4ILDA

Crystal structure of truncated bovine viral diarrhea virus 1 e2 envelope protein
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
241
structure length
235
Chain Sequence
DVVEMDDNFEFGLCPCDAKPIVRGKFNTTLLNGPAFQMVCPIGWTGTVSCTSFNMDTLATTVVRTYRRSKPFPHRQGCITQKNLGEDLHNCILGGNWTCVPGDQLLYKGGSIESCKWCGYQFKESEGLPHYPIGKCKLENETGYRLVDSTSCNREGVAIVPQGTLKCKIGKTTVQVIAMDTKLGPMPCRPYEIISSTACTFNYTKTLKNKYFEPRDSYFQQYMLKGEYQYWFDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of glycoprotein E2 from bovine viral diarrhea virus.
pubmed doi rcsb
source organism Bovine viral diarrhea virus 1-nadl
molecule tags Viral protein
molecule keywords Envelope glycoprotein E2
total genus 38
structure length 235
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-12-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3000 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ildA01
3.30.1360.280 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4ildA03
2YQ3A 2YQ2A 4ILDA
chains in the Genus database with same CATH superfamily
2AJXH 1JZ8A 2M8XA 3KPRE 1AAJA 3O9WA 2R2CA 4NFCA 4PRNB 1Q0XH 4Y88A 3SOBH 4BCYA 1MHCB 5B1JC 1SDDA 5GS3A 4AGNA 3ZDWA 3TESA 5IYBK 2Z35B 2J4WL 4PWGA 1XXAA 1E6JL 4YHPA 4C2MC 2B08A 2BNQA 4A3KC 1R9TA 3LS5L 1P6WA 3BZDA 5KJ4A 3T77A 5AB0A 3TA3C 3WNPA 1S7WB 2PWGA 4H26A 1QLRA 1INQA 1P9MC 2DJ4A 2R69L 3KGRA 2ZNWA 2O1AA 1NC2A 4X7TB 5I1GL 1D9KA 4X6DB 1EJ6A 5KN5A 1TWCC 1T2QH 3T4AA 4M7ZC 4FJ6A 4G0WA 4IK7A 1EXGA 1XXCA 2KDGA 2AQQA 3SQBB 3Q2VA 4PWEA 3SE4C 1UWXH 1CLZL 4QOKD 4EI5C 3B2VH 2P5MA 1NWPA 2GUYA 1J1XL 5EBWA 3RNKA 5J8OA 1TVHB 1AE6L 2BWQA 1UH2A 4A93K 4BKTC 1O6TA 4GKSA 4H8UA 5FKAA 5DJDB 2A5UA 2YXVA 5G4MA 1WLHA 2IFFH 2RD0A 2F7PA 4S2SB 1OAZL 4R90L 1SXCA 4M48L 1AXIB 3D85A 5EO1B 4CKQA 5IK3A 3Q06A 3ECQA 3NK4A 3V0WL 5FA4B 3UZQA 3S5LB 3MUHL 4HUMB 2JJWA 4ODUB 1X5FA 1OCZB 4DT2A 4RA0C 5JIDA 3TT1L 1RPUA 1MFCH 3BZ5A 3E1F1 3RL2B 4DKDC 2LFGA 4MCZA 4PW9A 1YJDH 5TFSL 2PXYD 2D4DA 1B4JH 2V2TB 2CLVA 4HS8H 2ICWA 1N64L 1O6SA 3TZVD 2DQFA 2XCMC 3WKNA 3QH3A 4FG6D 5DJXB 2RQ8A 5F88A 1S9VB 1U8JA 1I3GH 3BX7C 5JDSB 3TXAA 3TZVA 1ID5I 2EKSB 3HUJF 2J88H 4BIKA 4PRAA 4Y19B 4LPUA 1HHKA 4K94L 1JK9B 3QUMB 4WSKA 5JR1L 1DBKL 1NCOA 2XTSA 2EIBA 3T0EC 5GZOC 4TVPD 3RVXD 5A7EA 5I1JL 1DZBA 3UTTA 1YN7B 1E4XL 3L4VA 3FT0A 5LXGL 4XVJL 4PRDA 4ZTOL 15C8H 1JPEA 1UVQA 3FB6B 3QEQD 3T6QC 2WO3B 1PZBA 5DMGC 1A5FH 2K45A 1GPOL 5I0YA 3DV6B 1Y0LB 2ADFH 2ZWKA 3SPHA 1CBVH 4LQYA 2WQWA 4LNRB 5AUMA 3N9GL 3CD4A 4MJ2A 4JFOB 4HUWA 1NCCH 3KLSA 2YR3A 3P9LA 4J27A 4PJIE 4XGZB 2P5WA 1NCBH 4DF9A 5JOFA 1OPGH 4HQQL 3NABL 4RAHA 1Y07A 5F7LB 4HPOH 5I9QB 1UXLA 1S9XB 2ZTBA 2HLEB 5GGTH 1R5IA 3V4VA 1NC2D 5E9DB 3BWAB 4LLGA 4D0DA 2DWTA 3RA7H 1Y1VC 3R19A 1TTFA 4XO9A 1T1XA 3OXRB 4Z0BL 4ODXA 3QUMA 3QYCA 4M1CC 3QG6B 5CAYB 4JRXA 2FJHA 4GSDL 2VB5A 3QR0A 3WEXA 2PMZL 5G55A 2AJUH 1VGXA 4OZHB 4JO2H 3SBRA 2ZKXA 4PRDB 3A6CH 3HI6H 3QORA 3WUWA 2CXGA 2WNKA 3LKNA 3MBXH 5D6DC 1XBRA 5JLZA 3KJ4B 1UUSA 1GS7A 1ZA3B 1GW6A 4APQD 5FO9A 5EGHA 4U1NA 4LVHC 5C3EC 3N1FC 1D5IH 3UTZB 4R4NC 4G83A 2DQDH 1HDMA 5EC2B 2VQUA 4XCEA 5LWYH 2YAFA 1WE5A 4NQEE 3OZ9L 4EO5A 5DEFB 2A7BA 1BYOA 1RI8A 4N87A 4M7LT 2VM3A 4BLBA 1BFOB 5IZ7A 4Z7WF 4AT6A 3HAEB 3WGVB 1Y18A 3HRZA 4JQIA 2D7OA 4NC1C 1SYSB 4TSCL 4I0PB 1GJUA 1I9RL 5FXCH 3TO4A 3I6GA 3GSUA 4RNRA 2JJTA 2N0KA 5MHSE 1FE8H 4KTYA 5C0JB 3V6OC 3W81A 1KYOK 1ZT7A 2DEXX 3DTXA 3H9HA 2N56A 2CXKA 4MKTA 1XGRB 2FJGB 4MA3B 2ZOLB 4WEEA 3MR9B 1CGVA 4PRID 5K5YA 2R4RH 4HSCX 1J1OH 3V0VA 4OSUH 3IDYC 3FHZA 4AK2A 5FJ8K 3QWRA 3ZDZE 4MD5B 4ZMYA 3K2IA 1PZ3A 3ULVC 2X0VA 3HZMA 1HZKA 3DMMA 4HOXA 5IHZB 4ESKA 4UT7L 3LKSB 1GGTA 3IGLA 3DIVA 3Q8EA 3IDJB 3RNKB 1HVXA 2MWCA 4OD3L 3GBML 1ET7A 3U0WH 3IXAA 4DJMA 2H1PL 2JIXB 2OYLA 4RESB 3L5XH 3CBJB 2ZX5A 4IU2B 3ULAB 5D2NE 4ZFQA 1BZEA 1DLHA 1YMHB 4YDKL 2R2HA 1B90A 1KIUA 3OJDA 4J6RH 4KJYB 2C1PB 4XPGH 3VTMA 1JG9A 1CFQB 2Z31A 5IHWA 4E41E 1Z9LA 3GJEA 4ZO6A 2DIBA 4Z95H 4O2EB 4DK5A 4QRAA 4AYBD 2ARJA 5DQDH 1XZ0B 4GAYB 1N5YL 4Y5YA 4XNQB 3GUTA 4KO6A 1GYUA 2AQNA 1MVUB 2PW2B 1PZ5B 4YSRA 4FQLL 1NIBA 4HFWB 2QVKA 2VM4A 4Y16B 4QJ4B 1EHKB 4A3CK 1KLFB 3E7JA 3H85A 4OQTA 2DH2A 2B14A 1V5JA 1LTXA 1XAUA 4YGVB 3VFWB 3T3PE 1JGUL 1I7RA 4G8EA 1S7QB 2GT9B 2ZUYA 4Y2DA 3Q05A 1ORQA 5FWRA 5HDQH 5PAZA 1LVEA 4AVKA 3ZE0F 3Q5TA 5DMGD 4KK9D 4GW1A 4QRFA 3GKZA 4Y1AE 2X2IA 3IJHB 3WN6A 1NMCB 1HKLL 3KPLB 4U6YA 4X5XB 2ZKHH 5FV2A 3QUXD 5E8PA 4F20A 2WWOA 2WVVA 3DX7A 3FTWA 3T0ED 3WEBA 3ZUCA 4X6CA 5ACZB 1OE3A 3GI9L 2AXGA 1HL8A 2AJVH 4L4VE 4MMZA 1AI1H 3DPBB 4H25B 2ZUFA 1KB5B 3EO1A 4IBTA 4Z7OF 5DZ9A 3QJZA 2XQBH 5KANI 3FB5A 2OTPA 3BVNA 2G5UA 1MCCA 2OJZH 5KYXB 1CICA 1N3NB 2WQAA 1L0WA 3G5YB 5CINL 4JFOA 2AEQH 1PDKA 4J3UA 4AM0B 5EU3A 4FFWD 1F58L 4L9LC 4LARL 2EYRA 1ZJBA 4TN9A 8PAZA 5KVFL 5L2KE 5C44C 5DUPH 1SJMA 3TCXA 4AG4H 1EVUA 5AW1B 5E2UL 4TLUA 2FUTA 3VFOA 3FT9A 1SY6A 5I1KH 2CUHA 5TK2A 1MIMH 4P59L 1OB0A 5IOQA 3UYRL 2IQAA 4OM0L 3S35H 3E8UL 4GS7B 1CWVA 3HNVL 4MAYD 3F7PC 2Y24A 5TE4L 1ZT4B 2BFGA 4J3BA 3O2DA 1F4WL 5E08H 1V3LA 2X1OA 1TWHC 5DO2D 2BW5A 4M5YL 2PR4H 2UZPA 5CCKL 5HYFA 2X3BA 4HS3B 4X2UA 3HTLX 1SHXA 1C1EH 3G7TA 1AFVH 4MDJB 