4ILDA

Crystal structure of truncated bovine viral diarrhea virus 1 e2 envelope protein
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
241
structure length
235
Chain Sequence
b'DVVEMDDNFEFGLCPCDAKPIVRGKFNTTLLNGPAFQMVCPIGWTGTVSCTSFNMDTLATTVVRTYRRSKPFPHRQGCITQKNLGEDLHNCILGGNWTCVPGDQLLYKGGSIESCKWCGYQFKESEGLPHYPIGKCKLENETGYRLVDSTSCNREGVAIVPQGTLKCKIGKTTVQVIAMDTKLGPMPCRPYEIISSTACTFNYTKTLKNKYFEPRDSYFQQYMLKGEYQYWFDLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Envelope glycoprotein E2
publication title Crystal structure of glycoprotein E2 from bovine viral diarrhea virus.
pubmed doi rcsb
source organism Bovine viral diarrhea virus 1-nadl
molecule tags Viral protein
total genus 38
structure length 235
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-12-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3000 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ildA01
3.30.1360.280 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4ildA03
2YQ3A 4ILDA 2YQ2A
chains in the Genus database with same CATH superfamily
2X4SA 3V0VB 1E4KC 1U36A 3BO8B 4P2QD 5AWNH 3FT2B 3M1OA 3WY2A 1YY9D 4HEME 2F68X 2GHWB 4NP9A 2IMMA 2P8MA 4U0RB 4Z7VF 4MDRA 3F8UB 3FCUB 1TYEB 5C92A 4D0CA 4XMZA 4U6VH 4OLUL 1DN0A 4GW5B 2DLIA 5DJDB 1OO2A 2BP8A 4DVBB 5AG8A 3TNMB 3SKJH 4I5BB 1CYXA 4ORZC 1T0MA 1Q9WA 4NS0A 4FAAB 1QI5A 4E41D 4Z7OF 4M7JH 4N2CA 1N4XH 3CD4A 5DJ2A 4PP1C 1MF2H 2BIIA 4I8DA 1NFDB 2R69L 4NGHH 5EU4B 4BY7K 3N1QC 3K1DA 1BZDA 1A6ZB 5AVXB 2A7BA 3D3VE 3FYEB 3U0PA 3B9VA 3QHFL 3PV7A 4HIJB 4DVRH 2BS8A 3U9PL 1OCWH 2EDKA 5CJQL 4OB5H 1ZS2A 4JDZB 4Z77A 2QFRA 4ONHA 4DO5A 4KKNA 4JREC 3V95A 2ZE0A 3N9GH 5B1CA 4KJQC 1U3ZA 4A3BC 4NIYE 1XEUA 5AYQA 3G5VB 2WK2A 4NOIA 4Y4KD 4XO9A 1QUNA 2VR5A 4X6DA 2Q2EB 1B0GA 1CFQB 2X38A 3ALWA 2BIMA 2A3TA 2FHFA 3DETD 2CK0L 2YUXA 4ODSL 4XNUL 4XN7A 4EI5D 2H0EA 2GJZA 1E7VA 3CC1A 3UYRH 2WQWA 1A22B 1KGCD 5F7EL 1LO3L 5INCA 1J0HA 2QADC 4PFEA 5HYSB 4QIWD 3VA7A 1K83A 5MHSD 1AD0A 2P7TB 4XCNA 4AQZA 2EYSB 3MUGA 3RZCA 2YFNA 4YBLC 3BZEB 1PLCA 5CFAA 2GK2A 1EERB 1YY8B 3BJ91 2F53B 3LJ3A 3QC5X 4NO0A 4Z8FL 1QZNA 3EHBD 1OHZA 2BP0A 3UTTE 1DJIA 1S46A 3NJGA 4KKCD 4X4ZA 1T5XB 2FLBT 5C0FA 3RTQD 2H5UA 4X9YA 1JOIA 3BN3B 1AO7B 4AYEC 2JA6K 4Q9RL 3ARFD 1JDAA 4G8FA 1E43A 2B9BA 2P80D 1QLEB 3W3BA 3RFRA 1GKOA 2I27N 4MB1A 1ZLUH 4OQ1A 1R5VA 3TONA 5IJDC 3Q5YA 3GMOA 1ZSHA 4HEPG 1SXSA 2UZXB 4W9DC 4QXGL 3TX4A 4JGNA 2NVTC 3F01A 3SPIA 4NI6A 1BM3L 5I1JH 3WTXA 7PCYA 1MCOL 1Y07A 2J6EL 4NUGH 3KR3H 2Z65C 3SGKA 3O3BA 4QRPB 1KJ3H 3FQNA 5F1OB 3UCRA 2YPLA 1KN4H 1IGMH 3CMOH 2C9VA 1TWCK 3O6FD 2B0SL 3QEQD 1A4AA 5IK3A 4CMMB 1NCDH 3D50A 1VB9A 4A3KC 3QFGA 5F9OL 1MREH 4QYAA 3VXTB 4QYOB 4HIPA 4OBSA 1U8QB 2DQUH 3BQUA 3TN0C 4M7ZC 3W39B 4FA8A 3O9WC 5CILH 4JFPB 4X6CA 2VUMA 4NWTL 1EWHA 4N2FA 1R75A 3QCVL 2Y7NA 5CD3B 2PCPB 3FB5A 4ABUA 2B39A 4JFFA 4GAYB 3V0VA 5EZIH 3MRKB 3KWTA 4NN6B 3S1NK 1EX0A 2IGLA 1BDFA 4XPTH 4EMZA 5EORH 3SGEI 4PRPD 1W0WB 3HG5A 4CW1B 5I5JA 4X9IA 3GBNL 4RMBA 3NIFF 4NFBA 3QRLA 5L9DL 3RB5A 4NENB 2P1YA 1PY9A 2WLZA 3BWAB 3QSKB 1NC4D 5KTEL 1IS1A 4MQXC 5CP3H 4WU5B 1TQCC 5DWPA 4E41E 3MRCB 2MJWA 3DSFH 1J48A 1JGLH 1YRKA 1KTBA 4GW5A 4PGDB 4RAVA 5L2KE 1AKJD 1WBZB 2NTFB 5ESAB 4G1EB 5DJDA 3TNMA 3IE4A 4YSUA 4GTDA 4I5BA 3PWVA 5D1QB 1SMOA 2G4GA 4PY7B 4G9DB 5BZDB 2NMSA 3A6OA 4OU3A 4F20A 1EO7A 3GPEA 1NFDA 2J1YA 5EU4A 4UTBA 5IMMA 4P2AA 1A6ZA 2ZXWB 4QT5B 5FGBA 4NSKB 3SPVB 3GZOA 2R0LL 3ARPA 4HIJA 1UOVA 5TQ2L 3FBQA 3J8F7 5TH2B 3SOBL 3UEZA 2E4FA 2WIMA 5IJBC 3ARBD 4IOSA 3AG1B 4YSSA 2F8VA 3CWGA 1SBSH 5E7FA 4XNZC 2WO3B 1NLDH 4FJ6A 5I74C 5DJCB 3OKOB 5I1HL 1KGCE 5MHSE 2Z4TA 2EZ0D 1CLYL 5JOEA 4WKZB 5LUMA 1CFQA 1IL1B 5B38A 1XGZA 5KN5B 1XZPB 2JH3A 2EO9A 3LVTA 4FFTA 5HHNA 2OJZL 4FNLL 4L8SC 4G8GB 3RL1B 2QDVA 3FXIC 4OM1H 5DZPA 1UA7A 3GK8H 3LPPA 3OVUB 3CXHK 4W4OC 2P7TA 5C3EC 4Z7QB 4KATA 4R6UA 3QIWB 4U05A 1RZ8A 3JVGC 2AJZB 2C3VB 5ILTL 1JPTH 3THMH 3BZEA 3L3DB 4N0YH 2CR0A 2WQXA 4UAOC 1YY8A 3IDGA 3SKOA 2F53A 5IOKA 2EDYA 2VN3A 5DLLA 1T0PB 1U3NA 3LPFA 4XP9L 3RG1C 1JZEA 1T5XA 1W8EA 2DQJH 2VH5H 2AXGB 1BEYH 1VGKB 4Z7UE 3MA9L 2ATKB 1I8LA 1AO7A 1I9EA 3FFCB 5EN3A 3ETSA 1BZ9B 3PWPE 4WO4D 4X8GA 5FW7A 2BSTA 5ABDE 4L3AA 3TEUA 1VZHA 3FPYA 4LLVB 4S1DD 5E99H 2UZXA 1G7MB 2VLJD 1PG7W 3NABH 3BKCH 3HHRB 4RFOL 4BCYA 3C5ZB 1T1WB 2OSLB 5GS2H 5JR1L 3GPSA 3IDYB 2VRAA 3HNTL 3ZPDA 1AQ8A 1CFVH 2ZYHA 3M4OC 4ODTL 1DVFC 5IQMA 4QRPA 1JZ4A 1U6AH 2GG1A 4YC2B 1NANI 3F58L 2KBGA 4CMMA 1P0SE 3D5OF 3RIFK 2NY1C 1AACA 3VXTA 1NL0L 2JJSC 3BPCB 1DCEA 1SJMA 1CUOA 1U33A 4QYOA 1U8QA 4BH8B 1T1YB 4YHOH 4PBDA 3MUY1 4YZFE 4JFPA 1HAUA 3CFQA 2XIBA 4JVPA 2JK5B 4DQOH 4AX3A 1YPZF 1PNDA 4JFYB 4ZUWB 1ASOA 3LAFA 3OL2A 5D55A 3GSRB 3L7EB 4GAYA 3CFKA 3G6DL 3RFZC 1S7UB 1WT5A 4TF4A 3O2DA 2WZ0A 4KMUA 1KXHA 3DXAB 2VQUA 8FABB 2LU5A 4QOKE 1JZ6A 3I50L 1V7ML 1FZKB 4CW1A 5T33H 1H8NA 1HL8A 3L1FA 3P0GB 1WA0X 4GO9A 2NYYD 4FHJA 2CBPA 2E7BA 4OCXH 3OPFA 1Q8MA 5AVRB 1DQIA 5B7FA 5CMAA 2JCCE 5F96H 4NENA 3BWAA 4OY9A 4S1SH 5D7LD 2GJ6D 1HI6B 4Y5YB 4WU5A 1MFBH 2WXLA 4O58L 1NBQA 1QLFB 2NY4C 3MRCA 1Z9PA 4PGDA 1O6VA 5HVFB 4BFOA 5MI0B 1HIMH 3IPFA 4U3SB 5TE6H 3X3GL 