4ILDA

Crystal structure of truncated bovine viral diarrhea virus 1 e2 envelope protein
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
241
structure length
235
Chain Sequence
DVVEMDDNFEFGLCPCDAKPIVRGKFNTTLLNGPAFQMVCPIGWTGTVSCTSFNMDTLATTVVRTYRRSKPFPHRQGCITQKNLGEDLHNCILGGNWTCVPGDQLLYKGGSIESCKWCGYQFKESEGLPHYPIGKCKLENETGYRLVDSTSCNREGVAIVPQGTLKCKIGKTTVQVIAMDTKLGPMPCRPYEIISSTACTFNYTKTLKNKYFEPRDSYFQQYMLKGEYQYWFDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of glycoprotein E2 from bovine viral diarrhea virus.
pubmed doi rcsb
molecule keywords Envelope glycoprotein E2
molecule tags Viral protein
source organism Bovine viral diarrhea virus 1-nadl
total genus 38
structure length 235
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-12-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3000 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ildA01
3.30.1360.280 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4ildA03
2YQ3A 2YQ2A 4ILDA
chains in the Genus database with same CATH superfamily
4EIBA 3LAFA 1OEZW 1QI5A 3CFKA 1T6WA 1DVUA 1NMBH 2EDOA 2WB7A 4C56A 3NT0A 1ZE3H 2V4LA 2BOLA 2JA7K 1OAUH 1AMXA 3RIFF 3VM7A 1X5GA 4Y4FD 4RMVA 2WCGA 4CN4A 4KVCL 5CJQL 2WINA 1I8KA 2XWXA 2IWGA 2OL3H 3ZKMD 2J6WA 4Y5YA 1Z5LA 5DMKA 1JCKA 1MIEL 3JQOB 2NY1D 3B6SB 4TMPA 1DLHB 2CU9A 5IUCA 4BXSV 2G2PA 3KJ4C 3MODH 4FQCL 2XICA 2J7LA 4TULL 1MWAA 1GGBL 3FRUA 4K73A 5JHDD 4MD0A 3GRWL 4FA6A 3TBWB 5I5RA 1BEYH 1KIUA 4IK6A 5T1MB 3GSVA 4LEXH 4WSGA 3PGCB 5TDOB 2EEXA 1PYWA 2Z31A 1OQOA 4TS6A 1RZFH 2BNUA 1X6NA 4KRMB 2WN3A 3FSWA 1QO3B 2Q87A 4ZW3A 1VJSA 2R0WL 1KDJA 4P3DB 1FIGL 2A0LC 2F74B 4GP4B 2JA5A 2DLEA 1AKJB 1UM4L 3QIBC 1NL0L 2N7SA 3V8CA 3NCMA 1ZLUK 3OXRA 2WVSA 5T3XD 3R8QA 1B2YA 1XGPA 4FTVB 3BZ5A 3RTLA 3TZVA 4M1DL 4D3CH 3NIDE 1E4HA 3FFCA 4PJ5B 4AQ1C 4Q4IA 4HOMA 2ZXDA 4ODHH 1YAIA 1DUYA 1H3WM 1P84K 1YNKH 2ZCZA 1CCZA 4QRTB 4NKOB 3D50A 1K8IB 3TFHA 1QFUL 4LAJH 4AYGA 4HZAA 3GBDA 5C6TH 2X70B 5D70H 1URZA 4J1UB 4MJ6A 1PG7H 3HZMB 2W9EL 3RBGA 3PS6A 1FP5A 2BJML 2HUHA 1UCBL 3ARUA 3EH5B 3CDFA 3IETA 3E9TA 1FDLL 4KI5F 5E5UB 3CLWA 3U1SH 3O4LE 1HT6A 4CU6A 3VXNA 4Q52A 4H5SB 1RUAL 2R7EA 3C5SB 5DZ9A 2LU5A 4MCYA 1ZANH 3O3BA 4TL5A 2E3VA 1EHNA 1P9MC 4ZO6A 3CN1A 3S1NK 5MEPA 1YUHA 1U92A 3L7FB 2V3DA 1HYRC 4NN6B 1AO7B 4NO5A 4Z95L 3IDNB 1FRGH 4EN3A 1J1XH 3PABA 2MOQA 2CRYA 2KDYA 1XF2B 1ZCRA 5DS8B 43CAB 1X5LA 4L29B 4XPHL 3HI1B 1OK8A 4G8IB 4LKXA 3GZQA 1Q0YH 3II2A 3VXSE 3QR2A 3N06B 4R7NA 4J23A 4UB0H 2C3VA 1E4WL 5HPMA 2FEDC 1OAXL 2HRPH 3SCMA 1KB9J 4F7EB 4FA8A 1I8MA 1A6ZA 1UD6A 3MBXL 4KH2A 3BISA 5J8OA 1AZRA 3FQNA 2BSDA 2J12B 4M7KH 3FTGA 3S3JA 5L4FA 4NCC1 5IJDC 4A63A 1U42A 1P1ZB 3TBTA 5BS0A 2BY2A 2X3CA 2R2HB 1UJ3A 2BP5M 4HUVB 3GTGK 3IFPB 1VGXA 1BXAA 1ZK9A 3MA9H 3OLGA 4XNYL 5FYJE 2EVFA 3VD4A 2X6AA 2B20A 3S36X 1DQDL 1QSVA 1M05B 5ESVA 1LO2L 1DZBA 1Y18A 1J9RA 3HN5A 4XCFL 5T3ZE 1MFVA 1UXWB 2LV4A 5M7QA 4WSJA 4HCIA 4LP8A 4ABUA 1C16A 2ILLA 3ZYIA 3MRCB 1ICTA 3VXUA 1I85A 3FC8A 2CKBB 4PAZA 3T6WA 5T1DL 3C2AL 3MV8B 4OZIF 1S7UB 3IYLW 3TLRA 1NCIA 3GTMA 1JRHL 4XVJL 1N6VA 1DCEA 3QK0A 2BDNL 2YRPA 4HSAC 4ES8A 4GTFA 3CZFA 1YQ2A 2Q8BL 3LKNA 1A1NA 2YPLA 1U58A 3IFNH 1BIIA 2NUTB 4UILL 5LG1A 5I9QB 1R3LB 1GMEA 4YDMA 1Y7VA 3WE1A 1TNNA 2N1KA 3SKNA 4B9PA 3A4DA 3FONA 3U4KA 3IXAA 3D33A 3ZIYA 4KJPD 1ZJBA 5LN8A 2X9WA 1D6EB 5D2LA 1FPTL 3MRPA 4UNIA 5I16B 1OD9A 5GJTH 5DVKA 5B7MA 3LHAA 2O72A 3U7YL 1DFXA 3AAZA 5I76B 1HOEA 2FRGP 3HJEA 2CDFA 5F7WC 1C12A 3K2UL 1MHCA 4YHML 4Y5VA 5BRQA 4NYLA 2HKFL 2HYMA 4HXAH 1G87A 4RMBA 3SBWC 2F54E 3FRPA 3ZBMA 5IWLA 1IU1A 3OKNB 1TCMA 1YEGH 4LRIA 1GSMA 2DL2A 3KYOB 4LCWB 5F21B 5H37A 4X7EC 2BIQA 3PWUB 5D7IE 5LBSH 4ELMA 5IV2B 3WHE0 3GK8L 1FGVL 3FFDB 2XZCH 1TTCA 6TAAA 1O9VA 4HGKC 4JFXA 5E6ID 1QR1A 4YZWA 1XGTB 2CGYA 4F8LA 5IFHL 3K8MA 4M6NH 4F80A 4IMLA 1N64H 3VFPA 5KSBE 2IANE 2R4RH 3FCUB 4L5FE 5KJRL 2F58L 5FKAA 3SQRA 4IHOA 4KDTA 1MVUA 4JRXE 3SPCA 4HS3A 2GVYA 4CC4C 5BRZB 3RDTD 1QABA 2M2DA 4X6DF 3NIFE 5D1QE 1U93A 2CO1A 4QRAA 2DD8H 3ZE2E 1C9SA 4KHTH 2BSED 4S1DD 2GI7A 1F02I 1HEZA 1OB0A 5DD1H 4YHPB 4Y16C 4YSEA 1X5KA 1I7RB 4KB2A 1EUTA 2G0LA 1DLHA 5K9JL 3T01A 1A1OB 1VFAA 2W80C 3QE5A 5T1LD 2WXFA 4LNVA 1Z3GL 1EXUA 3EFOB 5CGYC 2O61A 4D9RE 3FN0L 1MCPH 1JG9A 4ACPA 3OZ9L 1F6LL 3D3VD 1IE5A 2O5ZH 3JTSA 5E5MA 4KHXH 2QSVA 2EO9A 3QW9A 1RVFH 4MAZA 4B50A 4KVNH 1UXSA 1KJMA 1EUUA 1IGYB 2YGQA 1N26A 3B4NA 3HZYA 1I1YA 4HHGA 4KY2A 3C6LB 3UYPA 1TVHA 1AKJA 1KWKA 5GQBA 2J2ZB 4G9FB 2NY0D 3M7FB 2VLJB 2EDNA 4Z7NE 4F5CA 5D2NB 1UFUA 3IFLH 3L17A 3ILDA 4LVEA 4DGIH 3NYKA 4G6ML 1WVZA 3O0RL 2BSRA 4L2LA 4PYHA 3HUJF 4KGJA 4BSJA 1QATA 3DOSA 2XN9D 2EE9A 4N8CL 3MRIB 1NMAH 3T0EC 2AXGA 2CW0A 2JNZA 4UIMB 2Y6SD 2A6HA 5ENWB 1NCTA 3ULSA 2HKAA 3UZVB 4X42A 4I2XA 3V55A 3WKYA 3QWOA 3T0EE 4NZRL 4BZ1H 4ZSOA 5AOMA 2H2SD 1P6FA 1RIVH 4NKQB 4J1UA 2ZG2A 1OCWL 2DKSA 5D96C 4MMYB 3B3IB 2DQGL 4IHBA 2XTSA 3O2DL 1MREH 3L95B 1U3NA 4MXVE 3MPCA 1EBPA 4AUUA 4DO4A 3ARGC 3NZSA 1E30A 4U1HA 1KZYA 2FATL 4TRPH 1QZ1A 4W6YB 3NACL 2AQPA 1ACXA 2Y36H 3HC3H 4QXTB 5JW4N 4AUJA 1GA2A 1JJUA 3K5RA 1GJIA 3R1GL 4WKXA 4Y4HA 3KR3H 4WNJA 2G2NA 3V52L 2HP4A 