2VO5A 1JK8B 1KBWA 1YEHL 3PPSA 4RWYH 3LEYH 3ARXA 4Y2LA 3MV8B 2Y36L 5D1XD 1A3LL 2I5YL 4BHUI 3RL2A 4YPJA 5I28A 4NXSA 5JIPA 3T08A 4CC4A 3QXDA 3PGCB 1KFAH 4OQTL 4K55A 1RZFL 3UX9B 5EEZA 3EO0B 4YL9A 3ELAT 1DVFD 1E4WL 4QRUA 1S9VA 5TH2A 2W7VA 2MHAB 1VGEH 4R7NB 3T4YB 4IDJH 1AD9B 2IOOA 1E5YA 1BQLH 1OM3H 3WY1A 5C08B 5FO8A 1NQBA 3ILPB 2ADGB 3MYJB 3DLQR 4F57L 3S7GA 4A7UA 1JYVA 3IDNB 2C9PA 2RJMA 2IBBA 1FYTE 1SXAA 3WV0A 1MI5A 4HT1L 5F7MC 5C3EK 2VMCA 3DO4A 3ARWA 5C0AD 3FHEA 1T1YA 3SQBA 2BOBA 1XH3A 1DQTA 4YXLH 5GPRA 1NBCA 5AENA 5SWQA 3MJGX 1QHPA 3TH4T 3V9CA 2WWMD 3LRSB 2VZTA 3UEQA 3GTQK 3BPLB 2PYFB 2QQLH 2Y1VA 5MI0C 4F2MA 1KJ3H 2BE5A 2OSXA 3RP1A 4H1LH 2R92C 4KI5E 1U8HA 2G4GA 5ESVB 3K8LA 5I5JA 3F7KA 4F7KA 1T21B 4OJCA 1FAIH 5HPMB 2CMRL 4LLDA 2ZX9A 3GDCA 2J43A 1OWWA 4N6RB 1Q1JL 2ZX8A 3MOBH 5B7FA 4TSAL 3S1QK 4BZ1A 1KIQA 1RY7B 1YLBB 1ZVNA 3EOBB 3HZKA 2K9UA 4LGPB 1ZHBA 1ZXQA 2CR0A 4TNVF 3BVTA 1TQCC 4QRTB 4L8CA 4P2OD 4NP4H 5IFJA 5CBEB 2ZYIA 4AEIL 4MQ7B 1H8OA 4FCHA 2G3MA 4W9LC 2OL3H 5BW7C 1QLFB 4H8QA 3CFBA 3UZVA 4BZ1H 2YEZB 1OSPH 3LEXB 4XXCC 4B50A 4GXFA 4KUZH 5MERB 2JA7A 4HD9A 4JRLA 3LKOA 4X4ZA 3NT0A 5DLLA 4U6YB 4X5XA 3GKWH 1TU2B 4GW5A 4A7VA 4F8TA 3CWGA 5SWZE 1S78C 2P80D 1HI6B 4IMKA 2B1HL 2BDNL 1WOSA 5FECA 3KPPA 2QGBA 2MH4A 4GRLD 3BGFC 1ZLWK 1JV5B 3QI9C 4D9QD 1WT5A 5MEND 5KZCD 2PCFB 4PD4J 4PJGE 2LU4A 3BE1L 5DJCB 1TKWB 4P05A 3VD5A 5DUBB 4QXUL 3B37A 2EDMA 3GI8L 4OZGB 5H35A 4F2EA 1P4UA 2OLDA 1IGYA 5CP7B 4AKPA 5CR8A 4LHUD 2W8CA 4NI3A 3TV8A 5CS7A 2PW1B 4YPGA 3OLDA 2I85A 5AKRA 5E1AA 2VXQL 1SNRA 1FJ1B 3K80A 4R0LB 1DDTA 1GZQB 3R4DA 4KRNA 5J6GA 4JLRA 1FC2D 2FHBA 1QBMH 4JM4H 2GITA 1QO3A 4MA1C 3WFEH 4LSPH 5KBKA 3VDBA 3SDAD 3C8HA 1WIPA 2QFRA 2X6VA 4A2HA 1H3UA 2Z0UA 3TVMB 2FR4B 3STLA 3ZL4L 2E46A 3ET9F 4EJ1C 2UZXB 3DX8A 3U0TA 5IMLA 2XWJB 4BKLB 2I07A 4QTIL 5HHMD 2VIRB 1U42A 4U33A 3FO1B 3VFMB 2EXWC 3V4UL 1NPJA 4OZIB 1UACH 3PAVA 4P9ML 2BP8B 3NCYP 4CMMB 2PN5A 1A6VL 1XEUA 3AWGA 3CQZA 4K5NA 4LSQH 2EDOA 2F5AL 1TO4A 3AMLA 1G9MH 1QKZH 3O4LA 1KBBA 4LHUA 3CAGA 7PAZA 2QVFB 2IH1A 1LMKA 2Q86B 4E9QA 4D7PA 1HOCA 2CRMA 4Y4KA 4WJ5A 1W6LA 1IEBA 4TSBL 3V5HA 4X6FA 4LHUG 1EDYA 3L16A 4MJ5B 4WNQA 4DTGL 1L9TA 1F8TH 5ENWB 3GSWB 3TO4B 1O28A 1DQDH 3F7YA 4NN5B 3PGDA 1DBJL 5D1QA 2D7MA 4AUUA 3BIKA 3D9AH 4HK3N 4DN3L 2EXSA 4O9HL 5MEOB 3BC9A 3OHXA 1RMFH 5KVEE 1QTSA 1ORSB 3UDWC 2EP6A 1MFMA 4G6KH 3RPKA 1KJMB 2JLLA 4ZBJA 4FI7A 3QJSB 4JM2D 2VMFA 2AQ3A 1RZKL 4HJTA 2B59A 3MA9H 5D6CB 4ZI8A 5JW3H 4P5TA 3UJTL 3WIIL 2WZPD 1NKGA 2GBAA 1BYNA 1XF5A 3P3RA 2WPGA 3KPRB 3X11B 3MRPB 1TFPA 2ED8A 5LAXB 5D1ZD 1NKRA 1BV8A 3ZDXB 3SYOA 3Q3GA 5ESQB 2FB4H 3RBSA 3CZNA 5FA3A 4ELME 4IRZH 1JRHH 5GGTL 4UUJA 1JHKH 2P5ED 5CEYA 3IGFA 3VI4B 4ZMTA 1FRGH 1OOWA 3TN0B 2BVTA 4YSEA 2VR9A 3O6KL 2NTFB 2DI8A 5C0AA 2QELA 1FWXA 4PJ9A 4XCYA 1F18A 1OY3B 4X6DE 1BM3H 1IC1A 2TRYA 2OMXB 1TU2A 1A6TB 3CN0A 1MNUH 4LF3B 1MVYA 3FSZA 4RFEA 1LO2H 3T6ZA 4NQED 3LIUA 1IBGL 3BYTA 1A5FL 5ITBL 3CFBB 4YX2H 1A9EB 5D1ZI 1DBBL 2HLFD 3HZYB 4BDVA 4DP4X 3I3EA 4OZGF 1J5DA 3F58H 4S11A 1CZ8H 3QPXH 2V17H 5FFGA 3K71A 4NQCD 4I88A 1L5GB 3FKUS 2EYSB 4FFYA 4DEPC 2CGYA 5D1XA 3AAZB 5DD1L 4AQ1A 3MBWA 3W3BA 4A3EK 3CZUB 4RETB 2VLKD 3SGJC 2R2EB 2ZSVA 3OMZA 1CDCA 3DYOA 4CVXB 2CJTA 1MWAA 3QFGA 5HYEA 5DMKB 1D5MA 2MCPH 3SPVB 3BP7B 4RSVA 4E9WA 5DVOA 2HTLC 2BP5M 1YG9A 2EO7A 1BLNB 4AGOA 2ICWI 3EJZC 3M1BA 4NEHB 5IQNA 5DZAA 4TULH 1BSIA 4H8WH 1MFCL 4EXKA 4G6AC 5T3XE 3BLKA 2V6HA 5TH2B 1A7RL 4MS6A 4ODUA 4UYPA 1GZPA 3WNOA 1IAIM 1AGFA 4L3EA 5I74B 2XUWA 5F1NB 3UJTH 1YQVL 4P3DA 2BVYA 4QXGL 2FE0A 4YE0A 1IBDA 1KIPB 3MLRH 1AO7A 3SKOA 2WLNA 2IADB 2IV9A 3OLEA 4NENA 3MCLH 3MJ9L 4O2FA 4NPJA 4OVVA 1AD9A 1KJ2H 3LKPB 2GHWB 2CGRL 4X98A 4JUTA 4KJWC 5T5FL 5TE7H 1FO0A 2EDFA 3DXJA 1PVHA 2CLZB 4PJXA 4A93C 1GIGL 4BD4A 2ZOKA 1I1AC 4YHOH 3LJ3A 1LE9A 5KUMA 2VNCA 2HCZX 2JA6C 1ASQA 1BBDH 1LO4L 3AJ7A 1HOCB 3CVDA 2CHDA 3GIRA 2WWNA 4KMTH 4OZIE 1F4WH 4R9HA 4DTGH 1JZ4A 2H32B 1MJUH 4N20A 2ATPA 2MOVA 3FB7A 3TVMC 2NY2D 4LRNL 1CLYH 2EDNA 1O0VA 1A2YA 1NA8A 1WEJH 3SO5A 5DJ8B 5AW6B 4MA1B 4HG4K 4FZBA 1I8MA 3T0BA 1RUQH 2J44A 2PO6C 1AS6A 3T0WA 1YEIH 4TVPE 3WTUA 2R23B 2JIXD 3NJLA 3BW9A 5FLMC 5DVMA 3C5JB 3ZY7A 2CRIA 1H5BA 2Q9OA 2GJZA 1J5IA 1TFHA 1YYCA 1ZLDA 1HEZA 3ESPA 2QMKA 5EPMB 1JYNA 4BQBA 4AUJA 3VFMA 3UAJC 4QTHA 3X3FH 1JPSL 5GGTA 1M1XA 3V4VH 1Q9WA 5DJ0A 1KPVA 2DYPA 2RTTA 1Q9WB 3D25A 5IQ9A 3HLAB 3WFEL 3I2CH 3AACA 1A8ZA 3ZMEA 4Y16D 4PCYA 3VGFA 4YR6B 4BXXK 4A3JK 1QG3A 4NS0A 3NUKA 3IDXL 4AUYA 2I32A 1MFUA 1M57B 4IRSD 1KYDA 2J5WA 1KJVB 3L9EA 1YAIA 4ES8A 2GAHC 4UU9A 4NAQA 2XWTB 3S97C 2VDNB 3C8DA 3LPPA 3ZDXE 1JGUH 3PF2A 3J2PA 1V10A 1IKNA 1BBJB 4QHUB 4JRFA 2CE6A 1JPGA 4PJDE 4UNUA 4ZFOA 1EXUB 4Y7MA 2A6DA 1UZGA 3ZDZB 1JXJA 1X44A 4YLQT 1URLA 1A7NH 5ABAA 4K23L 2D03L 2IFGA 1R33A 2YUWA 3I85A 1KGCE 2BPBA 3CFCH 5IYDC 4JJOA 2IH3B 2ZCLL 2A6IB 1KLFA 1KIRA 2X3CA 3VWKB 3LAFA 4K5LA 4F93B 5DRZB 3TFHA 4L5FL 3LNIA 3OR6B 5F2FA 5D2LF 2V2XA 1ZLEA 1IZJA 1GTFA 3TO4D 2CO3A 4Y9EA 3WHXA 4C3IK 1CU4L 2X6BA 2BM3A 1MAMH 1OB1B 2HUEA 3FCTA 3QWOB 4I87A 1ZLUH 4FYRA 1X9QA 3NCBB 4ZTPL 3F7RA 1U8HB 4YHOL 2OSYA 4FLOA 3ZTNH 5C0BA 3D0LB 1USQA 