4ILDA

Crystal structure of truncated bovine viral diarrhea virus 1 e2 envelope protein
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
241
structure length
235
Chain Sequence
DVVEMDDNFEFGLCPCDAKPIVRGKFNTTLLNGPAFQMVCPIGWTGTVSCTSFNMDTLATTVVRTYRRSKPFPHRQGCITQKNLGEDLHNCILGGNWTCVPGDQLLYKGGSIESCKWCGYQFKESEGLPHYPIGKCKLENETGYRLVDSTSCNREGVAIVPQGTLKCKIGKTTVQVIAMDTKLGPMPCRPYEIISSTACTFNYTKTLKNKYFEPRDSYFQQYMLKGEYQYWFDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Envelope glycoprotein E2
publication title Crystal structure of glycoprotein E2 from bovine viral diarrhea virus.
pubmed doi rcsb
source organism Bovine viral diarrhea virus 1-nadl
molecule tags Viral protein
total genus 38
structure length 235
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-12-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3000 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ildA01
3.30.1360.280 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4ildA03
4ILDA 2YQ2A 2YQ3A
chains in the Genus database with same CATH superfamily
4Z8FL 4PLKC 3KZ8A 5D1XA 2JJUA 2E74C 1NCOA 3G04B 3UJTH 1YYCA 4IRJC 2Y3PA 1WFOA 2MOVA 3NPSC 1NJ9A 1UH3A 3VXOB 1DJYA 1AQKL 1NAMB 1YSOA 3RQ3A 4ONFL 4OCXL 2ADFH 2GEEA 2VDNB 4E9VA 1MQKH 2HT2C 2DF3A 1F6FB 1RPQA 1AG6A 4IK7A 2F53A 4ODTL 4A2HA 5IMMA 1I50K 3MLVH 3NQKA 1DBAH 1HHKA 2CHZA 4RZCB 1AZZC 3S17C 5C8JA 1QNIA 2Z8SA 3OZ9L 4S1QL 4E0RA 2V6SA 4MJJA 3N1PC 4LEXH 4IKJA 4NP4H 4GIOA 4E41E 4I89A 4MSWA 4Z7UA 4LMQE 1RXLA 2Y7SA 4P2AA 1DHKA 2R15A 3NEXA 4NEHB 1LP9F 1A3QA 4BQBA 1DZ0A 3SYAA 4GTAA 2BFVL 5F3FA 4HW6A 1NINA 2VLLB 3QZOA 3TEXA 4P5MA 1CXKA 5JQ6H 1KTDB 4HIXH 1OQXA 2KQNA 5GS1B 4JFOA 3CLFL 1M57B 1F3RB 2I25N 3T5WA 1BFTA 3VJ6A 4FQQB 4R7LA 4KAQH 5AAWC 3A3YB 2D03L 4PGCA 4MDIA 1B90A 2GJRA 4Y5XC 2PPEA 2DQTH 4RWYH 1Y18A 2MH4A 3BIKA 1MFMA 4H13C 4J23A 4NZTL 3SDCC 4WNJA 2QELA 4MA7L 3MLPA 5AEAA 3ESPA 4WI7A 3TBBA 3VI3E 4YSQA 5JW4M 3VXSE 4L0YA 3DXAB 2YD1A 2WKOF 1LXMA 2YPLD 3ZDXF 5E2TL 1WFTA 1F90L 2X2JA 2HTKC 2JIXA 1AC0A 4U49A 3GBNL 4G8GB 1CD9B 1GS7A 3BP7B 2VR6A 4MAYB 3WO4C 1FFNB 3BP6B 