  4DV1 O;  3APO A;  3RYH B;  2ADP A;  2CTP A;  4DV6 B;  2LJ2 A;  2RNB A;  4DUZ O;  4TV9 B;  3LNN A;  3L70 H;  4UXN A;  2ZIN A;  1F4M A;  1U97 A;  1DGS A;  4LF8 O;  3E22 B;  3AG1 C;  4G27 B;  2Q0A A;  3G67 A;  2ZM6 B;  3K58 A;  3IC9 A;  1Z2G A;  4YJ3 A;  3RW0 A;  3JD1 A;  2QA4 V;  4Z1M G;  2CH7 B;  4J9Z B;  1GN3 A;  1GKF A;  1P84 F;  1SET A;  2P4V A;  2AZ2 A;  3DXR B;  4PJ0 Z;  4L8J A;  1IBK O;  5HFL A;  2UXC B;  2YID A;  1JMK C;  2DYS B;  2WLJ A;  1BQZ A;  4FZ1 A;  3W7W A;  1H2M A;  2F1M A;  3OM3 B;  1HNW O;  2OCC B;  1XBL A;  1M90 W;  2PI5 A;  4R8C A;  2OIE A;  1FYJ A;  1QNM A;  1XHX A;  2WLL A;  5EIB D;  2F4V B;  5CA1 B;  3G4S V;  1BS3 A;  1V54 B;  1PV0 A;  1YXB A;  3ICX A;  3K03 A;  4X20 B;  5JVD A;  4DYL A;  1WLE A;  3D8C A;  4YJ3 B;  1M57 C;  5LGN A;  4K8X A;  5EBL C;  2CDY A;  4JYC A;  3CCV V;  1PNL A;  2JGU A;  5B1B B;  2YXY A;  4DV5 O;  4U7N A;  2AZ0 A;  4HNA B;  1JX9 A;  1K7D A;  1K92 A;  5LMN O;  2XAF A;  4TQD A;  5LGT A;  3F5T A;  4IYH A;  2XT9 A;  2EIL C;  2VS0 A;  2LFR A;  1S77 D;  3CXC U;  2N74 A;  4LNU B;  4PA4 A;  4MW8 A;  2WLL B;  4TUY B;  1WJZ A;  2LGW A;  1S5H C;  3ZHS A;  5IE9 A;  4O2B A;  3RVZ A;  5KA6 A;  3UT5 A;  4K0K B;  2XHB A;  5LL6 Y;  1D2D A;  2EX3 A;  2Q7H A;  4AQY O;  2OT5 A;  2ZDI A;  1R6T A;  1PM9 A;  4JI5 B;  3THO A;  5LP6 C;  1EN4 A;  2CTQ A;  5J2T A;  1Y6X A;  1YTF B;  3W7U A;  4JYB A;  3QVN A;  4G28 B;  2A7W A;  4JPR A;  1YHQ V;  3D36 A;  3QNE A;  4TV8 A;  1VMG A;  2GHY A;  3OE7 G;  5KAF Z;  2FKX A;  1ZL8 B;  3ZHT A;  3U11 A;  4R7C A;  3A2F A;  3ZHQ A;  3QTC A;  3SYQ A;  5L3D A;  1GK9 A;  1GN2 A;  5KHH A;  1B3Q A;  3JD3 A;  4WBN A;  2Y69 C;  1H8E G;  4O2B B;  1DTO A;  2OWO A;  3JAW A;  5KMG A;  3JSL A;  1TVK B;  4UVB A;  1Z5W A;  5GTI Z;  2EBO A;  1LR1 A;  5J9P C;  4PDV A;  2DQ3 A;  3G6E V;  3K0D A;  1XEQ A;  2R9R B;  1OV9 A;  4CH5 A;  2N04 A;  4JI4 B;  1VF7 A;  3HKB A;  2EIK B;  2E74 B;  1XIL A;  2XAS A;  1BGY H;  1RPO A;  3RYF A;  5LXT A;  5J2T B;  1NT2 B;  3ZMV A;  4KHP O;  5B1O A;  3K79 A;  4EKW A;  3BY6 A;  1SRY A;  4W4K A;  1XL6 A;  5L3G A;  1SER A;  3OEH G;  5JH7 A;  2YIC A;  4UFZ A;  5FNV A;  3K04 A;  