2RH0A 3WDJA 1UD2A 2Z93B 1F00I 3SO3B 2F54E 3FFOA 3V6FA 2FWLB 2QQKH 3BKJH 5A3ID 3FOLA 1KIUB 3OJDB 2OTWB 6PAZA 3IPJA 3ZE0B 2CM6A 1OP5H 1XGPA 1JERA 1JWUB 2QVMA 1IVLA 1DANT 3K74B 4K7FA 2JCCB 2VDPB 2Y6TE 5I0WA 1HH9A 3PDOA 3V4PH 5C6WH 1XSKA 5DJXA 1ZT7B 5DJZB 3IS1X 4QXGH 4OAWB 4GSQA 4NDMB 3WNMA 3FAWA 1ILUA 5ACLA 4KOCA 1BLNA 5L88H 1A7RH 1XGTA 2J1WA 3HZMB 4JFQB 4U3SA 4KKAC 4POUB 4YXLL 2Z3FA 4Z7NF 1A3RH 1MJJA 5BZWB 2MPAH 3DJSA 2ITEA 3L48A 1RQ5A 1BF5A 1OF0A 1VJEA 4K5OA 4ZFGH 2O61A 3VSTA 4WGVB 5L88L 4ADIA 4IU3B 3P40A 3R7QA 4Z3GA 4WENB 2JA5A 3D85B 2GK0A 3PP4L 2YZ1A 4OD1L 4QXTA 3P0GB 1TWFC 1G7QA 1EH9A 2XA8H 1PKQB 1RZFH 1V05A 1F90H 3IRZA 1U8QA 3CFEA 3H3VD 1RIHH 3HPLB 5I6KA 1DL7H 2VLJB 3PGFL 3H2QA 1WCMK 4OV6F 4X4XB 5D70L 1WFNA 3CVCA 4B9ZA 2WYTA 1L9RA 1TZIB 4PJBE 5DEFA 1GA2A 2CCWA 4KKPA 4K2UL 2NY5H 1EERB 1U8NA 3QEQA 2OAAA 3SOTA 1HI9A 5ITBH 2OJZL 3CGTA 1PSKH 2YKLL 4L9LB 1G7MB 3T3MB 4B60A 1PIFA 4PRHB 4XBPB 2N4IA 4XPAL 5E9DA 1I1CA 3ZDXF 3V6OE 2EVHA 2G5BB 5J1AA 2R1WB 3RWDA 2ATKB 3S15C 5E08L 4MA8H 3UC0H 4QI3A 4HS6A 4WW1A 5DR5L 5F3HA 1OZTG 2MCPL 4OM0H 3S35L 2Z92A 4FKKA 1JPTH 3NJKA 2JH3A 4F58H 1S7UB 5CLYA 4JK0D 3GLEA 2BXZA 5TMFA 1TJMA 1NFDF 1WJ3A 3B1TA 3OZKA 3MUGA 5KYUA 3DHMA 4EKJA 1NLBL 2I9TA 2FB4L 5DFWH 3F5WA 3V4VB 5EGEA 3QDMD 4O51A 5JPMC 2ZXQA 1YMMA 4JPIB 1ZXKA 1OCRB 2WWKO 2Y6SC 3QUKA 1H6FA 1KB5A 3BKML 4HUWB 3MV8E 5LGHL 2BVQA 4L37A 2NY2C 4HV8A 1B4RA 1EDQA 4C3IC 2EE0A 2P8LA 1M2OA 4PRHA 5F1IA 3HLAA 5JW4N 5SX4H 4BKSC 2XWTA 1O2BA 3QISA 2A6KA 2JJUA 3EIFA 5I71C 3IU3B 3AROA 3D6GA 5F96H 5IVOA 1ITBB 3NRPA 5BRZB 4YE4L 5GGVL 1IC7L 1MF2H 1AXSA 4QOKA 1A22B 3CU1A 3EOTH 4HAKA 5KBDA 4M9PA 2ZKHL 5HJ3A 4KJWD 1J9QA 1P4LB 2NNAA 2YO3A 1OGAE 3IAQA 3UEZA 3BSZA 1D9KD 4HCGA 2JJSA 5CZXC 3WEAA 4HPHA 1JZ5A 4F91B 1F8TL 2CW0A 3NJVA 4PG2A 5F7WC 4UWQB 4XN8A 1DFXA 2DQFB 5GGSA 1NAMA 3APMA 4WILA 2ESVA 2WSKA 3DYPA 5IEKB 5ACMA 3DJRA 2NUTA 2LR4A 2C3HA 4NZTH 1YMME 4POZD 2J57A 4QGTA 3ME0A 1G9ML 1MCLA 1QKZL 1KJ2B 1ZXOA 1CJYA 2UY6B 3VGDA 3GBEA 4FJZA 4OFPA 3D39D 3KLDA 1E8YA 2D73A 4G8IA 2Y23A 3MXWL 3WMSA 4W6XB 2NCMA 3MOQA 4JMXA 4LRNH 4CILA 4XB8A 1W80A 2XIIA 2Y1AA 4XOCA 5DU7A 2R7ZA 4OIOA 3WJJA 3DROB 3EYQC 2VE6A 3GEIA 4QTIH 2X4UA 3CQPA 2EDKA 4ZW6A 1VEOA 4CN6A 1CLOL 1F02I 2BINA 2WXKA 2QFPA 2ATPB 4K7PX 4KWUA 4TOYL 4LGSB 4YSOA 3E9TA 1BF8A 1Z66A 3WKMH 3UJIL 4WTWA 3KPNA 3NJHA 2WVSA 4LCCB 1QFWM 1BVKA 3GZPA 4BXSV 4KN7A 1CT8A 2FJFA 5JOPD 1A4JB 2J4WH 1NC4B 1OV8A 5FDYA 1XGRA 2FJGA 2X0WA 3AT0A 4EAEA 4YSTA 1XIWD 4Y4FA 3DI3B 5BZDB 2IGLA 4U6TA 5AL8A 4KO7A 3ILQC 2GJ6B 4W6WB 3KH3A 3V5DB 3RTQA 4GUOA 2AJUL 4PJGB 1T1ZA 3AY4A 4L23A 3WY4A 5FHBL 5F97E 1QW9A 5FECB 4OZGE 5DGRA 5HDRA 3KCPB 5HVWA 3T0XA 4WFED 3RVWC 4HBCH 2OBGA 4ZXBB 1IQDA 1PIGA 1TVDA 2MNWA 3E80A 2WZAA 1QP1A 4PYHA 3ULUH 1FN4A 2RAMA 3GSQB 4G5AA 1KC5H 2ZG2A 1KJVA 5I1EL 2YPKA 4WGWB 2Z91B 4N0CD 1GC1C 4NQQA 4X99A 5DD1H 3I6SA 1V27A 4QRTA 4L8CB 3L7FA 4JO4H 3F84A 4TUKL 4Q52A 1MFEL 4R2GC 3UTPD 2VWEC 4NWTL 1HYRC 2VZVA 4G70B 3ES6B 5ADPH 3MLWL 1OALA 1NCAH 2QKIA 3MRJA 5IJCC 3C9NA 4LDLB 3LEXA 3FFCD 5AB9A 2M26A 2YPVA 5TF1L 3VXSD 4LZKA 4J4PC 4JQVA 1FGVL 4HULB 4MD0B 4UZGA 5DC9B 2GW5A 3BHBA 4PJEA 3W0WD 2PA8L 5JVOA 2Y0SL 1BEYH 1Z5HA 5J89A 2OYKA 2P49B 3EXLA 1T5WA 2OTUB 4P2RB 5F1OB 1UASA 3RIFK 3AQZA 1IEAB 5ETUA 1P5UB 3NABH 2LHAA 3FU3A 1OTSC 4KGLA 4ZS6D 1ERNA 3DBXA 5BVJA 4LLYB 2FBOJ 4BBRC 1TTRA 4UQCA 1IC5H 2VQ1B 1NUFA 5E99H 5HYJD 1AG0A 1D6EA 5CSBA 2YU9K 2OJ1A 4DGVL 3I75A 4X9BA 5L7XL 3FRPA 3IVKA 5DJAA 3CC1A 2MEJB 3N9GH 1TENA 4JG5A 5EOTB 3KYMB 3EFFB 1JZIA 1H6UA 5T5NG 5GZNC 2JJVA 2ZP0T 4BWWA 3ESUF 4QRUB 2VLMD 3HNSL 3QUXB 3QFDB 4YFLF 3KW8A 2R8SH 2ZPKH 2JXMB 1VGEL 4WW2B 5E70A 4JG0L 2X38A 2ZXAA 3GMQB 1E4WH 1Q1JH 3MOBL 2VTFA 2IAMD 3RPIB 1USMA 1TNMA 4ODSL 4ONFH 1UD4A 2D9QB 4TUUA 3HR5A 4HWEL 2DY2A 3EYSH 4HIXH 5MI0B 3V4PB 4QIWL 1J9RA 4L1SA 2P48B 1RIHL 4DPRA 5C07D 1P4IL 3QIUC 1CLCA 1OP4A 1BZQK 4XPFH 4G43B 3K6FA 1U93B 4MJIA 4XZUB 1SOSA 1ID2A 1OW0A 1OGAB 4PW3A 4LCVA 1YEHH 2WB1A 3GGWB 4JDVA 2VMDA 4KK8D 1Y1VK 4E9XA 3B6SB 3ISRA 4TQIA 3CCHB 1LEGB 2DQCH 1OOAA 8CGTA 1WOOA 2A0LD 3D1MC 1IAOA 2WV3A 1IKFL 4LHUB 3KYMA 1HH6B 1J1PL 2BOLA 2DJUA 4LPYA 5EU6E 2Q8AL 3IFLL 5DA4A 5LBSA 2YC1B 3REVB 1RK1A 3OSVA 3WELA 3CHXA 3GK8L 4F2FA 3V9FA 5ENWA 2CO6B 3JTTA 4YMPA 1Q0YL 1TVHA 4UV7L 4LSTL 3SJVA 4N86A 5KSVA 4O2DA 4K71B 4YDJB 2W80C 4RBPK 5E6IC 4YOKA 5D55A 4ZAKC 5TQ0L 3VD4A 5DK2A 3SOBL 1M05B 1FHGA 1V3KA 3BVUA 4K7FB 3APFA 1I1YB 3QRGL 3OKEB 1JGVL 3MZTA 2FYYB 3QXAB 4FMKA 2RACA 3MRCA 1OAJA 4WO4A 4D9RD 2OCJA 2W5PA 3EJQA 4S2SA 3PNWA 4HLJA 2FVNA 2QQKL 4TS6A 1S9KC 5T1KB 3BKYL 2ZYRA 1C16B 3LKRB 1MREL 3Q1SH 3X1EA 2YD3A 1RU9L 3O3AA 3S17C 3EOYG 1SN2A 2V0AA 3APNA 1JXDA 4LXFA 4UDUB 3DX9A 4XVSH 5IMKA 4RWYL 3QHZH 1KCWA 3X3GH 3IMRA 4AYFB 2NXYB 3TPKA 2EYRB 3H7BB 1JV2A 3MJ7A 3QG7L 3JV4A 2I07B 2H7WA 3Q7JA 1RP8A 2W1NA 3UABA 2P24B 2XTLA 4G9FD 3LNHA 1Z9MA 4X9IA 5IW1B 4EBQL 3M45A 5IM7B 2EIMB 2OYMA 5E8OA 5IEHA 2CKBH 2VR3A 5KN5B 3RY4A 1CO1A 2P5EE 2XN0A 2HMID 1U8CB 4PJXE 1YEKL 4KATA 3EJUA 2FGZA 5D93B 5H35B 2FLMA 1LO3H 3L2LA 2DQ6A 3FSWA 5DEJA 4W70A 1LK2A 4NC2B 1IARB 4I0PD 5CWSA 5DJCA 4PY7A 1NMAH 2GJ6E 