2NTFA 1BZQK 1YEDB 4G1EA 5ESAA 1P6AB 4K8RC 5D1QA 2R1WA 3K2MC 3K2UL 4P3CL 3VXOB 2CJSA 3V9FA 4K8RL 4G9DA 2XN0A 4J3SA 1A9BA 1SPDA 5BZDA 3ABKB 3W37A 3QUMH 1HHKB 4K5NA 4L3CB 5DJ8B 5AUMB 3RGVA 3RJQB 3SYPA 1F3RB 1OL0A 1Q0XH 2WXQA 1JVKA 2QDWA 3D9AL 3PDDA 4NSKA 4OD3H 3SPVA 3IDJB 1JDCA 3FJTA 1NAMH 4ZD3L 1OP3K 4JZJC 3ARSA 3HB3D 4JHZA 5TH2A 1R3KB 2X0VA 5CGYC 1JVIA 4ENZA 2F19H 2HFGH 2CSPA 2RA1A 3CZLA 2JA5A 3OKOA 5KYUB 3U6XS 1NPUA 3HOUK 4OTXL 2CKNA 3IXTB 4FNPA 2TRYA 5K39A 3EYUH 1IJ9A 2MQGA 4LCVA 5KSAB 1WCMA 3C5JB 4WKZA 1PZDA 1IL1A 3D2UD 5KN5A 1XZPA 1DQLH 3ILPB 2L04A 4LRIC 5FKPB 1UJ3B 4GRWH 3W2DH 2CO6B 2N0KA 3NJJA 2X28A 1O2AA 1OCZB 4QNPF 2BSCA 2Z92B 1HZHH 1JYWA 2WLMA 4LE8A 1TWGA 1U3HC 3CIQA 3QIWA 4Y1AB 3CU1A 2AJZA 2MIZA 2C3VA 1KFAH 15C8L 3GTJK 3PNRB 4MB5A 1F7UA 3FS9A 4IS6B 1J88A 2AS5M 3G4AA 2JKXA 2C9PA 1UM4H 1MNUH 4NPKA 4FL4C 2H6PB 4DGVL 5L8KB 5GRJL 2VLJE 1VGKA 4ZTOH 4N6RA 5J0BA 2ATKA 1OGAA 2X4PA 4PRNB 4X0NA 3FFCA 1AG0A 4GYBA 4Z0BL 3V8OA 3QRGH 1MUJB 1BZ9A 2EINB 2ICEB 2QVMA 3AQZA 3EDEA 3NN8B 4NYLB 4R7DB 5I5IA 4ZX6A 3MNZA 1G5AA 3EOTH 3HMXA 2IGFL 4YFEA 2C4FT 2XXGA 1EFQA 3VFVB 4I4WB 5F2FA 1G7MA 5JXAL 3CVIL 3NIDF 2PPBA 1CB4A 2JQZA 1OAXL 1T1WA 2BNRD 2OSLA 3FO9B 3IN2A 3APMA 3R4RA 4MMZC 5EU7E 2NCMA 5EUOE 1G7QB 2RJMA 4ODHH 1FO0H 4WHYG 3ULVE 4KKAC 1AQHA 4X80L 3IMBA 4OZIB 4P5TB 2I32A 4I1RA 3QNXB 2BY2A 2EDEA 1KCUL 3FAWA 4BH8A 1SUJA 2QQKH 1I3QA 5SX4I 1T1YA 1AHWB 1CGSH 3GIZL 4HUXA 4J8QA 5KS9E 3SZYA 1Y18B 4JDTL 4LQFL 3GTQC 1Y1VC 5CLWA 2JFCA 1E27B 2JK5A 5H94B 4AV5A 4JFYA 4XVOA 4ZUWA 3H9ZA 4GTBA 4D0BB 3S3BB 4XPAL 4PMFA 5I1IL 1XCWA 4PS3A 3L7EA 5IMOB 3RZOK 2V9QA 3OAZK 1XGYH 4AYGA 1S7UA 5IJVB 3DXAA 8FABA 4YHLL 1FZKA 5FJ8K 1CL7H 2VRKA 2NY2C 3HUJF 3EDDA 4J4PC 3BAYA 2JI3A 4PY8J 5GISL 5I1EL 3BVDB 2C7UB 5B1AB 5C09B 2BOBB 4G82A 3QT2A 1ZHNB 4MKTA 3QDGB 1HI6A 1F4HA 4Y5YA 3SDAC 2E7HA 4RCAA 1QLFA 1QYGL 3BQVA 5IP4A 1YMMD 1JNNH 3BP4B 2HKFH 4U3SA 2UWEF 3AY4A 1QABA 1L9SA 4MSWB 4F7MB 5JTWA 4HWZB 3NIDB 4LCUB 3TBYB 4KHXL 5J89A 2ZWNA 2E9IA 2PW1B 2WLKA 3NZSA 3VXOA 4IRSA 2EVGA 4X8JB 2DDQL 4OIIH 4CC4C 3DMMC 1HHKA 4EKXA 5AUMA 3FOMB 4FYSA 1O27A 4BZ2H 2XOTA 4DUXA 1OT4A 1I1AC 4Z5RB 3IAQA 4P04A 3GTKA 3IDJA 1QBAA 3I6GB 2B1HL 2HLFC 4AJ0A 4YXKH 3F7YB 3AQPA 4Y5XB 1R3KA 2GAGC 2QELA 5I6NA 1HINH 1V3JA 1A1NB 1YN7A 1YPZA 5IVZB 5KYUA 5FYJH 4LVEA 1DP0A 3V0JA 3IXTA 2IBZX 3LX9A 5E1AB 1JTOA 3TLRA 3GTOA 2AF2A 3MCLL 3C5JA 3NFNB 1SXZA 3DVFA 3L3JB 3DV4B 4FJYA 3ILPA 5FKPA 3WJJC 1OTUC 2CO6A 3V7AE 2F1AA 1I7RA 5KVGE 3MA7B 3MLSH 5IREA 5E08L 1YNJA 2GT9B 4KOBA 3V4PH 4KK6C 5T1KB 5FV1L 3Q8EA 4J6IA 3IWUA 1ZVSA 1IQDB 1FL3B 4W1TA 3MV7B 4HIXH 2XTJC 4IS6A 1ZLWH 1XMWA 1K4CB 1A6TB 3FN0L 4ELMF 5DD3H 4BKWA 5DFVC 1CZ8L 1MXGA 5C7XH 2FT8A 2V0AA 1O2FB 5ACMA 1Y7VA 4PRNA 3QNFA 2YEZA 4HWEH 3D0AA 4L1BA 3EYQD 1MUJA 2ICEA 1I82A 3NN8A 1SLUA 4LDCA 4R7DA 4NYLA 3AT0A 3GSQB 1LDPH 2XDHA 2W60A 3LKNB 1FN4B 2WZ5A 4N25A 3MYZA 2HVKA 3CFJB 3VM7A 2CRZA 4I4WA 3VFVA 5D1ZC 1P6FA 1KXQE 1JERA 2DIJA 2E7DA 2FVNA 4X4MA 4DCQB 3FO9A 2HMIC 3FCSB 1D7CA 1QFHA 4RX4A 1XGPB 3VI4E 1G7QA 1JXKA 1R5IB 1ZTXH 4KV5E 5JZ7C 4M1GL 2Y2WA 1RUAH 2WYZA 3O4OB 4UDUB 1HEHC 2FLRT 3DVIA 3TBTB 2R92K 3CBKB 4S1RH 4NRXB 4TUJB 2VJ8A 3QNXA 1I6VA 2X4UB 4TNEA 5E9DE 2VZTA 3P11L 1U30A 2G3XA 3OHXB 1UM5L 4B5EA 2BP5M 3L5XL 3QO1B 4RMQA 1CFSA 4ZFGL 4KZEL 4FZ8L 1H8OA 2A83B 1AHWA 1FNLA 1SLVA 3KPQB 2FQGA 5DD5L 1ZVHA 2O5XL 2VDMH 1Y18A 1O7VA 4PJDB 4KM9A 1Q9OB 5H94A 1E27A 1R33A 2MTAA 3MVSA 3U79A 4F2MB 3RZCD 4D0BA 1KIUA 5IMOA 4P5MB 4XPFH 3GHPA 3AXIA 5IJVA 4NO0D 5E5UB 2CKBH 3MJ8A 4A3MC 4P5KB 4FNSA 2ERJB 5ISZB 3B37A 1FE8H 1Q72H 5J8OA 1ZANH 2P8LB 2PLTA 3OZKA 4AEHH 1UASA 1CLCA 4XP6H 4ELMB 3DDGA 4EZJA 1A5FL 2XSKA 2C7UA 4G9FE 2A99A 3GHEH 5C09A 3V6OC 3ZTCC 5F9WB 2BOBA 4JE4B 1SY6L 1ZHNA 1KG0B 2OMUB 4PVNA 5F7FA 4F57L 3CZEA 4LVHB 3BP4A 1RULL 2VERN 3ROOB 1MAJA 4HK3J 4BXSV 4F7MA 2H1PL 4LCUA 3TBYA 1J6XA 4YXLL 3LNFA 2PW1A 4NOFA 2J44A 4X8JA 1KEGL 4DETA 1D6VL 2YPLD 4D8OA 3N0BA 4X6AC 3QFDB 3RVXC 3C6SB 1OAUH 1FIGL 1F6AA 4NN7C 2NTSP 3O41B 4O51A 5TFSL 4D9RD 2BSEA 1EFXB 3AD9C 4GNKB 2LLLA 3OPUA 3U4AA 4PJFF 1IBGH 2FATH 3V9EA 1FGNH 3BQUD 4AKPA 1GCFA 5EOCL 2H1LM 3MBWB 2SEBB 5AWNL 4Y5XA 2HJKB 4YSOA 5IYDK 4GUOA 2YU9K 1A1NA 3G7TA 4ONOA 2W9EH 4JFFD 4C55A 3D12B 5IVZA 4LARL 4CSPA 1RQ5A 1WLHA 2NW3B 2BOLA 2ZXDA 2J56A 2NY0C 4PUBH 1OD7A 5HHVH 1S7RB 3BXNA 1LTXA 3DV4A 3L3JA 2VITB 1QNZH 4NKMB 2YA0A 3HUJA 5I73B 2X6AA 1NINA 3MA7A 4B50A 1ADQL 2GT9A 1PS3A 3QUYB 5IW1B 2AJXL 3SKJL 1TWFA 3TV8A 2LAAA 1UWXK 1ET5A 3VGBA 3MV11 1IQDA 1UZ6F 1FL3A 4CU6A 2DMKA 1INDH 4OD2A 1BVZA 3DTDA 4YL4A 2GVYA 4GXUN 4PS4H 4GW1B 2JA7A 5C4JC 5AYTA 1JD7A 1N0XH 3HFMH 2EIKB 3Q5OA 2AQSA 2CQVA 4YX2L 4C83B 4AGQA 3UDWA 1R17A 2AZAA 2CALA 1GC1H 4ZUUB 4NNYB 1LILA 1XWVA 4TULL 1UZ8A 1IC1A 1FN4A 5DC4B 3WTSA 4KTYA 3B56A 3I3DA 1NCJA 2JELH 2XBTA 3N9GL 5JOPE 4XP1L 3D0LB 3GD1C 5EOTB 3WS6A 3R1GL 4U1NB 2FX7H 4D9LL 2NVYC 4X6DE 4DCQA 2ZAHA 4IOSD 1RPKA 2CWRA 4FKEA 1XGPA 3K5RA 1OZTG 1R5IA 3AFLA 2E6QA 4G11A 4WJ4A 1GHFH 1MJ7H 1P4LB 2ZKHL 4LDEB 4R0LC 2VKXA 4UDUA 5EZJB 4N2KA 2KDGA 4ELDA 2QQNL 1GGTA 2Q8AH 1AFVH 4TUJA 1O9VA 1IBZA 4Q6IB 5J3HC 5EBLB 2X4UA 5C71A 