2DOS A;  3MAQ A;  3S3X A;  1Y74 B;  3HKD A;  4J41 A;  4DV7 B;  2QKC A;  4GKJ O;  4LFA B;  3AG2 C;  4I50 A;  2HJF C;  2LFS A;  3CWB H;  2UXD B;  1KU9 A;  1Q82 W;  3CRQ A;  5ITZ A;  2AHZ A;  1P7B A;  1SC5 B;  3B40 A;  5LHH A;  4GX5 A;  2UXB B;  2CAZ C;  3JAW B;  1NVP B;  3ZHR A;  2HJD A;  5BR8 B;  5IY5 B;  1DLB A;  3CMA V;  4K3A A;  1GM7 A;  1XOU A;  3JD0 A;  2E3C A;  2IJI A;  2LGQ A;  4LH6 A;  3ZBH A;  2UUB B;  4KUM A;  3OMA B;  4GLX A;  4J10 A;  4WFA V;  4FIP C;  3D3Q A;  1SQP H;  1FD9 A;  4PD4 F;  3AEI A;  5CBG A;  2BSK A;  4CS3 A;  5E79 Z;  3ZED A;  2KB1 A;  1W2B U;  2ADQ B;  4X62 B;  1QLN A;  1N0N A;  3HKD B;  4DR7 O;  5EK0 A;  1HP8 A;  4B3T B;  4I50 B;  4UCR A;  4B3M B;  5ITZ B;  1Z5V A;  4UCT A;  1ZUQ A;  2P4K A;  5JWP A;  1CEZ A;  4J7Z A;  1NTK H;  2LO1 A;  2V1D A;  5H5N A;  3T1Y B;  4QE7 A;  2QEX V;  2UUC O;  5L3F A;  2CTW A;  1HNX B;  2OTJ V;  1M4U A;  2ZXW B;  4IL6 Z;  1AP6 A;  1YEW A;  3LDE A;  1K34 A;  4MW3 A;  2XND G;  1QVG U;  1W59 A;  4Z1V A;  3OW2 U;  4MVQ A;  2X6C A;  3JCU Z;  5KX5 A;  3UQ8 A;  3FKS G;  4CZZ A;  4UB6 Z;  3EXA A;  3FAV A;  1SQG A;  1HW7 A;  1I0H A;  5B5E Z;  5CN0 A;  3CCS V;  1K97 A;  2XAJ A;  5H2F Z;  2QR4 A;  3E35 A;  1IXM A;  2BE3 A;  3ZCC A;  2FTK A;  3FB5 C;  2UXX A;  5KUM A;  2VRZ A;  3ABL C;  4U3F H;  3ETQ A;  1R3L C;  4DR5 B;  1NVP D;  1N0J A;  1Q5O A;  3SJB C;  1FJG B;  2Y48 A;  4DV2 O;  4X1K A;  2UU9 B;  4I5S A;  2QWP B;  3OUS A;  4CH3 A;  1XDC A;  3AG4 B;  3JCZ A;  3O65 A;  5IJ0 A;  2GDS A;  4MTX A;  4YJ2 A;  1J5E B;  3ZMS A;  1FFX A;  1VQ9 V;  2CGN A;  3CS5 A;  1SQX H;  1YJN V;  4UCU A;  3SPH A;  2E76 B;  4PDL A;  2EIM C;  1KMI Z;  3CCQ V;  5H9C A;  1Q7Y W;  4W4L A;  5IYD O;  3J81 N;  3W7X A;  3I56 V;  5LBQ A;  1O9G A;  1RSO A;  4BR6 A;  1TA8 A;  3M8A A;  3P32 A;  5JQG A;  1MNG A;  3H1I H;  3JAR A;  3L72 H;  3JAK B;  1JFF A;  3JD4 A;  1KUQ A;  5IT9 N;  2NNU A;  4JTA B;  1YF2 A;  4LF5 O;  2ITC C;  1IXB A;  3CYO A;  2EIN C;  3ZMT A;  5KAI Z;  4YJ2 B;  3SDL A;  1Q3E A;  4QPK A;  3ZMZ A;  3HR0 A;  4JI8 B;  4JV5 O;  2GSM B;  1YZB A;  4IIJ B;  3ETD A;  4DV4 O;  3E2E A;  1IBL B;  1IDS A;  2YUA A;  4B7E A;  1L0N