4OFDA 1I7UB 3D08A 2YPVA 3AY4C 2DOCA 4JUSA 5TFSL 5TMCA 1YNLL 3VH8G 3H4FA 3QUZC 2K4WA 3MGOA 1OL0A 3TP4A 1JXDA 3SPVB 1SJVA 4MD4B 3AS2A 1S7QB 5DS8A 4PJCE 2FQFA 3QS3A 2YAQA 4ETQA 2Y1VA 3EBHA 4HKBA 2VZ3A 1NFIA 4Q6IC 5FF6A 1EEZA 4ZMOA 5DJAB 4OZHB 1A9EA 4L8SA 4GRWF 3FQXB 5EUKA 5IVNA 4ONHA 3S34H 3LNEA 4H13C 2QPDB 1YEJH 5J89A 1MRDL 2NDGA 5EC2A 1QFPA 1Y6NR 5AAMA 4JFOB 3VI4A 1NPJA 3PXJA 1UQSB 1W8NA 4NUQA 4AITA 1NC2B 1UEMA 1TTUA 4FQQB 7FABL 2V5MA 2YUXA 1QRND 5IHUL 1JOIA 1Q72L 1YEEL 5C0BE 4L0ZA 1FH2A 4X6CE 4WFFE 5L2KE 3KPMB 5DZAA 1G7PA 1SDDB 2FUQA 5J1AA 2A4ZA 1MRFL 3BPNB 4XBGB 4AE0A 5HHNB 1YDPA 2I9TB 3PDOB 4LSPH 2EH7H 2QBWA 1DJXA 3J27A 4X8JB 3MRCA 3LQAL 1F4YL 2D7MA 1BX2A 2ZUQB 1YG9A 4H2AA 4L4VD 2VDLL 5FO2A 1X7TA 2AXFB 5HHOA 3IJEA 4TQPA 2ENQA 1NUDA 1VZIA 2X4TA 3BLBA 5EU5B 1PQZA 4Q9QH 3UACA 1HH6B 2CAKA 1A6TB 2Z3FA 3CVCA 4Z7AA 5CP7B 1JD9A 2F61A 1IT9H 4DFHA 2IALB 3FF8A 5K69A 4OQTL 2E9GA 1WORA 5AUMB 4OCXH 5J12B 2AABL 4F7MA 3V5KA 4HK3N 3SDYH 2F68X 3N1GC 1XSOA 2D0FA 4JN1H 4G43B 4O00A 1IFGA 5HDLA 1N0LB 3T9WA 2OK0H 4JRYA 2DN7A 4DZ8A 4ANVA 3FB8A 2VTFA 1JZ8A 1D9KC 5ITFA 2GSGA 3PP4L 3FSZA 3WL9A 4OZ4B 1X5HA 1KLFA 3VXRE 4JKKA 1SGKA 3OKNA 4HIEA 3RU8H 1LE9A 3AQOA 1QYGL 3HG1E 2W5PA 1DLFH 1B9ZA 1H3XA 4Z8FH 5KVDL 1AXTL 1NCBL 1U8QA 4LF3A 3TT3L 5ADPH 1JVIA 1DE4B 5I6OA 5IIEB 4QRRB 5I5JA 4R84A 1NIDA 3QUMA 1QWUA 2ALWA 1F8TH 2EUVA 3DV4B 2GABA 5IMLA 2H41A 2B9AA 2XVLA 3HI6L 3RA7H 4DESA 5ADOH 4FG2A 4XNMB 3ABGA 4P2OB 1QLEL 4A37A 5FM5O 5A6MA 3J8F7 2FWOB 2ZX7A 3NJLA 3D2TA 4WNQB 2PHCB 4D9QD 2HLAB 1IARB 4Y4FB 3TBYA 2CBPA 3GSWA 4EOWL 1G0DA 3SD2A 2X4PA 5GGQH 8FABB 3OJDB 1HHJA 3WFBL 4YSUA 2RBLA 4I5BA 2BOCB 3EF7A 3WG7B 5JIQA 4YBQC 4JFWA 1A1OA 3HE7B 1OP3H 4YNYA 4PWEA 4HZLB 4BH7B 3VTMA 5J4MA 2TAAA 2VJ8A 2Z65C 5HYSB 2BVPA 4PJ8A 1NBZA 4PJFE 1S7WA 3MRRA 2PP9A 4AL8H 3BZEB 2IQAA 2P47B 4XMPH 4ZW8A 1ETZB 5BZZA 2W8CA 4QHNB 2ZOWA 4UV4L 1CD0A 4KXZH 1IGCH 1R5IA 5D71H 3S4SG 2V2TB 3BN3B 1G9NL 1E3FA 2XWJB 5CWSB 5DD0L 4TVUA 2WNKA 3C6LA 3UFIA 4DAGH 3QDGA 2G60H 4LEOA 4N2KA 5G2NA 1U8IA 4E9WA 2OMZA 3TGXA 3AFLA 3BFOA 3ABLB 3DARA 3SBQA 2VXTH 3KLAA 1XSKA 1WHPA 1NC4D 1QPXA 5D7KE 3WIHL 1CLCA 3BD3A 3QCVH 4QHMB 4O02B 1MIEH 2DQ6A 5GS0D 1T66D 2IPUG 3QUYA 1OP3K 4JJOA 4HCRL 4WWPA 3U48A 2AK4B 3EYFB 4ZMLA 5F3BA 1CFQA 4TULH 1K9TA 1GGBH 4OJCA 1R5VB 4JVPA 5KZCD 3GRWH 1MW3A 4YDLC 2MCAA 2BSSA 3L95A 5J6HB 3WXVH 5EZLA 3P4NB 1ZS2A 2PCFB 5HY9B 2H9GA 2N56A 4AENB 5CJXA 1GYVA 5ETUA 4QRPA 4X7TA 1EZVY 1OOWA 1IBFA 3QIUC 4QTHA 5KBMA 3QORA 2ZNXA 2Y0SD 1UOKA 1AANA 1G4RA 2IFGA 3THML 3VI3E 1FIGH 1AXIB 2MKLC 4G2AA 1UM4H 1EQRA 3ADAC 4RQQB 2W60A 5CJOL 2D7PA 1NL0H 1AHMA 2XA3A 5JW5A 3GIZL 4FQLL 4WWID 5C3IA 3G5YA 2X4SB 4HPOL 2GT9B 4KKBC 3RE0A 4BFBD 4M1DH 1WWAX 3EH3B 4AXWB 3SPVA 4J4PD 1FFNB 5IBTL 1NGYA 3CHSA 2HN7A 4IKJA 2WSDA 3STLB 5IMKB 4Z23A 1Z0NA 2GAGC 4MEYA 4W9CC 1TZIB 3NIGE 3PNRB 4FG6D 4OZHA 3U9UB 4YC2C 3L3DB 3GF8A 2NVTC 3H9SD 3JV6B 4DUWA 1IZJA 3MU3A 5IF0B 3RWJB 1IAOA 1T2XA 2WLNA 4I3RH 4AYDC 2W9EH 4ZTOL 5K9QG 1Z66A 2QQNH 3VDAA 3ZKND 1XF5A 4Y2LA 1UCBH 3EJUA 4HH9A 1LEIB 3S0XA 3CPLA 4TNWF 1FDLH 1NGWB 1JAEA 2A9BA 2XZQL 3CU7A 4OZGF 3EGXA 3I84A 3EKCA 4KRPB 5E2VL 3WKML 1TWGC 3SBPA 2XVGA 4AT6B 2ODHA 4JCMA 4EI5C 3UTPD 3C12A 3CHXA 4PMEA 5FEBA 4JPWL 3WV0A 4AQOA 1SFOC 1I3RA 3MO1B 2CJSA 3KHQA 5HHNA 1L9QA 3F04A 3I85A 2OYPA 3I9GL 4NUMA 3T6QC 4LQYA 1CLYL 4ODXA 1PD0A 3HC2A 4M93B 4A67A 5KBDA 3AROA 4XPHH 2ZWZA 5DFTA 5CJ8A 3D18B 4YK4C 5DSCA 5FGRA 3MRDB 3ZW3A 3QFJE 1EH9A 3HR5A 3CZGA 3VW3L 3W56A 4ZFOA 5DFVD 1E4WH 1Q9OA 1OAXH 4FQPA 5A2LH 1LK3L 2VABB 1H3PL 1Q9WB 1F4WL 3CXDL 3ASNB 5CINL 3GUFA 4BQ9A 1G84A 3H7BB 3T0VA 4PJGB 2IADB 1DDHB 3MBXH 4DGVL 4OZIA 5HGHA 4XMKH 2OS7A 4NHCH 4NLHA 5GSVB 1KT2B 4NB7A 4NENA 4F33B 1ODAA 2NVYC 3CGTA 1U8CB 3S7GA 5I1IL 4U6VL 4UUJB 2V5SA 2DKUA 2XC8A 4H8HA 4XNYH 1I3VA 2VXQA 3JZYA 4AEFA 4PRID 4GIAA 2P52A 4HPYL 5KAQG 2VUMC 1I1FA 3JV5A 2PF6A 5CEYA 5K9OB 4L37B 1VEPA 4XCFH 5E4EB 4LNRA 1F3RB 3DRTA 4ZUUB 5AYUL 1CICA 1R3KB 3BQUC 4C83A 5ICZA 3BH9B 4BRVA 5CUSL 2YO3A 2ZX8A 3C2AH 3FO2A 1VADB 3OR7A 4LK4A 4XVTL 5T1DH 1H0DA 2GW5A 1AGDB 1JRHH 4GKZB 3FAXA 4XVJH 3BAXA 1DVQA 3QZBA 4YL9A 1PL3A 2GEQA 2Q8AL 1U95B 4KOCA 5E6IB 5AB1A 2ED8A 2XQBL 3ABMB 1CPUA 2Q8BH 3ESPA 3PP3H 2PCPA 2LHAA 4ODVL 3IXTB 1G9HA 4M3JA 4UILH 1DQJA 2BRRH 1BQLL 4KY1L 2ARWA 1SLUA 5FOJA 3T1WA 4YSDA 3DJ9A 3T2LA 3K80A 3GTPC 2QKIB 4FEIA 5TDNB 5BV7B 4EQ2A 1MW1A 1QNZL 3HB3D 5HYJE 3RDTB 1MFDL 4F37F 5CCKL 1NDGB 4G42B 5KUMA 3V0WH 5GS1A 3GINA 3WTXA 2CFAB 1U3JA 3FCTB 3I02A 5CIPA 1MI5E 3Q48A 4PS7A 2Z8RA 3BWUC 1JBJA 3LEXA 2YUWA 5ABZA 2CWRA 1V27A 4HIIB 5H4ZA 3K2UH 1Z9SA 2B1HL 1RK0A 2E7CA 1Z1WA 2WXRA 4IOIB 4YHMH 5T1LB 1A47A 1FN4B 3SJVE 5IFJA 4X6EA 4X6FB 1MCWM 5CSZB 5JHDA 1OCZB 1JK8B 4O51A 3RUGF 4HWUA 4LPTA 3D3VB 4NOBA 2O5XL 4IBVA 2PO6A 2APVA 3PWVB 4X5XB 5FGBC 3X14B 3BAYA 4BA8A 4BZ2A 3TFKD 1RD6A 4WI5A 1A3QA 3QH3A 2GITB 4XN9A 2ZSVA 2QADC 5JTWA 4X6DA 1DEDA 1FCCA 3GK8H 2WIMA 5EN2B 4ZQTA 4K7FB 2Z35A 5HTSA 1CI3M 4PG9B 1IGMH 1N59B 3UABA 4Z7VE 2D4FA 5EUOB 5C07E 5IFHH 2NY0B 1HESA 1U2CA 4FNRA 3F5WA 2NVTK 4XVSL 2B1AH 4KZ0A 5IKCA 2DB8A 4FDWA 3RVTC 2J4WH 2N0MA 4UINH 5KJRH 