4L18A 1IAII 1WHPA 2D3JA 3E3QE 3TXAA 3ULAB 3OHXA 4OCMC 2HT3D 3FOFA 2IVFC 5A2JH 5JFEA 2A83A 1E6JL 1MHEB 3CVBA 3MJWA 3WTVA 3EOBB 1H19A 5AW0B 1SHWA 3CHXA 3CQZA 4JMXA 3IRPX 3PREA 3HC3H 3NSYA 4F2MA 5EO0A 1ZRUA 4P5MA 2OMNA 1FNSL 1RU0A 2F53D 2NVXC 1Z3RA 2VDQH 2AQ3A 2ZUWA 4NQEE 4QUOA 5DGRA 1BSIA 1EZSA 4P5KA 5I6OA 1RZJH 3NEXA 1I8IA 2BPBA 1BFVL 2AVFA 1NLBL 2P8LA 2V37A 4UBDD 4AKOA 5GGUA 2DF3A 4E68A 4ELMA 4GSQA 3ZKNC 1U8NA 1AO7D 4ELKA 2WNXA 1IGFH 4B0MB 2NZ9D 3IMRA 4EOWH 1LK2B 2OMUA 1JGVH 3BSZL 2YPLE 2GUYA 3PFQA 2DKSA 1M7IB 1KN4L 1SN0A 4WTQA 3ROOA 1T83A 1I9IH 2X09A 3BWSA 4FNTA 3UOAB 4OD1H 5A1AA 3AM8A 1KCBA 1FVEB 2NXYC 3GMMB 2MPVA 4QRPD 1BXVA 2CRIA 4WU7B 2DQUL 2BSDA 1VJSA 4HMEA 1PZ3A 3T5WA 3QFDA 3QJFB 5C0CB 3C6SA 3F5WB 2FJHA 4MS6A 1JRHI 3RU8L 4HC1A 1AKPA 1EFXA 4RZCB 4XB3A 1PDKB 3LS4H 3WUZA 7TAAA 4QXVA 4A2DA 4UYPA 2OMYB 2ZJSL 4JGUA 3ILQC 3MBWA 4HGKC 2SEBA 4UQ3B 2Y7QA 4XGZB 3SE4C 3M3YC 1TWHC 1NA8A 3BSGA 3F12B 3SO3B 5D1XB 5T3XD 4U3HA 5EZOH 2N3JA 4NXSA 1UXWB 4NCDA 4CAGA 2IDFA 1OP5H 2NW3A 3D09A 2DMCA 3PL6A 4HISA 1AZCA 2PP9A 3A6CH 1A7PL 1XBRA 1JHKH 1S7RA 4N0RA 3GIVB 3D07A 2VITA 5LBSH 4LIQL 4NKMA 1FH5L 4LJZA 3QJTB 2WQAA 3Q2LA 2LTQB 1GS8A 3C9NB 3RX5A 1II4E 3QUYA 2G3NA 5JW3L 5E03A 2PR4L 4OGZA 4YGVB 4BKLB 3EBHA 5L0QC 2WD0A 5E4IA 3MRLB 5C08A 1R3IH 2OI9C 3GMNB 5IM7B 3TBWB 3A21A 3VD9A 2XKUA 2EDMA 2G3ZA 3LY6A 3INUL 1UZGA 3EYFB 2RB8A 2J2ZA 3OXSB 5FC9A 2XCRB 2QVIA 1SXCA 2P44B 5D1QD 1IGCH 2VXUH 3CSBA 4HU2A 2WZ6A 5EUKB 25C8H 1FZJB 4E9TA 3CU7A 4RGOL 3LZPA 4ZUUA 4QXTB 4NNYA 5HI4D 1ANUA 3RGVD 5TMCA 3S3PA 3CK0L 2ODIA 1AGDB 2N7SA 1WBXB 2XZQH 3FQXB 5CCKH 1Y6KR 4CVUA 3NJLA 3RVTD 5E6IA 5EOTA 4KMDA 1Z9SB 4PJFA 5HSFA 3HKFA 4MCZB 4U1NA 5IOTA 1BW8A 4LSQL 4NO3A 2G60L 5DJ0B 3GTVA 3L95B 4YL9A 2VDRB 1A4CA 4M5YL 1P4LA 3KPOB 5EZJA 2K6YA 4FQ1H 1MG2C 4J2XA 1CD8A 1X4ZA 2DQMA 2YGQA 4NZJA 5ERWB 5HI3C 1ZIBA 5TJWK 4Z7VE 4CC0A 1F8TL 4EUPB 4C2MC 3CVHB 4Q6IA 5EBLA 5G4NA 1TZIB 4XMXA 5GZOA 4OJAA 5EOCJ 3MODH 1ZWIB 3SYQA 1PZAA 4CMHB 2DIBA 2IF7A 1C5CH 5DD1H 2OXHB 3EOBA 4D0DB 3F84A 3L54A 5DUML 4JO5A 1KTDB 2JXMB 2DY2A 3QIWD 4WFGD 2DQJL 1J5OL 4LBAA 1ICTA 4Z7OE 4ZS7L 2ZKMX 3MLXL 3ADAC 2A4ZA 5HVGB 2WKGA 3CQQA 4A6YH 4I0CC 1VERA 1E6OH 5TQ0L 3QFJB 4UTCA 5C3IA 4NQUA 3VXNB 4UTAH 4JRLA 4ZX4A 1OGAD 3FFCD 1CICA 3NABL 1U0QA 3BKCL 4QTIH 3RDTC 5CJ5A 5J7CC 2XTSA 4K2UH 4H40A 2DWEB 4PGZA 3BH4A 1CFVL 4MHHG 1MY5A 4W6YB 4QRPE 3OLIA 1CC3A 4KHTH 2Q7YB 5I18H 1DEDA 3ZR6A 4CKVX 5JO5B 3FTSA 1DCOA 1U4EA 1M7IA 4DGYH 1BQSA 4LT7A 5C86A 5FR3A 2W9DL 3ZTNH 2QSCL 1BAFL 5HHQB 4H20H 1FVEA 4GG6F 3GMMA 3QWOA 4QHUB 2CCWA 4J12A 4BFJA 4KN7A 1DBAH 2CLZA 2J55A 4WU7A 5DDHB 1KZQA 1HZKA 3HOYK 1JF6A 1B2WH 3IU3B 3SDDB 2KC0A 2VR7A 3QJFA 4J3TA 5C0CA 2R2BB 3F5WA 1ZT1A 5KVMC 4DQOL 2EDTA 5A3IC 2A5UA 3L3IB 5IVNA 1ZQ1C 4RZCA 1PDKA 4JCLA 1XH1A 3L3KA 4XX5A 4AL8H 2OMYA 4AWJC 3LS5L 4YK4C 2WBWB 3CFCH 4XGZA 3KS0H 4Z3HA 3ZYZA 1KBKA 3F12A 4XNDA 3GO1L 5DRZB 3S17K 4KRLB 1S5IH 2OL3H 4OZFG 4QAMB 3TV3H 4BA0A 1T20A 3TPUB 2FH6A 3FQTB 3DXAD 1C12B 4WO0A 3R8BB 4S1SL 2CDEA 7CGTA 1HWGB 1T7ZA 3NCYP 4Q6YA 5HYSG 1NJ9B 1W9XA 3GIVA 4Y16A 3CH8A 4FNQA 4F2FA 1UA6H 3C9NA 2BHUA 3I6SA 1IT9L 5D1QE 2A6EA 2JKWA 4BKLA 1HX0A 1CE1H 1PZSA 3VG0H 2QKIC 1F4YL 1V54B 5EU6B 1AR1B 2BFVH 3MRLA 3RBSA 3GMLB 3TBWA 4YHNB 5IM7A 3CSGA 2JH2A 1HHJB 1WISA 3QUML 4PYGA 5EBGA 5CEXA 1IFGA 3OXSA 2B63A 1EZUA 2UZYB 2X2YA 3WIIL 5EUKA 3I9GL 3LMJL 1OAYL 4IRSD 4YR6B 3WCYA 4TSBH 2FHCA 1FZJA 4OD3L 4GG6B 4HQQH 1AG6A 3KPSE 4MRBA 4BSWB 4KJPC 5K9KA 35C8L 3L5HA 4QXTA 3CDZB 3NJKA 3WNOA 1PZ2A 1QP1A 4HJGA 4EDWL 2ZAGA 1AGDA 1BGXH 2F19L 2DJSA 4HALA 4HD5A 3FQXA 4NKQB 3V4VL 4JFZH 3PO2C 4HLZG 3RWCB 2JIXB 1Z9SA 4PJ9B 5F9JB 2J3SA 4TSAH 4P2RE 1KIRB 2G30A 3HE6B 4K15A 3QVAA 4ANKA 5I5MA 2FUQA 1MI5B 3L95A 1AQKL 4HS8L 3QJOA 1XGUA 3KPOA 3NIFE 4AW4A 4AQEA 4JHAH 2WVUA 1ZLVH 1UWGH 5ERWA 5G5DA 5E2WH 3CFDA 3I75A 3SYOA 3CVHA 1TJHH 1MCRA 1HZHL 2D8KA 5KBPA 3S1RK 3IFLL 1BBJA 2Y36L 1ZWIA 4L4TA 4R83A 4FP8L 1D9KB 4DGIH 3ULUF 1N59B 3GI9H 3WL9B 1DZ0A 2OXHA 2I60L 1JPST 3W0WE 4D0DA 3MCG1 1U42A 1ZDQA 1KTDA 1VGEL 4OF5A 4ZPTA 1T1ZB 1CU4H 1OGAE 3C2SA 1A3RL 2M83A 5SWSB 2VMFA 1K3IA 1PG7H 5I8KH 3RWEA 4AH6A 2L8AA 4KY1L 4XTRC 3EJZD 4YJZL 4IOFD 4X8CA 3NMEA 3QFJA 1XGQB 4PCKA 1BPVA 2AXJA 1PTZA 2B59B 1I1YA 2CHXA 3CZKA 3VRJB 3VXNA 4C4UA 5D2LF 4Y4FB 4BSVB 3NZHH 2DWEA 4JY4B 2W1NA 3H42H 4ODHL 1F11B 4JPKL 2HN7A 5IEHA 5JO5A 4F58H 4XSZA 1JXFA 1UT9A 2WHVA 2QVKA 2KZBA 1UACH 1GGCL 3US1A 1F4XH 3LHPL 3MZGB 4XC1L 5HHQA 1U92B 4QHUA 1PIFA 4GBXC 4YDNA 2JI2A 3HW7A 4P23C 2F8OA 2E0PA 3SDDA 4DP7X 5BNXD 1ES0B 2R2BA 1GGIL 5CJ9A 1IKFL 2F15A 2LHAA 3WY4A 1MW2A 1BCIA 2NSXA 3L1GA 3KH3A 3DXAE 2CE6A 3HN5A 1CXEA 2WKLA 3OQRA 1DANT 3FT3B 4PJ8C 2VDNL 3CNKA 1CBJA 4JO2L 2I24N 5DRZA 4MQSB 1DVXA 1HK6A 4YDIL 3RDJA 1M3IA 3ZKMC 4BWWA 3HLKA 4YNYB 2X0WA 3FQTA 3TPUA 1AANA 1UENA 3MRHB 2IBZY 1B88A 5I8CA 5BVJA 4U1IB 2XBZA 2Y1AA 1WP6A 4RRPG 5A7BA 4K94H 3FU9A 5AW6B 1N0LB 4Y88A 1K3ZA 4LRNL 1EUUA 1U8OB 1MH5A 3MRGA 3WENA 2PO6B 3GJFH 2HRGA 5C09D 3KLHD 4UI2A 5DEZA 2A68A 4Q5SA 2E2JK 3EJSA 3WGUB 2YRLA 5CJOL 4FRWA 3AITA 4U49A 2R29A 4NUJB 3P02A 5CD5D 3KDMB 4Z3EA 4R4BB 1U8HA 3SDYL 5EU6A 