3ARGB 3VI4A 1JZ7A 2XBDA 2EH7H 4X6CB 5IB1A 5ACZA 2JI1A 1VPOL 4UUJB 3FSVA 5IY5B 2EDBA 2EADA 3UIZA 1EHAA 2WTPA 4PRNA 1FF5A 1IGYB 4GXUM 2WZ6A 1MCRA 2A73A 2IDTA 4FM9A 1WRFA 5EG6C 3E38A 1BCIA 3JBG7 2WXFA 3KPMB 4IM8A 3S48A 4WI0A 3QEUA 3TJHC 4XAWH 4AENB 2ARJB 1CXIA 5SV4A 1U8LA 2WXJA 2VW4A 4G8EB 1T03H 4ZNCD 2EICA 4JZOB 3K3QA 4LLVA 3KPPB 5D8JL 5HYIA 3Q3QA 1NMCC 1DSFH 4NUJB 5B4MC 3C6EA 2W0FB 2DM3A 3WTXA 1PX4A 1KJMA 4F37K 3AS1A 3TTGA 1B0IA 3ZE2F 1DVFC 25C8H 4NP9A 1CN4A 4DKAA 1WDAA 2CCLA 3MRKA 3RTQB 4JFDD 4A3EC 1QACA 1XEDA 1XD1A 4PY7B 2UWEF 4JE4B 3K6OA 3ARVA 1BVNT 3H42L 2HFFB 1KNOB 4M5ZH 3II2A 1XTLA 2X9XA 5FGCE 4GBXA 1XZQB 2WQXA 1AYOA 4QMEA 6PCYA 3JQOB 3D12B 4WUUA 1HAWA 4N0UE 4K5MA 4Y19D 3UYPA 1J1OL 4XN2A 4DWHA 1M2VA 4J3OC 1GZHA 5J6HA 2XZCH 4L29B 4OKVA 1PJ5A 2W60B 4JDZA 1A7QL 1CXKA 4U4BA 3W37A 2NSXA 5JNYB 1BQUA 3GIZL 5ICZB 2HVBA 5FYJL 3F6LA 4NM4L 4NZRL 4NQDB 4WFFD 1BFOA 1BDFA 2AABL 4K9JA 2XY1A 4MXWH 4NN7B 5E4OA 2X4RA 2VDLH 2J8OA 5H8DA 4F57H 1ICTA 3TURA 2P8MB 1EDHA 1QZNA 1BJ1J 2VXTL 4IDJL 1OWRM 1XXDC 3LRLA 3QB7C 3NJMA 2PWHA 3OKKA 1G1CA 5IB5A 3QNFA 4XTRD 1RK1B 1OSZA 3OQRA 4QHNA 3F3HA 4P4KA 5D1ZC 1KBGH 5FV1L 3GLDA 4DEWA 3H0GA 1FO0H 3MUUA 3FHQA 4LCYA 3HOYK 4OF7A 4BFEA 2F74B 5IF0B 4RRPM 3GQFA 2J1XA 4JO2L 1ED3B 4NUMA 3RVVC 3K4AA 1CFNB 1JDCA 3EH4B 5MP6H 1Z9PA 1QHOA 4U7SA 3T1FA 4FXKC 5EOTA 2VLKB 4JM2C 1DBAL 1S4IA 3CSYB 2WLJA 4M5SA 4YSCA 5EOQL 4WFGD 3SBPA 4RFNB 1FZJA 3OR7A 1SZNA 5I1AA 5FC9A 4IBQA 4XCFH 1QBAA 5L9DH 1WOPA 3C5ZB 4HJGA 4NKMA 4V1DE 1JNNH 3GIVA 5DWPA 2UY7A 1L9NA 3B5HA 3GMQA 2E2HA 3QG6A 3WENA 1RHHB 4P59H 2WB1D 3H53A 4B7LA 2D7NA 4JHAH 1DQKA 3P2BA 4JFZL 1T3FA 2RFXA 4OTXL 3GRWA 4IOIB 5D7IE 1OHZA 2FHFA 5DYOB 1IM9B 4AQEA 1HL5A 4YIQA 4DKFL 4H1LB 1YEDB 1CZ8L 2VDQH 2ADFL 2EDXA 1MSPA 4X6CF 1BX2A 3MXVH 4B9JA 5C0CD 2K7PA 5TE6H 1EUTA 3ABZA 3GMNB 3UTOA 1FGNH 3ZE0E 2VH5H 3VH8B 2OTUA 4P2RA 3BXNB 3GLZA 4ADJA 4ELMF 3LRGA 1QPPA 4FA8A 3I02B 5FLVA 2P5EB 3G5WA 2NY1D 2JKLA 2D3NA 1U91A 4LOUC 4Q9BA 4EN3D 4ES9A 3BUYB 4OUUA 3RA7L 2FEEL 4YDNA 4WRLA 3EYVB 1DVYA 3QRLA 4QRQB 5CP3H 2DM2A 1U9KA 5EV7A 2V2TA 1HKLH 3QEGL 2QSVA 1V7NH 3MJ8B 5FUOH 3HOGA 4Z7NE 3KPSA 1N64H 2O5ZH 1B4JL 2MMXA 3ZR5A 4CADA 4F24A 5B8CC 4TRPH 2P3YA 4NT6A 2MQCA 4MBRA 3F2LA 1OAYH 5ECJE 1NTDA 4OCYL 3SD5A 4BA8A 6TAAA 5F88B 1H15A 4PR5A 5L4IA 2NVYA 3RZDK 3KG5A 1PY9A 3IU4L 1ZKAA 2D31A 2XY2A 4IIQB 2PWDA 4GKSB 4ANKA 2N3JA 3EBGA 1KXQA 4GKNB 4MCZB 4R7DB 2YEQA 1SN5A 5LXGH 3W39A 4FXGC 3MTXA 4IU3A 2P44B 3GM0A 4RMQA 3BGMB 5FW7A 4ZXBA 4PJBB 3ZYOA 3IFPA 4JCWA 3GJFB 1IL1B 3H9SD 2FT8A 3GMOA 3NIGE 1Z3RA 4NUGH 1JN6A 4ALAC 3AS3A 5IB3B 1G7JA 4I4WB 1AD0A 5C7XH 5KBMA 1J11A 2XPGB 2B15A 3NP4A 1XIWB 1MG2C 2DMCA 3RWHB 3UO1L 5DO8A 3F65A 4IKIA 1BFVH 1T2QL 2ENPA 4APQC 4P4RA 1D5XB 3K46A 1AS7A 4MB3A 1KLGA 3FS9A 3SDDC 1KCSL 1DO6A 1SMYA 3SPGA 3PHOB 4FXGB 1XZQA 5FCUL 1NGZA 3O0LA 3IETB 4QHLB 4L8BA 5J6SA 4A6YL 3GSXB 3V0AC 4AL8C 1JAEA 1KCVL 4P2OC 3H9HB 3STBA 3Q9QA 1QLRB 1VF5C 3NFPA 3S88H 1I3UA 3S0XA 4GG6E 5L4JA 1BWWA 2JKSA 3L95A 3HE6C 4IHBA 4MCNA 3VFOB 3K91A 4YHPB 1GXEA 4TL4A 3SPIA 3NZUA 1VB9A 3ULVH 2Y2TA 3PWNA 5B3JF 1IL1A 4NQVA 4P48A 2XACC 4N6QA 1NIDA 1YNTB 1SFHA 3AS2A 1UURA 4G7OA 4WCYL 1LD9B 3IAPA 4V11A 4IBUA 5I1GH 2NUTB 4A3GC 3WUWB 1RUML 4GIPD 4XNMB 3PAZA 4L4VA 1UA7A 2XETA 2NMSA 3O11B 3D50A 2VDPL 4H40A 2FZ3A 4YXHL 4UBDD 2EJ1A 7TAAA 3NPZB 1UZ8B 4OGQC 2EBBA 3FF7A 2F61A 4OGYL 5IJVA 2PHCB 3FUKA 3O0RL 2EH8H 2NNAB 3UH8A 4XP1H 1MXDA 2WXMA 3HE7A 4GT7A 1ODUA 4YXHH 1P7QD 4LIQE 5FOBA 1LO3L 1OXYA 5C1MB 1PS3A 3TJEL 1YMMB 2A1WL 3C5JA 4ORGA 1CDBA 4ZX3A 5D9SB 1RUMH 3DK0A 1YNTA 3MLXL 2IALB 2Z1PA 3LOWA 3RZDC 2X9YA 5DFAA 4PJ8B 3O6FA 8FABB 3CDZA 3IPFA 1MFBH 4MCYB 2G5RA 2GVYA 3KWWA 5FW8A 4W9KC 3RBGA 1BG9A 4OLWL 4HQQH 3QWNA 5E4AA 3ZUNC 2AF2A 3GTLA 3WLBB 3ZZSA 2TAAA 4LIQL 1NCCL 3NZSA 5AW3B 1OSPL 3BDBA 5AB1A 3N50A 1WAAA 1A25A 4TQPA 1OTSD 4UZSA 3SQOH 3UG4A 1O7SA 2OL3L 2IXQB 3EBHA 3BN9C 3MRNA 5IROD 1MRCL 1NPNA 2FO8A 3KDMA 1GPOH 1DJWA 2G0LA 3D8MA 5EB9A 4CAGA 5L46A 1BXVA 3GS0A 5FUCE 1Q9LA 2AXJA 4NO5A 4GQPH 4EE2A 1B0GA 1HHHB 1TZHA 12E8H 3MNDA 5KVGE 1E8XA 3PJSA 2PYED 4BSWB 2PCYA 3CPLA 3RILA 2AJ3B 4TUOB 3ALXA 2FSDA 1JHTA 5E23A 1CPUA 3QWQB 2DQCL 4N9GA 4HXBH 1X4XA 4NHCH 5ICXA 3ZZLA 3L3IB 2EC9T 2CO1A 3C6LA 2FSEB 4E0RB 4J23A 4JO8A 4Y5XB 5DUMH 3D3VB 2FT7A 3FJTA 1T1YB 3BGMA 5CJOH 3D18A 4MMXC 1KY7A 5HD8D 5DVKA 4UQ3A 5TQ2H 2OMYA 2DKMA 5LDUA 3CFTA 2O30A 4G1MB 4KNUA 4UILL 4N90D 5B4MD 4H44C 1MRFL 3HMXA 2OPCA 4KO9A 4QCIA 5C4XC 2CHNA 1NICA 1NEUA 1JZGA 4MZ2A 3RVWD 4RH4A 1KELH 5LVEA 4HIJA 3TJHD 1ZVHA 2VR6A 4Y52K 4L48A 5IK3B 1MIEL 2XHNA 3G6AA 4YDLC 2OXGA 1NOLA 2FBRA 4JFFD 1KXVC 1UD3A 3BQVA 3RGVC 2V9UA 2A6JA 1NGPL 1VH2A 1XIWC 4JBSA 1JZFA 1TPXB 1GGYA 1N70A 3I75B 1G9NC 2Y36H 3PJSB 5DUML 5CEXB 4HUXA 5DJZA 5D96C 4I3SH 3KYNA 3EHBD 3QP3A 2C34A 3TBVA 3LHAA 4G2AA 1ADQA 1FPTH 3IYLW 4P2RE 4XPHH 2ROYA 2MTAA 2ALAA 2CIKB 1BZ9B 5IOKA 3B3IA 3NA4A 4HIHB 2BK8A 4HCRA 2VAAA 3VD2A 4QIWD 3AG2B 2IQAB 5FF6A 2LABA 4EEEA 4FI6A 1FGNL 5IJBC 2KHAA 4XXWC 1JGDB 4LP4A 5CJ8A 4W4OC 4UTCA 3GTJK 3A23A 4G0UA 3DETD 4GY4A 4MQXD 5B21A 1SEBA 4OJAA 2ZUQC 3I02A 2BSCA 3C8KA 3SDDD 4TNWF 