4X8XA 3IT8D 1LDSA 4IS6A 1JVLA 2F58H 1AOZA 5GIRA 4KX7A 5EV7A 3DGCR 2XKUA 2ZF9A 2XG4A 5D5ME 2NZ1A 1CT8B 4MXQD 2ICEA 2KI6A 2PA8L 3QXVA 4JO8A 2A9NL 2EVJA 2Q2EB 4P5MB 2WAQA 3RVWD 5A6LA 2NVXA 4G0WA 3RTQC 5IB5B 1X5ZA 3LDBB 2YSSB 4J2QA 4RCAA 4Q0XH 3CH1A 4L0PB 5DZNA 3M1BB 2M26A 1SFOK 2H3KA 5K9JH 4G8GD 2CBQA 4ZUTB 4TV3A 5HSFA 3EYFA 4I87A 1J0ZA 3WMSA 3HUJA 5JIDA 1P7BA 5JQHC 1OP9A 3FN0H 3RL1B 4WUUA 3OZ9H 4Q6KA 1VESA 2VITB 2X4UB 1JK9A 1GHFL 3S17C 1KYDA 4FL4B 4HGWB 1OTTD 4N2HA 4PS8A 3ZTCC 5B1KA 2C9SA 3B7SA 1HVXA 3QEGL 4QJ5B 5E00A 4B9YA 4RGND 1P4BL 1HXYA 5E99H 1S46A 4UNVA 1ZHNB 1F2QA 3MGAA 4UDTB 2HWZL 1IE4A 4YSSA 3LQAC 4C47A 5DJXA 5AD0B 2RTTA 2VISA 3GXFA 3PNWB 4Z7WB 2H32B 3MLSH 1N2RA 3QA3B 1KC5L 1DJWA 2NVYK 3MMLB 1QZNA 2C26A 4N8CH 3WKPA 2BP3A 1GGIH 3QQ3A 3PQYE 1M7IA 1ZHKA 5GGTA 1YEIH 2JB5L 4QGTA 5FHBL 2VUMK 4BHUI 1PDKB 1G9ML 4CKQA 5J3HD 4KO5A 1GYAA 5D4JA 4EUPB 2ERJB 2VDPL 3BEWB 5SWQA 4LP5A 5CLYA 4NRXA 2Y5TB 1QSFA 4IRSC 4FMFA 2RFXA 1OCWH 1WIUA 2AK1L 3ZE0F 1PAMA 2DQGH 2QSQA 1PFCA 3RJQB 3LD8B 2D0HA 1FG9C 3O2DH 4UDUA 4HJEA 1QTPA 5EDSA 4BXXC 1MJUL 3MCKB 3MLTB 2MCPL 3VXQB 3L3IA 2FYVA 4WF7A 4BEIA 2WCPA 2ADJA 1JZGA 4XZ4A 3NSCA 2FATH 2YAFA 2YOCA 3NACH 2YGOA 4Y1AE 5D4QA 1QKZL 2HSIA 4ODUA 5E8NB 5J6GA 3WJJC 2XFXA 1JZHA 1KMGA 3S2DC 3V52H 2Q5BA 3Q44A 1IM3D 3KPLB 4GS7C 2K6ZA 1LEGA 4BK4A 4Y9GA 3GTPK 1NICA 5TFSH 1UZ8A 1YNLH 4UCFA 1FFOB 3QEQE 2W91A 4E9SA 4JKPH 1ED3A 2IWFA 5D7SL 1EAQA 1BQHA 1ILUA 1E43A 3PWLA 3NQIA 2VLLB 1JWUB 2J20A 2BIHA 4AZ8B 3T65A 5KVDE 4NJAL 2J5LC 5KS9E 1D5MA 4JFEE 2APFA 4TLTA 5F1IB 3G08A 3GSNA 1R5WB 3H7BA 4L0YA 3CQZC 2JA6A 1QFOA 1MRDH 1B4TA 4TQEL 3ZSTA 4P5SA 2VSCA 4FFVC 4H0GA 5GSVA 2X5PA 2D6FC 4LSUH 2GCYA 3K2MC 3T0AA 2LW3A 4FXGC 1HILA 1MIML 5JLZA 4PP1C 1KFGA 3O45B 1J8HB 3RX9A 1A3RL 2X12A 1IRAY 3LZRA 5IHUH 2F5AL 3DX8A 2ZG3A 2ZP9A 5GRWA 4OCSL 2WXLA 3DSFL 5KW9L 3QG6A 5D7JA 1CBJA 1LQSR 5DO8A 2D7NA 3GTJC 2IQ9H 1FZOB 3PGFL 1W16A 2OSXA 2AJUH 1MLCB 4LHUD 4RDQF 1JPGB 1QLFA 5B38G 1HCZA 2VDLH 1CLOH 3O4LD 2HFEB 3QDJE 4GKZA 4KASA 5EPMA 3D2UB 1QW9A 2WYZA 4FQXB 1QVOB 3DBXA 5FIEA 4ZD3L 2R0ZL 4JFFB 3VYNA 2BFGA 1U8KA 2GSIA 3AM8A 3NH7L 1T0OA 4P5RA 2FNBA 1G9NC 4ONOA 4QTFA 3WO3B 2ZP0T 4ZTPL 2EVIA 4NT6A 3GMNB 2A74C 5MEQB 3RY6A 3FUFA 3MROB 5GRZA 3DXAB 4BINA 2AABH 4Y8DC 2IAMB 5ERWA 3TN0C 1URIA 2R56L 2YD7A 4L9DA 2J88L 2QTVA 3KZ8A 3BT2L 1SYSB 2CE6A 1Q1PA 3DTXB 5C3TA 2HTKC 4G42A 1YVLA 4E41E 4XO9A 1GAFH 3S17K 4KAQL 1MW0A 5IG7B 1HXKA 3ULVE 2BSEA 3A23A 2DJSA 1PW3A 5H35A 1NM9A 1Q1JH 2EDRA 2OZNA 4GSXA 4RNRB 2EDMA 5F1KC 4HIIA 1CVRA 2CLRB 4U1IA 1HYSD 3ZHLA 1FN4A 4G7OA 2FEDD 5C0AD 1T1XA 4QRQB 2EDWA 1UM6L 1AKPA 2MPAL 3C9NA 3KYAA 1OGPA 1U8MA 3EJZD 4KXCA 1QYGH 5KTEL 1HNFA 4LLGA 1AHWA 2XX1A 3V95A 4YH6A 1NCBH 2XV0A 5FYJD 3EIFA 1ZHLB 2P24B 4KTDH 4U1MA 4PCKA 1VF5C 3I6SA 4HCGA 3TA3C 2A7BA 3GI9L 4FGMA 3QRBA 4Y19E 5T3ZD 1ONQB 5EFIA 5F7YC 4NRZA 2ED6A 3ZDYB 5D9SB 3GXNA 4HSCX 4UM8A 2WTPA 5AOJA 1QLEH 4NHUB 5T5FA 2XN9A 3D7PA 4JHWH 4YFXA 4BXXK 2IPUK 3SGKC 4QF1A 4Z7IA 4WWKD 2J1WA 5MEOB 3N41B 4N87A 3PCYA 3UMNA 4EOWH 4KMDA 4HC1A 5IB5A 4ZFGL 5IR1A 3WFBH 5DQJA 3US9A 1RIHL 2W92A 3Q1SH 1PJWA 4PJAE 5F9WB 3S2DK 1A4JB 4QGYA 2UUDH 4ZUTA 3FBKA 3FT0A 3QQDB 2OMVA 4UT9L 5E1QA 3UC0L 1RSFA 2NYKA 5CJ5A 4GUQA 4N2DA 1OSEA 1LNUA 4KH9A 3TV3L 4WKZA 3I50H 3NCFB 1AE6L 5F7DB 3MTRA 3Q6GL 2WQ8A 1PX3A 3AMKA 5DC0A 3HHSA 3CFEA 3Q6FA 4N0FB 3CN0A 1G9NH 5INDB 5DD0H 1DJHA 4Q97A 2F54D 3FTUA 4ANWA 4P99A 2B9BA 4UDTA 5DRXB 3PL6B 3WCYA 4CSPA 1JYWA 3CQZK 4JCLA 1QHPA 5HDWA 4MD5A 3OGOE 4ZMWA 1I4FA 4H8UA 3GMOB 2K3HA 2P49B 4JUTA 4HJ0C 4JHBA 5ACLA 1M6OB 3P9LA 4LO9A 3K46A 5ID1A 3WIHH 1IVTA 3HMXA 1LP9E 1VAHA 2OMXB 3F7YB 4LB8A 2ARJA 4X8GA 5C97A 4KMAA 2IAND 3HJ0A 3FBQA 1CE1H 3BPLB 1SUHA 2XYBA 1LO3L 1KGWA 2DI9A 5JORB 4HCRH 4LOUC 1IL1B 3QHTC 4MQXC 1RAMA 5HYEA 3GTJK 3DUSA 3CDCA 2IGLA 4Y9FA 4B0MM 1PD6A 1YEWA 3MBEC 4L9LA 9PCYA 4KZEL 5D1QD 1M2VB 1QRNA 3SQBA 4WIQA 3X11A 2ZE0A 2OMNA 2JCCB 2JTDA 4HUWB 1MCFA 2ZOLB 4GIPD 3OXSB 3FUDA 5B8CA 2ITDB 3LMJL 4NNPL 3THMH 1FNEB 3KE0A 3DHPA 5E7BA 1DTUA 5I6XB 5IESL 3VFVB 3O3AB 1QBLL 5J13B 3VDBA 3GIZH 4FQLH 4Y16D 3G5VB 4HPOH 4D9RD 2DTSA 4FI7A 1ZV5A 4P2RA 1A7OL 4L4VA 4CJ1A 3FH8A 3CDGB 1JF6A 4OB5H 4G1MB 1HQRB 2DM7A 4OZGA 5CGYD 5IBTH 1DBKL 4N6RB 1XXCA 1XBDA 3FTVA 3RB7A 3CFJA 3D0VB 2QT6A 3G4CA 5JOPE 1SDAB 5IVZB 1A0QH 2HFGL 2R2BA 3BVXA 2E9IA 3CZEA 3A6CH 3T3ME 1TWCA 2QGDA 1FG2B 1FNGA 1YY9D 4NSKA 5DHDA 4ZTOH 1TTBA 2WBJD 3EO1B 1NCCL 3T8MA 4FFYA 3QQNA 2XZQH 2FECI 3WKMH 2DF3A 2D7TL 5A7EA 1EFQA 4LLYB 5EO0A 5I5MA 3L4WA 4MJIA 4J6RL 4GTBA 3VFOB 3L3KB 3T0ED 4HX1B 4JEGB 4TKWA 1TKWA 3GHBL 3GI8L 3S2HC 2ICCA 1TUPA 2ENPA 3V4UL 3ZKSD 4Z9KB 1YSOA 3I9GH 3Q0HA 4A6YA 5KYWA 4JZJC 1RHHA 4QHPA 4XVUC 5EBWB 3ZDZE 3ZQWA 1CLYH 2GPZA 1WQHA 4M3KB 2AJ3A 1H9DA 3NCJL 1W0WB 2OZ4A 5AW5B 4GP8B 4P4KB 1C5BL 1TTGA 5IYDK 1Q8MA 4PP2B 1B4RA 3GEWB 3LS5H 2FQTA 2W0KA 4YHZH 3VYPA 1NDTA 4RAVB 3KXFB 2JK5A 2W9LA 3ARGD 4KMTL 4XMVA 4AYFA 3EOAB 4M3HA 2HVKA 3M17A 3U2IA 2BY0A 4D7BA 2CO3A 2NCMA 3P54A 1H3PH 4HLJA 5E2WL 5TF1L 3ROOB 4F9LC 4PR5B 4Q9CA 2EADA 2Y7SA 3TBSA 3HB3B 1U8NB 2WCSA 4CC1A 2CHZA 1EMTH 2CHDA 5EU7E 1EJOH 4YZFE 5TPWL 