4ILDA

Crystal structure of truncated bovine viral diarrhea virus 1 e2 envelope protein
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
241
structure length
235
Chain Sequence
DVVEMDDNFEFGLCPCDAKPIVRGKFNTTLLNGPAFQMVCPIGWTGTVSCTSFNMDTLATTVVRTYRRSKPFPHRQGCITQKNLGEDLHNCILGGNWTCVPGDQLLYKGGSIESCKWCGYQFKESEGLPHYPIGKCKLENETGYRLVDSTSCNREGVAIVPQGTLKCKIGKTTVQVIAMDTKLGPMPCRPYEIISSTACTFNYTKTLKNKYFEPRDSYFQQYMLKGEYQYWFDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of glycoprotein E2 from bovine viral diarrhea virus.
pubmed doi rcsb
source organism Bovine viral diarrhea virus 1-nadl
molecule tags Viral protein
molecule keywords Envelope glycoprotein E2
total genus 38
structure length 235
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-12-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3000 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ildA01
3.30.1360.280 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4ildA03
2YQ2A 2YQ3A 4ILDA
chains in the Genus database with same CATH superfamily
5GRZA 3MROB 2NY7L 5K5YA 3S34L 3NAAH 4IRJC 1HEHC 4CSZA 3GBDA 1QI3A 1R3HA 3FHAA 4K4KA 3BJ91 4D7PA 2G4GA 4A3BK 1B0WA 1YEDB 1BQHG 5F70A 4QXGL 2HCZX 2NY6C 2HRGA 4H5SA 3HZMB 4TQ8A 1K9TA 2YARA 3QIUB 5DMIL 2WB7A 1KT2A 3QPQD 3U1PA 3U4EA 2A6EA 4G5ZH 3I85A 3TO2A 3S88L 1J1OL 3FB8A 3MYZA 5DLML 5EBLA 2G3XA 2D03L 4FHBD 4YBQD 1BVOA 3BSHA 2ZXDA 4LCIL 3G5YA 5E2UL 5HGDB 4UBDC 4FERA 2HP4A 4BXXK 1N64H 1T6VN 3S4SB 5J1AB 2CR3A 3IJSB 1FN4A 2GK2A 1G87A 4JUTA 4XPAH 3VRJA 4HJTA 2O5XL 4TL5A 2BNRA 3DUSA 4P3DB 2DPKA 5I18H 1U42A 4XO3A 4FI7A 3MJGX 4UQAA 4EI5D 3MO1B 1I31A 2QV4A 4KY2A 4AEHL 5FW6A 2FWOA 1MI5D 3VH8G 1QSFD 3OVUB 1CLCA 1MFAH 4ZAKC 4I2XA 2ATKA 5BCAA 2PPBA 4R26H 3UABA 3HOWK 3OMZA 5C07B 5FGBA 2J6EL 4AEEA 5BOJA 3FRPA 4A3CC 1B4JL 1T5WA 1Z3RA 4DKEH 1R3IH 4E42B 3AXLA 1PSKH 4A66A 5I16B 3O8XD 2BFVH 3WELA 4KBPA 5L7XL 5T1DH 5D1XD 4XPBH 5IIEA 4X9IA 4U0RC 4RMBA 2XPGA 1A7PL 4XOAA 3CX5J 2ROXA 5AB2A 5I75B 2KLRA 5D6DC 2X4QB 4A7TA 4PB9L 4L4VD 3QQDB 3L4CA 4KROB 2ITCB 4Y5YA 2VKWA 4Z3HA 3DXAD 2DZEA 5D1ZI 2Z31A 4ELKB 2Y1YA 1YYLL 2ZX7A 5TE7L 3WTTA 4LEXL 4QRSA 2BWIA 2ZF9A 3NZHH 1KB5L 4P2OD 1OF2B 3P9MA 3WKML 1UUSA 3EJCA 4RSVA 2J44A 2IDTA 1D6VH 3L1FA 5IQNA 4L3CB 1BD2E 1SVZA 5IM7A 4TOYH 5EN2B 3UO8B 3EH1A 2AQ3A 4QJVB 2ZCZA 3CDCA 3DX6B 2VXSH 4R7XA 1QRKA 1OF0A 2E7LA 4W81A 5I5MA 2PA8L 3GMRB 3IRPX 1NUNB 4KK5C 2VUKA 4KB2A 3IU4H 3Q8FA 4HWBH 4CA4A 2B59B 3KYKH 1N4XH 5C09B 4F7PB 4S1SL 5DYOA 1M6OB 3O3BB 1QFUH 2YMTA 5HD8D 3MLZH 3QCVH 4IBZA 4BCYA 4PGCB 1NCBH 5ECJE 1BM3L 2IAAC 2WBJA 5IB5B 3LNIA 2AK4B 2IQAB 2DTMH 1S7VB 3BDYL 3IFNH 4U1KB 2BVPB 4ABVA 3V8CA 1T4KB 4IDJL 3QI9B 4JM4H 3BZ4B 1VESA 2JJTC 3P0VL 3OHXC 2GTWA 1HCZA 2P80D 4R0LA 5HDQH 3GF8A 5I17A 1JDAA 2VJ0A 4EI5B 1OZUA 1G5GA 5D7JD 1AD9B 1G1YA 2NY1C 4XE0A 4UT9A 2WXNA 4LDLB 3VNZA 3ABGA 4HJ0C 1AR1C 1PG7W 3EGXA 3MV9B 2KHAA 4D8PA 4F9LA 3WIIL 1SQ2N 3VXMD 5M3FK 1D5IL 4K5PA 4FFZH 2BNRD 3AY2A 3BQUA 4PJ6A 1DR9A 4JFFB 1E2ZA 3DX2A 5EWIL 3I6KA 3N04A 5E03A 5JW3L 2EXYD 4WI9A 3L13A 5FHBL 1HZHH 5BOZG 3TURA 3L7FA 3WODA 4KATA 3V4VA 1S2EA 6TAAA 2W94A 2QPUA 3T8XA 4BZ2A 4K71B 3IMUA 3SBRA 3LNHA 3P40A 1KJ2H 4UTBL 3S15K 2XBDA 5MEPB 1T1XA 2FL5B 1FYHB 3G3LA 1QHPA 3AADB 4PLOB 3U2IA 2LABA 5BXFA 4XNAA 1IC7L 4ZO9A 3F6JA 2YU9C 5BVJA 1UB5A 4NZUL 1U3ZA 4HD9A 4G7ZA 4IRSD 1N0XL 3NJGA 4HHWA 2J88H 2ITFA 1T66C 3PNWB 4J4PC 4L4VA 4LMQI 1I3QA 1A7RL 2WVSA 4POZD 4DZBA 2R7ZK 1E5CA 1NFIB 4M8QA 4NFDA 2OW6A 3DXAE 4JDEA 4JFOA 1TWFK 4Z18A 4ZS6D 4KNQA 1FFOB 2WWMC 4IS6A 4QRUA 2Y06L 2YEQA 2R0LH 1QTPA 2WXRA 5B4MD 1W16A 3APDA 3C5ZB 3OR7B 4YX2L 3R7RA 2B63K 2X2HA 5KBPA 1ACCA 4LLWB 4WKZB 2WXIA 2F1EA 3HVNA 4PJGA 3O6FB 4Z7WA 3ZIYA 1IEHA 1R9TK 1JK9A 3EJQA 1WCQA 4GIAA 3S8WA 5I82A 1NC4B 3VDCA 3CMGA 4HJJH 4XHJD 4WUUD 3RWDA 2ITDA 1N6UA 1OT1A 1PZUB 4NUMA 2Y2TA 3QJFA 4FQQB 4XPAL 1XMEB 1HNYA 3BCFA 3GB7B 4O2EB 1AC6A 4BSWA 3NUKA 2X9ZA 4HOWA 1AP2A 1EFXD 3IDGA 1W0YT 4AE1A 1UB5B 12E8L 2BY2A 3UPRB 4O9HH 2FYYA 5T33L 1A3QA 2AXHA 4CC1A 1FFTB 4NQCB 1NBYB 1DFXA 1IM3D 3HAEB 4ZXBB 3CFUA 4NKQB 3QDJD 3T8VA 2VR3A 3GKWL 4YUEL 1A2YA 1AZCA 4YFLF 4G8IA 5IW3A 1LO0H 4CRPA 5TK2A 1ZLEA 3MOAH 2X1PA 2ZKHL 3BUBA 2YD4A 4PJXF 3GPSA 3HAEH 1E50A 3TCLB 2R29A 4I5BB 3VSTA 4HIIB 2BFVL 4AYGA 5EBMA 4RGNE 1HOCA 3VFTB 1Y0LA 1NMBH 1P4BH 1WA0X 1TLKA 1EHNA 4CMMA 3L4TA 5LLIC 2EYSB 5ADPL 3EZJB 4PIRF 3RZCC 5IVXE 4P3CH 2QSCH 4BSJA 2IQ9H 5TDNA 4I18C 1KF9B 4OQTA 3BYYA 1CGYA 7FABL 3K7AK 2WZ0A 3ROOA 4H8HA 4M1GL 3N3EA 2CMRH 1RZFL 4RRPA 4X9HA 2HVJA 1NBQA 3H3VL 4A2DA 1XX9C 1KV7A 3FU9A 4H13C 4HIEA 4UILL 3F6LA 3EG9A 4MJ6A 1DZBA 5CFAA 4LLQB 2PTTB 4WO0A 1NSNL 4ONFL 3RX7A 4C45A 4HJGB 1O7VA 1PMYA 4M5SA 3QCUH 1EAPB 3VFWB 2BDNL 1WWBX 1KQ4A 2ICWA 3RY6A 3KXFE 5JQIB 5JDJA 5IOQA 2HPOA 2D3LA 2ZX8A 5F9OL 4OQ1A 1OT2A 4I3SL 3WAKA 1VFAB 4Y52K 1AH1A 3NESA 1H8SA 4DGYL 4B3EA 2RBLA 2V5TA 4LL9A 2EDKA 5F3BB 5LG6A 1XGPA 3K0WA 2YIHA 3SPJA 3VXUB 2VSDA 3MGOB 1FLTX 3VMNA 4JREB 1M7IA 2IMNA 4YHPA 1YY8A 2PO6C 5E7FA 1MFEH 3HHSA 5J11B 1QLRB 2EDRA 1W0WA 1WZAA 3F7VA 1NCOA 2PYEE 3QJOA 1AAJA 4N5EC 3FCTA 4WI8A 4LEEA 5LNDA 1QUPA 4NPYA 1JNJA 4XN7A 1N5AB 