2UVFA 1YYML 5HI5C 3TVMD 4KZDH 4U05A 2VDOL 4Z7UF 3G6JF 2HVKB 4WI8A 1MLBB 4NO0B 3PJNA 3EO9L 4LIQH 1H8SA 4GXVH 3OX8B 3NZ8A 2P8PB 4Z7WA 1NGQL 2OA9A 2F1EA 3WN5C 1LO0H 7PCYA 4EUPB 5F9DC 5IVZB 1KUMA 4WTZA 3I9GH 3QO1B 4X4ME 2Q1EA 5AOMA 5FA3B 3QXVA 3MA7A 3DXAE 5F9WB 4CSSA 3O6FB 1MPAH 4M8QB 3E6HA 8FABA 5JXEA 1HE8A 1AZZC 4OM1L 4M7JL 3VYNA 4WTZG 4CBPA 3DSFL 4JNXA 2JSFA 2OQJA 1NANH 3IJSB 1MCPH 1J6VA 5DVLA 1AQDB 4MZ3A 2GJ6A 1S7TB 4FXTA 3S34L 3HS0C 2PCXA 3RGVB 1CXFA 4HXAL 1TZOA 1FO0L 4XVTH 1FCGA 5DQ9B 3A6BL 1FUNA 1OGPA 1ASPA 1S7QA 3IGAB 4Y2DB 4H0GA 5FCUH 1GVIA 2F74A 1BLIA 4IRJC 1KPVB 4X6FB 1NSNL 2F9BT 3ULVE 1U58B 3RZCB 1N8ZA 2RALA 3BDYL 3BVWA 1IAMA 1P0SE 3UG5A 3NJGA 1MCNA 3UAAA 1XGQA 2R0KH 4EN3C 4P23B 4JM2B 4KDDA 3FK3A 2XXCB 1CLOH 4XE0A 2H6PB 3CH1B 4RMTA 5DJDA 4GQRA 2APBA 3S3JA 1GC1H 3LVTA 5IESL 4OV5A 5CJXC 4NHUA 1IT9H 1BQHB 1I3VA 1P84J 1CG9A 1K4DA 5EU7C 5K9JL 2EQDA 2FYYA 3QXAA 4G80A 1A3ZA 2OV0A 2CO7B 1SFOK 1RVFH 1I50K 1CCZA 2EKJA 3H7LA 4YDLB 1X4YA 1TWCK 2WVTA 3H6JA 4G6FB 2WNWA 3I74A 1CURA 3WAJA 4UYQA 3H0TA 4WI9A 4BCZA 3MVSA 4PJ6A 2D6FC 1WTGT 3HVDA 5L6YL 1WH0A 1OAQL 2WP3O 3ZYJA 4B3EA 4ZUVA 4P3CH 4CC0A 4E9RA 2HX7A 5J06A 2OYPA 3WNLA 4MD5A 5IBUG 2YK1H 2NTSP 4LSSH 2OKMA 1F4YL 3SE3C 3JVGC 2VDMH 1USOA 3BQUD 5DEZA 2G9KA 3DO7A 5EF3A 4YPGB 1RVFL 2JKWA 2ZYSA 2F53D 4Q7DA 3N0BA 3DIFB 1SBSL 3K72A 3VXTB 3W2DL 4OM1H 4L2YA 3GB7A 1CD8A 5AD0B 3PUUA 5JZ7C 1JTTA 2XVGA 1ACCA 2ZUSA 4RX4D 3VDCA 3POHA 2D3VA 2C26A 3S1RK 1I9RH 3SPVA 4I8DA 1MEXH 4Q56A 2WKLA 4QYOB 3IU3A 1G6RL 4AI7A 4PCTA 5EEYA 3MFFB 3Q0HA 3WJLA 3A8IA 3ARTA 5E1AB 5DHVA 4AW7A 4NT6B 5IP9K 1JCKA 3MV8D 1UZ6F 1F86A 2F18A 3M3YC 1SOXA 3NSYA 3S8FB 3GSNA 1K83A 2EVGA 3KNBB 2ZF9A 4BELD 2QADD 3KHOA 2ZCHH 4IIQA 3ESMA 3L3DB 2FO1A 3DUUB 4N8VG 4LCWD 2BS8A 4N8PA 3S34H 3MUGB 3HC0B 1BYPA 1FSKC 1QMUA 4NQCB 3B3IB 4UOW1 2JVUA 2MOQA 4CGUB 2Y2YA 3K5SA 4UQDA 5B1BB 2OZ4A 4HYTB 1IE4A 1QWNA 3IRCA 4AX3A 4DCQB 1T1XB 5ABZA 1BAWA 2YMXH 3MROA 3NRFA 1AHMA 2E75C 5ESVA 3BZ4B 3QG7H 3CZGA 4A3MK 4QHMB 2XRAL 3QHZL 1T2JA 1U8OB 1XR8A 1G7MA 3RWJA 2EUWA 2A83B 1OPOA 4GT0A 2VC2B 1KIQB 1U30A 2JKTM 2C9RA 2EINB 5BOZG 5LLIC 4ODBD 1DFBL 3ZN6A 5M94B 4XB7A 3EYQD 5K59F 2CK0L 5IHUL 2OZ4L 5HHVL 5FX3A 5IR1A 2BZDA 2WCSA 4PN6A 2RIKA 1YECL 1NCDL 3QQDB 3FTVA 2AMGA 4I18A 3L3DA 4J2QA 2IBZX 3HJEA 4IRJD 2QJDA 2E59A 5KBLA 2GTWA 2JB5L 3FTSA 5D1ZB 4P5BA 4WWPA 2PTTA 2XN9E 4POZC 1TNNA 2H4EA 3QS3A 1G6RH 1ZHKB 3LQAC 2FYVA 4QYAA 4DFHA 1IILE 1RHHA 2NXYC 2Q8AH 2WNGA 3HMXH 1XF5B 1BVZA 3V7MA 4Y9GA 3CHSA 1ZGLB 4DGIH 4XLPA 2BSED 3VM7A 4QJ3B 3U46A 2NR6A 4P5TB 3GMRA 4OCSH 3VGEA 4ODVH 1CVRA 1P1ZB 1KV7A 3P4NA 3BISA 3D09A 1OTUC 2X2UA 2ZP9A 3ARDD 1GJIA 2CJSA 4PJCB 3ZYIA 1J0KA 1JNHA 2KQNA 3QFJB 1AQKH 3COOA 1CFNA 7FABL 1CYGA 3UAJD 3SE4A 1ED3A 4EI5A 2F7OA 3UTSD 1UFUA 2UVEA 2Z4QA 4RBPH 5F7KC 3K6NA 3GMMA 4P2OB 4H5SA 3PG2A 4XMWA 1AQMA 2E76C 5FA4A 4AOFA 3TX4A 4FGMA 3V0FA 2ZOOA 3WFZA 2HMIC 3A0OA 1DHKA 1TF4A 4PAZA 4DQOL 4H20L 3VDAA 4A3KK 2A38A 1DEEA 2COVD 2I7SA 2IWKA 3LZFL 3N43F 4F7MB 3TF7C 2O5YL 1MRFH 2NDFA 1FL6B 4EDXB 3OEPA 1K6QL 2NY6D 2XKNA 4XMVA 2RMNA 4R3SB 1UGNA 4F7PB 5A2CA 1UCTA 1UD5A 1KQ4A 4OINA 3KWWB 3VWKA 1D5ZB 1A7QH 1ULVA 4FQXC 1BJMA 4JFHD 3AG1B 3P9MB 1FNGA 2B3IA 3WXWH 5F6HJ 5F9WC 1P69B 1SJHA 4GAAA 1XCTA 2CSPA 3D87B 2BNRE 2V5RA 4OFYD 5E6ID 3WN5B 3P77B 1R5WA 3APDA 1N8ZB 3I9IA 4DGYL 1WWCA 3RNQB 5GZOA 4Y4KD 4KVCH 4E9LA 2D4FA 3MOAH 1G7PB 2WIIA 3GEWB 3OPZL 4G1EB 1PCXA 2EH8L 3O4LD 3OQ3B 4RWHA 3P0VL 4FZ8L 4RMFA 2WXQA 3DC0A 2WLIB 4N25A 2EDHA 5KOVC 1V55B 1CIDA 3CFDB 3QNZA 4KDTC 5CGMA 4BFOA 1FG9C 2GITB 5DZVA 2KC0A 5GRUH 2QQQA 1DSFL 3GZQA 4HFUL 1MZZA 2VUKA 1DEDA 3FT3A 4MAZA 4FFTA 3ZO9A 1UXMA 4GIOA 4K15A 4KTGA 5I66A 3JXAA 3KCPA 2R7ZK 2ZXEB 4LLVB 1FZMA 4D2NA 5C09E 4H4NA 4MB5A 2AEPH 2BVUA 3L95B 4HC1L 2YPKB 1FIGH 4L8DA 2Z31B 3GTOC 3PWVA 3MRMA 2EDWA 2OMWB 1BGWA 3Q5OA 2WJ5A 5HYJE 4NQVB 5TQ0H 5CEZE 5DMIH 2NQDA 4YLCA 4LSTH 3AB0B 2PABA 5KS9E 2HLFC 3KBEA 1M3IA 2HFEA 4ZUWB 3FQWB 1U8KB 4G42B 1KXTA 1UJTA 3UPAA 2XCOA 2VRKA 1F45A 3P4OA 4MHHG 4EUPH 4R84A 1AHWB 5FFLA 2VZ1A 4PGCB 5CGYC 2H32A 1CDJA 2V9QA 5DURD 1ANUA 1NIEA 3NFNA 4EVNA 5ID0A 1KGWA 3FSOA 5GJSL 3N04A 3KWVA 3HN5A 3VFVA 3KGSA 4A2FA 1BIIA 5K39B 4N2GA 2YQGA 2VW7A 3EYFB 4CNIA 1ZTXL 4JRYB 5I30H 1A0QH 1G4RA 3HG3A 1THCA 5JHLL 2Z1KA 1WWWX 1NJ9B 1ZMYA 2ZAHA 3BPCB 4ELKB 1D3CA 3QDJA 4LP8A 1FL5B 1QUPA 4HPYH 4XN4A 1VCAA 5DLMH 1WYJA 4RISH 1NAMB 4URKA 3BZEB 1G7JB 3RX5A 2UUDK 4D0CB 1EK8A 4WI4A 1IKOP 3B7RL 4NZTL 3MTRA 5E5RB 2BOBB 2Y7LA 3UZEA 1OE1A 2JKJA 3CLEH 4PJ7E 1JGLH 2OR8A 2HVJA 1U3HC 5C2BL 3GXPA 3BH9A 4IBLT 3INUL 2RCSH 5FO2A 2ALWA 5GGRA 3QUXC 3GSUB 4RNRB 4WKZB 3T5WA 1AQKL 1OSEA 1IUZA 2DQJL 5JUEL 2DLTA 4MDIB 3GTJA 3S3PA 5DMKA 3FUEA 3GHPA 4YS4A 5HY9B 3EXJA 2IO5A 1RZKC 1FNSL 1VZIA 1Z7JA 2DQUH 4GLRH 3PL6D 4N2HA 3WEXB 3VA2C 4D9RE 5C7XL 4NO5B 1NINA 5KVFE 4GAFB 3TO2B 2X6CA 1E2ZA 2Q76A 3HR6A 2Y5EA 5DC2A 1NWOA 4P5SA 2QPEB 1JI1A 2SODB 3BUBA 2W65B 3EYSL 3MACH 4HIXL 4MJIB 1MHHA 4Z7VF 1SOQA 1PMYA 2A99A 3CPLB 2NSQA 5IVXE 2NY0B 3GTQA 3SCMD 3QWOA 4CGTA 1K4CA 4EIUA 1SYVB 4P2AA 3EW3B 1CD1A 2AJYH 2QSTA 2Z8VC 4NKOB 4S1RH 1IAIL 3QJQB 5D7LA 3G4AA 