3L4UA 2YGNA 3SSGA 5LLIC 4Y9BA 3QUZD 1YECL 5C0JA 5I1IH 4U6VH 1SN5A 5I1AA 4AGOA 3ESUF 4ILDA 2FYYB 2XY2A 3LKSB 3LVTA 4HPYH 4N2AA 2KKQA 1F58L 4LHQB 4BA0A 2H3NB 4OV6F 3WUWA 1HZKA 2R59A 1SN0A 2GAZA 5CBAA 5C09B 1P5VA 5AW9B 2YOAA 3FHEA 1J1PL 1HZHL 3TNMA 1F11B 2LE9A 4K4KA 3RYMA 1HHGA 3NA4A 1UUNA 4KK9C 5CUSH 4EZJA 4H26B 1FVEA 1W0VB 2LABA 4XVTH 5BUPA 4LCYA 3N91A 1W72B 4JQVA 4RA0C 3REVA 2Q8AH 1MWAL 5C0BD 2XQBH 3NZ8A 3KYKL 2ICWA 1TPXB 2NZIA 1DQQA 2K8QA 2OL3B 4YXHL 5J6SA 4DTGL 5L2KD 4MS8C 4TPRL 3GEEA 3GMLB 5I1JH 1KULA 4DN4L 1V3JA 3N0BA 1BQLH 1XVSA 4XNZC 1ZS8A 3ME0A 4MAUL 3RUGA 1QPKA 1CFNA 4H1LB 1FC2D 3UTSE 1CN4A 2WKGA 3QUXD 2A68A 3TESA 5TH2B 3RWIB 4M6AA 2IH9A 3ZHFA 4FYQA 3GQFA 5EOCJ 5BUGA 5DQ9A 1MFDH 4Z77B 1NC4A 1YMME 2XV6B 4ZO9A 1X4YA 2PWGA 5A2IH 5D1ZA 2A6EA 4HJUA 3U79A 2EUWA 5DUBB 3ULUF 1IM9B 1DCPA 4CN6A 1Q9KA 2BC4B 1G9MC 1OE2A 5IQ9A 2UX7A 3VFTB 4CMMA 3UL4A 5F7KC 1AGCA 3REWB 3QPKA 3QUHA 3DVIA 4LEEA 4WDIB 2E76C 3ZRFC 1ZT1A 1MCOL 3EJYD 2EDEA 4GINA 4I0CC 4ZBJA 3QXAB 2BNQB 5D7IF 4MX7A 3P1VA 3EDDA 3UADA 2R2EA 4NC1E 4ZPTA 1HZLA 2XNAA 2G4GA 4PRHE 1B4BA 1QLRA 5HGDA 2EKSA 3OLDA 2Y0SA 3C87A 1U8OB 3AH5A 1SJEA 2CIIB 43C9B 1U91A 5GGSB 4NQEE 1KGIA 1KPVB 1X4ZA 2GB2A 5KSBF 1UG9A 4JB9L 1V7ML 4OUUB 4K7PY 5IJVB 4XVSH 3VSTA 2CDGB 2WHVA 5I28A 3VXRD 4YIQB 2X4RB 4HIXH 4QAWA 4Z7OE 5D1XC 1D6VH 3HG1D 3OBAA 2JJSA 5EIIB 4BDVB 1C08B 2BH0A 2XQYG 2VN7A 4XRCA 3TO4A 4Z7UB 3T4AB 1EFWA 3PXLA 1KB5A 4YDKL 3VB9A 4FQJL 1WGOA 3NIFF 1WSST 2KS0A 3ZE2F 5LO7A 2O5YL 2A9NH 5D1XE 3U46B 2WLLB 1E3XA 3OKEB 4MA1B 1UYWL 1DO6A 4XXCA 4DP2X 3S5LG 4W6XB 3UBXB 1MCEA 3U4BL 1WSRA 3H9SA 5K39A 2JQMA 3RHWK 5E9AA 1TJHL 1X7QA 3S2HK 2AXJA 1R33A 3L81A 4ORGB 1FL5A 2DV6A 3LKPA 5K1VA 1KV7A 1BCIA 3MQIA 3DYOA 1VFMA 4HXBL 5EU6A 1HOCA 4UYPA 3FT2A 4JDZA 2ZOLA 1AGFB 1S9WB 4JZOA 5FV1L 1ZTXH 3QEGH 2F53E 1IM3B 1P4BH 1W91A 2VKWA 2JV6A 3CX2A 4Z7NF 3O3AA 1PLGH 6PAZA 2EXSA 1F56A 1N19A 3DUHA 2HWZH 3V4PB 4AMKL 3G5VA 3S96A 3KJ4B 1W6LA 2Q9OA 4XCNA 3OMZA 1EHLL 3G9AB 1KEGH 2CCWA 4HYTB 4HJSA 3ZYJA 4ETYA 2AJVL 4PHXA 1HQRA 3OREA 1V55B 3VYOA 4HEPA 4K2UL 4HKZA 4HJGB 1O6SA 2CDEB 2F5BH 3L54A 4QWWC 2JB5H 3MTXA 1BBJB 1XR8A 5FHBH 5IVZA 1D3CA 3GIVA 3HNVL 1G9MH 2C3GA 4NPYA 4XX1G 5CR8A 1X9QA 2ZX5A 3S88H 3FNKA 1ITBB 1JCVA 2FQEA 3I2CL 3QIBB 3NIDB 3VM5A 3VVVA 4KK8C 1KTDB 2DYPB 4HCFA 1KIRB 1TWHC 3C6SA 4MXVF 2ZUWA 5IFAL 2VDRH 1FVDB 1DFBL 1ET5A 2Y2YA 3H2QA 3S35L 1MJUH 3EW3B 1I8UA 4AQ1B 3SGDI 2WLIB 4PRIA 4MRCA 5BOZG 4E9TA 1LO0L 1EVTC 4PLOB 1JNLH 3H7LA 4XXWA 2O93L 3BGMB 1KSRA 5DVNA 5JOFA 4YFLF 4FFZA 4L1SA 3TCTA 4U2ZA 3O4LB 4PJCF 1CFSA 1L0QA 5JMRA 4OCRL 3FT1A 4Y2OB 2QGEA 3DECA 1XZ0B 5FYKU 4H25A 1SMAA 1JZJA 3APMA 4XR8C 5I1HL 3SGEH 3CIAA 1U8JA 2WQVA 4MNGB 3MRNA 3QIUD 1C1EL 5EZIL 1XF4B 1M4KA 4Q9BA 2EKJA 3GBEA 5KG9A 4K9EL 4OCWL 1RJLB 1VZHA 3LXBA 3ARBC 4IGBD 5HDOA 4LCVA 5L88L 3QNXB 1GJUA 1MAJA 2FR4A 4WO4C 2CO6A 3BH4A 3ATAA 4KFZC 1NUNB 4BKWA 4X6CF 2GUOB 1A3RH 1JGEA 3S8GB 3DX6A 2F5AH 2J8UB 3GSOB 4N2NA 1NA8A 2ZYSA 3ABZA 3I6GB 3FSAA 4LPUA 4OCSH 5C0AB 3VTAA 2Y1ZA 1L9NA 3B83A 4G59C 1NM4A 1TDQA 3MJ7A 2KERA 2VAAB 4WEMB 5AVRB 4F2MA 2NY2D 2C8NA 3CHRA 3D09A 3KPNB 4V2CB 1OW0A 1WE5A 2R0ZH 3X2QB 1UHVA 4ZD3H 3NH7H 3QI9A 5E08L 4G7QB 2B8OT 1JI1A 2W65B 3LJ3A 4J28A 4WHTB 4ZTPH 4QYAA 3VX1A 2IGFL 2J25A 4WI0A 4JM4H 3MJWA 4EI5D 2CUAA 4PD4J 4MCZB 3QISA 1F41A 2WXIA 4KKRA 2R56H 3GO1L 4ZS6C 1KGCD 1J1OH 3BT2H 4RFEA 4F3FA 1UEYA 1GXEA 4QIWD 1YNNA 1JNNL 3IDUA 2CJUH 5EH1A 4KAQH 3VFMB 1QI3A 2P5WE 3QFJD 4KU1A 2R9HD 5EN3A 5C0CE 4Y2DC 4JY4A 3U0TA 3VFGL 5CGTA 1DVFD 1V54B 2I32A 3FT4A 5DJDA 2VDKL 3T08A 2EXWD 4G8GA 3QNYA 1D5IH 3SDCC 1I7TA 4OLWL 5HI3D 4GBXA 5BO1L 3ASOB 2WZ0A 4GRLD 3HPLA 4DCQA 4ZX3A 3BDBA 4GXFA 4XCYB 5AVVB 2MPAH 3ILQC 1N4XH 4FF9A 2DM4A 3T6VA 5F44A 3SE4A 3EG9A 3F7PC 1XAUA 4ODWB 4U6HA 1MCLA 3TIEA 1ZGLA 1XIWA 1NEZB 3F7LA 5F3HB 1TITA 3C8HA 3R8BB 3PGDB 1CFVL 1JYNA 2PXYA 2H6PB 2YBRA 2IDCA 3FTZA 1S5IL 32C2A 1GGYA 2YS4A 5BXFB 3FRPG 4PRPE 4YIQA 5IB1A 5C9JA 3H9HB 4AQEB 2CA3A 1TWHK 4BDVA 2XTJE 5H37G 1HJCA 3BQUD 3T4AA 3MR9A 4NOIA 2C9AA 3QDAA 2YPVL 2WXQA 5JQ6L 4D7PA 1E65A 4KROC 3NFNA 4JHUA 4ZMPA 3HZVA 4HG4K 5FCSH 3GTGA 5DTFA 2IANB 4ZFGH 2YIHA 5M3FK 2WQUA 3K7UA 1BAFL 1RIHH 4OLXH 1E4XI 3BP6B 3LAPA 3QYMA 4PJEE 4XB7A 5HYJD 2KWAA 4I0PC 4UT9H 3WS6A 3UC0H 1COBA 4PJFF 3TBVA 3N0PB 4GEJA 4MKMA 1MI5D 1XD0A 3NZHL 3TV3H 5A43C 2IBGA 1KLGB 3LH8A 1AQDB 4U2YA 5E94A 3P3YA 4WK0B 5E68A 5DJZB 3RZWA 3TYFB 4P9HL 4OR1A 3S97C 3SJVD 1O7VA 4Y16B 5C0RL 1O27A 4XLNA 2E2JC 1PCXA 4RRPA 4DEWA 3NAAL 4KQ3H 1M3IA 2WD0A 1VLOA 1EEYA 2V7NB 3GTKA 1R3HA 3IWUA 3LEVL 3EBAA 3PAUA 1NJ9B 2Z8VC 3VAEA 5C0DB 3MNZB 4GFTB 1B6UA 2QADD 5DUML 2PCXA 4UIKL 5C07D 3WGVB 3WS3A 1MG3C 2B63C 4YQXH 3VXME 1WBXA 1A7RL 2BWIA 4NI6A 3D39E 2NPLX 1YNTB 2XV3A 3JSSA 3V6FB 3PYCA 3M3YC 1KIRA 1RU9H 4UQIM 1NCDL 4MB1A 2X38A 1RJCA 3RVTD 4RMTA 2YJLA 1EFXD 4XP4L 4KZEH 1RXLA 2IBZX 4D0BB 3KJ6L 3LS4H 1KXTB 2YD0A 5J9PB 3VI3F 1XXAA 1L6XA 1MPAL 3LMJH 4NNPH 4PRAA 5IW3A 5E1HB 4C56E 1I31A 1UWFA 3RTQD 3WODA 3Q05A 3KM1A 2YXVA 3PJSB 5D4HA 1QBLH 1L6ZA 1P6AB 2FX7L 1BVLB 3SE8H 4Y5YC 1A7OH 4LHUA 5F1OB 1UA6L 5FGSA 3K5SA 1DBKH 3W0WE 4XWGH 3D25B 