4MAZA 2GSIA 1M9SA 2HVJB 4A3EK 1S3KL 1KZQA 1UXMA 1WQHA 1PKQB 1I9RH 4PGEA 5CBEA 3PABA 3ZN6A 1UOLA 3ZJAA 2B3RA 5HBBA 4HJGA 2WNKA 2EXSA 5A3ID 1H19A 5IW6B 1EK3A 2ADJB 4XVUC 4OIOA 1XXFC 3BH8A 4FJ6A 5J1SC 5DYFA 1HINL 3C6LC 1YPZF 2QKIC 1ZQ1C 4KDTA 1V3KA 2GAGC 2VC2H 4A3KK 3DX0A 4OIFA 2BNRE 4NBXB 2C9UA 5I1GH 5JUEH 3CQZK 2OAAA 3G4CA 3VI4F 3AU1A 3CHRA 3WCYA 4M1XA 4TUOA 4L4TA 2BMKB 1CD9B 1P2CA 3QXUA 1F5WA 2YLHA 3IK2A 3QUML 4GFXA 5EBGA 5F88B 4PW3A 3KLLA 1F1DA 1JFHA 3MBWB 4Y1TA 4OGQC 5KBKA 2FJUB 3R8QA 1S5HA 2RR3A 4OFYD 5DA4A 4YWGL 3JTBA 2BRRL 5GS3A 4JKNA 1UXLA 1X9RA 3RURA 3GBNL 2E7CA 2Z31C 2HRHA 2DQIH 2D0FA 1A3RH 4YR6B 5EGHA 3GMPB 4GW5A 4HKBA 1VZIA 3MV11 1UD3A 1X6NA 2E7DA 3O0RL 5I8CA 1KFAH 4XP5L 4WV1B 1NKOA 1P4LA 1SJEB 4M6AA 4FG0A 2R92K 2Y6TE 3CFJB 1F6AB 4K3JH 5CD3A 3BH8B 1NGWB 2BNQA 4GSDL 2A74A 3DOHA 3SY0A 1HXMB 3WJMB 3ASNB 1MY7A 4OZFB 4G9DB 2PA8D 3N40F 1W80A 1XSOA 3ISRA 4IW4C 4L8DA 1D7BA 4QGTA 5D7KE 3W1ZA 5I30L 3TO4C 5DFAA 2VSMB 1IL2A 1YEFH 1CURA 4Q2ZA 3T0AA 3F12A 3KPOB 3J2PA 3BKYL 4LHUG 1FV1A 3L48A 2NY4C 3DBXA 1YY9D 3J8F7 5EZLB 5IJVA 5EB9A 5TJWK 2QJDA 3H3PH 3QPQC 4GB9A 4P5MB 3HZVA 2P8PB 3H9SA 3O9WB 5CLZA 5IB4A 4Y1AB 4HS8L 1GC1H 1Z9LA 4NQXB 5GS1B 2FR4A 2EZ0D 2CZNA 4DEWA 3SDXB 4YFXA 2VRKA 4R3SB 2DM2A 1GTFA 2H32H 2ZWYA 3HG4A 5GGVH 4BUHA 1G7QA 5CJOL 3S1NC 1E65A 3EYUL 2BVOB 1KT2B 3HMWL 1SPDA 3MACH 2X4UB 2XWBA 1TVHA 5IVXF 2ZNWA 8PAZA 2O5YH 4JKLA 4NERA 2HJKA 3QUZD 5HVWA 3RX8A 3ZMEA 4YSDA 2Y07L 4D9QE 4IRSB 5A6LA 5BS0D 2VLLB 3BKMH 5LXGH 4Z7UF 2BMKA 4NWUH 3S7GA 2YU9K 3V4PB 3FT2B 3TX4A 3ZTNH 4C2MK 2C9XA 3TBBA 1DVTA 1FN4B 2J4WH 3CQQA 3MLXL 1NMBL 1IFHL 3RVTC 3V52L 4K73A 2UZXB 4Q7DA 2XZQL 4U49A 1NH6A 2OJEB 4MBRA 4X6CE 3VFGH 1O7SA 4GAFB 4TSCH 5A43C 1DQIA 2ZUXA 1FZMA 5JLZA 3RWGB 4XSZA 2EVIA 5IMLA 4X0KB 4RMWA 3QPKA 3CZFA 4KARA 4NI6A 1GGIL 3DUUB 4QMEA 2E0PA 1TWFA 3FOLA 1KNOB 2L04A 4XBGB 5HYJA 1A0QH 4PBXA 1XCQA 3JYCA 5C6WH 1DDHA 1IEBA 2YMXL 4HZAA 4MD4A 3PJNA 2JIXD 4PRPD 3WEXB 1NC2B 5DF0A 5TK4A 4N2IA 3KPRB 1OW0C 2H2PC 3MUJA 2R8SL 3E2HC 4HEPG 4ZPTA 4G43A 4X6AC 1FJ1B 3U9UA 5IP9C 4LEBA 2J8UA 1F3DH 1WCMK 3AMKA 3QBTB 4FS0A 3TT3L 1TJIL 5I0WA 2Q2LA 3TYFA 3QZPA 3SQBA 4PJ9A 4F8TA 4ANKA 2G5BB 5JHAA 5D1QB 2VUMC 2PHCB 2G75B 1QBLH 4IU2A 5E24E 3ZE0E 4DP4X 1QABA 3RX9A 1EX0A 4K3GA 5ENWA 5FDWB 1U91A 1CJYA 1T1ZA 2IFFL 5ALBH 5JPNB 4G6AC 2NZ9C 4MJ2A 2O5JA 3UJIL 3SE8H 1UWXK 2KH2B 3SE9L 4YAQB 4ELMF 4KX8A 5IB2B 5D1ZB 5GGVY 5FFLA 2EILB 2PPEA 1IC0A 1YPZE 4J39A 4K9EC 4ZQKB 3D39B 1P4UA 4RAHA 3GMRA 3FL7A 2B2XL 4OM0L 2OR8A 4PRID 5KVEL 5CLWA 2DWDB 1L9QA 1NMCB 4X99A 1BV8A 2Z4TA 2I69A 3PIQA 4K3EL 4QWWC 4H1LG 3ZL4L 1T5XB 3B7UX 2VLME 3EYVB 2W88A 2BHYA 1ZT4B 1IQ0A 1N59B 1EZUA 2AP2A 3QUZB 1BIIA 1Y18A 2VQUA 4Y5YC 1TJHH 4X5QA 3SGKC 1UQSA 2ZCLH 3QO1A 3X1EA 2J8UB 1S7WA 1CQYA 3CDFA 3IMRA 2P8LA 1F3JB 2VR6A 4L48A 5D7JC 5FB8B 1QYGL 2KWAA 4I1NB 4HMCA 5G4OA 4RQQB 4UM9D 5I1LB 3OC8A 4XXCC 4XO8A 3FQUB 4B41A 2EYTA 5JIKA 4GT9A 4K15A 3M45A 4WFED 5SWZD 4EOWH 1UH4A 4N2LA 2EEAA 3HOUC 1U91B 5C0AD 4K5MA 4FQHA 3QRLA 5T1LB 4HFUH 3BMVA 1FF5A 3C5SB 1UT9A 5IFHL 2FVNA 2X4SB 1KXTB 3V0AC 4YHYB 2KZKA 1CD1B 5DVLA 2VDPL 4D3CL 4B9JA 2WQXA 4KKZA 5EDXA 2N1TE 4I9WD 3S96B 3BYTA 3DDGA 4ZPTB 5KSAD 5HI4D 3UZEA 1MVUB 4AL8L 3EF4A 1JAEA 2WLMA 5C6TL 1KYOJ 2NY5H 2YZ8A 4DKDC 4ZUVA 4Z7WE 1DCLA 4HS3A 2XQBL 2CKNA 4PRBB 4ZSOE 1CFTA 1HL9A 1WS8A 4QRPA 2IQ9L 1J9CT 2DM3A 4HIHB 4HLEA 5HI5C 3KLHC 1XZQB 4YS4A 4XNQA 3EOAB 4WNQA 4U3SA 5EOTA 2OL3L 4CVZB 3KPLA 3D85D 4OF7A 2FT7A 1I7TB 1UUNA 1YEDA 3JV5A 1KIUA 2VH5L 4DUWA 3PHOA 1YEHH 2HUHA 2JB6B 2GC7C 1GTNA 4XNXH 1WCBB 5AVRB 1WYJA 1A1NB 3MNWB 4MLSA 4R2GB 2ZKWA 5F72S 2KS0A 2XA3A 2ICWJ 5FK9A 2NCEA 3LAJA 1JK8B 1NFDB 1M6UA 1NEUA 2Y5QA 3PFQA 1MCNA 4YX2H 3FTGB 3GXMA 2M83A 5JA9A 4M6OH 1CD1A 4JJ5A 4GKZB 4JGJA 4N24A 2Z34A 2NR6C 4LPUA 3QJVB 2UYLA 4LLAA 4F5CA 1AR2A 2VLRB 3BD3A 1PJ6A 4HISA 2VXQL 4DZ8B 2WM0A 1CE1L 1MXDA 1PU0A 3CSFA 4WSGA 4ALAH 4C83A 1CGSH 5F7EL 1NFKA 3V5KA 2ZCHL 3L2LA 4FQJH 3B2UD 4HKZB 4U3CA 1BZ8A 1MREH 2ZP0T 1EA9C 2B1OA 1FP5A 3OR6B 3VWJB 2PYFA 5C0RL 2OM5A 12E8H 2G0LA 1E43A 4JRYD 4BKWA 4PRDB 2Y25A 2ZXGA 3ETTA 3REWB 3I6KB 4NAMA 3S37X 1N18A 2X4SA 4QCIA 3MV9E 4GG8A 5IG7B 4NZJA 2IAMC 1OHZA 4JY6B 4W9IC 2ZOLB 2VMEA 1FAIH 2FYYB 4R5TA 1FL5A 1PLCA 3EH3B 4U1IA 4XMPL 3CAGA 5KBLA 1I6VA 3AY4A 3QUHA 3L9RB 1JK8A 2WMPB 4FNTA 3AM8A 5CS7A 3GMOB 1M7DB 4K55A 2X4QA 5IMOB 4UU9A 4BBWA 1V05A 3D05A 3CCHB 3FQTB 1VADB 4PBVC 4GTEA 3NCMA 2WXJA 1BAFL 4G8GA 3T4AC 3D52A 1GYWA 3NRQA 3KEHA 2E9WA 4NIYE 1MZYA 2EYSA 1T7ZA 3FRPB 4Y88A 3GUTA 4XCNA 4Z7WF 3F58L 2OULB 1NUGA 5LNEA 4NAJA 1F90H 3UBFA 4JFOB 3CSGA 3VNYA 3CZNA 4NQEA 4G7YH 1DN0A 3T65A 3SYQA 3EO9L 2Z0UA 2DQUL 3TBYA 1WIHA 4PW4A 4MA3A 5JA8B 2MPVA 4LRNL 1ZWIB 4Z7QE 1IO4C 3JVGA 3B7SA 2BS8A 1PFOA 4A2HA 5CGMA 3SCMD 2UZIH 1J6XA 2IV8A 3EUUA 4X7EC 3G04B 3D3VA 2WLHA 1I1AB 3FB6A 4FJZA 3R8BB 5F6IB 2N7SA 2PW1A 1F00I 3RU8L 4P4KA 1EMTH 1PAZA 4KJWC 4N5ED 5EOCH 3O4LE 5I19L 1HEZB 4TTDC 1T7YA 4K3EH 2V17H 1LHZA 1HJCA 4IOIB 2PPAA 3QQ4A 2A9AA 3HE7C 1JZEA 4ZO7A 4MAYA 3A6BH 2NQCA 4BFIA 4HK0A 1MW2A 1ZLUK 3VMPA 4LSRL 4KMQA 4UDTA 3L3DA 5GPRA 4ZW5A 2YJQA 1E2VA 4Y9FA 4HS8H 