3DV4A 5DYOA 3MV9D 4PVLA 4Z7QB 2R92K 5MEPB 3VH8A 4AZ8B 5A6MA 4KQ0A 1GKEA 1A66A 1JFHA 1LQBC 1QA9A 4D3CL 3F00A 2BHYA 4XVOA 1FVDB 1M7IB 2AKRB 4WHYG 1A6UH 1K5NA 4ONOA 4B0MM 5C0EB 1BECA 2PO6D 3BPOC 3D2UA 2IXQA 2KI6A 4MLSA 1JPTL 3WNKA 1YSOA 2NY6C 3LH9A 2IDFA 1KC5L 1Q72L 5D72H 1NEZA 4PG9B 5JIKA 1H3PH 1IAKB 4XBPA 2YMXL 3GEHA 1ZS2A 2AK1L 3BESR 2FRGP 4MMZC 4OGXH 5AW2B 4M1DL 2X9ZA 1ESOA 2VDOB 2AEWA 3NJXA 5JA9A 2VKWA 4AJ0A 4M7KH 3ERED 3V8OA 3NFSL 5TDPB 4GW1B 1NCAL 1NFAA 2DYRB 3DUUA 3PL6B 4P2YA 2H9GA 2E8YA 5E94B 2R83A 5C0IA 3WHE1 1TJHH 1C08B 3AS0A 2FO4A 5T5NF 2VDPH 3EGDA 4P5KA 3MRJB 1R3JA 1OTUD 3PQYB 4NIKB 4Z3IA 2E6JA 1ZHNB 4PIBA 4FQIL 1PFOA 1CICD 3GRGA 2K0RA 2WXIA 3PHSA 4WFFE 4AQAA 4DW2H 4GP5B 1I7ZB 2VLJA 3N41B 2X4SB 4TOYH 1SQMA 4PCKA 1DQDL 1INDL 2ZQKA 4GRWF 1KBPA 4P57A 4PB9H 4IGBA 2DMGA 5DTFB 1NCWL 5DYFA 5FGBC 1QNZH 3SDXE 4B96A 2V6UA 4JZJB 5AAPA 1MCOH 4FADA 5FYLH 2IDSA 4XX1G 3UYPB 1PKOA 4PU2A 3HBQA 5DUJA 1TPXC 1UA6L 1J12A 3CDYA 5AOLA 2WLLB 3KW7A 4KHTL 1TT6A 4L8BB 4XMPL 5F7NC 3MUJA 3QZLA 1GGCL 4JMNA 2IH1B 5LBGA 3TEWA 5IQMA 3IMVA 3DWTA 5ANHA 3RY6A 1EX0A 5I15H 1KLGB 4ETQA 5I5IA 1Y1DA 4P3CL 1XH0A 3GBLA 5KZCB 2EO9A 2LAGB 4JHWL 1SHWA 3PQYD 3VXOB 4M5ZL 3C5XA 3GHBH 4LSVH 4D9LH 4OFKA 2FDBP 1ZGLP 1IE5A 3E3QE 5KYYB 3FOEA 1Q9KA 2HUHA 5CD3A 1LEKB 3QHTC 3U0TB 5HHXL 1MN4A 1RJYA 2OJEB 1EEQA 3H6AA 1PF3A 3MNWA 1MW0A 1XR9A 1QATA 5FK9A 1RFDH 1B2WH 3OC8A 5E1IA 4HALA 4PWKA 3OB0H 4ODWB 5F89B 2GSGB 2W0PA 3QEHB 2E7DA 3UBGA 1F41A 3B34A 4QF1B 3AMKA 2Z31D 4YE4H 5GGVH 3CK0L 4G3YH 1L7TH 4JFYB 1JGIA 2XPGA 3EFDH 3QUZA 3WFCL 5L8KB 3ATDA 5F96L 1BXUA 1Y18B 4LPVA 3UP6A 1E30A 2X70B 3QZWB 4X4KA 3HOUC 4FA6A 1WQVT 4NAJA 1DJYA 1LK3L 5SV3A 5GZOD 3U6XA 5ALCL 3SGDI 2E7LA 3LV3B 5IB2A 2XJLA 4KAWX 1HWHB 4DPCX 2WQUA 1U3HD 4UM8B 5E00A 3CFJB 4D7BA 5HD8C 1XB8A 5EFIA 1WFOA 1Z6JT 2FWOB 3AT8A 2WBJB 5C2UB 1AXSB 3HE7B 3FOFA 2ZUUA 3DRQB 3FTXA 3Q2CA 2N1KA 2VDRB 2PXYC 3QJFB 2EYSA 1MPAL 1CF1A 1YUHA 1TQBB 4U6HA 2FEEI 2ZONA 1IC7H 4EBQH 3FU7B 4GQZA 1IM3A 2UZIL 3WJMA 4UT6A 3UIYA 4DP7X 5E1QA 5KVMC 5IQLA 3QAZC 3VXNA 4XVSL 3GTKK 1H9DA 3AFLA 4IMKC 1M7IA 5DRXA 5T1MA 1CTNA 3N85L 3A22A 4J3OD 3HC4L 3FH8A 3BIBX 1D7DA 5BJTA 5D7KD 3GIVB 3GUFA 2Q7AA 1AZBA 1QVOB 4RMRA 1I3RA 2ORBH 3EYOA 5D93C 1WTLA 3ARFA 4LMQE 4Y7NC 4TNVK 4JHAL 1N18A 3ZDYE 1SOKA 3IFOA 2K3TA 4JRXD 4M4RA 4NNXB 2LTQC 3FQ1A 1W0YT 3ISYA 2VLRA 5GS0C 1MJUL 1ZV9A 2YXWA 1ZWIB 3GRWL 3NEOA 4HK0A 4D8PB 5EEUA 3GTMC 4PJ5E 4V1DA 3TWYA 2JKRM 4P2QE 1K4CB 3THML 4OFQA 3BWSA 5TTRA 3BUDA 4ZMLA 3O4OB 1BW8A 2P5WD 3NGBC 3HG1A 1H8NA 4ICWA 3WFBL 1SFOC 3P0YL 2OMVA 3AXLB 1JZ6A 2OK0L 4O00A 4F1ZA 4ZMPA 2XKUA 4OLEA 4PCSA 1DVTA 3BH9B 3UACA 1ETB1 4Y4HC 3DX0A 4PS4L 3W9EA 4LSUL 1BQRA 1O6VA 4EF3A 1MIEH 3CZFA 1BA9A 3CVHH 4P99A 5I1HH 1FNEB 5J56B 3W1ZA 4PJAE 3W0WB 2OK0H 3OAUH 4JFHE 2E6QA 3BUTA 4Z7VE 4NJ9H 2RB8A 3JUZA 2EYTB 2OMZB 3IDIA 1IIKA 3GSRA 4C3JC 3GSWA 2DJSA 1N5AB 1ZLSH 4F33B 1QOKA 4UILH 3PABB 1H15B 1QLEH 4PR5B 3IM1A 4Q14A 1IKFH 4XNXH 2ATAA 1EQRA 4GI6A 1H3XA 4GRLC 4LE8A 3IPEA 3GIZH 4NQCE 1NM4A 4PVMA 7CGTA 5JIQA 3VM5A 1EFWA 1MCSA 3HE6D 3KPSE 3L3IA 1IU1A 2VN4A 3HPJB 4JM0A 2IBGA 4HAFA 5ABDE 4LCWA 4YJZL 2B5IB 4CMMA 4CVZA 3A4FA 3DETC 2DPKA 2HT2C 1MWAB 3DBXB 3U2IA 2LLLA 4MNQD 4ABWA 2OSWA 4YDVA 4C4BA 4LL1A 3TT3L 3D85D 4HIEA 1S5IH 1V7ML 2OMWA 4Z7QF 4QHMA 5TGBB 5K9KA 1UWYA 4PGCA 4PTTB 2UZIH 3ATEA 4OIIH 3N1MC 1AI1L 1T66D 2PPEA 4FEIA 2DMHA 4H8WC 4I1PA 3EHBC 2VLLA 1JZJA 5IP7C 4WI0B 1KXTB 1OK8A 5EA0L 5GGQH 3DBSA 3VXPB 2RQEA 1I1AD 5EIIB 4FJYA 5IVNA 4U2ZA 1IX2A 4ZSOE 4RGMC 1FRGL 4FN0A 5J1SC 2ZXGA 3TOPA 1T5XA 1N10A 2WXLA 3ARDC 1L3WA 4KMQA 3WAKA 5I1EH 5GS0H 4HX1B 3QC6X 4Q2ZB 2X88A 1QEWA 3BWUF 3T65B 4NKMB 3VG0H 4PJGA 3FRUA 3ECUA 3WXVH 3MDJA 5BQ7A 2GT9A 4I3RH 5BUPA 4NPYB 3MV11 4KMAA 4XX5A 2Z7ZA 3O2VH 5GRJL 3ARBA 1ZGLM 2HJLB 5D7IF 2DYPB 3D25B 4U4IA 2QLYA 1PLGL 2VQTA 2IAMC 3DDGA 1UXWA 4OI8A 5C0CE 4HHWA 2JH2A 4KTDH 4LOUD 4OFDA 3L3OA 3KAAA 3ZQWA 3GNML 4JG1H 1YNTF 4G7HA 2VW6A 1XXFC 5CF3A 5D2LB 4ALAH 5INDA 3SGJA 4GO8A 1R9FA 3L4XA 3QXWA 3EOBA 2QLVB 3HZKB 5F8QC 1TR7A 3MRQB 3U2SA 2CZNA 3LDBB 2W88A 5BVPH 2R7EB 4HUUB 1W72B 5AAMC 1KB9J 1UWGH 4J12A 3QUHA 4X8JA 4C55A 2DQEL 3PUCA 3LXBA 1C16A 2GC4C 1XGUB 5DS8B 3S4SA 5HHPA 1U6AH 3H2WA 4JO1H 2L04A 2I69A 4S1SL 5DD3L 4B9CA 1U4FA 4P23A 2YUXA 1OK0A 3VWJC 4HWNA 4Y4HB 1E5UI 4YZWA 5SWQB 1WEJL 2OR7A 2V2WB 3ZKSD 5H94B 3EDDA 43CAA 1GHFH 1M05A 2B7DT 2H0PA 5AL0A 5KJ7E 2F08A 1MI5B 2WYHA 2Y4SA 3B7YA 1M42A 1CG9B 1A4KA 2QZ5A 2Y0SD 4LAQL 4CMHB 5C4JC 4KMTL 4IGBB 4FQHA 5DTFA 2ARJQ 5E5MA 4FTVE 2BSSB 1VERA 1XGQB 1AKJA 3BSZH 4X8JB 5EZIL 4JFED 1LDPH 1FNEA 2MKWA 5I8OH 5J11B 2P52A 4P3WA 2I60H 4W9DC 1WAAF 1FH5H 1KTLA 3SZKC 1WO2A 5DDHB 3B2XA 4M6OH 3U82B 5F1NA 1PLGH 3TVMA 1URIA 3ILEA 3QFDA 3X1NA 3IDMA 3ZE2B 1SVCP 2EE3A 4X6EA 4MTMA 4Y5VA 4P8QA 4JANA 4GAGL 5E94A 1VGKA 3ULSA 2DV6A 4ZG1A 4W4NA 1U8LB 4LDCA 4QIRA 5K69A 1TWGC 2K8MA 4LT7A 2JB6B 2WNXA 5H37A 2Q6WB 2ENSA 3BUEA 1E5ZA 4I3RL 2FH6A 4JFWA 4JRXB 4J1UA 5EEWA 3LIZA 1HI6A 2AQPA 1FFNB 5C97A 1JMXA 5C0GA 4OLXL 4FHJA 4MHHI 4XWGH 1FZKB 5I73C 4P46D 1YY8B 3LN9A 1UENA 5I26A 1WHOA 1EH1A 2X1QA 1ZPLA 3RWJB 5T8IA 4ZUSA 