4UQ2A 1G5GA 2H3XC 3ARGB 3NBNA 3NIGF 4RMRA 5BQ7B 3E2HC 3S36L 4R26H 1DBJH 2BO0A 3BSGA 4LIQH 2Z31C 2TSBA 1GPOL 1GW6A 3NDYE 4PN6A 3ZDXE 3QUML 3OX8B 2ZXCA 1BZOA 2Y23A 3QPXL 3ZT7A 1JPFB 4XP6H 3C8KA 15C8L 5LQBL 1MDAA 4EBQL 2JA5C 4E42A 1ZLVH 4HIQA 3GNMH 3QUZB 2J1YA 4ORZC 1MCWW 3H85A 4GRMA 3UJJL 3OKOA 3VXSA 4IRZH 2OX5A 1XZPA 4NKDA 4G71B 1OPGH 3TZVC 2D7TH 1R3JB 2GUOA 4J6RH 5EB9A 3LN4B 3CNKA 3OAZH 3W38A 1DBAH 4KTEH 2HG5A 4Q6IB 1FH5L 4MB5A 5I8OL 1JNJA 1WFUA 2H0PA 4AGNA 2HPTA 3GHBH 4G5AA 3GI8H 4AYMC 4A2FA 4PGEB 3H2WA 3I75B 1FZMB 3TU6A 2YWYA 1U3ZA 4NPKA 5A7BA 3DBSA 4IRSD 4XCCH 2VAAA 5IM7A 2ADIB 1MCKA 2P8LA 3MN8A 5C0BB 4DW2L 3BVNA 4GAYB 1MVFA 4Y1AD 4ELKA 2B08A 4A38A 1KGYE 5L2KB 4G72B 4OJAA 2A6JA 3VJ6A 2X0VA 1BAGA 3LPPA 4D2NA 3SZ6A 1YJDH 2WIIB 4FLQA 3GLDA 2GAHC 2EDYA 1C7TA 1OAZL 3WFEL 3BZ4B 4MCZA 4UYQA 5FUZL 4NPJA 5A3ID 3QEQD 1ZLVK 2BS8A 5DURB 3UZEA 2TSAA 2P7TA 1BEXA 5TPWH 2BINA 4JN2B 4WWKA 5I6MA 3TURA 4OGYL 2CCVA 5CAYB 5LGKA 3O3DA 4BFIA 3BD4A 4JKNA 5EDXA 1ZXKA 1URLA 2OMYB 4EN3C 1X44A 1F3DH 1LILA 2WANA 2BHZA 5J0BA 3P3UA 4JFED 3LNIA 4AVJA 4NM4L 2H0FA 1VGKA 3FYEB 1SXAA 3UTTE 4Y5XA 1NCHA 3V6ZB 1NPUA 1F58H 2YD3A 5IW6B 1RP9A 3FPYA 4LCCA 1P69B 2E2JK 5SX4I 4KDWA 3LXCA 4NUJB 1NKOA 2DDQL 1TSRA 5EOQL 1Y1WC 4DSYA 4UM9D 2MNWA 3SCMC 4K0OA 3MRFA 1OSZA 5C0IB 3RPIB 1BVKA 3BDXA 2AI0L 5FM8A 3OKDB 4UQCA 4EI6A 3U36B 3GEIA 4O2CB 1MWAH 1E4JA 5IQNA 1MRCL 2XQYK 1NBYA 3SB3A 2B63K 4DTGH 4YXHH 3J07A 3L16A 2F54A 4PP1D 3HBPA 5DJ6B 1D9KB 5F71A 1XL4A 2WOBA 5LBVA 3VXRB 1RLWA 3FOFA 3L3JA 3TEUA 5D7IA 3M3YK 1U4FA 3DUUB 3EQLA 3BKML 3QDJD 2L7QA 2H1LM 3ZTDC 2VDOL 3D5OF 3V6OE 2MHAB 2G75A 3VGEA 1OCOB 1R19A 5LAXB 1F3JA 2F7QA 2YEZA 3LZPA 1I85C 4MRBA 2EYRB 5EBMB 1T20A 4N5EC 4PG2A 5IHZB 5KSBA 2XI9A 3VRJB 3GTMC 4EN2A 1XAKA 1F1AA 5HI5C 2YLKA 4IK7A 3CC5A 2DY2A 2AMGA 3ECQA 3QBTB 1MCOH 4XT1C 4JRXA 3HHRB 2NRDA 4N2FA 1OLLA 2GFBB 4HQQL 1A4AA 4ZH4A 1GGCL 2QDWA 5IYBC 4IDJH 2FQDA 2V2WA 1BM3H 4MDIB 1KCUL 5D1QA 5BZDB 1JWMB 3WNLA 2AEPL 3QULA 3ULVD 4OFYD 3DURA 2DQFA 5IEKA 5KVEL 3FU7A 4IKNA 3QWRD 4Z7VF 2FEEI 5DJZA 1A6VL 3CMOH 2ESVB 3FU9A 4JB9H 2HVJA 4BBWA 1YY8B 4PJ9D 4Y16A 3SKOA 3ETSA 5FGCE 2DQCL 1DBML 1NSNH 2XETA 3I74A 4KNSA 4CSTA 4WI4A 1SFDA 2LU3A 2JA5K 1PG7W 2BSTB 4RH4A 4ZQKA 4FKKA 1E5YA 4OLYH 1FAKT 4LJZA 4UU9B 5L8KB 4APXA 4LRIC 1UYWH 4G9DB 5FUOL 3JVFC 4TN9A 5IROD 2NSQA 3U4BH 2FB4L 2X1WL 2ZZUT 4Z0XB 4PJXB 3TA3D 1TJHH 4K9EC 1TFHA 5GGRB 2OPCA 1OGTB 5TJ3A 4ELME 4HJIA 3OVUB 2WBJA 4ZFOL 2E2HA 1GW0A 4LGRB 4C45A 3DO7B 2NTFB 3HC0A 1UH3A 1WFNA 4U1LA 1ZVSA 4POYA 4W9GC 2YR3A 4HXBH 2PPEA 4RA3A 3SYQA 4KDTC 4DKTA 5J9PA 1KBPA 2WO3B 3AC0A 1J12A 3V8OA 3T0EA 2VLRD 3HS0A 1INQB 2G9HB 3N42B 3WKNA 2XWTA 3WJLA 2GY5A 3CBJB 5ISZD 2GIXA 4TF4A 1S5HA 4XC1L 1MF2H 3T8XA 2VXQL 4AMKH 4BK5C 2CK0H 1NZRA 1N8ZB 2VLKE 1EHLH 3QQ4B 3R06A 2E27H 4O2DA 3TWCL 1UOLA 1K3ZA 2AJVH 4YDLB 4S2SA 3WEXB 35C8L 3GXIA 2UZXA 1TYRA 2DLHA 3WIFB 3P30H 1AYRA 4GXVL 5AAWC 4J7RA 3QIUB 4V11A 3HNVH 3OLEA 3QX3A 3NRPA 2EUZA 1UKSA 2DBJA 5DC9B 1J0YA 1MWOA 1FZJA 3BVDB 3G5ZA 2D31A 5AALA 3QYNA 4U1JB 1Y1WK 1KTBA 4PJCA 2EYTA 3IS0X 5IHHA 4X5WA 2XZAL 1FLTX 3L3GB 2CH8A 3S35H 2YAHA 4DVBA 4QLWA 3NFPB 2WBXA 1T2JA 3FHZA 4LHJB 4DQAA 1XV8A 4ZDHA 1AS6A 1M9WA 2B5IC 1A14H 1BZ7B 1G1OA 2C1PB 4HJ0D 3BWAB 3NEOA 5ACZA 3KWWB 4APQA 1ZK5A 2AV1A 1LO0H 3U30C 3BP4A 4R8WH 4YC2B 3S37X 1AY1L 2DKMA 4QHUA 4KDDA 2NVQC 3ECWA 4R83A 3G04B 3QRGL 1NOAA 4ABVA 1RZGB 3AADB 4JGJA 2VIRA 4JPQA 3IKKA 4LOUD 5JW3H 5HHQA 3MUGB 2D73A 1NCNA 3MGTA 2QGBA 5C0BA 3TCLB 4I2XE 2YC1B 4X6CA 5JIIA 1WWWX 2XXMB 3MBED 4ZSOE 5TJWK 3JWOL 2VSKB 4BZ2L 5I1HH 3A5VA 1UJTA 3HN3A 3GTMK 4MGXA 5H37H 5JIHA 2ZFZA 4ZAKD 2VC2H 4R7LA 1QNIA 1C1EH 4I1RA 5EZIH 4ZUSA 3QUXA 2ZUEA 1GY2A 5EZJB 1JPSL 3I4MC 3P11L 5E1AA 4Q2ZA 5B1CA 4OCWH 4EKXA 1NIAA 2XWZA 4M7ZC 2VXUL 2WWMC 5IYBK 4XX5A 4Y4HC 5ALCL 5L88H 3GUTB 4GI8A 4XP1L 4MFHA 5T3XL 4I3GA 3IU3B 1HSBA 4FLSA 4KN7A 3SPIA 3UO1H 5JOPD 4R7DB 4GSDH 3KPPA 4YK4B 5AVQB 2OYLA 3VH8B 2GBTA 2V5TA 2FL5A 1AS8A 3FO9B 1WBYA 2IV9A 1BW8A 3STBA 3P9MA 4HW6A 1CTNA 5D7LE 2WAQL 1KDIA 1D2OA 4GMTL 4OF3A 4O4YL 1PS3A 4L8SC 1FV1A 4MA8L 4M4RA 4NO2A 2ED9A 4ADGA 1UXLA 5HHMD 1TYJA 2NXZD 1HAWA 3U36A 5AAMC 2JKSA 2WQRA 3L6FB 4LSTL 1ND0B 2EC9T 4P9HC 5E08H 1KPUB 2XKNB 2QMJA 1USZA 2SODB 4X98B 2E8YA 2ATPB 3VI4E 3VXRA 1IGTB 5MI0C 1HQ4A 4XPAL 3HG1A 1MFUA 4P04A 2UY7B 5J1TC 3BQUB 4RAUA 3GO1H 2Y7QB 5IOTA 4PI0A 4HIHB 1BS2A 1MEXL 4NRYB 1JZ3A 3L08A 1JNNH 3HG4A 4XVUD 3ULVF 5I1CL 1UTDA 2DQUH 2BNRA 1WA0X 5C08D 3F7KA 5I71C 5I75C 1PKQA 5EBMA 4PS4L 2HFFA 4JFQA 2R1YB 2KZWA 2VDKH 4P57B 5FYKE 4HS6B 4X4ME 5HYJB 1BHGA 1TJMA 3FXIC 4OLWH 4AKPA 1O9ZA 5GGTL 5BO1H 2ADYA 5AW3B 3EH2A 1C0AA 4K5PA 3MRJB 2EE0A 2VR3A 1EO5A 3AACA 1Z9OA 5E9DE 1MI5B 3PHOA 3VMPA 3PWNA 1WCBB 2Z1PA 1KJ2A 4G8EB 2HLFC 3ZE1B 3V7MA 2HX8A 2ZOUA 4OBSA 1CL7I 1O6TA 2IH1B 4KJQC 1EI6A 1NGQH 1CFVH 4HBQA 5CILL 2DH3A 3SJVB 4NDMA 3MI6A 3QQ9C 1EJ8A 4LLQA 1ZVYA 3B9VA 3PF2A 3QEHB 1KIPB 3CUPB 5E8EB 1HI9A 1YN6B 3MA7B 3BXNB 4AUYA 1VEOA 1P5UA 4PJFA 1X9RA 1WAEA 1S2EA 2C7FA 3Q3GB 4ZS7L 1BJTA 1HEJC 2Y1AA 2ZWSA 3JXAA 5BNXD 2A9ML 5JQIB 3MNVB 4WGWB 2QADB 2VXVH 5JQ6H 1JPEA 5CLXA 3EH1A 