3OMIB 3WKPA 1S78D 3IBOA 3GMLA 3MRFB 1E42A 2Y3AA 4N8VG 4YHNA 1HHJA 3AD8C 4YVUA 4GP5B 4AC4A 2VAAB 5ENWB 2R2HB 2UZYA 2X9YA 3DHJA 3VD7A 3E38A 5T5FA 5DK0B 4GG6A 4M6AA 4CILA 3QAQA 1IKNA 3OR6A 5H37A 2QKSA 4DZBB 4YXKL 2EEFA 1GVIA 3CDZA 5FA3A 3U25A 2C1PB 4JRYB 2BSED 3S35X 1YPZE 1TZAA 2ZUVA 4JO3L 4YUEL 3VWJC 3RKPA 1GTFA 1ZGLB 4AQ8C 4R4ND 4JQVA 4O5LH 4GI8A 2PWGA 1YN6A 1NDTA 1KIRA 3HE6A 2EBBA 5C3TA 5CJXA 1MI5A 4BKTC 3HS0C 3RILA 4HETA 4FQQB 2Q2LA 5EBMB 4LOUD 4ZW8A 1EVUA 1P4UA 5EOQH 2X4QA 2GBUA 3HVDA 4QRTB 5I0XA 2XICA 3DUHA 2APBA 5CSZA 5B39A 3J2PA 5I1CL 1D9KA 1F58L 4IBQA 1N59A 5D2NA 3WL9A 2PP8A 2QLYA 2BX5A 1MY7A 2ZQKA 1OSPL 1FYTB 2Q5BA 4FFVD 4YHYC 2R4RL 2ITEA 1AS7A 2WP3T 4KXZH 2F7PA 3TN0B 4PW9A 1Q9LB 1T1ZA 3HR5B 1XL4A 3O9WB 4GMTH 5SWSA 1OSYA 4P2YA 1LDSA 1HT6A 3OHMB 4BQBA 3BKMH 4GT9A 2WVTA 1I9JL 1ZK5A 3N6YA 4DPAX 1RFDL 4JFOA 3VD0A 1LDPL 4G8EB 1XGQA 1AYOA 3OKEA 1I50K 4NM8H 1MFDH 3DJRA 3VRJA 4NP4L 4AEIL 5AVVB 3IDUA 4X4ME 3CDFA 4Y4FA 4BSVA 2WWOA 3L9RB 3FKIC 4JY4A 3MTRA 3ZDZF 2KLSA 4BBSC 5GS1C 3IU4L 1F11A 4N6QA 2BZDA 4LPXA 1CLOH 4ONGL 4J6RH 1CIUA 4XRCB 3TFKC 5IYBC 1U92A 2KH2B 3DV6B 2A9NH 3FHQA 1JZIA 3UBFA 3UTZA 2P52A 1MCSA 1BPLB 4MNHB 3H9YA 3VA2C 2R0WL 5B4MC 3OV6A 5HJBA 2A6KB 3KL0A 1EHLL 4XPFL 2R8SH 1CE6B 3ESUF 3Q6GH 4QIRA 3FT3A 5D70H 3NCWA 1MZYA 4ILDA 3VG9C 5A6IA 2JCWA 3I85A 1OE1A 4P46C 3WJMB 3QZBA 3LZOA 1Y1WC 1IGJB 5K59F 2XV0A 1K9TA 4YNYA 1E5CA 2J8UE 3MRHA 3LIZA 3MLTB 2DKUA 3HC4H 5I74B 5HI5C 4U1IA 4A3FC 3D18B 3HN3A 1CYGA 3ZRCC 4HCRA 1AXTL 1N0LA 1YA5A 2HLAB 4IM8A 1U8OA 4IRJC 1YEGH 2PO6A 1S9WB 2PMZA 4PR5A 1U58B 4AY0A 2E2IC 1GE9A 5D2LA 2Y5EA 4NUJA 5J06A 3KDMA 4R4BA 2FEJA 2OCJA 4LPUA 5D96C 5FHAH 2IH3B 2OYPA 2YN3A 5LKNA 1SM3H 4X6EB 4XX1E 1KEMH 4YBQD 4D7PA 4WRLA 1NM9A 3FF8A 1OAUL 4HX1B 4RFNC 5ENWA 4APXB 5LQBH 2CD0A 2FEDD 2R2HA 1G9NH 4UAOB 3TH4T 5D5ME 2H3NB 4KVCH 4BY1C 5DK0A 4HIEB 1OPGH 4WI8A 5BUPA 4MD5B 3GZKA 4PWIA 1IZJA 2VDKL 1H3PH 4JRYA 3ARXA 3EUUA 1EFXD 1IE0A 2Z7YA 2I7OA 2QQLH 4WILA 2IBBA 1USOA 3BT2H 1NCCL 1LNUB 3IJHB 1K6QH 4AMKH 3GLEA 5HHVL 3M17B 3HZMA 3RVUD 4IBVA 3HUJE 4CVZB 2DS4A 2WJ7A 4U1MB 1A6WL 1JZ7A 3KXFB 4FQQA 1JZHA 3C2AL 3HMWL 1O7DE 2DLFL 2R2CA 5KVEH 3HBZA 2VQ1B 3PL6D 2N59A 5EB9A 4QRTA 2X2IA 3NFSL 4Y4HB 5A40E 1Z2KA 4EN3C 1MAMH 2MQ3A 4MAUL 3UJIH 4MASA 5D6CB 3Q1SL 5EV7A 1YEEH 2UWEE 3FCTB 3QUYD 4GKLA 1D5MB 3Q1EA 4GKNB 3TTSA 4LL9A 1F1AA 1DJGA 4M1CD 5C07E 2XN9B 1KMGA 3TN0A 4OIOA 1GC1C 1Q9LA 4FQCL 1LWHA 2YXFA 1Z7JA 2WXJA 5C08D 3HR5A 2WBJC 1CT8B 1GC1L 3WYRA 1PLGH 2ENYA 1YJDH 4TPRH 1EJOH 4QHLB 5J5EA 1TUPA 1FAIH 3NACL 1O5DT 4MCNA 3BE1L 1EAPA 1TEYA 5J1SC 2CHDA 3BPOB 3C60C 1QWHA 3K2KA 2IAMC 1RMFH 3IDNB 1EMTH 2C26A 3OBAA 3L9RA 4NZDA 3H3BC 5EU5B 3WMSA 4Z23A 4YLCA 3BAIA 1A14H 1QSEA 2A0LC 1YEJH 2CHNA 4JQIL 2XQYA 4PLKD 5E6ID 3IGLA 5IBTL 4ODVL 2E4TA 2NY4B 2Z7UA 3WS3B 1THAA 1EBPA 1GY1A 4XRCA 1ETB1 5DHVH 1HN1A 3GRWL 1DBMH 1PF3A 4AZ8A 3K91A 4X4XB 4BXXK 1SHSA 1QLRB 1QPKA 5ESQB 5T3ZL 4DAGL 1F6LL 1GH7A 1XR8A 2V7NB 2VRQA 1KB9K 2R15A 1CFNB 5GZOD 1FL6B 5M7QA 2EDDA 3GXNA 5BV7B 2A6KA 1W6WA 2KQMA 2ADYA 1NSNH 2CFAA 1D7FA 1O7SA 1LO2L 1TFPA 1B3JA 3P3YA 1RZJC 3UG3A 2XQ0A 1XD0A 1CE6A 6TAAA 2H3XC 1Q1JH 3I6LD 3OWEA 3UC0L 4AUUA 1XTLA 2H0JA 1BWWA 4ELME 4JZJB 5HYIA 4L3EE 5DA4A 1A4BA 1IGJA 1M53A 3EZJB 2B1AH 5D4JA 2EH8L 3U30B 1PBYA 4N90D 4FHBD 4AQ1C 3QYMA 1TT6A 4NC2B 3HHMA 2C3WA 3UAJA 3D18A 4NQCE 3DIVA 5IP7C 2P8TA 3DHMA 3D85A 1P4BL 4FXGC 3D4GA 2HLAA 3LNEA 2DD8L 4HULB 3JYBA 2K3TA 1S9WA 1XXFC 1CICD 2A6DB 3AG3B 1I9IL 1U58A 2PTTB 3K46A 5DQJB 2ICES 3AU1B 1YY9C 2ITFA 3SDXF 2WLYA 3VFPA 3VH8G 4A3LK 3FHZA 4P2CG 4OAWB 3GSIA 2FSEA 2NNAA 3MLYH 4X6EA 1U3HB 4G7OA 3JVGA 2Z8VC 3LEVH 1PLBA 4V2BA 2YPKA 4TLSA 1JJUA 1H3TA 3LDBC 3PWJB 5CN2A 2Y25A 4H1LG 4APXA 4YFKA 2APSA 2LU4A 2WW8A 4L3FA 4N8CL 2H3NA 3V52L 1WSST 4HIEA 1CFMA 4HBCH 1JIBA 5JW5A 5C0RH 1R3JB 3HI6L 3QP3A 2F9BT 4MD5A 5C0CD 3S4SB 4Q7DA 2XRAL 3FB6B 1YEWA 1G4RA 3RY5A 4CDHA 1MCPH 1HHHB 5C2BL 5EZOL 3D25B 1U9KA 5FGRA 1F4AA 43CAA 2V3FA 4OLYH 5FLVA 1LNUA 4MMXC 2X10A 1LGVA 3CH1B 3IJHA 3BEWB 5ABZA 1IZKA 1WQVT 3NTCH 4XNAA 1MW0A 3M17A 2EC8A 1RSFA 5D1XD 4CVZA 1HH9A 4U1MA 3KWVA 3WIHL 4MMZB 4Y2LA 4U4BA 3KXFA 1TCMA 3P73B 4XPGL 5HGBB 3ESVF 1EIBA 1DVQA 2GY5A 3S1QK 2VQ1A 5D93B 2PYEE 3DX7A 3FU7B 1I3VA 2WGNB 5C08E 4Y16D 4Y4HA 1QBLH 4HZLB 4YVNA 3TWCL 1SJHB 4P8QA 1ZGLP 2AV7A 3DVNB 3I74A 5D6CA 1G5GA 2NUPB 4Y4KC 5AW7B 3CZNA 3FCTA 4LVNC 4JRXB 4GKNA 3DETC 3DGCR 1BQHA 3SD5A 2PETA 2XN9A 4ES8A 1MFAH 4EI5C 3SDXB 4Z9KB 5AB1A 3EBAA 5E2UL 2GSGA 4FABL 4YSEA 2EILB 2BWIA 2JKNA 1MRFL 4QHLA 3NPSB 3GTMC 5D8JL 4QIWL 4KNQA 4GIPD 2VDOB 2ZZUT 3O2WL 4L4VE 1G7JB 1KXTB 5CCKL 5IB2B 5FUOH 4R90L 4UQ2B 4E9QA 4MJ6B 3OPZL 4PJFE 1RZQA 2CLRB 2AGJH 2F58L 2NY2B 3EHBC 1RLBA 1E4WL 2DB8A 1ECZA 2BIOA 1OGPA 4KKCC 5EU5A 3P4MB 4XVTH 3G6JB 1OF2A 2XXCB 1IEBB 4KMLB 5AVQB 1RY7B 4Q89A 2VGLM 3TEYA 3RTQC 1AY1H 2B2XL 4FZEH 3S37L 2K8MA 4FQ1L 4HPHA 3IKCA 1CTOA 1XIWB 4TNFA 2UY7A 3ARFC 3SDAB 4AIZB 1R6VA 3IJEB 3OJVC 5C4XK 5EPMB 3DO3A 3FHAA 3IMWA 3MODL 1OAKL 4OVUA 4X4XA 4O02B 1QLRA 4NNPL 5ITBL 1BVLA 1LXMA 2Z6FA 1E9PA 1T7WA 1BA9A 3RY6A 2V7NA 5GGTL 1H6TA 2IG2H 1X7SA 4XWGH 1CFNA 