4L3EE 2CM5A 2BP5M 3JSSA 3QZMA 5HYSA 5KVFH 3ULUC 2IBZY 4IHOB 4MA8H 3BFQG 2CRIA 3FNKA 2YRPA 3K8KA 4XCEA 1FGNH 5K9OB 1UXSB 4MQXD 3VXMB 3B37A 3HOXK 3I3DA 3SGJC 3TIEB 3T09A 2AJUL 2EEXA 2WKOA 1YYML 3LH9A 1HK6A 4WWKD 4V1DB 3FKUS 4OFIA 4X6DA 3RNQA 4RBPK 1WOSA 3ECQA 4WY7L 1RZJC 3TWCH 1DBBH 2J12B 4JR9L 4ODSL 3FT4B 2FEEL 4M4RB 2QSVA 3R18A 4PP2A 5L4IA 3VWKA 5IYBK 1E8XA 4KRLB 2W91A 2IDFA 3KD4A 2FJGB 4KKPA 2PXYD 4PJ8C 4AH2B 5E1IA 3T6QC 3EADA 4TUJA 4JG0H 2JH3A 3NFPA 3NSJA 4OGAD 2DYPB 3TZVB 3UC2A 5CBEB 3TV3H 4RMVA 5FEBA 5HY9B 4R7NA 4JPSA 5AVSB 1C16B 1R33A 3GBLA 2VH5H 4R26L 2XN0A 2Q8AL 3UTQB 2HG0A 1U21A 5EUOA 4PJ9C 2BSBA 2X3CA 3LSOA 4OCRH 5C2UB 3CZGA 1L9MA 2YA0A 2ED9A 5IQ9A 1YNTA 3OR7A 3Q06A 1IRAY 2P8MB 1ED3A 2XQYK 3OKLB 3DHJA 4Y1AD 2QKIA 3P4MA 2YXVA 2GI0A 4FG4A 2XWXA 5F7BA 1UM6L 5CEXB 1G9NL 5H4YA 1P53A 3EBAA 4U1JB 3VFNA 1VF5C 3QX3A 1QRNB 4YPJA 2XC8A 1PKQA 3GZKA 4JW3A 4N1EA 5ICXA 1DCOA 4U7SA 3ILQC 1ILUA 2G2NA 2HKFH 1EPFA 2Y5TB 2AXGB 4Y9BA 4IK6A 3PU7A 4JFSA 3IFOB 4NNYB 1PNCA 4QYAA 5CN2A 2YSSB 2PN5A 1MREL 2XWJA 2AMGA 3ATFA 2XHNA 1VJSA 5HPMA 1JSYA 2F6AA 1A6UH 3NSYA 2YJLA 1IBGH 4A3FC 4G7RB 2CFAB 3JWNE 4DUVA 3MRJB 4AYDC 3P3TA 4LP5A 1SJHB 3TCLA 1HKLL 4MBOA 2ODIA 2DD8L 3RWDB 5JXEA 3QZWG 1R3LB 3UTTD 3IAPA 4AC4A 3KH4A 2WPGA 2EAEA 4LARH 4WJ4A 5C0GB 3L5WB 2A83A 2D03H 1MPAL 3FN0H 3PCYA 2VR8A 1RK7A 2GTZA 1AO7B 2XN9A 1FYTE 4WWKB 5E6RB 2E46A 4R2GD 4X6FA 2XQYA 2CDEB 3CTTA 1MRCH 3WY4A 4OGYH 3DIVA 1IEAB 3PQYE 4NGHL 2UZYA 2NNAB 2WQUA 3ULVH 4ZMLA 1DQLH 3H7BB 2WINB 3W37A 3LVTA 3WNIA 3HPLB 3IFLL 3GLEA 4NZTL 3CBKB 1CFVL 1JNLH 4ZW7A 5AOMA 4D0DB 3GUFA 2H4EA 1BLNB 3PXHA 4AQ8A 1NCUA 3FW6A 5J56B 1KLFB 4DO6A 4D9RD 2HJFB 4RLDA 3RTLA 3BN9D 2WZ5A 5BMFL 4E9WA 5AZ2L 2EVHA 2X4UA 2E74C 5C08A 1L6PA 2NY6D 3OLDA 2GBTA 1MHPH 3M46A 2ICWI 3QDME 1HTYA 5C6TH 1LVEA 1U9KA 1NAMH 1TTRA 1E5YA 2GC4C 1M53A 4XP4L 1O75A 3JQOB 5EIIG 3RUGA 5A7EA 1KBPA 1S46A 5JPMB 3LN5B 5C7ZA 4R4FL 1YAZA 4N9GB 5IMKB 2ZWZA 1V54B 3NJFA 5F3FA 2B5IC 3BVNB 5FUOL 3S5YA 5I19H 4BK5A 4KVCL 1KOAA 2F5BL 2FHBA 3HZYB 4KRPC 4ZMPA 1F8TH 1NEZG 1CVRA 1S3RA 4XN2A 4NQSB 1OCOB 2GJZA 3G6AA 3HN5A 4I4WA 4PN6A 3MRLB 3BPLB 4WO4C 1OP3K 1PS3A 3LZFH 2XA8L 2A6KB 4TPRL 2QT6A 2OZ4L 2X70A 3O3AA 4JPKL 2WSKA 4QRBA 3TJEH 2FJSA 1WRFA 3KXFB 4ZG1A 4NFCA 1E0OB 1NGQH 1K83A 3I9GL 1LE9A 4F7EA 3X13A 5B3NA 5FHAL 1XBRA 4GMSH 3GSXA 2XN9B 4YDNA 5CKAA 1G1KA 5DJAA 1JXKA 4JVUA 1NANI 3LZNA 4ANWA 5IWLA 5L2JA 1OOAA 3AU1B 1NAKL 3QCVL 3KBPA 3ZE0F 2ZP8A 4HPYH 1L0XA 5IQ7H 1TTFA 3BZEB 2WQVA 1SOSA 1FE8L 1NEZB 2Q8BL 2H7WA 4UOZA 1IVTA 2O6PA 1RUQH 2DJ4A 3R0MA 3UAJC 3RZCA 3S1MK 4FXKA 1CZ8H 1F3JA 2P8LB 4PWIA 5AQ0A 5HDQL 3MRNA 5ID1B 5E6IA 1F4AA 5ICYB 3PS6A 2DJSA 3WGUB 1PKQE 1RZGA 3UDWA 2H5UA 3BRGC 2EXYC 3MREA 1WZ1L 3VD7A 4LSUH 2XKUA 1R5WB 4F7MB 1U8OA 1OT4A 4U6VL 4LBEA 3IMTA 3WLBB 2I25N 4IQHA 3ZLQC 3SYPA 2R4RH 1KLGB 1ZYRA 3CHQA 1A6PA 3QEQE 4FJYA 4BY7K 2R92A 1ID2A 3PGCB 1I1FB 4DAGL 3S1QK 2BCMA 3OKYA 3PDGA 3S96A 2LE9A 4E9VA 1BD2A 4HUVB 5DJAB 1KCBA 4P3DA 4KK6C 2JFCA 3GSRA 4N20A 3TFJA 4G82A 1ZJBA 2Z92A 2Y3NA 4HALA 4PJAF 5E2VH 1T7XA 4EDXB 3RZOC 3Q48A 3WFZA 3U25A 3VFMB 3DLQR 3CLFL 2OMZB 5IBTH 2JA8C 1VIWA 4J4PD 1LWJA 3ZW3A 5B38G 1XB3A 4JCWA 2X6VA 3MXVL 1GW0A 3D4ZA 4JFYB 4R90H 2BOCB 3GSNA 4QHLA 3C08H 4KKLD 1ZVHA 1IGTA 3DARA 5CFHA 4A3FK 4CVWA 4PVBA 3FFCE 4ZS6C 1BG9A 1AS7A 2XWDA 4PD4K 5C0BB 4ZJ9A 2NNFA 3ZUCA 4LKCB 5FA3A 2CIIB 2VGLM 4QJ3B 1MFUA 1N59A 3QUZA 4I3GA 4XVTH 5DD3H 1PLGH 2QV2A 4FA6A 1WPCA 2AI0L 5D4HA 2OYKA 4EDWH 4P49A 1JOEA 2YHGA 4F7MA 4LSDA 2XPGB 3O11A 4QUOA 3FSZA 3DO4A 3F7YB 2EP6A 3GMNA 4P2RE 2BIOA 2BP8B 2VXQH 3KLAA 4ZUVB 3U0WH 1P84J 3D4GA 4KMHA 3LIUA 4KQ3H 2P46B 4OKDA 4WJG3 3QT2A 1T2JA 1MJ7L 4UM9A 1MIEL 4K8RH 1V3LA 2ZXAA 2BS71 3L2MA 4ZMYA 3FN0L 3IMSA 1YEKL 4NLHA 3VJ6B 5FJ8K 4NQDE 5HVHB 1AGBA 2W7VA 4LSTL 1RH8A 5DD6B 5GGQL 2QQNL 2YD2A 4WK2B 4H20L 4XBEH 5DC2A 2IAMD 2ZOWA 1RQ5A 4RFEB 2MRYA 3WHXB 3ZO9A 2EXWC 3MOQA 5MHSE 2OSWA 2WXPA 1BFVL 1BVNT 4FTVA 1Z1WA 3HG1A 3GNMH 3REWA 3KBFA 1I1YA 5L6YH 4B9YA 4OBSA 1PW3A 1SBSH 2AEQL 2ITCA 3C6EA 4IRSC 1M6OA 3BRDA 3QRGL 5D6DA 4RETB 3RY5A 4J3OC 5LDSA 1LILA 2OA9A 4JFDB 3GLAA 4Z0BL 1FL5B 5DZPA 2E47A 4KAQL 4XSXA 4Z3TA 3VW3H 4NCC2 1JNNH 2A77L 2CJUH 2R29H 4IRZA 3OM3B 2Q7NA 2BX5A 5GRUL 4RISL 3GBEA 1MHPL 4R97B 1HINH 4NJ9L 1NAMB 5FYJU 5FYKE 1QLEH 3O9WC 1PVHA 4X0KA 4AJ0A 4YHLH 3OR6A 4B9PA 4Q8BA 4HULB 2J71A 2BVUA 3G6JF 1YN6A 1MCLA 2HH0H 4JY4A 3BUYA 2DIBA 2OZ4A 5FPIA 4S1QH 4MZ3A 4PJ5D 3QWRA 2NY4B 3W39A 3PQYA 1I1CA 5C09A 4OF6A 4MJIB 3FHQA 4UM8A 3VGAC 1DFBH 4LRNH 3I9PA 3U6RA 4QTHB 3LPWA 5CJXC 4JFFD 2NSQA 2HKAA 4FE9A 1UZ8A 1NSNH 2A99A 3O11B 5EBWA 4LU5H 4ZMZA 2CLRB 1B4AA 3IPEA 3GTLA 2JCCE 4ODUA 3VQ2C 2WBJC 4MA3B 4L3CA 2WWMD 4I1RA 1ASPA 4OIPA 1RJLB 4I88A 3CCHA 4TLUA 3SBPA 4L1SA 3T2LA 1EK8A 3OAYK 4P5TA 1CDJA 2E6JA 5KVGL 4XI5C 3L4VA 4HLZH 1FGVL 4HJSA 3N1PC 3HBQA 4KTDH 2R83A 4XCNB 2TRYA 4OCXH 3H8NA 1G84A 3ZQWA 1KELH 5JR1L 4OZIB 4HKJB 4KUCD 1NAMA 1DQVA 2DQCH 3F84A 3HHMA 5D1QE 1M1XB 2MWCA 2HLFD 4XBMA 1QFWI 2DLFH 3U36A 4I9XA 2I07A 5LGJB 3DNKA 4ESKA 3RDJA 3VFSA 4OZGA 4LJZA 2OJZL 3CAFA 3T3PE 1BFOB 2XTJD 3MLVH 3BQUC 1HL4A 1NIFA 4HQQL 