H;  2PUS A;  5B1N A;  3ETG A;  4ASU G;  1G8M A;  1LNQ A;  3B77 A;  1FFT B;  4LBE C;  2ZE7 A;  4X89 A;  4FPP A;  3CX5 F;  3STL C;  3SJQ C;  1FXK C;  1TUE B;  4DV3 O;  1E79 G;  1NU1 H;  1ZTE A;  4CC6 A;  1GN6 A;  3HB3 B;  3JYC A;  5GTH Z;  1BL8 A;  3JAT B;  4J42 A;  3CME V;  4YHH O;  1QQC A;  3JSN A;  5KUK A;  1R1B A;  3TXQ A;  5JQG B;  1H2L A;  2CUG A;  4GCZ A;  2FB5 A;  4JF3 A;  2WA4 A;  4DUY B;  2IJK A;  4JAA A;  1IBM B;  2VQF O;  3E8B A;  2P7T C;  1GN4 A;  1YDX A;  1VQO V;  4B3S B;  1HR0 O;  3ABK B;  4O2A B;  5LGU A;  3MD0 A;  1N36 B;  4ZHQ B;  3K9S A;  1OCO C;  3OD4 A;  1P49 A;  4X65 O;  1WN7 A;  3KZI Z;  4MS2 A;  1OCC B;  2BTO A;  3JD2 A;  2CK3 G;  4I55 B;  5LHG A;  2WSS G;  4DV6 O;  2HR3 A;  1M56 C;  1DK1 A;  2XAH A;  2IH3 C;  3OTF A;  3C3S A;  4FLW A;  5D5Q A;  2YIA A;  2DYR C;  5D5P A;  4TV9 A;  1MA1 A;  1VIB A;  1R6N A;  2YEV B;  3M99 B;  1NTZ H;  1YIJ V;  2ILM A;  1OCZ C;  3KCX A;  1AI6 A;  1QR9 A;  2ZM6 O;  3E22 A;  2VWJ A;  1RFY A;  2L35 A;  1IX9 A;  3NXS A;  3K5N A;  4LFB B;  3H1L H;  1MG1 A;  4NTX A;  3AG1 B;  4X1I B;  5DN6 G;  2CH7 A;  4WFF A;  1XNR B;  4K8Z A;  2UXC O;  1MSD A;  3SPI A;  1XMO B;  2IW5 A;  3DXR A;  1N33 B;  3DTU B;  3TET A;  5H6R A;  2HFE C;  3APQ A;  1QCE A;  4UCS A;  1WNS A;  3DGE A;  3EVK A;  3ZN1 A;  2RJZ A;  4NXN B;  3VQV A;  1NR7 A;  4PI2 A;  4C7U A;  3ASO B;  1JOY A;  2F4V O;  3CCR V;  3CC2 V;  1WPX A;  5F2V O;  3WG7 B;  4DK1 A;  1YVW A;  2WA3 A;  2HG5 C;  1G1X B;  4O4L B;  5CA1 A;  3T2M A;  4DR1 B;  3LSQ A;  2BOB C;  2QDO A;  4X20 A;  4U7O A;  3SYA A;  4AHC A;  4JI6 B;  4ZKI A;  1S3J A;  3K3W A;  2KQX A;  2ZE8 A;  3BEH A;  3ASN B;  5B3S C;  2Q6A A;  3ZMU A;  3K0G A;  4JZG A;  3MDS A;  2G38 A;  4XDJ A;  1V55 C;  4JYA B;  1YJW V;  2R9I A;  1B06 A;  4HNA A;  4X66 B;  2QM8 A;  5LA6 B;  2YIB D;  1K8A W;  1R3J C;  1SQB H;  2KG7 B;  3DC5 A;  4D7S A;  1HDJ A;  3W7T A;  4NKG B;  4OX9 B;  1OHH G;  2EJ7 A;  4RUE A;  3HKC B;  5KHJ A;  4LNU A;  2EIL B;  4TUY A;  2PTM A;  1WB7 A;  3CCE V;  2BCC H;  4E4E A;  4GX1 A;  4X9Q A;  4CH4 A;  1M9N A;  4FM0 A;  4UCO A;  1WP8 A;  4DR4 B;  4EB6 B;  4DV1 B;  1PNM A;  2V7Q G;  4JI5 O;  