1JTTA 4YLCA 1SQMA 1BVNP 4QHLA 4YPJA 3LPPA 4F15B 1HJBC 4LQYA 4X98A 1D9KA 1FNSH 3EOAB 3IU4H 3OAZH 3GMRB 4IS6A 4Y9EA 1FO0B 4Z23A 1AZVA 3T0WA 3AITA 3PLYA 3KH4A 5B4MD 4QRUB 5DO2C 3RVWC 1JGEB 3UADA 2V5TA 5GRXG 3M1OA 4KGJA 4NO0A 3BE1L 2VQ1A 4ZUSB 4FA7B 5CEZL 1L9RA 1I1AC 2HJFA 3FU0A 4X4ZA 4AZUA 2FH8A 1IVTA 4M48H 2VR3A 1YEIL 5B7FA 4L0PB 5CBEB 3WEAA 3WHXA 2CUIA 3FFCE 3D87B 3NACL 4XN1A 1P7QA 3WAJA 3NZHL 5DVNA 5IHWA 3SDXB 4D8OA 2WXPA 3ESNA 3QQ3A 5GISL 3RWFA 1VAHA 2XV2A 2Y6SC 4HBCH 4RMBA 4NKDB 2H32H 4R0LB 4UAHA 3ZK0A 4TSAH 5KJ7E 3GBML 1ZLWH 4G6AC 4GQ9H 3CQQA 1RUKH 4AMXA 3Q3GB 2X4SB 4HP5A 2GK2A 1FZJB 1T2JA 3RP1A 3L2NA 3B34A 4BRVA 4YHOH 4GQPH 1QSEE 3BFQG 3CBJB 3IDXL 4LFHG 5E6IA 3V6OC 4MCYB 3WIFA 1I6HC 3EGDB 4G9DA 4WHTB 2VLJE 2A1WL 1UVQB 3NH7H 4AX3A 2XQ0A 1JFQL 2I7OA 5AVTB 4UT6H 3A4EA 2NNCA 3FT0A 4LVNC 5FAAA 4CDHA 5D1XD 3EYSL 4NN6C 2WXIA 1LP9B 4FYRA 4JZNB 1H5BB 4AV4A 1CBVH 4YGVB 4JPQA 5GSRA 3UBXG 3K5SA 1IW7A 1IEBA 5J6HA 2HA1A 1U36A 1H9VA 3GJFH 1H3VA 4OJFL 3ZR5A 5E7FA 1NBYA 1UM4H 4PTTB 1JL8A 2L7QA 3T2NH 3FN3A 2F53D 4GI8A 1F4XL 5IR1B 3PRZA 5KSBF 1TQCC 4K73A 1DQMH 4NERA 4I2XE 3IJYA 4AQ1A 4QCIA 1EV2E 1L0WA 3MSPA 1CUOA 1JWSA 4HQQH 1FLTX 4W93A 5LQBL 5DVLA 3KNBA 1DDTA 2ZKWA 4XP5L 3NIGF 2JXMA 5HYSB 2ZOLB 1U3HC 1DBBH 4Z0XB 4JREB 4ZNEE 5C4JC 3BWUF 4L1LA 3C8DA 4FG0A 2O5XL 4V2CB 1JPSL 1UOLA 2V3EA 5ICYA 2A0LC 2EZ0C 5E1AB 4A3EK 1B4JL 5KJRH 1ZS8B 3QXVA 3U6RA 2GT9B 1ZHNA 3GGWA 4E42A 1XR9A 3ZDXB 3GMLB 4UDTB 1T2QL 2HT3C 4HXAH 3FJTA 3GMNA 4OLZL 1MCWM 3ARBB 4AT6B 1K5WA 1MRCH 1J1XH 3BIAX 5C44K 1C1EL 1I53A 4IRSB 2AJSH 2CALA 2NLJB 5F9OH 3D05A 3GZKA 3QQXA 3LKQB 2B9AA 2ERJC 4D7PA 1YAZA 4NIKB 5EDSA 3EYUH 4HETA 5I1AB 1TZOA 2X4TB 3VD2A 1GA2A 4XNAA 5LXGH 1A7OH 5DHDA 4F93B 3OAWA 2QGBA 5AAMA 7FABL 1D5IH 4Z7WE 3QIWC 1YNLL 2OMWB 3FO1A 3VI3A 2A6EA 2QTVA 1IGFL 1URZA 2Z93A 1WV7T 1N6UA 2NNFA 4RDQG 3T3ME 4L4VA 4F37K 1KWKA 2WNKA 4HKJA 2IPKA 4FP8L 3D39B 4O2DA 3IRCA 1GYUA 1P7KA 1OWRM 4XWOD 2WGXA 1Q0EA 1UD6A 4TYUA 4OR1A 3TT3H 4IRZH 3H42H 3EDJA 4LVHC 3KL5A 4XCFL 3TN0C 5EBMB 2PWFA 2QSVA 3KL3A 4M5YL 2OV0A 2BINA 1CDHA 4G0VA 5EU7E 1OSEA 