5MERB 3LZFH 1FL6A 4L4TD 3KBPA 1QLEH 1CPUA 1OT1A 4N90E 2ZOKB 4RLDA 3FB7B 1I1AB 4OLVH 4NT6B 5B21A 5C3LD 5LXGL 4F9PA 3MLUH 5C0AB 3LTVA 1XXDC 4HLZH 3BN9D 1R0AH 2OR9L 4BDVB 1JGIA 5EEZA 3VI3B 2EE6A 2AJUH 3NA9L 3BPLC 4PJ7E 1WOOA 2BVQB 1SOKA 2ZT9C 3QFJD 4KHTL 4CRPA 3L4CA 4N3TA 4KTDL 4EQ2A 1W91A 4FQLL 1J9CT 2A6DA 2H3KA 2PTTA 1CD0A 5DQJA 2B9AA 3RZDK 3OQ3B 4X0KB 3SODB 1U91A 2E86A 1IVLA 4OAWA 4DZ8B 4G5ZL 5C0CE 1EO8L 5T3XH 5JQHC 5DQDL 2W38A 5J12C 3MUZ1 3O2DH 1AB4A 1DQMH 4UYQA 4XBMA 2ITCB 3BD5A 1O75A 3P0YH 1R3JA 3T1FA 3SDDD 4LSPL 3CFCL 3S4SA 3FB6A 1ED3B 5IYCK 1BDYA 5D72L 1S5IL 3K0WA 1V27A 3EUDA 1HHHA 4UMGA 3D25A 1AYRA 4JUTA 3ARVA 3EOYG 3ULSB 5F71A 3JSTA 3S0PA 3CH1A 4RRPM 3HG3A 5DT1L 1P2CB 5D1ZB 1FGVH 1KJMB 5ESVB 5IGXL 3ARDB 3BRFA 3GSXB 2BHYA 1EEYB 5C0JB 5IVXE 1RIHL 2OXGB 3P73A 1KBPA 5HGBA 5IT2H 3ARBC 1VADA 3IE9A 3OGCB 1SMAA 4MJIB 3RWDB 4D94A 3FU7A 1RHFA 4WV1A 4POZD 1N64H 4ZMLA 1GAFL 4ZDHB 4GSXA 5J1TC 2WXHA 3B2VL 3L8QA 1SJHA 4N0FA 2OYLA 2RH0A 3DVNA 1U2CA 3N42F 4NWUH 1A1OB 2EZ0C 5TK4A 5EO9B 1I8UA 2O61B 3QCUL 4DKTA 3MACH 3MRBB 1PKQE 4JRXA 4ZW6A 4YZWA 5DUPH 4O2FB 4C4BA 1RJLB 3T8VA 4LSVH 4ABQA 5EU6D 3DX6B 1HDMB 3SDXA 2OMXA 2R56L 1HKFA 3QWNA 2AV1B 1GKEA 5CEYA 3CXHJ 1J10A 1M05B 2XU9A 4G3YH 4TNWK 2VQ4A 1MRDH 2EAEA 1BP3B 5BJTB 3P69A 4M61B 4KQ3H 1G7JA 4UQ2A 2W91A 4WWPA 3OG6B 2CLRA 1FP5A 1H6UA 2BSRB 2NUTB 1Z1WA 3II1A 5IB1B 1IAMA 4JG0L 1TVHB 3NCYS 1FBIL 3U6RA 3P4MA 3DK0A 1IEBA 2EEBA 2B77A 3L17A 2AAVA 2BIHA 1MNNA 1MW1A 3SDAA 1XIWA 2J21A 2FIKB 1F93A 4WO4C 4RISH 3GI8L 4L4TE 5EPMA 3VSTA 3HE6D 4QHNB 5I6MA 1MI5D 4S1DC 3FSAA 4O02A 2ZWSA 1MHPH 2BFGA 4J1UB 3GI9L 5CR8A 1Z9NA 2BP3A 3TTYA 3QYCA 4PWKA 1KBGL 4HUVA 4YSTA 3G5WA 2JV6A 2R27A 5MERA 2R93A 3DUUB 1I1RA 5LCVL 3TBBA 1D9KD 1CFTB 3HMXH 3F85A 4CGUB 3S98A 4TNVF 2ZOKA 3FB7A 4WF7A 4NT6A 2ZXGA 3N42B 3QFJE 5L2JA 5EU7C 5C0AA 1FUNA 3ULVC 2AEWA 3ILDA 4RNRB 5SWSD 2HKHH 2IQ9H 4M4PA 5CZXD 2OYKA 1UHVA 2RTTA 4B5ZA 1I53A 3ULVL 1FLRL 2WYTA 1AGBA 4GY4A 3NZHL 5LGJB 2BVQA 2GK0B 3H42L 4LBEB 4OIQA 3SE3C 9PCYA 2DM7A 2UV3A 3CV5A 4Y4FD 4FDWA 5JA9A 5K33A 3QG7H 4X0KA 4A67A 2NYYC 4CBPA 1L7TH 1LHZA 4UQEA 1O0VA 4U1LB 4LCWB 1P53A 4PJCF 3Q2NA 4DZ8A 5A2IH 2XUWA 1P5VA 2OMTB 5L7XL 5H2BA 4F3FA 2L7JA 3KLKA 4BV1A 4Z3GA 3FRPG 3SZKC 2G9HA 2QV4A 2GSOA 1JUFB 4AOFA 1NCBH 2ITCA 2O5YL 1C8QA 4DNLA 3M1CA 4R3SB 1O6SB 4RMWA 5HVWA 2V5RA 2D7TH 2NZ1A 4U2ZA 2QEJA 5ICUA 3ZR5A 1ED3A 2GSMB 4O9HL 3QI9A 1XGRA 3VJ6B 1A3LH 3X12B 3VQMA 4YGAB 4C47A 2UXVA 2XWZA 4Z3FA 4R5TA 4M48H 1DQVA 4QJ4B 3ULSA 3PGCA 5ES4B 3UACA 3ULUD 1B0WA 2AQ1A 4K94C 4PRHE 4QRFA 3H2WA 5TE7H 1VDGA 3LRKA 1P2CA 4S0HA 4EUPG 3MJ9A 2BVOB 3L2NA 4EIUA 3ARDA 4K94L 4HFUL 3GSXA 4XVSL 4I3RH 2OXGA 3HB3C 5CEZE 5IB3B 3MRPB 3REVB 2PF6A 2Q87A 1IAIL 4K3EH 2Y07H 4R0LB 3OGCA 5EU6E 1PJ7A 2OX5B 4PHXA 4NZ8A 4UWQB 4OJYA 4ZDHA 3SCMB 2PO6D 1KJ2A 2Z7ZA 4TUUA 2PMZD 4IJ3C 1PCSA 2ED6A 3U7WL 1A1OA 3VMOA 3RE0A 5EO9A 2O61A 5A6MA 1KYFA 3CPLB 3MRBA 4YOKA 2IDCA 4P5SA 1DCHA 2IH8A 4L1SA 4O2FA 4OGAD 1J98A 3Q8BA 3DX6A 1HDMA 1F02I 4AYFB 1B9KA 1M05A 1XR9B 2V8LA 2X6BA 3GM0A 4PJCB 5M5WK 1SFOA 1F97A 1S9VB 2YUWA 1S7QB 4WFFE 5BJTA 1UJTA 5HJDA 4BZ1H 5KJ4A 4W9EC 5INDB 3P4OA 2DYSB 2QVTA 3RHWF 4Q9QL 2NY3D 3TPKA 4IRZL 3WFEL 3ZKSD 5IB1A 2BSRA 2GPZA 2K4WA 5CGMA 5LN8A 3G6AB 1TVHA 2G0LA 1MI5E 1SY6A 4JRYD 4V11A 5AAWC 5KVGL 2X53A 3T0WA 4ZXBA 4GKZB 2FIKA 3ECQA 1KB5A 1KLGB 2WN2A 1JK9A 2AMUA 4JHWH 3WY3A 4X9HA 5FM5O 1NUNB 1JZGA 1VFMA 2UVFA 4HMDA 5D2NE 1DLFH 3QPXL 4QRSB 4J1UA 3ARWA 3ZTJH 3DWTA 2NXYB 3T0BA 4ZSOA 1AXIB 4Y7NC 1DZBA 5HYEA 1G6RL 4GKOA 5CHNB 1FL5B 3DUUA 4FLQA 5D4HA 1GZPB 5I71C 3ZZQA 4GMTL 1CFTA 2VWEE 4B97A 3K7AK 4DWHA 4U31A 2C3XA 4PJXF 4K7PH 1XPPA 5F7HA 2CM5A 5LG6A 1TVBA 1JYNA 32C2B 3TN0D 3K71A 4F33B 4RNRA 1TO4A 3GSUA 4K7PX 4LSUL 3LRGA 2E2HC 1XO8A 5LGJA 4LBEA 2DQIL 3FSOA 3H3KA 1TR7A 3UPRB 3K4DA 4PGEA 4LP5A 3S3SA 5D71H 3Q2VA 4J6RL 1R9TC 1WUNT 3EYSL 1ADQA 2DBJA 4OQTL 5EGHA 2G0KA 1H5BC 1EDQA 3RGBA 4U1LA 1ZV9A 4LCWA 1QSED 4YPJA 2VZ1A 5LGHL 2AJ3B 5IEKB 3DXJA 2OMTA 4KVNL 5IQLA 2YLHA 4GSDH 4A93K 5KVDE 2CO4A 3KBHE 2OI9B 2WXKA 1JUFA 3C6LB 4WI9A 4JPWL 2YS4A 4R3SA 4AMWA 1O6SA 2O4EA 5E1GA 3ULUE 2R8SL 3N3YA 1M7UA 1RI8A 1FV1B 3CFIC 4PRAB 3B2MA 1UWEL 2FECI 2YKLH 2R7ZC 2J5WA 3ERED 3NQKA 4GS7C 3NJNA 1T2QH 4NAMA 2F7IA 2W80C 4HIIB 1KGIA 4A3JC 2O93L 4FI6A 3LZNA 5G4MA 4PJXB 4H0HB 1MKFA 3L13A 4K3GA 5B1JC 1EZLA 3KVPA 1YEGL 3B7TA 3DPDA 1JGUL 5IB3A 4PP2B 5D2LE 3RYMA 4UCFA 1AJ7L 4M7LT 1N7MH 4HZ1A 4R0LA 3UAJD 4JFHD 3BUDA 5B1KA 3D85D 4FMKA 5E5MB 5J6SA 3SCMA 4PTTB 2YBRB 4ZYKB 2Z8SA 4P4KA 3X1GA 3JUYA 1NGXB 3CPLA 2DEWX 3MKKA 3F7LA 4IDLA 2H6OA 4NQTA 4OCRL 4AYFA 2AJVH 5E94B 1AC6A 1PW3A 4XCHA 3GTGA 4PJCA 2P3YA 4XBGB 4R97C 5JIQA 2J88L 5FV2A 1S9VA 3L81A 4IKKA 1S7QA 1TTUA 3CVCA 2WB1A 3MLRL 5GSRA 4D8PB 4KQ4H 5INDA 4YSAA 1DR9A 3STLA 3S14C 4M7KH 3ZT7A 5KEZA 2I7SA 4J3BA 5JDJA 3KWXA 1MCFA 4WW2F 1CWVA 3QNZB 4GEIA 4EEEA 4WSJA 2XFGB 5ID0B 2YHGA 4QRRE 2J5LC 1QFWM 3UZEA 1LQBC 4X4YB 4GKZA 1HCYA 2O6CA 2XG4A 3G5XB 5AKVA 1KLGA 4HJUA 4G6MH 2Q86B 2E7CA 4KKRA 3D0VA 5IESH 1U8PB 1CGUA 3QQDB 5DEFB 2P49B 3ZE0F 5KWYC 1SN2A 2CGRL 3KXFD 4HCGA 3VXRB 4MQ9A 4LPWA 4Y7MA 2HXAA 4QF1A 