4DUZ B;  2FYU H;  2XAQ A;  3FB8 C;  4PA7 A;  3GB7 C;  1JPX A;  2IJH A;  4X64 O;  3CCU V;  4QGP A;  1JR9 A;  2ZIM A;  4EEQ A;  1TGO A;  5LP6 B;  1K33 A;  4GZR B;  3SYP A;  4H33 A;  3QO7 A;  4LF6 B;  3BAA A;  4YY3 B;  1ZL8 A;  1WB8 A;  4FFB B;  3ZJZ A;  2EZO A;  2QE7 G;  2PF4 E;  4EFB A;  4FLX A;  2OCC C;  1FPO A;  2HHH B;  1ZAU A;  1K4C C;  4NXM B;  1SQF A;  5DM6 V;  4P9P A;  1IBK B;  1FXV A;  1SES A;  1NZ6 A;  1TVK A;  1VQM V;  4OPA A;  2V4D A;  4JI4 O;  1S5L Z;  4CC5 A;  4N23 A;  1HNW B;  1GTO A;  5L3E A;  2YI8 A;  3A0H Z;  2PGG A;  2JEU A;  3BRC A;  2R72 A;  1YCI A;  3ETE A;  4QNH B;  2R70 A;  1SKV A;  3TXS A;  4LWS B;  1WA8 B;  2VQE B;  1TUB A;  3N2K B;  1S72 V;  3TJT A;  1L8D A;  2B1I A;  3CJH B;  4CBC A;  5B1B C;  3SPC A;  1KB9 F;  3VBB A;  3CHX A;  1M1K W;  5B1A C;  1MMM A;  1NTM H;  2HVK C;  2X7R B;  4I4T A;  3K59 A;  2IM9 A;  4TSF G;  4EFE A;  3SYC A;  5CMU A;  1BCC H;  2UXD O;  3MHS C;  1Y74 A;  1J95 A;  2OIG A;  1EZV H;  2ZR3 A;  4BIU A;  3VQY A;  2UXB O;  2F66 C;  1Q6U A;  4DV5 B;  1E1Q G;  2AHY A;  2A9H A;  1F51 A;  1AJQ A;  3OFN G;  5LMN B;  5IYB O;  5BR8 O;  1H2S B;  1R6K A;  2BTQ B;  3G6B A;  2UUA B;  4D7T A;  1AIL A;  2A0L A;  2UUB O;  5CBF A;  2ZNI A;  3I5D A;  4JI0 O;  1EBO A;  4F6R B;  3CC4 V;  1YIT V;  1KKD A;  5K1X A;  4DK0 A;  2QWO B;  4JAU A;  1ZX3 A;  4JAS A;  5L3C A;  5HFM A;  4DR6 O;  1TUB B;  3F7Y C;  2E75 B;  4DO2 A;  4X62 O;  5LOV B;  1YJ9 V;  1HNZ O;  1Q6H A;  3BHP A;  4I4T B;  5BMV B;  3C3T A;  1VQP V;  4ABM A;  5FLX N;  1G4Y B;  4B3T O;  4JI1 O;  5IWA O;  3IJ4 A;  1EN5 A;  1KP3 A;  3GVM A;  4WFH A;  2Q67 A;  1QBZ A;  2Y4U A;  2IU0 A;  1COW G;  2HVJ C;  3B2E E;  4OPH A;  5JJE B;  1HNX O;  3D3I A;  2PY5 A;  1XI1 A;  2XTA A;  1F23 A;  1N32 O;  3ZRW A;  4FLZ A;  1VF5 B;  1EZJ A;  5CA3 A;  1Q8I A;  1K9M W;  1UPG A;  2ZDI C;  3QO5 A;  2EIK C;  4UV8 A;  3GWK C;  3CSX A;  5LYJ A;  3U10 A;  4Q20 A;  3BVO A;  4JZ2 A;  4GKK B;  1R3K C;  1AP5 A;  4BW9 A;  2ZT9 B;  4LCU C;  1P7G A;  2E5L O;  4JI7 O;  4RAI A;  2LW7 A;  2GV9 A;  2Z5U A;  3D36 C;  4L87 A;  4NVP A;  3RGB A;  1AI5 A;  1PNK A;  4H0L B;  2X6A A;  4P30 A;  5EBM C;  4X8A