5C3IA 2Q0ZX 3V4VB 5I6XB 4RFOL 4UQDA 5C0AB 1WFTA 5IFAL 2OW7A 4NUQA 4AIZA 4EI5A 1A7BA 1KTBA 3MRMA 5HYIA 4HH9B 4UV4H 3ZGIA 1FC1A 2PW1B 5IROA 3P77A 4JG1H 1UACH 1KPVA 3C60D 1DQMH 2BZ7A 3Q6GL 1KEML 2YUZA 4P2RB 5CIPB 5DFVD 2AV7B 2CD0A 4OGYL 4LVHB 1J5CA 1DYZA 3I75B 3UBGA 2B08A 1N6VA 2CA4A 4G6ML 5F1NA 4KM8A 2UXFA 4TUUA 1NOLA 3TA3B 4J3XA 2M2DA 2APSA 4FF9A 1DJZA 3OHXB 4GY4A 1U3HB 5H4ZA 3D39D 3LDBB 2O30A 5F7LB 3TV3L 1VA9A 1MWAH 5J9PB 2F53E 3QJUB 4APXA 1TQBB 3VXTB 2PTUA 2VDNL 3KYAA 3GK8L 1AS6A 3QDGE 4GRWE 3I02A 4TM9A 5IJDC 4N22A 1DVZA 3W82A 3GTPA 1KXHA 3MV8A 3QRBA 4AG4H 4GBXD 4P2RD 2CAKA 4ISVA 4KXBA 1GGIH 1M7XA 4AMXA 3TFIA 4PU2A 3MV01 4LGPB 2G2RA 5FYJE 1AQKL 4CKQA 1J1PL 3ZHKA 2X10A 3QHTC 1Y0LB 4LPVA 1DQDL 4NO2A 3MLSH 4JFDE 4DZ8A 1BGXL 2P8MA 1W91A 5D7SH 3VGDA 3MUGB 1JD9A 3BE1L 1AC0A 3VO0A 5HL8A 3FUFA 3KYOA 2R8SH 4JO2H 4BCZA 4Q9RL 4UNUA 1N6QH 1SEBA 1KY7A 4N87A 1BWWA 1RULL 4LP4A 4WW2F 4AJYV 3HTLX 1WFMA 1WTGT 1XSJA 4YHMH 3MUUA 4PRHB 1JUFB 1MWAA 3E6HB 3HG2A 4M1CC 4JQIA 1INDL 3RJQB 4OTXL 1ZLWK 4MA1B 4U0RB 5E8DH 1QPXA 4NO0B 5K1VA 3CVDA 3F7PC 5DD5L 2W9EL 3VFPA 1K4DB 3WTXA 4XRCB 5HPMB 3V4VL 2EXWD 2H6PA 5FHAH 1L3WA 3GNML 4GIOA 5IM7B 3SPHA 1ADQA 1ZVSA 4OV6F 4ISVB 4X5RA 5L6YL 1HIMH 3DSNB 5F7NC 2D8KA 2YUWA 3HFML 3WXWH 3LV3A 4N0UA 1YNTF 5IQ7L 4UQBA 2WTRA 1OEZW 3QB7C 3IT8D 1QLEB 3CZLA 3TO4A 2GAZA 1JNNL 4LLQA 4NT6B 4GG6A 1AHWA 3Q2NA 3S17C 2YFNA 3DUHA 1DBJL 1PJWA 4FNUA 5CR1A 5GRUH 1C12B 2DQTH 1YMMA 4N8VA 3U2SA 2Q10A 1U3JA 3QJQB 3HOZK 4OZIE 1U3HD 3F5WA 3LEYL 1OP5K 4FQLL 1FDLH 2FO4B 3N6YA 4DKFL 3BN9C 2ZYSA 3CFMA 3GSIA 2TAAA 1UYWL 4PRAB 1KLUA 3DECA 2WWKT 4GRMA 2H2PD 5T1KB 3WSQL 1P4IH 4HH8A 3MLWL 3QFDA 3SD2A 4E9LA 4W6WB 3QIUC 2R1XB 4X6EA 2DDQL 2X0WA 3SKNB 3W38A 1TETH 3IRZA 3HI5L 4OVVA 4JGNA 3D0VA 1TZGL 4RGMC 3PWLB 3UBXA 1NBVL 2AQSA 1K72A 3QDGD 3BUQA 3IFOA 4NNYA 3PDOA 2UZYB 5I6MA 4A3MC 1JMZA 4IRJB 1SEBB 1JWMA 1WG3A 4FQXC 5CCGE 3FUEA 3QUZC 4JANA 2QQLL 3MUY1 5BO0D 1EBPA 2VISB 5JPMA 3STLA 5MEQB 3WE6A 3EJPA 3F7QA 2NX5A 4XI5D 3WKPA 4A7GA 4JFDD 5FO8B 1CT8B 3TEUA 2ZOUA 4HOXA 5AAMC 4GTAA 3K72A 5IYDK 4PJAB 5J6GB 3APCA 3FTZA 3V0DA 1NCGA 2C9AA 2VUOA 5E56A 3NAAL 3MU3A 5DD3L 3A8KA 1TCRA 2QGEA 4X8JA 3KS0J 5C0FA 2H3KA 5B3JE 2VXVL 2W60A 4HHGA 4G8GD 5CZVL 3QYMA 1A6ZB 4FQIL 3N0BA 3ABZA 2EDTA 1FG2B 4BA0A 1U8LA 3TH3T 1CLVA 1ACZA 3JT2A 3QDGA 3QXAB 4WIQA 4YE0A 1T04A 2ETWA 1EQWA 2ERJC 1ULVA 4L8DB 1J1OH 4K8RL 1I3GL 3V9FA 5F8QC 3PHAA 1N8OE 4HZ1A 4YIQA 3GHBL 3H56A 4UQEA 2W92A 1TEYA 4BZ1L 1N64L 3Q13A 2GABA 3BDBA 3LNEA 4JBSA 4ENED 4NUPA 4JO4H 2GHZA 2HFEA 4HUKB 4FNLH 5SX4I 3CQPA 1X9UA 4OUUB 3O6FA 1E4HA 3GEFA 3U7YH 2EIZB 3QW9A 1YAIA 2E7BA 4GKNB 1EERB 4L3EB 4F27A 3QXVA 3PP4L 1FIGL 2F15A 1CFNB 3UX9B 1IKFH 1TWCC 5L8KB 1UWFA 4PLJC 1W72H 3UMNA 1G7QB 1ZT7B 4GAJL 2FWUA 4U1HB 5IFHH 1AZUA 4JKMA 4U1LB 4X9GA 3ULSB 4OI7A 1GRWA 1TWAK 3WAJA 3KLHD 4NEHB 1GGCH 1V5VA 2Y7QA 4YHKL 1J8HE 3CSYB 4KHTH 4UT7H 2D9QB 3MTXA 2VLKD 1LM8V 1PZSA 4NWTH 1KDJA 3N5AA 3E8UL 2GI7A 1JS4A 3Q7JA 2NXZB 3G5WA 2RQ8A 5ICXB 4CDHA 1E67A 4AKQA 1WD8A 4P4KC 1IQWL 4FI6A 4HD5A 3P4NB 4QXTA 3CZSA 4G3YH 4BZ2L 4NDMB 5KSUB 4UYPA 4ONOA 2JJSA 1CL7H 4FA7B 1DJYA 4S1QL 5BRQA 4NENB 2VDRL 3PLYA 4R3SA 2WANA 3QR0A 3CZUB 3EJYD 2EVJA 3FU6A 2FGZA 2HFGH 4LKXA 4WV1C 3QISA 1QQDA 1KC5L 4KRMB 2EEDA 3T6ZA 1IM9B 3GSOB 1KB5H 4R7VA 2MNWA 3ML8A 5KTEL 2VLJE 1NA8A 4UMSA 3WNOA 3BAEH 3VG9B 3FQ4A 4OT1H 4PHZA 4OLXL 4WK4B 1N0LB 5CF3A 5GJSL 2ADFH 5B39B 2YGOA 3Q3QA 2K6ZA 2DM7A 5E5MB 3L5WA 3UL4A 4MD0B 5HHOD 3HE6D 1IUZA 4MHHI 3COOA 2W9EH 4XX5A 2B0SH 1YLBB 1VFBB 1JG9A 3QZBA 1HH6A 4Y19D 1D5XB 5JW5B 1U6AL 1NFAA 2H41A 4PJDB 5DK0A 3CN1A 5JYMA 5DHVA 3O2VH 5KSAC 2KZWA 2VXTH 4YZFE 1KELL 3ARVA 1YNLL 3IRCA 3VI3E 5JR1H 4LSTH 5GGQH 4Y89A 3RU8H 1FCGA 2CKBL 4FQ1H 1D9KD 2NLJB 3MX0B 1U8PB 2PR4H 2H3NA 2VUMK 1CIUA 4OUUA 3OKMA 3P4NA 4PPTA 4QXTB 5F1OB 1FH5L 3VB9A 5A2LH 2VLJD 1RSYA 3ABLB 4FGMA 32C2B 5E94A 2C3VA 4AEIL 3KPQB 4DKTA 1PD0A 4WWNA 4M7ZC 1H5BA 1OE2A 2K3TA 4XVSH 4L3ED 1NCWH 3AB0C 4IMKC 4S10A 4F57L 5C1MB 2VYRE 2ICEA 4EI6B 3RGVD 3ENEA 3HI1A 2BP8A 3KLAB 4PJEF 3BISA 2HSIA 5B39A 5IOSA 4HXAH 4JFPA 4TVPE 4X5XA 5HHVL 3KBHE 1VGEL 3WENA 2DYSB 3BGMA 4P4RA 4OD1L 1C5DA 5EWIH 3QIUD 3FOLB 1IV8A 4N4YB 1MCFA 2IIJA 4K94C 4YSSA 3L16A 1Z5HA 3B9KA 2FO8A 5IV2B 2WYZA 3O6KH 4G7OA 1C5BH 1E4XH 3V6OE 1XCWA 4NQSA 1YC7A 2IDCA 4F37K 3UC0L 3MBXH 1EJ6A 2YPLA 4OZHE 4Z78A 2ID5A 1F4WH 4PJBF 2EO7A 4WILA 5AW2B 3TIDB 1AXTL 3I50L 1JPFB 1T5XA 3RBGA 2C3VB 1H6FA 3JWDL 5I1KL 5D1QA 2VIRB 2YPKA 3JWOC 1BJMA 3MJ9H 2Z8RA 3IAGC 3S35L 3MHZA 3ZKMD 5KYWB 5J5EA 3BJLA 3PWNB 3VAEA 2K9UA 2VO8A 1UKSA 5AKRA 4Y7NC 2VL5A 4PP1C 4V1DE 5HYFA 4OKVB 4OCXL 5I1AA 5IKCB 3QIUA 5J11C 3EJRA 4P46A 2JJVA 3GHPA 5KJ4A 2AQRA 3UERA 4MX7A 2BNUA 3J07A 5I8CB 1ZV2A 1JBJA 2NRDA 3O9WA 4FMVA 1OPOA 2CU9A 5AOKA 3C60B 5E6IB 2OJZH 2R93K 2OTUB 3LN4B 1KCVH 3IJHA 4TOYL 1NMAH 3IWVA 4LQ1A 3OKDA 1NFDF 3QIBB 4QNPF 4F7EB 2VZUA 5L2KE 2EUZA 3NZ8B 1BSIA 2IVFC 3BLKA 5INDB 3JVFC 2X87A 4JLRB 1E42A 1MAJA 3WY2A 4P2CG 3CBJB 4QHNB 1XCXA 2C9QA 4HWBL 4HWUA 1I4FA 3MO1A 4UV4L 4UANA 4PJGE 3ZPDA 4DW2H 3ULUE 5HDBB 3VTTA 4LCIH 4ANVA 2EDMA 4LQFH 4HIXL 3C6LA 5CN3A 