3MGAA 5HGHA 2NSMA 4JPIA 2PUQT 4AK1A 4XMKH 2XU9A 1CI5A 1QSFA 4L1LA 1WBXA 2BC4A 5IHBA 1UXSA 4KQ4H 1WCQA 2FLRT 3ZL1A 5GGQL 4IJTA 5BJTB 3BQUB 3KM1A 1MCFA 1WQFA 4AIEA 2XV2A 1Z9SB 5EO0B 1DVXA 4OT1L 5EUOE 2DB8A 4AYEC 5EZLB 5JQ6L 1CICB 1N3NA 3ZE1B 3TA3D 3LKQB 5I1DA 3DUSA 1JYWA 4ZTOH 2EEDA 2VLME 5IMKB 2ATKA 5D7JA 3W5MA 3B2MA 3QDAA 3H3BC 3TN0A 5F9OL 4F8QA 5FF6B 1R3IH 4O58H 1IW7A 1X7TA 4JREC 4M8RA 4AQEB 1F3RB 5B1JA 2LV4A 3Q43A 1FL3B 2CLRA 4UQEA 3TBSB 2V5TA 2XA8L 3MRRB 4KC3B 4MB1A 4RFEB 2NXZC 5EZIH 3H9SB 3R8BB 1J88A 3S2HC 3E6FA 3A3YB 4PJ7B 1FYTA 4PJFF 4HGWA 1U2CA 3UGXA 5JHBA 3KBPA 4PTUA 1AS8A 1UOLA 4WFHE 3HUJA 1QSFB 4LCCC 3UTSB 3UBXA 3JTSA 4JFXA 2PYEA 4UOJA 3REVA 4C8XA 1TXKA 5AYTA 3T4AC 1UM5L 2GBVA 1KN4H 1CF8L 2YAEA 3NAAL 1PSKL 2YKLH 2V7NA 4DO5A 1CI3M 2HWZL 4N5ED 1YO4A 3QJHA 3W9EB 3GS7A 3L5JA 1PZDA 2NOYA 2B5IC 3FF8A 3RUGA 1IQ0A 4PJEF 1KFAL 4OQTH 4LEXH 4MJIE 5C0CB 4XXDA 2E2IC 3MV9B 4N8CH 1XVSA 5IROA 1I8LA 4PV8B 2EYTA 2OMZA 4QHNB 4H0HB 3CN4A 2FECL 4LLWB 4NNPH 1TYRA 2GJRA 1HHHA 1YPZA 2E2JK 3V4UH 5AAWC 5JYMA 1AC6A 4GTBA 1RURL 3UAEA 4B5ZA 3I4MK 2VL5B 3CHQA 1A4JA 3N0CA 2HT4C 3T4AB 1JBJA 2G75B 1KTBA 2VITB 4JZJC 1DSWA 2HLAA 5JW4M 2GSMB 4QLRA 3OAYH 1P4BL 1WQHA 2AJ3A 4TUOA 3VRJB 2A4ZA 5AVUB 4PJAF 2UXGA 1A64A 5TE4H 3ME0B 4IHOB 4KTDL 3U4EB 2A69A 5E5MB 4MX7B 4WHCA 1UCBH 4AIXA 1ZA6B 4TSBH 5CHPA 3P54A 3T04D 3FU6A 3MXWH 4ZO9A 3BWZA 1XF3A 4OCLC 1YJDC 2XWBB 4JY4B 1YEEL 5T1LB 43CAB 2LE9A 3RZCA 2UWEB 5EOCL 1MI5E 3TFBA 4Y8AA 3KDMB 4F9LC 2J8HA 2DS4A 1AMXA 5I8CA 4NHUB 1DJGA 2WXOA 3C09C 5HVHB 3T3MF 5JOEA 3HC4H 4NZJA 2R2BA 1K8IA 2W92A 4L4VD 5CNHA 4KZEH 3H42H 1G7HB 2Y9RT 2QVIA 2WVUA 4ZUUA 4ONGL 3FQXA 5EORL 2K6ZA 3SD2A 3VD0A 4ZTPH 3GD1C 3GTOK 4LHJB 4YFXA 2H26A 4Q89A 4DERA 3HVNA 2K4AA 3IDXH 4KNTA 4MCYA 2VIRA 3H3KA 4PVNA 2XC8A 3FQYA 3VI4F 3GNMH 1CYXA 4HF5H 3FYIB 3WTWA 1T89A 2VZOA 5EA0H 4FABL 4MNGA 5E6ZA 1P7KA 4BUHA 3IWUA 2V8MA 1RPKA 4C58B 4TYUA 4M61B 2GJZB 1P2CB 4O4YH 4XCCL 4C83B 1U8MB 5I8KL 4OIPA 1ORQB 5GS0D 4MASA 4GO6B 4YK4B 4Z18A 4GQ9H 5DJ0B 5DRWA 2APWA 5SX5H 1IQDB 3ARBB 3FTGA 5DD6A 2BVPA 1NIFA 2F53B 2YN3A 3CBKB 3MX0A 4I89A 4ZODA 5A2LH 1NEZB 5DJ8A 4BA0A 5IREA 2D3LA 1K2DB 3QUZB 2BY2A 5IBUB 4JL2A 4YDZA 3QZWG 5MEQB 4GG6A 1TQBC 2IAAC 2R1WA 3FO9A 5A3IC 3P9LB 4JVPA 4XGZA 1NKOA 1IGIL 1CLYL 2PXYB 4W6YB 1L7TL 1CFSB 4JRYD 1GR7A 1NOAA 1HX0A 3QDGA 1N2RB 3JWDC 1NC4A 1DN0A 2X70A 3QZWA 5D5MF 1NGZB 4HT1H 5IBTL 4R3SA 4TVPH 3K1KC 2EVFA 4LCIH 3EUUA 4FL4B 3QPQD 4FXLA 4ZXBD 1BBDL 2R59A 3TO4C 5ELIA 4YHMH 1N68A 1ZQ1C 3VA7A 2R0ZH 5FYKH 4BLAA 3MJ6A 5AG8A 1RURH 5D71H 3V6OA 4ONGH 4BK5C 2EXTA 5C44K 1GE9A 2WBXA 4M6NH 3HAEH 4O2FB 4ECNA 3BKYH 4IBZA 4TM9A 5FYLE 5FK9B 2CGRH 3BLPX 5T5FH 5J9PA 3TGXA 1T1WB 4PG2C 4OCRH 1MRDH 1JK9A 3LIZL 4FNTA 2H47C 3G6AB 3HI5L 3NYKA 1SQ2N 3PHOA 1R6VA 2O4EA 4PGEB 4X5PA 2ADIB 3BAYA 4HHAB 5DK2B 2C3WA 1CVSC 2WBJD 1N0LA 1KGIA 3KE0A 2YD8A 4PRPE 2G4EA 4XC3H 5B38A 1DSYA 4JQXA 4PHZA 3GBDA 3NUHA 3UTSE 3RI5F 2C7UB 3V6ZA 1ZCRA 1UCBL 2B3RA 4L3AA 3HRZB 4QKTA 1SMDA 2HVJB 1K5WA 3B43A 4PS8A 1GAFH 3FUIA 2EZ0D 3MR9A 4UB0L 1FLRH 4I13B 3TNMB 2H5UA 3DTXB 3IDNA 1MIML 5HDLA 5KUKA 2WZ0A 3L3HA 3R4RA 1GIGH 4OB5H 3WIHH 4Q74A 3VSUA 3ZMNA 5FO8B 2LW3A 3ECVA 5C0IB 4XMZA 4DGWC 2XKSA 3T4YA 1SM3H 3X12A 4LSUH 1OVZA 4PS4H 4ZYKB 1OB1A 4M6AA 1XH2A 5E8DL 3IJEB 3WHXB 4HWBH 3NDZE 1E67A 4I2XE 4NN6B 4PJHA 4M7KL 4XCEB 5I2IB 2DQHL 2MCAA 3TH2T 5FO9B 3V52H 4GSDH 5JQ6H 1AFVL 5C0AB 3D0LA 2Z8SA 1VSCA 3HZYA 1TOXA 1QQDB 2N1TE 5F9AC 3VE0B 5DEGB 2AK1H 3FHAA 3GRWH 5JW4Q 3U30B 2AXHA 5IYDK 5C9JB 5K93A 3ZDYB 4H0IA 2NVXK 4BFNA 4UNVA 3LQZB 3AVEA 1BBJA 1IGTB 2RFXB 1HXMA 3GDBA 5E2JA 3MAWA 2AJZB 3IN2A 4KFMA 3ALPA 1R0AH 4GW4B 3VFTA 2NTFA 5KSBB 4PRIE 1IEHA 2GSNA 3MV7B 5I16B 2QPDB 3AY2A 4F7CA 5M5YK 2OM5A 5I82A 5KVFH 1FNHA 3EJPA 3GSVB 1QFUL 1CICC 3L4JA 2QHLA 3WJMB 4IKJA 4BGDA 2BJMH 1HZHL 3PWJB 3KLHD 4IOIA 5FIEA 4H8HA 4MXQD 4OLZH 2ZUTA 5IB4B 1PEWA 2VXVL 3BJ91 1JPST 2XTJE 4ANUA 2F6AA 2VR4A 4JY6A 3QCTH 1PJ6A 3I84A 2WKGA 1T4WA 4NNYB 3WKQA 5D4DA 5C6TL 4LQFH 2R56H 1T7ZA 3D2TA 3QXUA 5CILL 3G5VB 4C4UA 4PPTA 5JDSA 3S2CA 4FLSA 1H9VA 3BKCL 2GBTA 2J88L 3EO1B 3UTTB 1SBSH 3KH4A 3VXMD 3K2MC 5I0ZA 1KPUA 3QIUD 1PD1A 2WXGA 2D7PA 1C8QA 3CFNA 4HWZB 1WS7A 3ZKMC 2F7QA 4XI5C 3ZQ9A 1N12A 1QAWA 4ZS7L 4Q0XL 4U1GB 3A47A 1GGBH 3S5LA 4U1HB 3L9RA 5KSAA 4FTDA 4BK8A 3L1EA 3RWCB 2MSPA 3I4NK 5HDQL 3Q8BA 2PW2A 1BJ8A 1BQ5A 1F3JB 1MOEA 2Y69B 3PXJA 2V7HA 5DVPA 2EO1A 3KVDD 1F1AA 1WIUA 1XZ0A 3Q1EA 4ANWA 2E2HK 2J55A 4KX9A 4FTVD 3MCYA 4NDMA 4X5LA 1JHLH 4UCFA 1P84K 3FT4B 4X7CC 3UBFA 1AY1H 3MREB 4M5TA 4WEBL 5FB8B 4MWFB 1NUGA 1SRDA 5DQDL 1LJMA 2J71A 1A65A 2A9BA 4NQDA 5LXVA 3EZ8A 4HLZG 5EWIH 1E43A 4XO4A 1T7YA 1E27A 3T3PF 5I74C 3NCEB 1QNZL 1G43A 1H3WM 2CLZA 2O6EA 1ACZA 2BFVH 3R06A 4P46C 1P4BH 1D5XA 1BHGA 1MW3A 4J8RA 3WY3A 2YRLA 4IHOA 3U4EA 2BP8A 1HHIA 4JEGB 3VAEA 1MZYA 5E7FA 2EIDA 4L3CA 1UYWH 2WC7A 2XQYG 1AD0B 1E6OH 5DK0A 5CIPA 3P9WB 4QHLA 4J4PD 5HGAA 4ZSOB 3IMBA 4JM4L 3PE9A 5ALBL 2HJLA 5C0NC 4FFVD 2AXWA 4CW1B 3LS4H 1GGUA 1ZHLB 5KYYA 2FQDA 1JWMB 5IYBC 4L0PB 3GXIA 2Z4TA 3QFJA 2OMTA 4QRPA 3N0PB 3RDJA 3LN4B 4M1GL 4R2GD 1PAMA 5DHEA 4GUPB 4LSQL 