A;  4ZI7 A;  4B08 A;  1J5E O;  2RQ6 A;  4TT3 G;  1VF6 A;  1VQ4 V;  3QF7 A;  5J2U B;  2OTL V;  4LF7 O;  3AG7 A;  3ABL B;  4J9Y B;  5DED A;  4YIP A;  5B66 Z;  3ZRW B;  3LDC A;  4GKJ B;  1VQ6 V;  3HPL C;  1F7Y A;  2IU3 A;  3AG3 C;  1EFR G;  3X2Q C;  2XUM A;  2YXL A;  1JQ0 A;  3WB2 A;  4BIO A;  3ZHU A;  5IJ9 A;  4BIZ A;  5LYJ B;  1I5Y A;  1ZWI C;  2EIM B;  2QM4 A;  4NTY A;  4O4I B;  4PV1 B;  1F4N A;  4NR1 A;  3GWO A;  4UV9 A;  4H13 B;  3SJC C;  1ZLZ A;  1XHZ A;  2DJV A;  4CH6 A;  5JCO A;  3E83 A;  4O4J A;  3B8M A;  4LFC B;  1ZSP A;  3LSS A;  2JJ1 G;  1XQ8 A;  1QLE C;  3JAK A;  4MVS A;  4ZI7 B;  1I08 A;  4JI2 B;  3KKY A;  4JI8 O;  1GM9 A;  2VWK A;  4MTG A;  4FFK A;  1IBL O;  1JJ2 U;  3K06 A;  2JJ2 G;  3N2G A;  4IIJ A;  4JI3 B;  3E89 A;  2JVD A;  1US6 A;  2HKO A;  3CEI A;  1BE3 H;  4QPJ A;  3K5L A;  3T1H B;  2Q8V A;  5IJ9 B;  3A0B Z;  3S3W A;  4P9O A;  3QG5 A;  2UUC B;  3SPJ A;  4MVR A;  3JAT A;  5IDJ A;  5GON B;  3CCM V;  1FXK B;  4DUY O;  4O4J B;  4CS2 A;  2YI9 A;  1CXZ B;  1IBM O;  5C8Y B;  2PZS A;  2ZNJ A;  4U3J A;  5EYP B;  3JAS A;  1VQN V;  2AW9 A;  2QTS A;  3K5O A;  4B3S O;  5LHI A;  1OCR C;  4NTW A;  1N36 O;  2NR5 A;  1R73 A;  1VF6 C;  2ZIO A;  3N2G B;  4O2A A;  3OTO O;  3NR7 A;  4DR3 O;  4ZHQ A;  1MZE A;  1MSW D;  3CB2 A;  2OYQ A;  4XDK A;  2W6I G;  2QM7 A;  4H44 B;  2P67 A;  1R3I C;  3WFV A;  2F93 B;  2JGD B;  1OCO B;  3ZRX A;  4I55 A;  2CGO A;  2WLK A;  3K08 A;  4B3R O;  1K5S A;  2RMK B;  1SQQ H;  2YIB A;  1IUR A;  2Q4P A;  4X88 A;  1M56 B;  3CRC A;  4FLV A;  2YEV A;  3B09 A;  3FYE B;  2QGN A;  4U3J B;  1OZ0 A;  4LR3 A;  4DV0 O;  2DYR B;  1IVS A;  2DWD C;  5CA0 A;  3JAS B;  1BT8 A;  1PPJ H;  3FYI B;  4BWA A;  3OT7 A;  3EHB B;  3LNM B;  5IYC O;  3ZIA G;  4LFB O;  5FPO A;  3ZRS A;  2KSD A;  3SGI A;  3RBZ A;  4LF9 O;  2JEX A;  4PA9 A;  4GUN A;  1FKA O;  3I55 V; 
#chains in the Genus database with same CATH homology
 3KZI Z;  1S5L Z;  3JCU Z;  5GTI Z;  5KAF Z;  5E79 Z;  4UB6 Z;  4UB8 Z;  3A0H Z;  2AXT Z;  3A0B Z;  5KAI Z;  5B66 Z;  4PJ0 Z;  5B5E Z;  3WU2 Z;  4IL6 Z;  5H2F Z;  5GTH Z;  5TIS Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...