1DFBH 3L4KA 5CHNA 3WFBH 2DH2A 3QAZC 5I9QB 1ZSDB 4Y4HD 1BECA 4P05A 1GZPA 1YJDC 3GXMA 4LSSH 2NLJB 3AS0A 1PLGL 4PU2A 1YJDL 4QJVB 4EIBA 2X0UA 2O5IA 2XN9D 32C2A 1TLKA 4H8QA 4U1KB 4YK4B 5DMKA 4LEXH 4F33A 4S2SA 1CGTA 3O6MH 2OZ4H 4MKMA 1RMFL 1K83C 1KCRH 4PSRA 4BJLA 1J5CA 1H3VA 2P48B 2IWKA 1QSEE 3E3QC 5TDOA 3RZCC 5C0DA 3UPRA 1QSZA 4JHVA 3ZO9A 3PCYA 1LEGB 2XQBH 3VSUA 3CFEB 4AMXA 4EZKA 2NVQK 4PLOB 4A2LA 3FFOA 1C8PA 5EDXA 1CGWA 4LMQI 4UT7H 3GTTA 2AJ3A 5IEKA 4AYBL 4Z7IA 3BKJH 3LYRA 1J9SA 3QJSB 4MD4B 2EO7A 1WGVA 2FHBA 4N8PA 3RWGB 3RPIB 4M93C 4XMVA 2RCSH 3C6LA 3IVKB 5E8NB 3V4GA 2PR9A 3ZE0B 4P9HL 1FZOB 5GGSY 1FV1A 1LP9F 4Y0GA 1NMBH 1PU0A 5D7KD 3SGKC 2OMWB 1N6QH 3IDIB 3MJ6A 1AZVA 1KCSH 3V4VB 2HRPL 5EWIL 3CZUB 2O26U 5CGTA 4F93B 1YECH 1OSZB 1ZE3H 1IO4C 3OKDB 4JFHE 1WWBX 4B95C 1HYSD 1TVDA 4HH8A 4PJXA 1EXUA 1I3GH 2HG5B 4PVMA 3A4DA 3HBPA 3O3AB 3V6BR 4W9JC 3BGMB 1IQWH 3BQUC 3VB8A 5IFHH 1MQ8A 2MKLC 1KELL 2NW2B 2B08A 4PP2A 3VXUA 2VUMC 5TK2A 3TA3B 3ZDZE 4L0ZA 1BF8A 3ZIMA 5E5MA 4HC1H 4I87A 1CXLA 4PTTA 5KANG 5I1LB 4ZYKA 3EBGA 3HPLB 1P4IL 4BFBD 5C6PB 1NGXA 4FI7A 4LSDA 1R3HB 2X9WA 4AVJA 2JKTM 1EDHA 4ANXA 1DBKH 1U8CA 3D69B 3ELAT 1WQGA 3EDJA 4HBCL 4BFNA 5KW9L 5C0RL 1PD6A 4NPYB 5E94A 3MUJA 2Z7WA 4AW7A 2E7MA 2VXVL 5E5LA 1WS8A 3NA4A 2OTWB 1OGTB 1MQKH 2BNQE 1CYWA 4D8PA 3WHE1 5KVFE 4KB4A 3JUZA 2MCPH 4PYHA 4XPBH 2DYPB 1DDTA 3L4JA 4G80B 3T6WA 5F21B 3ZUNC 1A6VH 4OZHE 4ABWA 1A9EB 2NY7H 3ZUCA 3II2A 2JJWA 3KPRB 3NTCL 3QNZA 5FUCE 1RP8A 3KPTA 5ID0A 4EO5A 5K59E 3NP3A 4MNQB 4X4YA 3QQNA 1DQQB 1LLAA 4N28A 1KQ4A 3RUGE 5IORA 2NXZB 5CINL 3IDXH 4AXWB 3K72B 5FM8A 5FGBC 3PGFH 5L46A 1BD2B 2Q86A 2V17H 1U8PA 4QKTA 3QQDA 4UTBL 5DEFA 1KWKA 1Q38A 1X5AA 1EVTC 3VXRA 3N41F 5E8OB 4KKPA 4L5FE 1BQLH 2RGRA 4GBXB 3T65B 1U4FA 4XLPA 2BMKB 1ZSDA 3A3YB 4X6FB 4I48B 2DQEH 1AZUA 3S36H 2HCZX 4KM8A 4GFTB 4N9GB 4UZUA 1NZRA 4G6FB 4FQJH 4QJVA 1SQ2N 4JRXD 4LOWA 4PG2A 2VDNB 4A3DC 2HT3C 3EOAA 4NPJA 4YDMA 3PPEA 4U1KA 4FCAA 3ZT6A 1RURH 1X7TA 3LZLA 2YD3A 1E9QA 3KPNB 3KBFA 5DD6B 1R9TK 3QEHB 5AAMA 3SQBB 2WLIB 4KUCF 3KWUA 2WXFA 2Q20A 1YAZA 3CFEA 4TM9A 4OJEH 5CP7B 2EDXA 4Q4ZA 5E8PB 3FFDA 4UBDC 5AOKA 3F7KA 3O3UN 4WW2A 1OGSA 3DX9B 3STBA 3B8YA 1I8LC 5SWZB 4GKSB 2ZX9A 4MRCA 2DEXX 1XIWD 3SDAD 3UYPB 3TFJA 2NZ9C 3WXVH 2IG2L 4XWGL 4XVUC 1G6VK 2XKNB 5F3HB 3P54A 5F7DB 5HL8A 3IVKA 3V0AC 3CLFL 5E8NA 7PAZA 3DJTA 1VEMA 2FX8L 1QHQA 5I1KH 1FZOA 1O2BA 4AIEA 3TFIA 4ZMWA 3NESA 3HTLX 3N41B 5C44K 1LWRA 3TU6A 1VFBB 1VZGA 3D30A 3CX2A 2W81C 1J6VA 2PPCA 2OMWA 3IDIA 1DUZB 2FB4H 2F54E 3TO4B 4KZDH 3TT3L 2AJSH 2JNZA 1G4MA 1IAOB 1QSVA 3CHQA 4TVPD 3V4VA 4A68A 1OVZA 4G6JH 4KARA 4OCLC 1OSZA 3OKDA 2WIIB 3G5YB 3PHOB 3K8MA 1A7NL 2KERA 3JZYA 3O81A 3TYGL 1OXYA 2HG5A 5C0AD 5I0YA 2MOQA 2CRYA 4Y9BA 3O3AA 3LCYA 1UH4A 1MFEL 3BGMA 1WIOA 2AKRB 2H9GB 2NW2A 1I4FA 1L6XA 4R5XA 3SBRA 4NBYB 1RZKH 4MEXA 3TA3A 3HS0B 1Z0NA 1IGYB 1MHCB 5HD8D 3LN4B 5ALBL 2JB6B 3QJUB 4LNVA 1WT5C 3U2IA 3CN2A 4FXLA 5T5NG 4EAEA 5I1LA 3LQAH 3S2DC 1NAKH 5JVOA 5DI8B 5CU9A 3HPLA 1DL7H 2HX7A 4I18B 4KXBA 1R3HA 1NBVH 3IMVA 1OTUD 4RSVA 4YEEA 3MMLB 2VZUA 5FCUH 3ATFA 1MJ8H 4FYQA 2XZCL 2BDNL 3D69A 2MPAH 4TQEL 5DEGB 5J11B 2K70A 3TNNA 2FQEA 4YHYB 2KDYA 1WS7A 1BQKA 4P2OB 2VN5A 4BYHA 2OTWA 4R7NB 1J18A 1OGTA 2EIDA 4YAQB 5IKCB 3L1OL 2IMNA 1WF5A 2WUBL 4XPHH 3LEYL 3BFQG 2DYPA 1DSFH 1UEYA 1U8IB 4G80A 2YIHA 3N91A 1A9EA 1HHGA 5D1QC 4JRFA 3QI9D 3KPRA 3X17A 5FDWB 1LP9A 5B3SB 3GMQB 1AGCB 3B1UA 4B9PA 2XNAB 1T03H 4N85A 4MNQA 3GDCA 4MB4A 1DQQA 1M9WA 5HI4C 4GAAA 3RGVC 3GMPB 1JK8B 1E9OA 4LOEA 2KZ1B 3K72A 4AXWA 1OARL 2EEDA 1BD2A 3IFNH 4NO2B 3ARDD 4NO5A 5DUBA 3RVTC 1UB5B 4WUUB 4BKSC 1NC2B 5D7EA 2QGDA 1PSKL 2AK1H 5E8OA 4W9KC 5FWRA 1H6EA 4Z18A 3KGTA 1CJYA 4MJID 4WI4A 2YAOA 1O29A 4OCYL 3SDXE 4RGNB 2JA5C 4X6FA 1EI6A 2L0DA 4I48A 1RZGA 4LKXB 3HKZL 4N9GA 3KGRA 4Z0XB 3VGGA 4GO8A 3EO1A 2AI0H 4FQIH 4IHOA 3X1FA 2ZG2A 1WCMC 3KHQA 5D7IF 4ZOBA 3H4HA 4IBSA 1L9TA 2OR7A 4H4NA 4MHHI 2FBRA 3MX0B 4M43L 1X5ZA 4U7KA 1TQVA 5DMIH 5IJKA 1O28A 3WKML 2VDRH 3KPNA 5DD6A 1QKZL 1TWGC 4PRIE 3SE9L 3QIWC 1AGFA 3QEHA 2P43B 5AEAA 4EUPH 4YQXH 5F6IC 1UADC 3CVHH 3LKPB 4JK0D 3L5IA 3QDJB 3BC9A 1CLVA 3NJHA 4MX7A 4ICWA 1KY7A 3DPBA 5CP7A 1OQOA 4IRJB 4BRVA 2V2XB 4BFEA 3HZKB 4AUJA 3MRRA 3MBXL 3DX9A 5SWZA 4GKSA 2DTMH 1OAZL 4ZXBD 4BFGA 5IW6B 4ATWA 4HXAH 3R19A 3WN5A 5F7DA 5F3HA 4F5CE 5JIDA 4TVPE 5FYLD 2EUWA 4MD0B 1T5WB 1YUHA 3KD4A 4XB8A 2FGZA 2F18A 4LHUB 1JV2B 4L8CB 3V4UH 2CUHA 4WLCA 4GT0A 4JANB 4C3JC 4C3HC 1EJ8A 1VFBA 3KJ4C 4Z78B 5I0WA 1N3NB 4R9HA 2VDKB 2YD5A 1TNMA 1DUZA 2UYLB 3TO4A 5EZPA 4J3OF 5DJXA 1IAOA 1FSKB 3IBEA 5E9AA 4ZI8A 4MA8H 1X5HA 5C6TL 2WIIA 3PHOA 1I3RB 1MLCA 1N8OE 4F7EB 4ODBD 1I3QC 4XO4A 2O6FA 3U4EB 2CR6A 4JR9H 1ZXQA 1FFOB 2AKRA 2H9GA 3DC0A 5TDNB 3VD1A 4OM0L 4TSCH 5EIIB 2MEJB 4H8PA 2YZ1A 2FRGP 3UZQB 4AT6B 4JHBA 4NZRL 3WXWH 1IGYA 1MHCA 1RUPH 1X7QB 4LDOB 4WI0B 1EHNA 3LN4A 2DQGL 2WXNA 4JVUA 2JB6A 4EJ1C 1I1FB 4MA1B 1BM7A 2XFXB 3KLQA 2AEOA 5DI8A 2YOAA 3EADA 1I9RL 1TOXA 3D3VB 4I18A 5DJAB 2ZCZA 3FO0H 4X7CC 3BDXA 3Q0HA 3HOVK 4LCWD 4B9FA 4ZMQA 4HIQA 3R4DA 4Q6KA 2ZUEA 2GI7A 3AQDA 3P3SA 4P2OA 5JNYB 2D7TL 1XL6A 4AYSA 2HT4D 3JWOH 