2BVUA 4AJWA 5DHVA 4G9DA 3QNZA 4EI0A 2CNYA 1ZVNA 5I66B 4X0KA 1RPUA 4MNQE 3VD5A 1ZAGA 3C5ZC 3UTSD 1XR9A 2R83A 1A7BA 3MV11 5D5MB 2NVQK 1HHKB 4KAWX 4PLJC 4CNIA 1WZKA 3B9DA 4OD2B 2I9LB 4A2DA 3UTQA 1EFXB 1YMMD 4P3CL 1N6QL 3MRKB 3GSNL 3NZHH 3MV7B 4URKA 4JDVA 3TFIA 1D5XA 1N68A 5TGBB 2MIZA 3KPSA 1XTLA 2V7HB 4X6AC 1JZ6A 1E0OB 3RTQB 5JYMA 4R5XA 2B4CL 3SEPA 4AW4A 3GSQB 4LP4A 2C7UA 2TRYA 5DRNA 1IIKA 2O1AA 5C0RH 2WBWB 3VG0L 5IQMA 3I4MK 4ODTL 4HU2A 1XSJA 4RBPH 3SHSA 5SX5K 5DS2A 3IDMA 1L9RA 3LEVH 3IE9A 4YHLH 1FNFA 4S0TD 1PZDA 2QR0A 3O3UN 1LP9F 3VI3A 4F8OA 5FDYA 3O11B 3WIFA 3DIVA 4GY4A 1Z32X 4PJ8C 2FO1A 4UIKH 1TLMA 3QIUA 3MFGB 3Q3QA 4LU5H 1B0WA 2X41A 3OAWA 1AQKH 5IK3A 1ZDSA 3D48R 5ESQA 3GPSA 4IGBA 1PX4A 3X3FL 1RURL 2CPCA 4JDEA 2RGRA 4P5BA 1AP2B 4PW9A 3O3EB 1ORQA 2K3TA 4HALA 1JHKH 3S4SB 4ATTA 4AYEC 5M5YK 1BLNA 5D1XD 4UTAA 2R39A 2VDLB 2IG2L 4XP4H 3MJ8B 2EP6A 5LGJA 5MEND 3DIFA 4PLKD 3QXTA 1UA3A 4ZFOB 1IGFH 2WXNA 3DSNA 4GG8A 3L5WA 1MPAH 1ZSHA 2MH4A 4ZPVB 2ITFA 3V4VL 1E27B 4XNQB 3O41A 5C6PB 2K70A 1IQWL 1Y1UA 4QRSB 4RBPK 3ERED 2FX7H 1IC1A 3D0AA 1F7VA 4IRSB 3UDWA 4XGZA 4UT7L 1RUQL 3TCXA 1UA6H 4YSTA 5IBLC 3QUYC 4G7YL 3TCLA 3U9PL 5IVXE 3K72A 2F53D 3R4RA 3S36H 2QV2A 1S7VA 1IBHA 1DJSA 3MC0A 3MAWA 4EI5A 1AZVA 5T5NF 4LPVA 1WLHA 2Z7WA 4AI7A 5CHNA 3EXJA 1MHEA 3OPZL 3QEQB 3QORC 3QUMH 4GS7B 3QPXH 5KBPA 1NWOA 4GTEA 3RNKA 4KO9A 1O7SA 1I50A 15C8H 3DX3A 5LQBH 1OB1A 4EBQH 4LQFH 1BQHG 1I3UA 4GKNB 1L7IL 3QFJA 5IQLA 3U25A 3KPRE 2V5YA 3PWJB 1NUFA 4E9QA 3E6FB 5KS9B 4NP4L 3FQUA 5DMYA 1G6RL 4OIAA 4ADJA 1N3NB 1DVFA 4B3VA 5T5FL 1J98A 1PZCA 4HK0B 1LE5B 3A4FA 5MERB 4B9CA 1FH5H 1VFBA 1ET8A 2J5LB 4RWYL 2E2IA 4GRLA 5I8OH 1K2DB 4OD1H 2A6IA 2EO1A 4HC1L 3CN3A 3OLIA 1IUZA 3H3KA 4UNTA 1QLEB 5L46A 1F6FB 1PJ6A 3QJZA 3UBXI 1BOGB 2F19H 3PV6B 2OXGA 4M7LL 3S6CA 4G7HA 3IPFA 1T5WB 5KYXA 1TFPA 4FHJA 5CCJA 3VXTB 4DW2H 4YEEA 5DMGC 2HCZX 4FXGB 4F7PB 4BH8A 5LKNA 3CN2A 1EEQA 4G8AC 4Z0BH 5KVEE 2Q76B 4DP7X 4HMCA 4PGCA 1A4CA 3TTSA 3DHMA 1OAZH 3WFEH 5FUZH 1SDYA 4G80A 4YZFF 2UY7A 3N43B 3BQUA 2XPYA 1M7DB 1QBBA 1T21B 2FH8A 3SOBH 1INNA 2HUEA 5CLZA 1YEDA 1S9KC 5F89A 4S10A 3H3VD 1GTFA 4QXGL 4LVHC 3V0JA 4BLBA 2H45A 4YO0A 5EMYA 3A8KA 2XA8L 3G3LA 1DN0B 3UJTL 4X6AK 3BAKA 4NM4H 2NNRA 5KVFH 2Q0ZX 4R90L 2RA1A 4LMQI 2A74B 3LV3B 5HYJA 3LKOB 2GC7C 3HMXL 3HNSH 1HIML 2I27N 2V0AA 1QG3A 3GTPA 5EU4A 5DK0A 4OY9A 5HGAB 4U1KB 2DLFH 1MI5A 1AD0B 4I77L 3TN0B 2AI0H 1MFNA 4BSVA 2V3EA 1E4KA 4YFKA 3FH5A 3NTCL 3G6AA 3L3OA 2BVOB 4WO4D 3QRFM 4JQIA 1Z9MA 3RIFK 3IJYB 2P45B 1MRCH 1XCTB 3MBWA 1JGUL 3V5DB 3D0LB 5AKSA 2XV2A 4NWTH 4C4UA 5I2IB 1K4CB 4QY8A 4OZIE 3T2NH 5AOLA 4J3BA 2VL5B 2BIPA 2ZXGA 3NCWA 1NEPA 2OMTA 2ZICA 2EIKB 3LQZB 5GRJH 2VDOH 1SMYA 1KTLA 1CICC 2XFGB 5AWNL 3WEBA 3U4EA 2N3JA 4Z7VA 1BD2E 5HDBB 3F65A 4YUEL 2L7EA 5C07A 4PI2A 1X7SA 5FYLL 4QJ3B 5LDUA 2VN3A 2V33A 2IMMA 3TA3B 1NANH 4GAAA 3Q06A 4N8PA 3GSXA 1NFDB 3BUYB 3N1FC 5DHMC 1YN7B 1ID5I 5LUMA 1E9QB 1ZY9A 3VA7A 3L4KA 1N67A 4OAWB 4ONGH 3T1FA 3VXOB 1KCUH 2P5WD 1K6QL 2OTUA 4A2MA 3UYOD 2EE6A 4ZS6D 5BZXA 1FO0A 4PJAB 2VLRB 2XIDA 2YZ8A 1CURA 3TJHC 3BSZA 5GS1C 3BW9A 4M8VA 2LFGA 5B22A 2VW6A 4FFYL 5ISZB 3DVGB 2ENSA 2X1PA 3ZKMC 3NJHA 3NJGA 1SVZA 4JR9L 4LDLB 4RSYA 2DQCH 1T0MB 1T5KA 4UOJA 4JM0A 5CEXA 3GSIA 2JQZA 2WQXA 1KYOJ 2D2CC 1QA9A 2YN5A 3SDCD 4J39A 4YX2L 3WYRA 4LCIL 4MBRA 1PJ7A 1YYCA 4U3HA 3ILQD 4EQ3A 1IKFH 2PO6C 3JWOC 5JW4M 5HD8D 3O11A 2OR8A 3AB0C 3MLXL 2CHXA 4NKMA 4OFVA 5ICYB 3AXHA 1OANA 2OZ4L 2YA2A 4G6KL 2FB4H 4PRPD 1EAOA 4HFWA 4BUQA 5KBNC 3GKZA 2QZQA 3LKQB 1DD5A 1HKLH 3WTWA 4X6DE 3P4MB 4UI2A 3O3EA 3PQYA 2YKLL 2PP7A 3VDCA 4O2EA 3V0IA 1MY5A 4MWFA 1J6XA 2CR3A 3BAJA 1CF8L 3RWGA 4DP4X 3MYJB 3JUYA 4IEFA 1CE6B 1KTRL 1I1RA 4OH2A 3L4XA 4ZPVA 2VDQL 2ICEC 4KROD 5CZVH 2XCRB 4ZYKA 3QB7C 1S3KH 3MNDA 2NVXC 4XNQA 4D0DB 3L4YA 4YOKA 4GMSH 4X9YA 3T8VA 1VKXA 1XGRB 4OQTA 4UZSA 4XC1H 4I4WB 1PNCA 2VXQH 3WNNA 1E2ZA 3SDXB 4GQZA 1A7QH 3X1NA 3GSUA 4YAQB 3D07A 4MVBC 2FO8A 4GJTB 2I07B 2Z64C 1RUPL 4FCHA 1RZPA 4Y1AA 3MBEB 5JVOA 35C8H 3EOTH 4L3EE 3GTVA 3IKCA 4LZKA 1J0KA 3ZTJG 1GS6X 3GSRB 2IEPA 4URTB 1SYVB 2XTLA 3TBBA 1YPZF 2VQ1B 1HDMB 5I8CB 1QUNA 5EEXA 4PBDA 2WC7A 1FJ1A 2YBGA 5AW7B 1H3VA 1JUFB 2PW1A 4I1PA 4NZUL 3BPCB 5DGQA 3II1A 5IGXL 1MJ8L 2MMXA 2BZ7A 5ECGA 3CK0H 3BP5A 3FB6B 3D4ZA 3VCLB 1ZVHA 2D2OA 3SGDH 3STZB 2BVQA 2WN2A 2YWZA 5KS9A 4JFEA 5DU7A 3UAFA 1KF9B 3VXMD 3T3MB 2FSEA 2W95A 3VD7A 2UZYA 1OGAE 4N0CC 5HDQL 4GZYA 1C5DB 3D39D 4M6ML 2VSDA 4UM9A 3QO0A 4EO5A 2N4IA 3BO8B 3BT0A 2IPKA 1G7MA 1I75A 4P9MH 5HHMB 4JFDE 5HL8A 1DJZA 3PV6A 4XNUH 2V8MA 4PMFA 4RZKA 3P77A 1QTYT 4KNQA 4JL2A 1KCRL 3EAKA 3EYOA 3CZUB 4YDVB 3KEHA 4FXGA 2AERT 3JWOH 1ZSDA 4K7PH 4BZ2H 1QSFE 4C56D 5B3NA 4N85A 1CG9B 2OJZH 3BKCL 3UZQA 1GYUA 3N2JA 5DUPL 2SEBA 1XGZA 3BPOB 3ZDZB 2Y0SL 1G7QB 2NR6A 1JPSH 1BZ9A 4B5ZA 4CDGC 1PG7X 3P11H 4JGNA 1ORSA 1WICA 1XGYL 3I6KA 3QDJA 3DC0A 2WLKA 3DV6A 3FOMA 5ALCH 4JZJB 3SKJH 1WAPA 2PWHA 4XP1H 3W0WD 4BSWA 2YU9C 3A67H 5C08B 1XL6A 5T3XH 1KN2L 5FK9A 3KGRA 5SWZE 2QQKH 1SRDA 4NQCE 5E6ZA 4DEUA 3TTGA 4G7ZA 1K3IA 3MLZL 2ZCLH 3DX2A 3QXUA 4MDJB 1GS8A 1KB5L 1VGEL 3EGDA 2GK0B 2Q10A 2L4OA 4JFHD 1GSKA 