5DD0L 4XC1H 4DUXA 2V37A 3WS3B 2XYCA 2DD8H 1MCPL 1DQQA 4YE4L 4Q14A 1YYMH 4Y4KC 2YU9A 3HRZB 3BP6A 3V6ZA 3RWGA 5B7FA 2X4RB 4XOBA 5AW4B 4MCMA 5CD5C 3ZSTA 3PV6A 5C3EC 3U6RB 3FCSA 4ODSH 4YDJA 4C3HC 5F3HB 5C09D 2CM6A 4NQQA 5L2KD 1UXWB 4JK1A 1WO2A 4J27A 4H88H 2P45B 3CGTA 2E27L 5DC9B 1KJ3L 4KXZI 2DJUA 4YLQT 2OYLA 3IDYC 5G5DA 1A4AA 1DBKH 1KYAA 1W15A 2BINA 5FW8A 1F1GA 1KCUL 4JAMB 1SY6L 4WLCA 2YD0A 3A23A 3DMMB 1U30A 4QOKA 4WNQB 4WHTB 1DUYB 1JWSB 1KBBA 2NCMA 5AVUB 5E99L 2XCQA 4NUGL 1PFCA 3IWUA 4YZFF 1WCBA 5I1AB 4ETQA 3H53A 4DP9X 1XMWA 3NJVA 1TCMA 4JO2L 4KJWD 1V7NH 2EDHA 1T1ZB 2FIKB 4W70A 4G8AC 1N6QL 1GGBL 3QZNA 3KPSD 1FWXA 2NY1D 1S78D 4JJOA 1CPUA 3LKNA 2OTUA 5KZCB 3OZLA 1TWHC 3GXNA 5DHMC 5DZAA 2E2HA 4RFEA 1L0WA 4L0YA 4CNIA 1UXWA 4N0CC 4B27A 3FSAA 3DROA 1G1OA 4JLRA 2ZUTA 2WMPA 4TVSa 4JKPL 1ZEAH 4XPGH 4FXKC 4JCLA 5CR8A 1IE4A 4XMVA 3RDTB 3IGUA 4H8WC 1KG0A 1S9XB 3HKFA 3PGFH 5IGXH 4LK1A 2ALAA 3F00A 4ODBD 5B3SB 3UROR 3E6HA 3VD5A 4GUCA 4R0LB 3G08A 3KWXA 5C0AE 4OJCA 4YQXH 4HYTB 2FBRA 2XA8H 1NTDA 4G8GB 4XN1A 5JPNA 1RZIA 2ZIDA 1BM3H 5E1GA 3NOIA 1CTOA 5J12C 5EF1A 2WKGA 1T1XB 2FL5A 2DY2A 2OR7A 3QEHB 4OCWL 3UTPD 5F7FA 5AW6B 4RNRB 3KGRA 3P4OA 5ESVB 3EOTH 3MNZB 3FQUA 2V9RA 5JOEA 3DV6A 4ETQB 1EGJL 3H6JA 5ADOL 3GHBH 3PDDA 1W6WA 3WFHB 1TWCA 1ZPUA 1AG0A 1KN2H 3PQYD 4MS8D 3T65B 4K71C 5EGEA 4BV1A 1JZ6A 2XTSA 4L4VB 4RGMB 3KDMB 2GIXA 5CCKL 4Q4ZA 4JAMA 1LYQA 3VH8A 3C6SB 1EHKB 1IC5H 3IJSA 5KVDL 2X4OB 4L3AA 4HA1A 2WCGA 8CGTA 1IKFL 4M61A 1CK0H 3VQLA 3LQAC 4QRPD 4ZUWA 3VFPB 4QRQA 4KI5E 3KPMA 5DQJB 3RPKA 4WDIA 4OBRA 1R24A 4PRBA 3UG3A 2QZQA 1KGYE 2RH6A 4X6AK 2Q2EB 1B3JA 4B9IA 2ZJSH 1FNSH 3WIHA 4RGND 2ENQA 4L37A 4FTVD 1QX1A 2MOQA 4O02B 3ARFD 4L2LA 2YK1H 3NPZB 5FECA 3GT6A 2BY3A 4RNRA 4TVPH 4DPRA 3UBXG 4UDTB 1EEYB 5JDSA 3B5HA 4QNPE 2HX7A 4UCFA 4NQCA 1I7UA 1PQZB 2UX7A 1N67A 1MDAA 2GTQA 4JRXB 3B7TA 2X89D 5DXWA 5B7EA 5K9KA 4G0VA 2HTKC 5FUCC 2VL4A 1XD1A 2VDLB 2YD6A 3IYLW 3R06A 3V7MA 5K9OA 3FOEA 2J20A 4FFZA 2QR0A 5KVMC 2QPDB 4LVNC 4HK3J 4V33A 4A37A 5FYLH 5T1KA 1JGLH 5ERWA 4NNPL 3KCWA 2NQDA 3DC0A 2O93L 4XXDB 3LSOB 4CVZA 4XX1G 2ENSA 4ODWA 3LPGA 1YQ2A 4N28A 5ICUA 5TQ2L 3U30C 2FQEA 4EF3A 3US0A 3DPDA 4DEUA 3IDIB 5HHOB 4W9EC 4LLYA 2WNXA 4MS6A 3KGSA 4ZQTA 1JMXA 3G5VB 5FF6B 1PZ2A 5CJOH 4GKSB 5ES4B 2E2JK 3IBOA 5LHDA 3HB3B 3U0WL 1N5YH 1W8EA 4G8IB 1MJ8H 1U3HA 3E3QC 1CLOL 1O27A 5HVFB 1AD0A 4AVKA 3RBSA 2UWEF 1R3JB 4PRIB 5H37G 3ZQXA 1EJ8A 3TASA 3RVWC 4JPIA 2NXZD 2J4WL 3MLXH 4CMMB 2YD7A 3GIRA 3V6FB 1T03L 1WORA 2YBRB 2DL2A 2FJFB 3RFZB 1WZ1H 2PWEA 4UAHA 4ZOCA 3WNNA 3FN3A 3MODH 4HUXA 2XZCH 5HDLA 5I1CL 3L5IA 1DE4B 3EG9B 3JZYA 3AQOA 4F33A 1AO7D 1XF5B 1T04B 1UH3A 4CDGC 4F8NA 4GNKB 4DEPB 5DR5H 1J8RA 3EGSB 4MMXC 4P3CL 4ZFQA 4F58L 3FU7A 4KMUA 4FI8A 1L7TH 2VDRH 1F86A 4PUBL 4UOQA 3UO1L 2ENJA 1G6RB 1I7ZA 4AITA 4PGJA 3NTCL 5H37A 3KJ4C 1F11B 1H0DB 3UCRA 3BPCB 3TT3H 1QLEL 4KRPD 4M62H 3B2XA 4GXFA 1XL6A 1M7UA 1YRKA 3CH1B 2W5PA 2F53B 4IIZA 1OWRM 3V4UL 4NENA 1OGAA 1VH2A 3G04A 4WEBH 5JW4M 3S0XA 4L1HA 3B9DA 1KBGL 3OC5A 2ZG2A 2F54B 3MRHB 4U7MA 3IU3A 3GEWB 5CMAB 5F0PB 4XVJH 5E2JA 3MRGA 5F7MC 1GY2A 1KIRA 1AMXA 4NLAA 1CDBA 1Z5LA 2GUOA 3A4DA 4ZFOA 4UTAA 3QQ4B 4GQPH 4ZZFA 2FHCA 2WINA 1N8ZB 1YYCA 4PJ7F 4RA3A 3DETD 3KBEA 5F88A 3PWVB 1MFEL 4EQ2A 3FO2A 4TUKL 4KFMA 3DXJA 5D93B 1PZ5B 4Q97A 1DEEA 4NRYA 4ZO6A 3QJSB 1SUHA 4C56B 3OPZL 1Z32X 4MNQB 4KNTA 3EYOB 3FB6B 1CDCA 2VNCA 2HJFA 2JKTM 4U1NA 5E00A 2WVTA 4AVIA 1KJVB 1MSPA 2J1ZA 5J57B 1XF2A 1IM9A 3GSOA 1EO7A 3T9WA 4KZDL 2VZTA 3ZZSA 2A6KA 1EO8H 1AI1L 1SDDB 1Y1VC 4PJCA 5TTRA 3C8KB 3MLPA 1JD7A 4Z23A 3FQRA 2F7QA 3B4NA 1TJGL 3PAUA 1FRGL 4KV5F 2VXUH 1EHXA 1HXMA 1IU1A 1JRHH 3WJMA 3EYUH 3E6FA 4WFHD 5L0QC 1CF1A 4AGPA 2PXYA 2JB5H 4Z95L 2E9BA 5DHVH 5GISH 2VC2L 1LMIA 1U95B 5EDSA 1YNKL 3V9EA 5ALCH 3UBHA 3ARGD 2OMVB 4PRNB 1J5IA 1R6VA 1KLFA 3L4ZA 2D7OA 5AOIA 4NZ8A 4NWUL 4C58B 5E70A 1XXAA 2G0KA 2V5MA 2Y1ZA 5AALA 3RP1A 1UACL 5JHDB 4DN3H 3V4PH 2NLJA 2ZXQA 1PZ5A 2BCKB 2WBXA 3NJJA 4OFKA 4LFHD 3VFGL 4WQOA 3B9KD 2XN1A 4LF3B 1ZT1A 3GZOA 3MRIA 4GRWB 1X5MA 1SY6H 3FTYA 3GTQC 3MJ9L 2WTOA 3BC9A 1JF1B 4OIIL 3FN9A 5DQ9A 2FEJA 4D8OA 3U2JA 1OO2A 3F12B 4ZZKA 3CHPA 4IRSA 1N68A 3EDJA 4IMKA 1ZA3B 4TRPH 3TIDA 1XL4A 3O4LA 3DX3A 1WFUA 4BYHA 3L45A 3HOGA 5D7LA 4S11A 3C5JA 1NOAA 1BZEA 1JFQL 5TGBA 1WOOA 5AVZB 2JQZA 4GT0A 5I30H 2GJ6E 4HKXA 3HPJA 2YD5A 1AFVH 2GSGB 3GSWB 3ZXAC 2NXYB 5BZZA 3EYOA 2HT4D 1F56A 5FIEA 1UWEH 4OZFH 1WA2X 3EQLA 3CVHA 4XNZC 5DHDA 2R0ZL 2AGJH 4G2AA 3VDAA 3ZHLA 2NVYC 1E6OL 4J8RA 3J27A 5E0QA 1P0SE 1EVTC 4EI6A 1MJ8L 3N1MC 1N7MH 5EUOF 2EDOA 3OKKA 2CUIA 1I1AD 3UTSB 3V55A 3VFNB 1QNIA 5F7AA 4NN6B 2P9RA 3NK3A 4V2CB 3OKDB 3QIBA 2X3BA 3QDGB 3QXAA 1CR9H 2BIHA 3FTUA 3G5ZA 2X9WA 5AAPA 1USMA 3EF7A 1H3GA 4WGVB 2BJMH 1A5FL 2VT0A 5I0YA 3VFVA 2WUBL 4Z5RB 2NW2A 2H1XA 2JA7A 3UJJL 1GKEA 3BP5A 2AERT 1JDDA 3SIKA 4M8RA 4FQCL 3FUDA 3CFCL 3QQ9C 4R7LA 4WUUB 4NJAH 2XICA 5AL8A 1A3ZA 2X4TB 4X9YA 3ULAB 5TGBB 4Q0XH 5I1CH 5JW4R 3ARGB 1Q9OA 3KYMB 4N2NA 3LNFA 1SUJA 5AD0B 1B9ZA 3LRSA 3A5VA 1I50K 1OANA 1A1OB 3PRZA 4G6MH 4JN2A 5CUSH 3STZB 1DBKL 2WXLA 1AHKA 3QDJB 1ZLSL 2ADIA 1HH9B 1QFWL 3B1TA 4UBDD 