2WBJB 3O45B 4R7NA 4UNVA 4YAQA 5I6KA 4OFPA 3WD5L 5F44A 3BZ4B 2OYMA 2YD2A 3EJCA 3FT9A 3AY4C 4FQPA 5IOSA 1A7OH 4G71B 1QBMH 1U8IA 1YYLH 1P5UA 5TE7L 3WNPA 4K0OA 1FVDB 4IRSC 2E9WA 2IAMB 3NP4A 3GMQA 1AGCA 2R29H 2XNAA 4URTB 2I26N 4OV6F 4A66A 5D4DA 2HX8A 4OGYH 2YAQA 4Z76B 1JK8A 5EEWA 1NDGB 3EYVB 1J1XH 3NQIA 3HBQA 4NO2A 5FGCE 4ZJ9A 5IHWA 3GLZA 4GQQA 1B4LA 3GTKC 3Q5TA 1M42A 4WUUA 4XVJH 5JHDE 5T5FH 4A2EA 4OV5B 3EGXA 4DTGL 2IO5A 3G4CA 5IMKB 2J1WA 3WNMA 2CW0A 3VTMA 1T21B 1FDLH 3D08A 4A38A 4PJAF 3N04A 3H7BA 3SCMD 1EEQA 4LKXA 4BK5A 1AAJA 3QC6X 4AKQA 4P4KD 4ZK8A 4JL2A 3RIFF 2IV9A 4GLRH 2YD1A 3MX0A 3FF7A 4K7PY 3VW3L 4QLRA 3FW6A 1A7QH 4G0WA 2CR3A 2BOCB 2VR8A 2GIXA 4U7MA 2Y06H 1H0DB 1HC1A 5CXPA 2ZUFA 4KKLD 3LKPA 2WB1D 4AQ1B 3UYOD 5IUSA 1BVOA 5E8DH 5F9DC 4UOW1 1YEFH 5JHLA 2WC7A 2WVVB 4Z95L 2XWTB 2NYZA 3EJZC 3JYCA 1X5LA 4IRJA 4IOFC 1JYVA 3HG0A 2V2XA 2YGNA 4GAGL 5FYLE 4JHWL 2NCEA 4WTZA 4PJ6A 3T6VA 2FK9A 5IOPB 3U4BH 2NZIA 4ZSOE 4AIXA 4DH2A 2VW7A 5I15L 3QG6B 2ICEC 4HKXB 1OANA 1FIEA 1J1PL 4NZUL 2JA6A 1OM3H 4ALAC 2B4CC 3H2PA 2P46B 1PD1A 1T5WA 4NQVA 2OSWA 4ALAL 3KGUA 3FTUA 2B4CL 2FYVA 4LHUA 4L8CA 4JANA 2VSMB 4GTEA 4NHUA 4Z78A 3GTOK 3FC8A 1N3NA 3PO3C 2UYLA 3JV0A 1KGUA 3WLWD 1RH8A 3H54A 3VGFA 5KG9B 3NEEA 4EPSA 3MLPA 1I3RA 1TWCA 4RQQA 4F7EA 5L2KB 1JF5A 5D7IA 4MMXB 1AHWC 2HSIA 3U4EA 3KE0A 2NY5C 1UURA 4ZUSB 5TDNA 4B53A 4RMUA 4U6HA 4Z7UF 3W81A 1ML0A 2EDHA 5EIIA 2OULB 4DN3L 2NY5L 4IOIB 3UZQA 1DLHB 4KK8D 1E2WA 1C08B 3AWGA 1C7SA 3SDCB 1X7QA 4GUPB 3GKWL 3HG1B 4PJGE 2XFXA 3OSKA 4C58B 4WI3A 3ZE2E 3D3VA 4A7UA 4OSUL 4M5SA 4M8QB 5CBAB 4KO9A 5DJAA 3ULUH 3U9PH 3MLWL 4KVPA 3IMSA 4WGKA 5CJQH 3QZMA 3UO1L 2ESVA 1UXLA 4Y4KB 1VHPA 4LVNB 3KLHC 1WA1X 1KYOK 2H2SD 3ASWA 2FJUB 4HOMA 1VAHA 3CGTA 1N10A 3HPJA 3O45A 2WBJA 3GSVB 5CNHA 5DWUL 5CD5C 2WLHA 2GSIA 3C6LD 3S2CA 1S78C 3BZ4A 2BS71 3MNWB 4MXQD 2CK0H 3B3BA 4ODSH 4R7LA 4XNUH 5L88L 5T1DL 4B6ZA 3OKYA 1FVDA 5F7EH 1LO3H 5DK2B 2VLKB 2EJ1A 1ZT4A 3DX4A 5E56A 4JQIA 2NRDA 4PV9B 4QHMB 2JA8C 3RTQB 1QPXA 2OMVB 1N7ML 1Q90A 5A2KH 3EYVA 3X2QB 1YQVL 1V05A 1SYVB 2YD0A 3ARFB 3S16C 3GRWA 1MIML 3T3PE 5A43C 2VXTH 1J0YA 1OE2A 3K6FA 2IDTA 4R4NC 4GIOA 1D5ZB 4OV5A 4JGJA 4Y5XC 4OUOA 5IMKA 3VXUD 4P5BA 2BS9A 3BGFC 4KX8A 1MJUL 1T21A 3VQ2C 4Z7UB 4Q9RH 3I4MK 3CDYA 2C4FU 2X42A 2ZWYA 1YYML 4UAHA 4PJCE 3PWPB 2AJVL 4LOUC 1JXJA 1MN4A 4ADJA 4YH6A 4QXGH 3SY0B 5A2BA 1OB0A 1BM3H 2OV0A 1HCZA 1MCOH 4GT7A 4F8OA 3FSZA 2J6EH 4M7KL 3O6LH 3QJXA 1KACB 4FFVC 1IQ0A 2BOCA 3MI6A 1O7DC 4U6YA 1TWFC 2D03H 2J1KA 4PVBA 2EP6A 3AGVA 2B0SH 1AE6L 2GBTA 1IC7L 5F9OH 5CLTA 2GJRA 5DRXB 5B3NA 2WVVA 5DFTA 2A74B 2JA7C 2XWTA 4NC1C 1NBYB 1HVXA 2WLLB 5IESL 3TWYA 1XH3B 3JTSB 1NMAL 3UDWC 1U93B 4NWTH 2UVEA 5IOPA 1BWMA 3QCVH 5BS0B 4HKXA 1N67A 1COBA 3U1SL 5DRNB 2HX9A 4NN5B 3OREA 4AK1A 3UJTL 5F3BA 1J5HA 4N5ED 4QOKB 4UM9A 3VXRD 3WS6C 1WFIA 3UFIA 3GBNH 4UQIM 5JQ6L 4LFHG 4WHCA 4MJ4A 5L9DH 4D9QD 5KOVC 2X88A 4U2YA 2JCCB 2BY3A 3WKYA 4XCEB 3K4ZA 3N5AA 5KTEH 3LVEA 2G5UA 4PJAA 4G43B 5DSCA 3MV9E 1BMGA 2EE9A 1BQ5A 2BVYA 1QNIA 5AKTA 2VW4A 2E6JA 4LLWB 3OHXC 1DVYA 1TU2B 3WU1A 5L2KA 3BUQA 3BP3A 3U82B 2CMRH 4WSKA 3HS8A 2WNWA 4ZUSA 2YKKA 5CGBA 3CQZC 1A1MB 4N1CA 2ZOUA 2O5JA 1UWFA 3SDCA 2OP4L 3LRHA 4GUPA 4AVKA 3ARBB 3HG1A 4OFIA 5B7EA 2G5BA 3DARA 3QXAA 2VMEA 3BKJL 5DZJA 5GS3A 1HSBB 4L48A 5CR1A 3ETBJ 1ZVUA 2ERJC 4JFSA 2R0LH 3UP6A 3S48A 2Q1EA 4M8QA 5TQ2H 5CBAA 3VFNB 3SOBH 2RCSL 3M45A 1TCRA 5EUOF 3T2PA 5GGRB 1K4DA 3ULVF 2WXIA 4GEJA 5HYFA 2UY6A 5I1HH 1BZEA 5J6HB 3GSVA 4LCCB 3BAJA 4ERSL 3HAEB 1NFAA 1CLYH 1ZE3C 4WNQB 1UUSA 4TN9A 4YIQA 1T83C 1UWYA 4YBQC 3CHOA 1YECL 1A4JA 4PJXE 2XPZA 1D5IL 2FEDC 3AM8C 4GQ9L 2OJZH 4TTDD 5FAAA 3V0HA 2I9TB 4QR7A 1O6TA 4JLRA 4OI9A 2VLKA 4WK4B 1T4WA 4FFZA 1IQWL 1EBAA 1VLXA 1Z0MA 5IFHL 2KPNA 3VXUE 4PV9A 2YQBA 4QHMA 3DROA 2OMVA 3CCHB 3W11D 3SJVA 5C8JA 2C9UA 1SYVA 3BVNB 4XP9H 3SYCA 1D5ZA 3ZZLA 2GIYA 4RDQF 1WBYA 1ZV5A 3ABLB 3QZNA 3TA3D 2VLJB 1ZPUA 4Z7UA 5EEUA 3RVUC 2XY2A 4NEHB 5FKAA 1M57B 5LWYL 1DBKL 4PIBA 2D6FC 1BFOB 3PWPA 2VUOA 5F7LB 5K1NA 1DUYB 3PL6C 4HUKB 2OW7A 1ZHLB 5KVFH 1KIPB 3L4YA 4P9MH 4RFOH 3MOAL 1DVZA 1DBBL 4K3DL 5JR1H 1J7VR 3HNTH 3S6CA 2Y0SA 5I73C 3EXJA 1ZIAA 1RIUL 2B7DT 2XZAL 5KSUB 5EUOB 1TJIL 2ZICA 3AS2A 3QUYC 3PABA 4ODTH 1KCWA 4ZPVB 2NY7L 4UDTA 4M1CC 1PMYA 1E50A 5C9KA 3F58H 4JM4L 4EZLA 1AOHA 2G75B 2QTEA 5AALA 4PB0L 3VVVA 4KJYB 5DRXA 4HS3B 1NL0H 2DYPD 1TQBB 3QDAA 4XN4A 2A74A 4PSPA 4FADA 3GTJA 1W72L 1NBYA 1E4HA 3GDZA 3KPRD 3PGFL 5KS9B 1XH3A 3T1WA 3TJHD 3JTSA 1RZIB 1U93A 4W9HC 3GNMH 4MNQD 5BS0A 4CADB 2P5WE 5F7YC 1BQLL 5DRNA 1TLMA 1TQSA 1SHXA 3G6DH 2NXZD 1P84K 4NJAH 1BD2D 2QGCA 4JPIB 3X1EA 5FO9B 3CTTA 3I50H 4ODXB 5E6IC 1V7MH 5L4FA 3DVGB 4MLSA 4QOKA 1PCXA 3S36L 2AJYL 3AVEA 2GTZA 3RI5K 2BVPB 4HXBL 4NFCA 2W88A 4K55A 3FDWA 5DVLA 2BW4A 1IGTB 4YDLB 2JCCA 3VX0A 1JNLL 3HLAB 3LKOB 3QXVA 4XCEA 1KB9J 4G43A 3S5LB 4WW1B 1R4XA 1Z5LA 3BLBA 4G6FD 4Q6IC 3KLSA 2WXPA 4LF3B 5GZOC 1CIDA 4K71B 3QXWA 2J73A 3X3GH 4G7ZA 2ADGB 1WQHA 4M9OA 2WCGA 3BMWA 3K2UH 4HUNB 3FQ2A 3NOIA 4FM9A 4FFYA 2NDFA 4MZIA 1XCTA 1BV8A 3D48R 1A1MA 3NIGF 1QFUH 3ZKMD 3HB3B 4N1HB 4PWFA 1LO5B 5D9SA 2W9LA 5BO1L 5BV7H 