3ZRFC 1UWYA 1YMMA 5IBUG 3GSIA 5F9WC 3EJUA 4NO0D 4XI5C 1E9QB 1NSNL 2VITA 3TT1L 4JFQB 4LCWE 2FJGB 2ZKYA 1GGTA 1IGIL 4NZUL 2LR4A 1Z5LB 4NO3A 3WY1A 1DDHB 3HR5A 1WF5A 2VAAB 1V7ML 1A1MB 3F8UB 3BC9A 1ZT4A 2Z7ZA 1D5BA 4XAKD 2PMZL 2E59A 4F7CB 5ISZB 1F56A 2QGDA 4Z3JA 1WCMA 5DZNA 4LEOA 4RISL 4G6MH 1A6AB 1IAKA 1IC4L 3B7RL 2R7EB 5KOVC 1RZGB 3PWNB 3V5KB 3D0LB 1F3DH 4BY7C 3FBQA 1A6VL 4LK1A 1VZIA 2YAQA 2A6HA 3CN2A 3DO7B 1KEGL 4ZX5A 5GSVB 2F08A 2O4EA 5CEZD 1BG1A 3QIUB 2J5LB 1ZT7B 3SPIA 2G30A 3TVMC 3FAXA 3KW7A 4WGVB 3RVTC 4GAFB 5KSBB 4OB5H 3WEXA 2BCKA 5CIPH 4F33A 2IBZX 4AEEA 4Q9CA 3QRLA 2PMZA 5E8NA 1Q9KB 2EDKA 1UD5A 4ONGL 2P46B 3V4VH 4HU2A 1IZJA 3BEWB 3C6LA 4IIQB 2E75C 4YGAB 1W16A 3OKNA 4L29A 4AE0A 5T1DL 3C08L 5ALBH 2PR9A 3ZE0F 4V11A 5I75B 3CU1A 5ICZA 4YPGB 2RGSA 2CDEA 3ULSA 1JV5A 4JL1A 5MEOB 3CMOL 4M8VA 4A6YH 1R3KA 4J5VA 4P2RA 3TJEL 3UJIH 4ZAKB 4LSPL 3QYMA 1WCBA 1BW8A 3ECBA 3LPWA 4UQCA 1DFBL 3DARA 4NQXA 3KJ4C 3P9MB 1J86A 4LFHD 3S48A 1XB3A 3X11A 1I7TA 4WNQA 5I2IB 2VLKE 4MB5A 4LL9A 3EDFA 2ESVB 2WO4A 3HS9A 4Q6YA 3ZU8A 1KCVL 5DMGD 2ILLA 1H3GA 4MJID 1MKFA 2VJXA 5E99H 4U31A 1BZ7B 3MJ6A 3AMLA 3BLBA 1F45A 3GSUB 1ZLUH 2Q8BL 5IG7B 4JFHD 3V10A 1HAWA 2DQFA 3FQRA 4F7EB 4E68A 3WHE0 3ULUC 2XWJA 1KOAA 2YGPA 3U7WH 1IC7L 1OARL 3FUMA 1WWBX 4KJWD 4LHUG 4M6OL 2CIKA 1T7XA 2DQIH 4HS3B 5FHAL 4QRFA 2FQFA 1ZLEA 2FB4L 5KSAA 3G08B 4FQLL 4P46B 3DX6B 1F4WH 5L2JA 1MJJA 3H9ZA 2E2IC 1I6HK 1BREA 5I1CL 3RJOA 3BOVA 1ZTXL 3U9PH 1S7UB 3C5JA 2H7WA 3DVIA 3PIQB 3SEPA 2JCCE 3UTPE 4ES9A 1SVBA 3WIAA 1I8UA 2IQ9L 3TASA 1MIEL 2WOBA 2Y2YA 4L4VD 3BRGC 2NSQA 1CFVL 1JWUB 2WXLA 3G9AB 3BD5A 4QXGL 1VPOH 4XVTL 4JR9H 4PRIE 2HFGH 5TH2A 4CRPA 2F19H 1EHKB 3DX3A 3K72A 3UFIA 2I27N 4JFEA 3GTQA 4BGLA 3MRGB 4C54A 2UXGA 3D3VD 4K71B 4X4ME 2CO7A 4JGUA 1DEDA 1I8AA 4HJ0C 3HN8A 1AGDA 1GH7A 2GC4C 4NUMA 4APXA 4DO5A 3TEYA 1I85A 1YMMD 5E2WL 3BI9X 5BO1H 5BW7A 2BIOA 3QBTB 4GG6A 3FCTA 4Z8FH 5KVDL 2G4EA 1BWWA 2AEPH 4FYQA 4F7TB 3LZFL 3S1MC 3L1FA 1NOLA 1T21B 2UY7A 3RX7A 4C4KO 3ULVF 4AYBL 4FULA 4ZS7L 2VDOL 4N8VB 1U58A 5J3HD 5C4JK 4PAZA 2JA8C 1ROCA 1AQKH 1DLFL 1UXSA 2B4CC 