4J8RB 3HOVC 1J0YA 4M7ZB 1EH1A 3H42H 1MWAL 2WCSA 1UKTA 1YDPB 3D48R 2E56A 3BZFA 3T0EB 4BDVA 4LNRA 3D2UB 5DRZB 4C3JK 2WVVB 4BQCA 2G5RA 1UYWH 2EABA 5I5RA 1FNSL 4P23D 5TD4A 1IARB 3F7KA 1OTSD 4QHLB 4ELME 2F19L 4RFNC 4N2OA 3NIGB 2K7PA 1SGKA 5KSUA 2NVYK 2IH3A 1AGFB 1XGUA 1YEEL 4K7PL 1CFQA 4KROD 5AAWA 2HFFA 1LO5A 2X3AA 1TDQA 4UT6A 4N0RA 3BFWA 4RWHA 4E9QA 4E5XG 4WU5B 1WZKA 1AIFA 1QBLL 3MX0A 5JMRA 2IDUA 2WXHA 1WAAE 4XNMB 1CLYL 1ZS8B 4JPWL 2XNAB 2WOYA 2A5UA 2G9KA 1A22B 3D25A 4KKQA 4LHUA 3EO1B 1TQUA 1GSKA 1XTLA 2IV9A 4YBLB 5DSCA 4Z7VF 2NT1A 5KOMC 1IIIA 3S3SA 4UDUA 2BP0B 2ICCA 3MGTB 3RPIB 2RIKA 4WEMB 3QDHA 4OM0H 4PAZA 4E0RA 1WE5A 3L4YA 4OTXH 4U1MB 3HRZA 2HVKB 1EO8L 4H5SB 2QHRL 5F2FA 2CKBA 1EVUA 5H94B 3LKQA 4MDIB 5C08D 3EOAA 2W95A 4HKBB 4O58L 4FCHA 4Y16A 4M5YL 4A3IK 3F05A 5ETUB 3TPKA 1UGKA 2NDFA 1UD4A 3K4AA 1KN2L 2DQ6A 2OCJA 4GXUN 1R4XA 4RESB 5EA0H 5GZOC 4P9ML 4APQC 2ZSWA 4IU3A 2ZUQC 5E6ZA 1BA9A 3IFNL 1NBZB 4MXVE 4M3HA 3QA3A 3H0GC 2B1AH 4PTTA 4P2AA 2IWFA 4LHUD 1BM7A 3GSXB 2EE0A 3IMVA 3MA9H 2ZWSA 4Q4IA 4KK9C 4JFHD 4YHZL 2RAMA 4EN3B 2NVQK 2PP8A 4YLBA 3MV9D 3GO1H 1MFAL 2XIDA 2Y2WA 3GSQA 1BDFA 4PABA 1JWUB 3N1GC 5LJYH 3LXAA 1QSFE 1ZHLA 5AKSA 2OMXB 1R34A 5I8EB 3A8IA 3HOUK 1UATA 4J2QA 1KGWA 4HU8A 4MCZA 1FAIL 4QRSB 4P5TB 3MGTA 4JK0D 5FYKU 1O25A 3BN3B 3P11L 2GIMA 3VXQB 1SN2A 3MQIA 4HJIA 4OY9A 5IHBA 2KI6A 4C83B 3QCTL 3W57A 3DRTA 1NGPL 4GW4B 2CKBB 3B2UC 3MXWH 1J9QA 1NIAA 2FSEA 4M4PA 1ZXOA 1H6EA 4YHOH 4XNMA 1NGYB 4YHKH 1A9BB 4QRRB 3MJ8B 4JG9A 4NP9A 1NFDA 3WTSA 2IG2H 2VDOH 5DJXA 5FS5A 1AZZC 1VPOL 2D3VA 3FTGA 3LHPL 3GTTA 4UT6H 5BO1H 3KJ6L 4KTEL 1SXSA 3BH9A 5AW9B 4HX1A 1N19A 4H0HB 5LN4A 4X5PA 3LAFA 5BVPL 4KTGA 4OZHB 1SOKA 2K1MA 1KBWA 5K9KB 5E4OA 2UVFA 1IGCH 2HFGL 3RWEB 3CFKA 3MZTA 1LEGB 2Q86A 1M1XA 2J1WA 3MRKB 1Z9OA 3F04A 1TVBB 3LEXA 4PV1C 3LY6A 2FBJH 3MRFB 1XCTB 4CW1A 3S3DB 4XAKD 3CPLA 2R4SH 1FVCA 3DOIA 5IWLC 5CEYA 1Y1WC 5CJ5A 5AOZA 4PJDE 4EVNA 2GBVA 3MUGA 1DQJB 1FO0B 1FORL 1Z3GH 3LNDA 5JOPD 3BDYH 1CLOH 1CYXA 4KU1A 2OMBA 4YNYA 2QVMA 3QH3B 2QDVA 1A9BA 5EPMA 3MN8A 5AB1A 3CZKA 4D9LL 1OWWA 2GT9A 1YJDC 4GRLD 1KMGA 5AZEL 1O9WA 3B83A 5E6IC 3R1GH 5T5FA 4RDBA 3GI9L 1R3JA 1TG8A 4RSYA 2J8HA 3FQTA 3VYPA 1JE6A 1ZHNA 4I2XE 4W6XB 1UTDA 2ICES 3RDTC 4OZHA 3GRBA 3BOVA 3IJYA 2PWDA 2WV3A 2JWYA 5BS0B 4FXGC 3WTUA 3HZMA 2XZAH 3ULVF 1F42A 5JXAL 4XMUA 5D1QC 2CDFB 4BKTC 1DVFB 4WF7A 1YNKH 1H3UA 1E28B 3LVEA 1I7UB 1PQZA 4FXTA 4GPVA 3NSCA 1OM9A 5ANMA 5MI0B 1GGCL 2F54D 5G2NA 4PIBA 3BIKA 5A3IC 1BEYH 2QGDA 2C8NA 2Q3XA 2CUHA 5I23A 3AY4C 1LXMA 3FH8A 2ZP9A 2E75C 4HK0B 4MJHA 2Z4QA 2CBOA 1J6WA 4MNGB 4N2KA 1URLA 4DZBB 5I76B 1GSMA 3Q1SL 5J1AA 3DKHA 1HT6A 4OD1H 5ERWB 2RGRA 2FZ3A 4X7CC 4DVBB 4G6KH 3LOWA 1ETB1 4HC1H 5D1XA 1CU4L 4AZ8B 4U1SA 4E68A 4M56A 3D34A 4NO2B 4HT1L 4XNDA 5FB8A 3O6FC 3SE6A 1A6AA 1E6JH 4V11A 3QWOA 3LQAH 3U4BH 2A9ML 4CKVX 4ZFFB 4ZUTA 3IF1B 3HE6C 4OJFL 2UZIL 1K6QL 4AM0A 1DJGA 4G9FA 3I6LE 1KV3A 4OCRL 4KVNL 1OAZH 3ESPA 4K7PY 2BDNH 4P5SA 4OT1L 5E8OB 4F33B 1BVLA 3KG5A 3KWUA 1DQJA 4GG6B 2VERA 1CFBA 4MXVF 4UM8B 4BFEA 4TUKH 1KCKA 5I1JL 1KYFA 5JOPE 1RUAH 1FIEA 1KIRB 1IE0A 3JVGC 3LN9A 4DERA 3L4KA 3NSXA 3WFHA 3CU1A 1NGQL 3KNBA 5F7DB 4C55A 1O24A 5L9DH 2AW2A 1DQTA 5HHQA 3BIKB 4O58H 4L1DA 3SHSA 3E1F1 3GJFH 2I5YL 5GRYA 5EA0L 5L88H 3BAJA 3K6IA 4GRMB 4XMLL 1X5XA 3GSVA 4DDQA 4LB8A 2J1YA 4HPYL 4HUWB 3SN6N 3UTQA 4C56E 3GSUA 4N90D 1AI1H 1TZOA 1NL0L 1WIOA 3R7QA 2VTFA 3QAZC 3JUYA 3QR2A 2W9DH 1BP3B 3TXAA 2XFXA 3IPBA 2V2WA 4GRWH 2NY4D 2UY7B 3GM0A 5H35A 2BJML 5LBVA 3DHPA 4NNXA 3VD3A 4Z95H 3RVXC 4O2FA 5D96C 2RACA 3TJPA 4E5XB 3LH2L 4RWYL 3UJJH 5CAYB 1AZBA 2ZUQB 2ZXWB 4F57H 3TEYA 1JWMB 3NIFB 1FG2A 2AVFA 4HV8A 4WCYH 1CIDA 3BO8A 5SWSB 2C7FA 4X98B 1RUMH 5MHSD 1FI8C 1VEMA 4LQFL 5HDBF 4Y2NA 1H15A 4HXAL 4F3FB 1XH3B 1RPUA 1J11A 4RGOH 3H4HA 1FNGA 2EYRB 3X1GA 1JXFA 5DK2B 5GS0H 1BGWA 3Q2CA 4AQOA 1CS6A 3KNBB 4TNFA 5JUEL 4AIZB 3NCEB 3WKYA 5I1GL 4G6JL 1FLRH 1SXAA 1TZAA 2R1WB 2YPVH 2BC4B 3MV8B 4P0DA 1EO5A 4L8BA 5EN2A 3OKEA 1I82A 1VPOH 4AV0A 1CUOA 1AY1L 1XSKA 3GTOA 4B3VA 1FZKA 4NRXA 1VADA 4XMWA 5K9QG 2QKSA 1EHLL 1A6ZA 1CXHA 2VE6A 4GOSA 4R90L 5C0GA 4R83A 2Y1VA 3H2QA 4MQ7B 4PG9A 1EFQA 35C8L 3UGEA 1LNUB 3GBNH 1X7QB 3JTSA 4KH2A 1KDIA 4R2GC 3VU1A 2PNDA 15C8H 4YO0A 3W56A 3DVIA 1CCZA 2NNAA 1ZE3H 1QBMH 4WTXA 1UFGA 3N3YA 1A6TB 5EU5B 4Y19B 5H37H 3ZR6A 3H54A 4DQAA 5C0CA 4U1NB 5E00B 1U8HB 4MVBD 2NY2D 1L9PA 4M5TA 3VRLF 5C0FB 4CU6A 4KOCA 1KCRH 3MRBB 3ZDZE 2YLKA 1H9DA 1U2YA 2F5BH 4PBDA 3SOBL 3AGWA 4LCCB 3QG7H 4CVUA 4JFXB 3D0LB 4Y16C 5IT2L 3LEVH 3FCBA 1ZAGA 5HYJD 2MPAH 2NUTA 2EECA 4Y9CA 5DVKA 4MEYA 1IGIL 2OZ4H 2VDMB 1YN7B 5AB0A 1Q0YL 1M2OA 1RUPL 4DPCX 4FYQA 5K59E 1J18A 3PGFL 1DBAL 4G72B 1RZKC 3ARZA 4HPOH 5JVOA 1UVQB 3GM8A 4QY8B 2N01B 3DTXA 4ZTOH 2IMMA 2MCPH 4KXAA 4A2GA 4RMTA 25C8L 3QHFL 1LDSA 3WY3A 4MJ5B 5KSAB 4GUOA 2GSGA 3GSWA 3ETBF 3D2UD 1NPNA 1O7DC 1BLIA 3QRGH 4F2FA 3W5NA 4JN1L 5C0ND 1Q0XL 3ZL1A 3ZRFC 3T1WA 4BWWA 4PWFA 5LGHL 4IBLT 5DS2A 1BAWA 1I9EA 5C44C 5ICZA 4WO4D 2WBKA 1BZOA 5IOTA 2A77H 2R29L 2FUQA 1J87A 4WV1A 4LEOB 2DOCA 1KIQA 1T1YA 1MQKL 1OKEA 1PKOA 1XAKA 3WEMA 4XCYB 4NBZB 3Q1SH 2XI9A 1BVZA 