3H2PA 1YHPA 3GBML 3RWDB 1HJBC 4Z1PA 3CZKA 3Q2CA 2Z31D 4RETB 4E41A 1KJVB 4O4YH 4O02H 6CGTA 3U9WA 3HBQA 4GG6E 1HXMA 3KPQB 1B0GA 1A8JH 4MQ7B 4M6OL 4OFYA 4B41A 1WTLA 1CDIA 1GL4B 5HJGA 3QZWA 3TPUA 4KJPC 2WXKA 4ECNA 2PTTA 2DI8A 1WS7A 3RKDD 1MJJA 3GMQB 4AH6A 2B4CC 4WGVB 3R7QA 3QZLA 5A2AA 1J5CA 4PJ9A 4QPEA 2CO7A 3D0LA 1BG9A 3WUWG 3KLSA 2BP0B 4XBPA 2JLLA 4XPAH 4JPKL 3U0PA 2XJKA 1MXGA 1TZHA 4GAJL 4OKVB 5ANME 5C0EB 3K2KA 3K6DA 4H8VA 1RQ5A 4TQIA 1P7KA 1KOAA 3DROB 4GXUN 4PH8A 5D7JC 1MEXH 4F7TB 2VDNL 2BP8A 2OI9B 2DIJA 1E6JL 2O5NA 2P1YA 3CFDA 5C8JB 5I1CH 1IQ0A 3MRQB 2DWEB 4Y19A 3GWJA 5IROA 5LJYH 4PS4H 2H26B 3P02A 3RPBA 2Z93B 3L9EA 1I9IH 2ZXWB 4BKLB 4CADB 3VMOA 2V9RA 4JO2L 5IMMA 5B38B 3IDYC 3V79C 2NVXK 1KZQA 3AM8C 5GRXG 1HH9A 2M8XA 3GMMB 4P2QB 5GGTH 4XNZB 4XPGL 1W80A 4N9GB 1UD2A 4M7JL 3RY6C 4PWHA 5E6SB 3S2AA 2YZ1A 3ARFA 1AZUA 3G6JB 5TQ2H 4TNGA 5LNDA 5CD3A 4PJAA 3LXAA 3UTTD 2ZPKL 4OCYL 5CILH 4B95C 3QCUH 4AEHL 1TVBA 2QPSA 2COVD 3WI9A 1QBMH 2YQGA 2VDPB 5DZPA 3HXAA 3KBFA 4X80H 3JBG7 1Q9LA 4JY6A 4XP9L 4X7FC 4K3GA 3JSTA 3I3EA 5ESAA 5E7FA 1Z6JT 4GRWH 4ZS7H 1JDAA 2H0EA 2KZ1B 2WO4A 5I5IA 1F97A 2J1ZA 3Q01A 5G5DB 2A9MH 4KRLB 3VWJB 3Q8CA 3NEXA 4YHKL 4CDHA 2DQJH 1E2WA 2EYSA 1XT5A 2WMPB 4FFZL 3IS1X 4R4FL 1WZLA 1IFHH 1L6PA 3TH4T 1AHWC 3ARQA 4PJHF 1O25A 4Z7OB 1ZA3B 3LRSB 2X4QB 1DP0A 1A4KA 4IJ3C 5TE4L 4PM1A 1E8WA 2H7WA 4Y8AA 3KLLA 3D69B 4P4RA 5DVLA 3P4MA 5FA4A 3WFDL 5D1XB 2W81C 5C2BL 1W9XA 4P3CH 4ZFFB 2FGWL 3GDCA 1NCGA 4MZIA 5MENB 4UOW1 3GSNH 1N6QH 1ASOA 1LP9A 1G7IB 3PDGA 4LGSB 1QQDB 3OZLA 1E9OB 4XB8A 4XXDA 2FGZA 1PBYA 4WSKA 3QHFL 5GGRY 3E3QC 5HVHC 2JKIS 2FJFB 1NLDH 4O58L 2B4CH 4ISVB 3ESMA 1DSYA 3ZVVA 2Z92B 1J5IA 3L5HA 2P5EA 3B2DC 1O9WA 3TH2T 4N5ED 5FUCC 3NJJA 1EJFA 5DDHA 4KJYB 2DICA 4LL9A 4DN3L 5F9AC 4N0UA 3VG0H 1W2KT 3E3QE 4Y0GA 4C57C 1XGUB 3QIWA 4I4WA 5HI5D 4KXZI 1KEMH 3SPGA 3RZDC 5DRWA 2YPLD 2YU9K 5IQOA 3SDAA 4KOBA 4PREB 4JFYB 3AS3A 1S7XA 3NA9H 3KS0H 4XH2A 5GZND 2ZYIA 4YDNA 4M56A 5IMOA 3GGWA 4CW1B 2E7BA 3MNMA 3ISYA 4ZAKA 4ZX5A 1CXHA 2OMBA 2A2QT 4LOFA 5FJ8K 5I0ZA 3ZT5A 3DX9B 5M95B 5EGHA 3X3FH 1JTPA 1TO5A 1AGEB 3E8VA 3MV9E 1KLUB 3IDIB 2ITCB 2W0LA 2JKWA 3I3BA 3OMIB 4FYTA 3VCLA 2IG2H 1S4IA 3STZA 3VFNB 1KQ4A 3EJJX 1I3GH 5I0DA 4JKWA 2NW2A 4PJBE 5BV7H 4ODSL 1DR9A 2YUZA 1ZT4A 2WLZA 2ZX6A 3HCVB 2W1NA 1F6AA 3CVBA 4JANA 2H2PC 2OJEA 1BYPA 1ZXQA 3FFOA 4OM1L 1HCFX 5ID0A 4MHHG 4GW1B 3WE6B 1IQWH 2BWDA 3BD5A 2FX8L 2TRHA 3BEVA 4FFTA 2CBMA 1RUQH 2BIOA 3VG9C 4G7YH 4DP8X 3GJEB 2FK9A 1S7TA 1MH5B 4G6AC 3U9PH 1A3LL 4XE5B 1LTXA 2RHEA 1IV8A 1RJZA 3DX0A 4L9LC 1CG9A 3NG5A 4L3CA 1JF1B 3FQ2A 1GOGA 4WWNA 2KL6A 1AQ8A 3OPZH 4BCXA 3BZDA 1M56B 2MKWA 3IN2A 1V7NL 4PJIE 3E1F1 1Z0MA 2FO4B 4K8RL 4UTCA 3A0OA 1K5NB 1O7DC 3UCQA 3HIZA 1SQMA 5K5YA 1JL8A 4JZJA 5AG9A 2CNZA 1WV7T 1L7IH 3M1OA 4CU8A 3C08L 2WNGA 3MCYA 3T02A 3GM0A 3K81A 2P8PA 1O7DE 4NP4H 2KYIA 4H20L 5B39B 4K23L 5T5FH 1ZDQA 4DERA 2PW2A 1JWSA 2OSLB 4X4XB 4HOWA 4NEHB 1L9PA 5FYLE 5I26A 3UX9B 2BVYA 2EEFA 5DEFB 5HVFB 1F1GA 4RDQG 2CLZB 1LO5A 3BIAX 3P2BA 3KPTA 2EDKA 1E5CA 1WWCA 2WV3A 3ARBB 2C5DC 4W70A 1TWCC 4FQ2L 4FXKA 3Q2NA 4WO4B 2IDTA 3MLPA 4P23A 3KHOA 3LZFH 1A66A 3QUKA 1EAPB 3ARED 4FM9A 3L3HB 2AEIT 3M7OA 4L8CB 3IEAA 5F7BA 1JGLL 3E6HA 4YR6B 4A04A 1AJ7H 1IAIL 2LLGA 2GTZB 3EJQA 3RWCA 3K6OA 3KMDA 2B2XH 4R96B 3LQMA 1XZWA 3RRQA 3U7WL 5A2BA 1OAKL 4BQ6A 2ATKB 4XC3L 2FIRT 3ZYZA 4QJVB 1QRKA 5DHYB 4FEMA 2QPFA 2D9CA 3OJVC 2F15A 2R23B 2DH2A 2P4AB 2LU4A 1I9RH 1UC6A 4TSAH 3Q8FA 4QXGH 3QJQB 2P44B 3K71A 3W9DB 4IBYA 2XA8H 2X44D 3OKYA 3PUCA 4FA7B 3MRLA 2A83B 1OF0A 3IMUA 1Z2KA 1MCNA 3IJ7A 3JTTB 5IHBA 3UTSA 4R5TA 4A7UA 3BH8A 3S3SA 4XO4A 4H4NA 4QOKB 3K3QA 4M5TA 1T80A 4QLRA 4F92B 3GMMA 1QFHA 3QJHA 4H88L 3HMXH 1HIMH 1YMMA 4HKJB 4J6IA 3VGHA 4M9OA 5B1BB 3RZDK 1X5MA 2G30A 3UXFA 1A7NL 1YEFL 2QQLL 3HEIB 3O6KL 1TU2A 2A1WL 2CD0A 1UD4A 2O4EA 3NTCH 4QIRA 4Y4HD 4QI3A 1UENA 1CXFA 3PHQB 3NOIA 4QRFA 4QUOA 3US0A 4YLCA 4Y2DB 3VFWB 1JGUH 2K7PA 3ATBA 4GO8A 4XAKD 2XQ0A 5D7LD 4FS0A 2BOBA 4WI6A 5JXAH 1BDFA 3PJNA 4PU2A 1JRHI 5TE6L 3MKKA 4PJ7F 3ZZLA 2DQEH 5E6UB 3SDCB 3TVMA 2MEJB 4JY5L 4I1NB 4PAAA 3BKJH 1EZUA 4OJEH 4PRHA 1SXBA 3NRQA 2VZVA 3ZTJH 2FAUA 3H0GC 2YD9A 5AVYB 4KC3B 4GKSB 4JMXA 3OHMB 4JJ5B 4KPHL 3RVUC 1PGRB 3RKPA 3U1PA 4WHDA 2XCOA 5AWNH 2EIBA 3BUTA 3QR0A 4K94H 4NQEA 2JIXA 4DJMA 2GBUA 4WTXA 4WWOA 4YUEH 5J7CC 3IJHA 4LLMB 1SXCA 2DL9A 4IBZA 4PRPB 4TVPL 3O9WD 4KMQA 4JQVC 1VH2A 2DRUA 1T1ZB 1OALA 5CMAB 2JB6B 2X4OB 5ITBL 4RWHA 5DF0A 1ECYA 1GE9A 4HMDA 3QZPA 1FFTB 3CQPA 3UG4A 2E7HA 3OKKB 4PJDB 5JIPA 1GGUA 3Q1EA 5D1XA 2NXYC 3SDDC 3L5XL 4N26A 2GBAA 4L4TE 4MNHB 5C7XL 1ERNA 1K6QH 1PEWA 4EVNB 4NZFA 5JIKA 3DDGA 1QQDA 4GO9A 2JXMA 1Q94B 3ET9F 3ABKB 4I89A 3VXPA 2YMTA 3UBXG 4PJEB 4OVVA 1FFPA 5JXEA 5D1ZC 2FX9L 4FFYH 4PGZA 1XD1A 4NBYB 5DJ8A 3U2SA 1WO2A 2VT0A 3P3TA 1WSVA 5DJCB 5E9DD 3DVNA 5AVUB 2FEJA 5H8DA 4CVZA 5CKAA 1T66C 1ZLWK 4RGOL 4I0PB 4YX2H 2QFRA 4TUJA 1JHLL 5JNYB 1K72A 1NBVH 1C8QA 1HN1A 2F53A 4A6YH 2IFFL 5ABAA 1B3IA 1TZGL 4WCYL 5GGUB 4TNWK 4FADA 5BVJA 2CJ3A 2JFCA 1WCQA 2JH2A 5DS1A 5KYUA 1JXKA 3L1OL 4KJQD 4QMEA 1YAZA 2WLHA 3L13A 4H8WL 4DGYH 5E0FA 3BP7B 1P2CA 