1B6UA 1HSBA 3D9AH 3Q01A 3ZJAA 1OWWA 4JN2B 1BJ1J 2VE6B 2GC4C 1ETZB 2FJSA 3VFNA 4IJ3B 1PX8A 2UXTA 5SWZD 2LT9A 1CICC 4AM0A 1S6NA 4WK0B 3D2UB 1EGJA 3QO0B 5I5RA 5EA0L 4G72B 3ALXA 4LCCA 4OTXH 4J3VA 3HAEA 3DRQB 5HYJA 1X5IA 2IIJA 4KZDL 4WNQA 4YBHA 3UBHA 3NCCB 3IRCA 5LHDA 1CQYA 4PG9B 1P7QA 2I9TA 1WZMA 2I07B 3FUFA 5DC9B 3VDCA 1N6UA 3TO4D 4LL1A 1RZKC 1LE5A 5GS0D 1D5BB 3AUVA 3QCTH 3FT0A 2XV6B 1Z6JT 1WZKA 4HUUB 1QHPA 4FG6D 15C8H 3CCHA 1D2PA 4E2OA 3KMDA 3QE5A 1I7UA 4NIKB 3BVNA 3LQAC 1IC0A 5ICYA 1SXAA 3I4NK 1CLZL 4HMCA 4HK0A 5EMYA 4BIKA 4X5XA 3LQAL 5GRJH 4DGVH 3T8XA 1BOYA 3SO3C 2VLMD 4Z0BH 3NIGB 1G6RB 2E75C 2QGEA 5FCUL 4P0DA 5E24E 1GGBL 1DE4B 1RP9A 1BFOA 4HIHB 4KUCD 2V4LA 2IGFH 1BZ8A 1DUYA 1ZHLA 3T4YB 5I71B 1KIPA 5JXAH 3CVIH 3WMQA 4Y16C 1OAXH 3D52A 4M1DL 2IOIA 5F1SA 3TP4A 4AVIA 3AY2A 2BY0A 2WVSA 2LTQC 2HH0L 4R96B 4OKDA 1D2OA 43C9B 5EUOA 1MPAL 3VI4B 2WMPB 3PHSA 4P2OD 4X80H 4DK5A 1LP9E 2I9LA 4EDXB 5JMOC 1E8ZA 1NEZG 2G75A 4ZW5A 2KZWA 5F89B 5F9AC 3TZVB 5E9DB 1KCUH 2FH8A 3SE3A 2B63C 2WINB 3GIZH 2N56A 2J8OA 4N0CD 2ZSVB 4FMVA 3LB6D 3A4EA 3ROLB 4LQFH 1KGJA 1B4JL 4XMWA 5CS7A 1F3JB 5C1MB 1RZIA 1TSHA 2F61A 3S7GA 2AK1L 4CADA 3HNSH 1WAAE 4XPAH 1QHOA 2IDSA 1OD9A 3P9LA 4M56A 5E4EB 4ZW3A 1OE3A 3MRMB 4JPIA 5FO9A 4ODXA 4YHLH 2NNRA 2ARJB 2VDOH 1RIVL 4QKXB 4WUUD 4H25B 5DHYB 5I2IB 5C0BE 2BVPA 2AI0L 3US0A 3HG2A 1W6LA 5GISH 5I1EH 3BKYL 1IBBA 1ETJA 1VSCA 3UPAA 4RGND 4G9FB 3DGGB 3HJEA 2G2RB 3HLAA 3LKOA 3O4LB 3S2HK 2H2PC 3I2CL 1AOZA 3S5LA 1QYGH 4JGMA 4WW1A 5BRPA 5I28A 4JG9A 4GS7B 1OIOA 1XCQB 4LF3A 1E5UI 5FO8B 1KC5L 3CSFA 3P2TA 5H35B 2R92A 3PUUA 5DMGC 2CUAA 2ADGA 2FWOA 1G7HB 2Q7NA 3PQYE 4KHXH 4R4FL 1HHIA 5ECGA 4O02H 5I30H 4L2YA 4DP1X 4JRWA 1WWAX 2B63K 2J4WH 2DDQH 3FN9A 3H0TB 4LHJB 3FCBA 4H8HA 3BN9C 5LXVA 1E4XI 4FEMA 2NT1A 4XXWA 2JQAA 4HXAL 2P5EE 2X4SB 4JN2A 4R2GC 4IRJD 4B27A 2B1HH 5M94B 1JSYA 1ETZA 3M88A 1OHQA 2GJJA 2IGTA 3E8UL 3GZQA 4HV8A 3OGOE 4CSTA 2JI1A 4HT1L 5A2AA 4LK0A 1TZGL 3MNDA 1R34A 1UXMA 4WI5A 5A6LA 2A4CA 5F7BA 3DRQA 4R97B 5DHDA 4RIRB 3MCLH 1A2YB 4D0CB 1HNGA 4LHUD 3S5ZA 4IRZA 2ZAIA 1DN0B 3DECA 3GWJA 1NGWB 4PG9A 5HXMA 5E08H 1IV8A 5B8CA 2BP8B 3H0GK 3ECBB 3QXDA 1HNYA 1PQZB 2YPVA 4MWFB 1D5BA 3SDDC 3LKSB 1Q9WB 2HWZL 3LPOA 4P3DB 4TSCL 4JY5L 1HCFX 1WPCA 4HUUA 5E51A 5EF3A 2RR3A 4A3GC 2J5LB 1M6UA 3A24A 1HSAA 3B2UD 5DJ2B 2G4EA 2WYIA 5EN2B 3FN0H 3RVWD 3S35L 4UM8B 1UCBL 3VWKB 1GTNA 1IB5A 1CZ8H 4V33A 3EIFA 2V2WB 2HG0A 4X7TB 1G87A 4OLZL 5LDSA 4YDJA 1G0XA 5HBBA 1IE5A 3EGDB 4PWHA 5ALCH 5F8QC 2D0HA 3OC8A 5F1NB 4AV0A 4FTVB 4Z77B 4HYTB 1DE4A 1I3UA 4ONHB 3GJEB 2YU9A 4HIHA 2LR4A 3WTWA 4PEEA 5HDBE 3SKUD 3PP4L 3D3VD 2FO4B 3T6QC 4POZC 1JD9A 2UZIL 1KXQA 2O72A 2DI9A 2ESVD 1SVZA 2F5AL 3MJ9H 3L3OB 1T7XA 2WNKA 3HI1A 4R96A 4X6DB 43C9A 4F8PA 5K9JL 2RD0A 3O3DB 4HWNA 1GXEA 3H2QA 1YYLL 2WBJD 5INCB 4EDXA 5CEZL 2V9RA 1B90A 3M07A 2E2HA 1KFGA 3ESNA 2L7UA 5DZAA 2R29L 2E5EA 5F89A 3TZVA 4N86A 5E9DA 4KZEH 4ZFGH 3L5XH 3MUGB 4M9PA 4FZ8H 3AXLB 2WINA 2CGYA 4OCWL 1J1XL 2B5IB 3GBML 3NYKA 4NO0B 4AYID 4RWHA 5DD5H 2O5XH 4XMKL 3ROLA 3LKRB 4WUUE 2FR4B 1JMXA 3OB8A 5IVOA 1BBDL 1OTSD 2QMKA 4J3OD 5LN4A 1I8KB 1I1CA 1MG3C 3MRMA 4XE5B 1J6WA 3VFTB 4NQEB 2ARJA 3TF7C 2N0MA 4OCSL 1QSFB 4H25A 1NCOA 5DHYA 5I2IA 1KUMA 4JQVC 2VUKA 5T3ZD 2H0PA 4Y2DB 3NZ8B 1A5FH 4N2HA 3HE6C 3JWNH 3NT0A 5CJXC 5AZEL 3DOIA 4G9FA 1E4JA 1SY6H 2G2RA 3DGGA 3O4LA 4JKPL 3Q43A 2F1BA 4RMRA 2P24B 2VB5A 4F57H 4A3CC 5C70A 4PCYA 5TF0A 1XCQA 1RULH 2YPLB 2DQTH 3ME0B 5FO8A 5H35A 1FA4A 1UD8A 1YEIH 2BC4B 2H1PH 5IK3B 4UV4L 1G7HA 5D2NC 1JVOA 4PREB 5E8DL 5HTSA 4YXLH 4E9RA 5IHZA 3S8GB 3OJ2C 4JFWA 3VD5A 5AVUB 2W07B 1TWAK 4ZFOL 1KEGH 1D6VH 3E2HB 2N4IA 1RUQL 3GXIA 1FIGH 3RWHA 5DFWH 1DVTA 5TFSH 5CZXC 3EH1A 4DEPB 2VWEC 1HEZB 3JV4B 1TQWA 1X5GA 2YJQA 3QARA 4M02A 5TMFA 1OM3L 1A6AA 5EOCH 2YRZA 3UO8B 5GSVA 4OJDH 1SFDA 1XQ4A 4Y4FC 3VFMA 1CBVL 4LARH 2OKMA 1HI9A 2ZONA 2BSSA 1F0LA 5LBVA 2VJ0A 1CVSC 3B9KB 1H8SA 4RIRA 1S8DB 2YMOA 4UM9D 1A2YA 4BSJA 3TEZA 4XNYL 3WHXA 1L9MA 2KWAA 4RAVB 2XY1A 5GIRA 1GMEA 1NGWA 2ZUXA 3FUKA 5D7IE 4C3IK 1ADQH 2VJXA 3IJ9A 3PAZA 2YD4A 3ECBA 1BVKB 2AJXH 4E5XG 1PQZA 3PWVB 4FN0A 4MWFA 4XXCA 4D7BA 3LKSA 2ZXBA 4BQCA 2HTLC 4P3DA 5G4OA 4HG4J 3CDGB 5GPRA 3UZVA 5L2KD 2DI8A 5EN2A 5KVDL 4TOYH 5IMMB 4UM8A 2ID5A 3QZPA 2XG5B 4NQQA 2WWKO 5FIEA 3VWKA 4YX2H 3ULUC 1LO0L 4YHZL 2V2WA 3KWWA 4WFED 4Z7WE 4X7TA 5FA4B 5KAQF 1P7HL 3NJXA 5IQNA 3ULUL 2ESVE 3EGDA 3SDCD 5F1NA 4PJEF 3HG1D 4FTVA 4GSRA 4TULH 2V6TA 1EK3A 3GJEA 4Q56A 3T2LA 3DYMA 3QORB 2P47B 3TTGA 4XP1H 1ZHKA 3PPSA 1L9PA 2FO4A 4OZGF 3LIZL 3MBEB 3R1GH 4D9LH 2PO6C 2NY6B 3L3OA 4GG8A 3FMGL 4HCRL 5B38B 4WNJA 5CLZA 3O3DA 1BF2A 2ZKHH 5HHNB 1BOGA 1MZZA 4LK4A 2PMZL 2QQNH 4OGAC 1Y1DA 1Q94B 2WGXA 3TOPA 3EYOA 3SD2A 1ZA6B 2IC2A 1NBZB 3DLQR 4Z7VB 1QQDA 2DIAA 5GRVL 1RZ8B 3GS0A 3AB0C 1PZBA 2MCMA 1Q9KA 3AXLA 3RQ3A 1E6JH 1JXDA 1TTBA 1IVTA 3IDGB 3SKOB 3ZIYA 4D2NA 4JG1L 2VLKD 4PI2A 4Z6AT 3LKRA 4M6ML 2FR4A 1I85A 2R2EB 1ILUA 2IDUA 3QR0A 2VXTL 2ZUTA 5T3ZE 2NY3C 4OFKA 4AYBA 3PXLA 4HS6B 3SE8L 4F8NA 1CGXA 4JO8A 3GKZA 2M8XA 1I8KA 2EABA 2MKWA 3SJVD 1FNSH 1MHHA 3VFUB 4Z7OB 2AZUA 3HBGA 3PWNB 2KL6A 2Q76B 3VFTA 1REIA 4NQEA