3UAEA 3RL1B 4AMWA 2EE2A 4NC1E 1T80A 3QDJA 3CC1A 1DE4A 4XPHL 1GYUA 3IS1X 3QGVA 4BFIB 5DRWA 1OP4A 2DLEA 5IYBC 4PJ8B 2ORBL 1S5HB 1ZTXH 2J8OA 2BWQA 4TQEH 4WFFE 3HB3D 5D7EA 4FADA 5MEOB 1EAJA 4AH2A 2VABB 4W1TA 3U7WL 4ZMOA 1AOZA 1NGPH 2JI1A 2XPYA 3HNSH 2E3VA 3BP4B 2GJZB 4I4WB 3KPNB 1IS1A 1C5DB 1CQKA 3SJVD 4K7PX 3RGBA 1JK9B 3HEIB 2R93C 1I9JL 4IOFC 1SXCA 3X3FL 4TLTA 3MRNB 5ID1A 3D3VD 5HI4C 1N0LA 3WIHH 4G6FB 3CDGA 4R4BB 1WQGA 4P9SA 3KJ6H 2J8UE 4KVCH 2YEVB 1GCYA 1FNAA 43C9A 1TQCB 4A7SA 4L4VE 2X2YA 3SPGA 4B50A 5KG9B 5CLXA 5E9DD 5LQBL 4E9YA 1RPQA 2KDGA 3B43A 3EDEA 4UNVA 4JDVB 5CEXA 5EEUA 1KN4H 1KLGA 3BZFB 3V4GA 3RL1A 3JTTB 1U4EA 1BJ8A 2YPKB 3UTOA 3ZUNC 2OMTA 5IYDC 1IAOA 2HTLD 2VQ4A 1SQMA 4YDVA 1U8PA 3FT0A 3KDPB 2ZF8A 1Q9LA 2FBJL 5GGVL 1S7SB 1U95A 1S7RA 2ZUWA 2YOAA 1L9NA 1A14H 4KKAC 2DI8A 4RDQG 2CNZA 2P7TA 4ZTPH 4X8XA 2AQNA 1AJ7L 1B90A 4ILDA 1L7IH 1RZJH 1CDUA 5K9JL 1FE8H 2E7HA 3TTSA 4WCYL 3ZKSD 4Z7OF 5JOFB 2FQGA 3A67H 1UM4L 1SHXA 5I8KH 2UX6A 4O02H 5IOPB 5GS0D 1IJNA 2I24N 2XQ0A 2EH8L 3QJXA 4Y4HB 2WO3B 1K3ZA 4LVOC 1BMZA 5FUCE 5KBDA 2GK0B 2PCFA 4I7ZC 1ICTA 1WK0A 2XVKA 3H85A 3HCVB 3MSPA 2LU5A 3MRIB 4JFPB 4OB5L 3QDJE 2PCYA 1OY3B 1YEJH 2G5UA 2KBGA 2MIZA 3F6IA 4ABWA 2XLLA 3QUYA 4ERSL 4FFYA 3PP3H 1XF1A 2IWEA 1AGFA 1XGUB 2B77A 4ZW6A 1Z9SB 1HYSC 4OKVA 4PJHB 3VCLB 3O8XB 2BY1A 3HC3H 2VDMH 4JQVC 5IHUH 1XF3B 1JZIA 3TC9A 3PHQB 5TQ0L 4ELMB 2CG9X 5DS1A 3P73B 4DTGH 1I50A 1G9ML 1N2RA 3CFBB 5EC2A 1JGDA 3NABL 1YSOA 2YPVA 4K7FB 3QJZA 4KASA 4GMTL 2R7ZC 3QA3B 5EF2A 3DVGA 3R4RA 1J0IA 4TNGA 1HAUA 3D2TA 2DKSA 3ULSA 3NH7L 4HC1L 4RIRA 1JGEB 4FLHA 4WU7A 3H0GA 2BNQE 2Y7QB 3CFNA 5D7SL 3QWQB 4NRZA 4FZEH 4O5LH 3T08A 1NCHA 4RAVA 1ZA3A 4PUBH 1RIHH 1WVZA 3UO1H 4FG6C 5D2LB 5HHXH 1A7QH 5A16A 4JHBA 3THML 1YNNA 3AD9C 1O5DT 2P5WA 1KPUA 4KM9A 3P9LB 5HI5D 5DT1L 4M43H 5DEGB 2EIDA 3LIZL 2ZONA 2MCAA 3TF4A 4LSVL 1O2AA 1KBGH 5FM5M 4FC3E 4PJHA 3O45A 2DWSA 1CLZL 3HG5A 3MDJA 5C0CE 4KTYA 1TZHA 5CEZD 2VMJA 4HWNA 1OW0A 1FZJA 5JIPA 5J13B 3FRUB 3BWAB 4LZKA 3LPPA 3OLGA 2DIAA 1A3LL 3K2MC 2VLMD 1I1YB 1QSZA 3GSQB 3IPFA 3NJNA 3P0YH 3PV7A 3QI9D 4K7FA 4L4TB 3OAWA 2B1HH 4KI1A 3GTPC 3Q44A 3WN6A 5JQHC 2CO7A 3X13B 4H26B 1QG3A 1JCKA 4BRJA 1TTGA 1WBXB 2AJVL 3M4OC 5KYYB 4LPTA 3RWIA 1Z9NA 4A67A 2QL1A 1C5CL 5CZRA 5FOBA 3HMXA 1OSPH 5F89B 2VWEC 1HHGA 2MQ3A 4PVMA 2GYSA 5G55A 1WIUA 2CHWA 4QLWA 2BZDA 3INUL 2QPFA 1MIMH 2NY3B 4F37F 1EEZB 3MRCB 4I2XB 5G4NA 4EN2A 2IBBA 1MH5B 2P8PA 3H9SB 4GXVL 1C08B 4X4MA 1XQ4A 5CINL 5DEGA 4TYUA 5T5FL 3S0PA 2NW3B 4MJ4A 4MXQD 5DJXB 5GZNC 5ACZB 5FGSA 4LSPL 32C2A 5E94B 3AGVA 1ZTXL 1W0VA 4TQEL 4M48L 3Q6GH 1TKWA 3N42B 4QTHA 3RWFA 3RA7H 3U0PA 1E28A 1HH9A 4BXVA 1ZK5A 3M1OA 3WIFB 3HE6B 5EEYA 2O5XH 1XWVA 3EFFB 4IBWA 4QRRE 4OFVA 3NIFF 2E2HC 4NC2B 4PWJA 4PFEA 4ADJA 3ILPA 2B16A 3MTRA 3HA0A 4QXVA 5D4DA 1R5VA 4LVNB 4IBQA 5IVOA 3QDMA 4KXZH 2A9MH 1SXBA 1BBJA 3LPFA 4U3SB 3MV7A 5EOTB 3EH4B 2NVYA 4M5ZL 1MCRA 3CX2A 1HSBA 2W0KA 3FH5A 3HG1E 4MZIA 1S4IA 1T5WB 1ZY9A 1CFQB 3OMIB 2WNGA 4NSKA 3RHWF 1JV5B 4JO3H 2CDFA 2IGFL 3KL5A 4GAYA 5F93C 5MI0C 4YNYB 3KCPA 4TULH 4NQDA 2E59A 4Z7OE 5BQ7B 4KK5D 5AW7B 4Z0XA 5A2IH 3M6DA 1I8LC 4BJLA 2B59A 3JBG7 3NJLA 5TE6H 4B9CA 4A93C 1NJ9B 4GG6E 4KKNA 4GG8B 3G6JE 5IG7A 3BE1H 4M7KH 4F7TA 2VIRA 5EO1A 4NYLA 4UIMA 2DLTA 4FNPA 4OD2A 2GVYA 4KKAD 4JGMA 4ZMVA 1RZIB 4JM2D 1OK0A 3FU3A 3BIBX 3VQ1C 2R93A 1IGMH 1PIFA 3OAZK 5DMYA 3P77B 3FQYA 3HNVL 2DQFA 4Z76B 1Q1PA 3R06B 1UWEL 4JRFA 2R2EA 5HVHC 4FEMA 1IGJB 3FB5A 3OTTA 2YGQA 2IANA 3IDJA 3VD4A 4BZ1H 2CHXA 1QBBA 3A6BL 4OFYA 1TIUA 4OV5B 1Z9PA 2VXSL 4JFYA 4RFOH 4RWYH 3N9GH 3RKDC 3C8DA 2L7UA 4BXSV 3FMGH 3D8MA 2ICEC 4A6YL 4AQ1A 5E8OA 3DURA 2CRZA 4Z3EA 3IXAA 4NQDD 4S1SH 4XNUL 2YAOA 1RKRA 4WI7A 1CDIA 1TKWB 1XDTT 2MCPL 1WBZA 4Y8DC 4MEXA 4M03A 4WI6A 3QQ3A 2CJTA 4YUEH 1P1VA 4XZUA 3WN5A 5MP6H 1VJEA 3BVXA 2BW5A 4OGZA 3NJHA 1BQHA 4YC2C 4OFDA 3HNTH 2O61B 4WDIB 3M17A 3P0VH 4M7LL 3VXRD 5B38A 5F6HJ 3MLUH 5DK2A 4AM0B 3SQRA 2DYPD 2E9GA 3F58H 3TZVD 4PLNC 3MBEC 1VZHA 1EHLH 4ODWB 1FHGA 2H9GB 3W81A 2ZX5A 3GRWA 4HJ0D 4TSBL 3SODB 3FO1A 1ZCRA 2Q7YA 2DH2A 2EYTB 1OLLA 2WQWA 4RBPH 1RZFH 5F44A 3VGAB 1BW8A 3VU2A 4B5ZA 4Y9GA 5LG1A 5FYJD 3I2CL 15C8L 4LPXA 5FX3A 3QNYB 4J3SA 2VRQA 3ZDYE 4QO1B 1FVCB 2PCPA 2Z7WA 3FB8B 1JCVA 4MQ7A 3HI5H 1F7UA 4L1TA 3SEPA 4DT2A 1LP9A 3L3DB 3DETC 3MRDA 5KYUB 2FATL 4HMDA 3TP4A 2Z6FA 3GSUB 3BAXA 3VRJB 4XX1E 3D3VB 1AO7E 4FFWD 3RRQA 5MEPA 1I50C 5F9OH 1I1RA 1AFVL 3ARDA 4X7TB 2Y6SC 1I1AC 1FL3B 2F9BT 3QG7L 3TBVA 3HLAA 4JY5L 4J3UA 3S97C 1HYRC 3TBCA 5IT2H 1HEZA 3AXIA 4JM2B 1WWWX 5C0EB 5L2KA 4X8CA 1ZHNB 2WLYA 1PJ9A 2IDSA 2V4LA 1Q9KA 5C0JB 1QUNB 2CWRA 4H8UA 4LSRH 2R1XA 2OTPA 3PNWA 4YXLL 1KB5B 4CC4C 2WQSA 3ZIMA 2YEZA 1J48A 4HPOL 1SHSA 3MLRL 3GI8L 3NACH 1VCBC 4Z6AT 3UPRA 1DVFA 4PJ7B 4PWGA 4GT7A 5CHNB 2I07B 3RYMA 4W9GC 5LGJA 3QIWC 1A5FH 4Y4KB 2OSLA 4ES8A 2EDNA 2O4EA 4FQXD 5FO9A 4KPHH 1XB8A 2FX9H 4PWHA 1D5ZB 3T4AB 1DSFL 4HS3B 1UXSA 2JJSC 4TN9A 4L8CA 2Y0SD 3FFDA 5I73B 1MCJA 4L5FE 1DBBL 3S14K 4UTAL 3WS6C 3ZMRA 5E2TL 2DI9A 5AYQA 2CW0A 1OCZB 5IQ9B 4CADA 3W0WD 5E95B 3B2DC 3K5SA 3MMEA 2DM4A 2R59A 2JSFA 1BS2A 1GHFL 2OMNA 4IGBB 5DJDB 4DFIA 