4YHNA 3SO3C 1MCPL 5IP9C 3GI8H 4I0PA 3IWVA 3PJLA 4XWOD 4BYHA 3J8F7 4R96B 1QEWB 1CF8H 2M1KA 3HAEA 1JPGB 5GGSB 4OGXL 4CKVX 1HILB 1L9OA 1REIA 4S1DD 1BS2A 1C5DB 2XFXB 5IMOA 4NKQB 4H8WL 5JZ7D 3KYOA 3OXSB 4ZNEE 4BXXC 3CG8A 4MA3A 5IHHA 1Z3GL 4XTRC 3WY2A 4G9FA 4F8PA 1ZHKA 1FL3A 4ZS7H 1Z1WA 5DZJA 5MERA 1Y6NR 4TLSA 5AVXB 3VFSA 4YAQA 5BW7A 1CK0H 1ZIAA 2KYIA 5K1JA 4AGLA 3BQUC 1U3YA 3M4OK 1X5HA 2W9DL 1HINL 2A9MH 2MQ3A 2M2DA 4M61A 1MFAL 5C71A 4WY7L 5I9QC 2JA7C 2X2JA 3BKCH 2H32H 4H7VA 1NLDL 4PBDA 4Q6IA 3RTLA 4KJQD 5DS2A 9PCYA 1D5IL 5C07E 3WNNA 1BG1A 3F12A 4HLEA 4OI7A 2DF3A 1ZANL 3MRGB 2ENYA 4MRBA 4XPTH 4H88L 1KYAA 1BPLB 1HQRB 2P5PA 5H2BA 4A3MC 4LLDB 2XQYA 3QI9A 2R1YB 3EF7A 3MOAL 1R1CA 1EFXB 4AEHL 3HS8A 4A2LA 5BUGA 3KBFA 5T3XD 1R3LA 3FQTA 1LO2L 4ANVA 3P2DA 3HOWK 2D7QA 4LSDA 4Z7UE 4G7SB 4KPHL 2FJHB 1U3ZA 4ZOBA 5IW1A 4GW4A 4X7SH 3VFTB 1MCBA 1ZVSA 5HYSA 1QRKA 2CDEB 4ODXB 2ZOWA 2GSUA 3MJ7B 1OP3H 5IOSA 1DJZA 5J12B 4AZ8A 1FYTD 4DAGL 3KPRA 2B2XH 4A3DC 3OKYA 5KSBE 1J9TA 1XF3B 3RB7A 4A55A 5F6IB 1QX1A 4KNSA 2HA1A 4XNXL 4F2MB 3NIFE 3GZOA 5FOJA 4D3CH 1TQUA 4Z7VA 3BUIA 5C2BH 5DHMC 1FIEA 2VDQB 2UXFA 2E9JA 1SDYA 1WIOA 1BDYA 4UV4L 4FFZA 5F72S 1S5IL 5DA0B 1NBVH 2A9NL 3TA3A 4MVBC 1RJCA 3EJYD 4HVBA 1N5AA 1QSZA 1A1NA 3C75A 4Y16C 3S96A 2LLGA 5CZXD 2SEBA 3RX7A 3MACL 3VD3A 3CFEB 1F11B 4JB9L 5KVGH 1F56A 2D0GA 3L3KB 2JWYA 3OJVC 3GB7B 1A3LH 4HUKB 2ENQA 3KR3L 4E5XA 5CEZD 5CJOL 5T3XH 2QQLL 4JFFE 3V8CA 5DVNA 2GK0B 1XZWA 1XTMA 3WIFA 1CDYA 4O9HH 4ANXA 4WW2A 4QWWD 2K4WA 5SWSA 3QUYB 1AGFB 4L3EB 2V2WA 3RZOC 1E42A 5BOPA 2W0KA 1S78D 3INUH 2YAQA 1L9QA 2YSSB 1NCIA 3GMLA 4KRPD 4LAQH 1BVLB 4WHYH 4XBGB 3Q6GH 4XB3A 5INCA 5TDOB 1JGLL 2G3ZA 3K6SA 3A8JA 5IB5B 3OKDA 1UM4H 5T3ZH 2HX8A 2CO4A 4YDMA 3BP7A 2IDQA 4WF7A 3UDWA 3TA3B 3IDGA 1DANU 4J3VA 4YQXH 5FDWB 4XP6H 3OAUL 4FFZL 3MLTB 1B4LA 2Y3AA 4Y4KB 4RFOL 2XSKA 5CJQH 2B63K 4NBXB 1DUZB 4NQXA 1KPRB 2IANA 2J2ZB 3EFFA 1JJUA 4Z7UA 2A83A 2X1PA 4JO3L 4XN1A 1BD2D 3IFNH 3I3BA 4HC1H 3T2QA 3R0MA 2FBJH 3CUPA 4FMVA 2NVXC 3LEVH 2L7EA 3MLYL 3B9AA 3MHZA 5J6HB 5JDJA 4YFDB 2Z34A 4R97B 3FONA 2BOCB 1DJHA 1UWFA 1UA3A 5I1DB 4NQSB 5KSUA 5CMAB 3VFNA 1PQZA 2R7EA 5KVDL 1PDKB 4AM0A 4MD4B 3LN5A 4FQJL 1J8HA 2IALA 3T9WA 4B3VA 4L5FH 4MXVF 3RGVD 2NY6B 5HDOA 3H9SE 5I0VA 3WD5L 4FCAA 4L1DA 2C9UA 4K9EH 4Y1AD 3CIQA 1PBYA 5A16A 3CXDH 4AVJA 4MVBD 1X7QB 1AOZA 1KGCD 2FX8L 1F9NA 2DEWX 2ITDA 2PF6A 4YAQB 5IP4A 5LB1A 3G5XA 2JCCF 3HG2A 4MLIA 3HNTH 1XL6A 1X9RA 1QFWH 3NJIA 5F7EH 2FQFA 2DI9A 4ZQTA 1TTUA 5DT1H 5F3FA 5D7EA 2HTLD 2YU9A 1LP9B 1U8IA 3SEPA 3MV9E 4GFTB 1EJOL 1LP9A 4QF1A 4EIBA 3NZ8B 4LL4A 1BIHA 3IJYA 1X6LA 1OL0A 4KAQH 2AK4E 2E7MA 3ERXA 5AD0A 3JYBA 1A14L 3ZHFA 4YUEL 5FGSA 5LUMA 2HVKA 3VFUB 1XHHA 4AXWB 3HG5A 1QI3A 3VI3B 1ZHLA 1KOAA 4W9EC 2YAHA 2OX5A 2GY7B 4JFTA 3NRQA 5T1KD 1UZ6E 2OXHB 4QYOA 2DQTL 4ERSH 4WDIA 1VEMA 4QRSA 1DQLH 2L7JA 3D39A 3S37H 4Q58C 5J3HD 4UDUA 3BN3B 1JWSA 2OZNA 1ZJAA 3O8XA 1F7UA 4YSSA 4MQ7A 3OGOE 5DFTA 5IORA 1MCWM 3S98A 1HIML 3QCUL 4AYDC 1E27B 1FNGB 4PJ5A 2NVQK 4JJHA 4KJQC 1DUYB 2C3VB 4BSJA 5JORA 3L3JA 4X5RA 32C2A 5IQ7L 5FUZH 6FABH 2UXTA 1UB6A 3O8XD 2NY7L 4Q6YA 3MLPA 1DDHA 3WFDL 3VA6A 3L2NA 2QV4A 5DWUL 4UT6L 4HK3J 5KTEL 1GH7A 4F2ME 3NIFB 4GI8A 1M71B 2ESVE 1IV8A 2R39A 2VE6B 1RKRA 1B3JA 1UM6H 5G2NA 2DWSA 4YXKL 3HMXL 4S1DC 4Y9BA 3U0PA 4M62H 1YEJL 3EO0A 3L9RB 4J6RL 3OBAA 4W93A 2BXYA 3QXDB 4G80B 1HSBB 2HAZA 4HIJB 1K9TA 2HRHA 2CJUH 1XF1A 3CFUA 4HDIB 4QXVA 4J7RA 3L5XL 4Z23A 2ADGA 3MYJA 1MJ8H 1YQ2A 5LWYL 2EDLA 1CUOA 3R0NA 4U6XA 5BRQA 5F7BA 3VQ2C 3VXRB 3PP3K 5GJTH 4DZ8B 4E0RA 2Z31C 5HYQA 3EJSA 4O02H 2FIKA 1PCSA 3OF6D 3ETBJ 2JE8A 1U33A 3GGWA 3VUAA 3ILQD 2GABA 3ABLB 4Y2OB 3T8XB 3NJNA 1A02N 5E51A 4RRPG 4GRWH 2FL5A 4A3LK 4Y1AA 4Y7NK 4NPYA 4URTB 3QDME 4AV4A 1I8KA 2PCFA 4Q9CA 4PY8I 1QSED 2P8PA 1GYAA 5DS1A 4HS3A 4HSQA 4G9DA 1T83A 4KKBC 5E9DD 1KTJA 4HW6A 1I9JL 1AGEA 3HKZA 1F6LL 5ID1A 1TWGK 3U4BH 1KGJA 1P5UA 3CZEA 4PB0H 3SPJA 4LNRA 5AUMB 4OFVA 2WN2A 3MA7B 1OO2A 3O2DL 2Y5TB 4WWKA 3GDZA 4N2FA 5EU5A 4Z7AA 4QRRA 1LE5A 2ED6A 2VDOH 2JF1A 2BSDA 3UC2A 4EQ3A 1U36A 3CN2A 3O45B 3W11C 5IIEB 1CYWA 1G4MA 2KZWA 1M56B 4I18B 3SKMB 3MV01 4BM7A 1JZDC 3CDGA 3AUWB 3LRHA 2NVQC 2GAGC 15C8L 1IAII 1S7UA 2PPAA 3E2HC 5EU3B 1JL8A 4EDWH 1IKNC 5E8PB 1ZVSB 5JA8B 1MWAL 2WINA 2F8XC 3BRFA 2WXNA 4DK6A 1TCRB 4DHLA 3NMEA 1CD1B 4NKOA 3FB6A 3HC0A 2VLRD 1G9NH 4C3JK 4IKLA 5ERWB 1Q72H 1M6OB 4NO2A 3S15K 2Z91A 4WKZA 2NW2A 3BFWA 1SFDA 2X1WL 2AGJL 3RUGE 4Y52C 3GTGA 4UT9A 5HGBA 3KLHC 1OT2A 4OQ1A 3X11A 2YXFA 2E74C 4FULA 2J56A 3KYNB 3QK0A 1C0AA 1F6AA 5BV7B 5D2NC 1BAFL 4ZMVA 3OVUB 3QQ9D 4PJHF 1D7BA 2MIZA 4H2AA 5E00B 4JZNA 1JI2A 4A1RA 4NCDA 2XJKA 3LV3A 5IB2B 3LN4A 4RDQF 1XL4A 4YO0A 5T33L 1TWHA 4FHBD 2DKSA 3JT0A 3L1FA 1QFOA 3KYOB 3SDDB 2ED7A 2I9LB 2QTVA 4PW4A 2QGCA 2ZCZA 3IDYB 5FYJH 5C0DB 4FNQA 4MQ9A 2OI9B 1MJJB 5J9PB 1E4JA 3V5DA 1X3DA 5LNGA 4NX0A 3BAEH 4XN5A 4KBPA 5GISH 2W07A 2A77L 4GRWE 1N0LB 2ODIA 4I0CC 6FABL 4G7ZA 1KTKE 3GRBA 2VUMC 5JORB 1DLHB 2ZICA 1OAKH 3MBEC 2C9AA 2NRDA 4RMBA 5JIHA 3QNYA 4B0MB 3MRMB 4M43H 4KY1L 4NZUH 4U1MA 2ZUEA 1KYFA 4K3DH 1S7WA 4OV5B 1F2QA 1U4EA 1U6AL 4JO1L 4Z7IA 3I6GB