2KLTA 2R0KH 3QQ9D 5K1JA 4JNXA 1IEBB 1UD3A 2EIEA 5T3ZL 2X05A 4JRYD 3AMLA 5IVOA 2YA1A 1TWCK 2YKLH 3JTBA 3QJFB 4JS7A 3U4AA 3VFNA 4MZ3A 5KSUB 4G8FA 4PRNB 1Z5YD 2JJSC 1CF8H 4HDIA 4U3SA 4DO5A 3JWDL 1XH2A 3NZUA 4PCSA 3TO4C 3IBOA 3IFOB 2PUQT 4LLDA 4MNQD 2VDQH 1S7SB 2LQRA 5C0FB 4UMGA 5HHPB 3RI5F 1T1YA 1U36A 4K55A 2PR4L 4XXCC 3EBIA 2EXTA 4U33A 4DVRL 2PN5A 3C5ZD 1NIFA 3BAEL 4QCIB 1NGZA 2B0SH 3ZSSA 5J1SC 1TWHA 3CFBB 3S5LB 4FQHB 1U8HB 4PLJD 1GIGH 3KL3A 3EO9L 3O8XD 1EQWA 5IP4A 3B5TA 1OT4A 2WQAA 3CFKB 1CFBA 4C56B 4N20A 1WQGA 1KIQA 1NWPA 4FABL 5IB4A 4OGAC 1T4KA 1JPST 1H8LA 2J1XA 2Y25A 3ULUL 3AGVA 1H8SA 2IH3B 2WINB 1I8KB 3WEOA 1RJYA 3LY6A 4LHUG 4AG4L 1H6FA 4Z76A 1R9FA 3NMEA 3W0WB 1MN4A 2VRQA 3HPJA 5IGXH 1MJ8H 1Z5LB 4Y5YB 5EU6E 5DMKB 1PLAA 4ELDA 4U1SB 1J9CT 4G3YL 5E6RB 2UWEF 2ZXEB 4LASL 4JO1H 2YXMA 4H8QA 1MWAB 4N25A 4MQ9A 5B39A 3FRUB 2LLNA 4MD0B 4HGMA 3ZDXB 4XMUA 2CMRH 3E2HB 3O6FA 1KIUB 4ZTEA 5HDQH 3FQ4A 3GSVB 1D7BA 4M6MH 4P2YA 2VLME 3FMGL 1PYWB 1SXZA 2Z31B 4PJ8D 4YBLC 2DWSA 5DFVC 2BNUB 2DWTA 4IMKC 3U83A 3EYSL 5DEFA 3SD5A 2A77L 2VWEC 3VVWA 4X4YA 4A3LC 5GS0H 3H0GK 2WYTA 2WB1A 5EO1A 3CZSA 1XF3A 4QRUB 2EBBA 2FCBA 2HPOA 4A2LA 2VWEE 3OXRB 4J3VA 1TG8A 4MAYA 4NGHL 4JG0L 1JP5A 2X87A 3APFA 3HHMA 1IZKA 3TZVB 5C6WH 4LRNL 2GSMB 2C4XA 3M86A 1J18A 2ZKHL 1KYFA 1FYTE 3FFCB 3BKCH 3L4VA 1V10A 3ZQXA 3IDJA 1DUYB 1ZKAA 1WC7A 4KUCF 4AK1A 1FWXA 1AAJA 1XGYH 3BESR 4Y4KA 3UJIL 2OMUA 4XXWC 2VXSH 2QGCA 4NZJA 1T83A 2HJLA 1KN2H 3HNTL 2Q1EA 3FTWA 3MXWH 4GFXA 4MJ6B 3S98A 3QUYD 1H8NA 5G55A 2NX5E 3MXVL 1EHKB 3OKMA 4N1EA 2A83A 1KB5H 2R2CA 3IETB 1A25A 2W07A 4Z5RA 4PB9L 4KDVA 4PIRF 4WQOA 3VXNB 2R7EB 3BGFC 1F3DJ 2K1MA 2VB5A 4JK1A 3D85A 4NWUL 2P5WA 3O3BB 3QORD 1D5ZA 3DETD 3SKMA 3KPRD 4BFGA 5I17A 3AG3B 1HSAB 5C0CA 5MEPB 1YUHB 4NERA 4POZC 4U7SA 1U92B 5E1IA 3UTTB 1Z5HA 5FLMC 4OF6A 1GVIA 4G1EA 5K9KA 3HG0A 3PWPE 3SE3A 5K59E 4IRJA 4EN3B 3PABB 2E7MA 5JHLH 4MB3A 1CQYA 1ZT7A 4WJ5A 1ODUA 4IIZA 4LKXB 2PNDA 3GYRA 3C2SA 4JPKH 3SDCA 4GAJH 4R7NB 2AEQL 2C3VB 5HPMB 3SCMB 2IPTH 1YO4A 2WUBL 4XVOA 1IEAA 2OMWA 3GFUA 4JJ5A 5E51A 1A6ZB 1JTTA 2KHAA 1I8MB 2RD0A 1E6JH 4QTIL 3TXAA 1EX0A 4WJG3 3E0GA 2G5BA 1WT5A 3FQNB 3FTGB 1YUKB 4PQXA 4GT7A 4HT1L 5BS0B 4GT9A 5DMGD 1U4EA 5E4OA 3UBFA 1UJ3B 3VD2A 1OW0C 2YGVA 3QI9C 1BMZA 3INUL 3BUPA 5KVGL 3MOAL 5E9NA 4XPGH 1N0XL 4K5NA 5FECA 1G43A 2GTQA 4M7JH 5E8PB 4ES9A 3AJ7A 4DOHE 5HYFA 4GPVA 1HWHB 5ESVB 2FLRT 1Y18B 5E03A 5AW6B 4AYBD 4C8XA 1D2PA 3KDMB 1DQML 3AXLA 1C16B 5F7EH 3ARYA 5ECJE 4PJHA 2ZPKH 1MVYA 4OCYH 5DQDH 3VXUB 1XZQA 3QEUA 1JFQH 2R93A 1JGVL 4NKIL 1H19A 4P8QA 3QJOA 4ZO8A 3DK0A 3CZFB 1BECA 3FQTA 2YPLB 3LKNB 1U58B 1BIIB 4IBSA 3EGSA 5CSBA 3JT2A 4AM0A 1B3JA 1EV2E 5ILTL 2ZOTA 1MFEL 4GBXC 1LK2A 1T04A 4YHKH 2Y6TE 4ABWA 2A69A 1X9UA 4FP8L 1TJXA 4FFZH 1PVHA 2PWDA 4R4FH 3FONB 1ANUA 3SKNB 3SE4C 3IXAB 3WFCL 4BK8A 1SNRA 2Q2LA 3C60C 4OIQA 1OTTC 3P4LA 3DYMA 4R7XA 5D2LB 4BQBA 4ADIA 1D7DA 3TM6A 1XIWC 3NK3A 4K8RC 4RGNC 1HHIB 5A16A 2HH0L 2PXYC 1DQTA 3AAZB 5K9QI 3QAQA 4A3LK 2CDFB 1C12B 1A6AA 1QWNA 1MHCB 2Z4QB 1Q0XL 2FGWH 4NYLB 5AKTA 1BD2D 2NY6C 2X89D 3AGWA 3LH2H 3FRPB 3VXMA 3B9KA 2H8PB 4P2AA 1TETL 3SIKA 3D39A 3HE6A 4O58H 4WW2F 2E47A 3KGUA 2B63A 4XPFL 3CG8A 4ELMB 4ZZKA 4S1RL 4Z7QB 1HWGB 1AMYA 1U41A 3TV8A 3QCTL 1AC0A 5J3HC 3R0NA 1QASA 3DRQA 1VIWA 1QPPA 4JFXB 5A40E 2ZUFA 1QR1B 3KGTA 3CCHA 2MFNA 3CAGA 2MOVA 3CX5K 4FTVE 4IMLB 3VFPB 1LWRA 3AABA 1ADQH 2J71A 4FULA 3HKZA 4G7RB 4PJ5E 3WS6C 2ZJSL 1HWWA 3FU0A 1L9OA 3DMMD 5FKAB 1ZLUH 4YJZL 4LPXA 2YPKA 2X9ZA 2PYEE 3LRLA 3N0AA 4FJZA 4IHOB 4U4BA 1KYAA 2R8SH 3QG7H 1MVUB 4HS3B 3TJHD 1W72H 5CKGA 2IH3A 1KCBA 1A2YA 1SVCP 1U93B 3EFDL 1A8ZA 1HE7A 4LCUA 4X9HA 4XZUA 3FQWA 3W0WA 1HEZB 2CSPA 4GW4A 2XXCB 4A3BC 3LEYL 3GXTA 4M61A 4U1NA 1JPTL 4U1SA 2OW7A 3C8DA 1RPQA 1VFAB 4LDOB 4PTUA 3CHPA 4H1LH 5FLMK 5L4JA 1EXUB 3AQPA 2O61B 1BPLB 1XB6A 3O4OC 3GTKC 1PX8A 1CDGA 2EE2A 3VX0A 4JLRA 4HP5A 4U6XB 1C5CL 3BQVA 2PO6D 3JTSB 4WAFA 5DI8A 5E5MB 1FAIL 4LVNC 2YSTA 4UQ3A 2CO2A 1KBBA 4OM1H 3HBGA 3ILPA 4DWHA 5E8DH 1KCKA 1J88A 1UXSB 1KJMB 2AV7A 1FVCA 3UPRA 4M7LT 4JHVA 4FI6A 3UBHA 3HZYB 1I1YB 3QQXA 4L1DA 1O2AA 3EUUA 3UYPB 1TVHB 4LBEA 3B7UX 4N8VA 4QRUA 1ZA6A 5IVXF 1GGTA 3LN5A 3NN8B 5ACMA 1A3LH 2YRLA 3RJOA 1HINL 1U0QA 4S1QL 3WFHA 5L8LB 2B5IB 2BSRB 4PIBA 4WU5A 4WJ3M 4EZLA 1KJ2L 2VDKB 3DOSB 1HI6A 3M45A 4X6BA 4C4KO 5CR1A 3U30B 3N1MC 3IVKA 2AXGB 2RCSL 3OG4B 2VN5A 1V7NH 2AQ1A 2PPDA 2E9JA 2YHGA 2WAQD 3NGBC 3ULSB 4ZX6A 1BREA 1IGIL 4I2XB 3QWOB 1SPDA 3ETBF 3EJTA 4QXWA 4ZSOB 2BW5A 4MVBD 1E2VA 1A1MB 3H0TA 4WLCA 4ENEC 4H20H 3K6IA 3S3BB 1Q38A 5I8KL 1FGNL 4YMPA 4NUGH 5E2JA 2ADGB 3LN9A 4WUUD 4WGKA 4CRPA 4A7GF 3WDIA 1CDJA 4U1HB 4TVPE 5GJSL 5JMOC 1BQRA 3IJSA 4KITB 5K93A 4XNBA 4M7ZB 4C4KT 4NQSA 4FQ2H 4Y4HB 1WOPA 1TF4A 1HSAA 2UX6A 2WGNB 3KL5A 3N1PC 2JCWA 1FZKA 2APTA 3UTTA 4NP9A 2QPUA 2CUHA 5I15H 4LQ1A 1OGAD 1MFBL 5DT1H 3MGOB 4YDJA 3GRBA 4Q9RL 1IBBA 1SEQL 1IC5L 4FKEA 5GSRA 1JGLH 4QYOA 2WZPD 5A2CA 5FOBA 3FTSA 1IAIH 3CFCL 4N0CD 4ETQB 4HKBB 2ZKMX 1S8DA 1KB9K 1OAKH 4XC3H 1NFIB 1WP6A 5FF6B 1EEZB 3ISWA 1X6LA 3EXLA 1A9EB 4L8SB 5EUKB 2AF2A 2PETA 4ONHB 3O2VH 3DPDA 4I48A 3EJRA 3L2LA