3TEZA 1E3ZA 4HEPA 5EZPA 2MCG1 3QNFA 3PPSA 3HC4H 3OL2A 3O6MH 2WXQA 1JVKA 2XRAL 2X1OA 3HKZA 4BFKA 4ZFFA 5E08L 4O9HL 5CZXC 2VCOA 3FYEB 2VQTA 4XN9A 5E1HB 2XWRA 1LO3H 4F15C 4K3DL 4KZEH 3QDAA 2W65B 4ONHA 3L3KA 1RJZB 3VWJC 2R2HA 4UINL 1ADWA 2WSDA 2UUDK 4JY6A 5KYXB 5DJYA 4QF1A 3MRBA 5BZWA 3BVWA 3L6FA 5KSAA 5J3HC 3DTDA 3ZKXB 1D7DA 1HOEA 3UYRL 2OSLB 1FFNB 4M61B 5IFJA 5IP4A 4X9BA 3P9MB 2DWEA 3L3GA 2WZPA 3MFGB 2FBOJ 4TF4A 4A68A 4CJ0A 3I6LD 2J55A 1XZPA 3CN2A 1TFPA 2O6EA 3OGCB 4FRWA 1U8NB 3HN3A 1RAMA 2DWXA 1XGYH 1WHPA 3DPBA 4L1LA 1DJHA 5ECGA 3VWKC 4LHQB 1IFRA 1INQB 1GOHA 2VMFA 3DHMA 3DX7A 1LDPL 1HWHB 1Q9KB 1RIHL 3FQRB 1K2DA 4KK6D 1PZCA 1Y1VA 2AANA 3BXNA 2R15A 4MDJB 5I75C 1MFCH 2YD1A 4U1HA 4YHNA 1BVLB 2W9LA 1CGUA 4U33A 4NIKB 3UAJA 4QCIB 3JT0A 2A3TA 3P1VA 5DQ9B 3KPSE 3NJMA 1FUNA 3Q6FA 4HWEL 1ID5I 2YAHA 3CNKA 3QCUL 3QJRB 4F9PA 1VCAA 3QNZB 5K39A 2R2BA 2MFNA 3BSGA 1BOYA 4WI4A 1IGCL 1GGYA 2OMTB 4JPKH 1QAWA 1LLAA 2KQMA 1AANA 3S48A 3DIFB 3WNKA 3HZKB 3WJJC 3WTVA 2AZAA 1QWUA 3S4SG 1FFRA 2GJJA 3X3GH 3LS4L 5I15H 3UTTE 3CQZA 2CO2A 1B4RA 2AQ1A 4O02L 4KRNA 4QIWD 4BBSC 4LHJB 4OJEH 2WK2A 1ANUA 2B1HL 4B60A 2HKHH 1G4RA 1KTLA 3ZQ9A 43C9B 4LLWA 4WKZA 4RZCA 4ZODA 5DRWB 4MSWB 3ZZLA 3KVQA 3V2AR 4I0PB 2A9CA 4TVUA 3VGBA 4WVRA 5TFSL 3LZQA 5CGYC 2EO1A 4YFNA 5CCJA 1H8NA 1UWGH 4LSSH 4YHYC 3PG2A 4ORGB 1D5BB 3ZTNL 4D9LH 4BHUI 4BFJA 1DN0B 4ZTEA 2EIMB 1JXGA 2BOLA 1FIGH 2NPLX 4MQ9A 4X4YB 5JZ7D 3L4JA 3V5HA 3GO1L 1MIML 5FYKH 2W65A 3IDXH 4Y1SA 1SFOC 4L8SB 5FXCH 2BCKA 3UPCA 5D4JA 2KQNA 1S7RB 3O2DA 3KR3L 3WYRA 2H0EA 4KVPA 4JZJB 4QTIL 4XC3L 4QHMA 1R47A 1MCHA 2E8YA 2GQHA 3TT1H 1WFIA 1OB1B 1FNFA 4XCCL 4MZRA 2MNJB 1ROCA 2A6DB 1HHJA 5DRXA 2YMXH 5DVNA 3SPCA 4Y4FD 5BQDA 4BKLB 5TDPA 4BGLA 3EUDA 3KXFA 1PNDA 4EXKA 2B39A 2V5SA 3GHEH 5DUBB 5F9WB 1WTLA 5EULV 5E2VL 1R0AH 1C5BL 1E4XL 4G9DA 3OBAA 2WQRA 2ZAGA 1Y7VA 5D6CA 2OYMA 4PP2B 1GGBH 4B6ZA 1AXSB 1LD9B 4BZYA 2DQDL 3AQZA 1FG9C 3IDNB 4HS6A 1UZ6E 2Z7UA 5C97A 4YZWA 5C0BD 1U3NA 3OZ9H 4XVOA 3QFGA 1IBHA 3O2DH 5BPPA 1SN0A 3HBPA 2X0VA 1XH2A 3GS0A 3NIGF 5GJSH 1BAGA 5GRJH 4DGUA 4GJTB 2JA7C 3GTKK 2KPNA 5SX5K 3RZCB 3S5LA 4J3OF 3O0RH 1SXZA 3N55A 4RH4A 5CZKA 3K72B 4L9LC 5F7WC 2FR4B 3GINA 2L8AA 4GTCA 5JMOC 4WGKA 1QNZH 4GQQA 4H2AA 1EZLA 4MD5A 3DJZA 3Q0HA 2AZUA 5LVEA 4YQXL 1DLFL 5D7LE 2VLRE 4UAOC 4ZUUB 5AYTA 4MNGE 3AWGA 4K23L 4PV9A 5T1JA 1QSFA 2FT8A 2PR4L 2FECL 4U2ZA 1MJ7H 4ZXBC 2Q8BH 2W60B 1FH5H 4CMHB 1AB4A 1NBYA 2OX5B 3KAAA 3D06A 5DQDL 5C0IA 4OZGF 4KHXH 2HRPH 4CSPA 4KO6A 4Y7MA 4LOUC 2MJWA 2J1XA 3VI4A 1OVZA 4NQTA 4UDUB 3ARGA 2R23A 4GXVH 5CINH 5E5UB 4CILA 1G1CA 1WZLA 1NGZB 2FEDC 2PMZD 2P26A 4G8FB 2DKUA 3DYOA 2YR3A 4FMFA 4TVPD 3PREA 2JJUA 3HMWH 1QWHA 4E41E 3ERED 1OTTC 1CK0L 2A1WH 1LO3L 3OX8B 3ILDA 1H5BC 1NDGB 3R0NA 1LK2B 2DBJA 4K0OA 1T1YB 5J7CC 2MHAB 3HS9A 1TZ8A 1MCOH 1YEWA 3KLKA 1R3LA 4YGVA 6CGTA 4WHYH 5CIPH 2JA6A 1MW0A 4XCHA 3WJLA 4U0QB 3ROLB 4L23A 1UOKA 2VSKB 1O9VA 5L4JA 3P2BA 4N2BA 4YK4C 3WMPA 2JA7K 3B3IA 3EFOB 5D5MA 4FP8L 4PSRA 1BXVA 3I4NC 3UADA 3EZ8A 3QORD 4PJ5B 3QXDA 3X1BA 1X5FA 4AKOA 1BZQK 1FLRL 3KJ4B 3VFMA 3C08L 8FABA 5GS1C 3I50H 3OG6B 1P5UB 3CZFB 3BP4A 1A7NL 3SQOH 4JO3L 4MXWL 2A9BA 2DQIL 2NT0A 4MMYB 2H3XC 4A63A 1T3FA 1MNUL 2MQ0A 5C9JB 4F93B 3VFRB 5B1KA 3MRJA 1F4XH 2R0KL 3VQMA 2NZ9D 3ESNA 3HMXL 4FXGA 2R69A 1NCTA 1A6WL 4N85A 3S36L 2FECI 4CMHC 2JJWA 3F65A 3DX1A 3MR9A 3RVUD 2BK8A 3HHSB 1INNA 1JGUH 3FCSB 4XPFL 3RWFB 3T3ME 5SX4H 2FATH 4ELDA 2GTZB 3OX8A 4IIQB 4WW1B 1NGYA 1JF1A 2YS4A 2BERA 3VI3F 2MMXA 4QXUL 5CEZH 3A22A 3VXOA 2VERN 3C09C 2XN9E 4BWUA 3GTGA 5DVPA 2HN7B 1NUDA 5D7JA 5MERA 1XBDA 2NTSP 1NCDL 4GRLC 2WC7A 5DO2C 1YEKH 1AR1B 4Z7UE 1E3FA 2IFFH 2GSOA 3QXTA 2EDLA 3VM7A 2E86A 1S7TA 4WUKH 4UOJA 3BP6B 3MVSA 4XWOD 3V6ZB 1MUJB 1FSKC 2R69H 3QS3A 1P5UA 1PF3A 1Q72H 1UWGL 3TPUB 1WQVT 4NPKA 3U0PB 3UIZA 1L0QA 1JYNA 3PNRB 1MCQA 2FNWA 4HF5L 2XBZA 3WFEL 5KVFE 2X40A 4R96A 3PIQB 3UZEC 1ZHKB 4YEFA 3TL5A 5I1EH 2Z91B 5E8NA 3GTLK 5JIHA 2X12A 1ROWA 4LO9A 4RMRA 3HNTL 1I8LA 2YN3A 3F83A 4OCNC 4Y19E 4YSTA 4QTIH 5FV2A 1H3TA 4JG1L 3CZJA 1ET8A 1HVXA 2IF7A 25C8H 3QHFH 1WP6A 1SHMA 4N0CD 3OB0H 5AYUH 4D0CB 2ARWA 4H25B 1YZZA 3CXHJ 2DQFB 1HILA 4G6JH 3CFKB 5MERB 2BHZA 2GFBA 3O2WL 1WF5A 3X1NA 1BZ9A 1XF3A 3LKPB 3SDAB 4CJ1A 4AEHH 2AK1L 3MI6A 3VXSB 5DMGC 3ME0B 3ZT6A 4F2EA 3KWTA 4AQ1B 2J72A 1UA6L 4H0IA 2DF3A 4ZOBA 3MRRB 3FHEA 4GBXB 1U3HC 5AWNL 3G5YB 5HGDA 1G7HA 5BS0A 1X44A 1TSHA 3O0LA 2HT3D 4MJIA 4U1GB 2OXGA 5B8CC 3V4UH 1SBBA 1JGVH 1B4JH 5CILH 4DKEL 1T21B 4ZFGH 3QQ3B 5MENE 3S1RC 1FPTL 2PW2A 3MJ7B 3Q9QA 3VFSB 3KM1A 1GAFL 1MWOA 4LBEB 4ODHH 1MVFA 5CGBA 4A3DC 4E41B 1HCVA 1DSWA 5EU6D 4OCLC 4G70B 2F8IA 1LEGA 1VZGA 1XGRB 3LKSA 4JY5H 2R1YA 3BT2H 3D33A 3GZQA 1IC1A 4X5XB 4XBPA 3SDAD 1TTUA 1Y6NR 1ZV5A 5D1XB 4OZIF 4M3JA 2OL3H 1AACA 3FT1A 3AQDA 4I89A 5DDHB 4F2ME 1KXVA 1HHGB 5DQJA 1ZEAL 4XPGL 3HUJE 5BVPH 4Q9CA 1O26A 4ZAKB 1QI5A 3OJDA 3I3EA 3GTOC 1R75A 4QJVA 2JVUA 3SJVE 5CJ8A 2MPAL 3GMQA 4UI2A 4B5EA 3SBQA 4Y4FB 4BBSK 2Q20A 4XAKE 3N0CA 1KB5A 4MJJA 5J6SA 3RI5F 3D4YA 1RK1B 1T1WA 3H2PA 4DN4L 1IVLA 5B39G 2OXGB 3CVHL 3D0AA 2BSCA 3KPPA 4M9OA 4AVHA 1MZZA 2BSRA 4E9TA 4AW7A 4U1SB