4ONFH 2DS4A 4OCXH 1N8ZB 5CO1A 1K2DB 2OXHA 3MCYA 4XPTL 4B7IA 4CVXA 4LVEA 3J07A 5AW4B 4ODTH 5E4OA 4KI5F 2H9GA 4XN4A 1JVLA 1KB3A 3HVNA 1OTTD 2EE0A 3OZ9H 2WNXA 4S1QH 4PRBB 5INDB 1HI6A 4CA4A 3K0WA 1T7YA 4NBXB 2E7HA 3RBSA 5KYWB 1MQ8A 3IAPA 3ZE0B 3FC8A 1CQYA 1N0XL 4XLNA 5ELIA 1CDIA 5AKRA 2BFVH 3GSXA 1W72B 4H88L 4ZXBA 2XWZA 3VRLE 2O93L 1EHLL 4KV5E 4I0CC 5A2BA 5CGTA 4QHNB 3U30C 4NO5A 4QY8A 4RGND 4AYBA 1JCKA 5G4OA 3U1SL 1IQDA 3S5YA 3WS6C 4GTDA 2XWBB 4PCYA 3COOA 3U9UA 3MBXL 4JO5A 2PMZD 3CLFH 4NGHL 5DHYA 5FB8A 3MRRB 3MZTA 4JM2F 3GM8A 3P4MB 2NW3A 1D7BA 3BHBB 2QKIC 3I9GL 4XMZA 2X4QA 3ZW3A 2D03H 4AMWA 3MZGB 2D3NA 2W0FB 3EYFB 2VAJA 4PEEA 3T0EE 3SZYA 3KD4A 3OGCB 3SKJH 3BWAB 4Y4HD 2VL5B 4DP5X 4J39A 3KS0J 4P2RD 4MA7H 1V3LA 3S8FB 3PJSA 1ZVNA 4Y8DC 1MCQA 5I66B 4NC1E 4XNMB 3N0CA 4UQ2A 1TQBB 2AJXL 5E2TH 4CGUB 3FF8A 3GMPA 3U2SA 1F90H 4HD9A 1EEUA 5DVKA 1KLFB 1JVOA 3GEWB 3BYTA 2MIZA 3GBNH 2IDFA 3THML 4JRFA 2EIBA 2FJUB 3C5ZD 1AS6A 2ZSVA 1I9IL 1WICA 4Z7QF 2RD0A 3DK2A 3QE5A 2X4RB 3UTOA 1R5VB 3G5ZA 2Y7QB 4XBPA 2QKSA 4XBMA 4IBLT 3GXFA 4RGOL 4OKDA 2O6PA 1BVLB 2IAMB 4KDDA 4ZFOB 4N6QA 3RWJA 3L9YA 1UB5B 4OLWL 3FB5A 2AQ2A 1MFVA 5DJDB 4PMFA 1CBJA 1WA2X 3FCSB 3QJOA 4BY7K 5DJZB 1JZEA 1K3ZA 2VZ1A 3BE1H 4G6JH 3H2WA 1VGEL 2HUHA 5CEZH 3US9A 5KSAD 3FQNB 4AGMA 4DUXA 4RMFA 3RUGE 2XIDA 1YEIH 2ZXAA 3TIDA 3CXFA 2Q76B 3PAZA 3NACH 2PLTA 3WLBB 3NZHH 2CHDA 2J57A 2J8UF 4PS4L 1FUNA 5BVJA 4JVPA 5GISH 1EAOA 4PREA 3DIFA 1COBA 2BOCA 4PFEA 3PWVA 3T0XA 4Y52C 4M3JA 5FYJL 4YDLB 3ZSSA 3GBMH 3QJFB 4HKBB 1VERA 3X12B 1M6OB 3DTXA 1CDJA 4ZW8A 3MLXL 4YFXA 4GW1A 4JFED 4KASA 4B9GA 3SGDI 2G3NA 3IDXH 2IFFL 4TUKL 3KGSA 4LHUD 1KIRB 3TYGL 3HB3B 1AZUA 1KG0A 3HA0A 4PRHB 4X4MA 1FZOA 3K7UA 3CVBA 5D7JB 2A1WH 1K83C 2AJYL 1GKOA 1Q72L 3DNKA 3IETA 4JFSA 4LIQL 2CLVB 3IXTA 3EYSH 5DJ8B 3FUDA 4KHTL 3HOGA 2APBA 4LVOB 4ZNCD 5HJ3A 4EEEA 1WBZA 4F7PB 3QEUA 3IGFA 2BNQB 4OJFH 4J3OG 3S15K 3HW7A 1A6WL 3GSNB 3MV8D 4G82A 1KN2L 2R1WB 2CJSA 2YSTA 4EXPX 1F4XH 5EUOE 5IB1B 4JM2B 4NC0B 1RU9L 1U93B 4BHUI 3BN9C 3G5YB 2WYTA 4Y4KA 5I1JL 2WVUA 5F0JB 2AZUA 3A4DA 4G42A 5J7CC 1QWNA 3RWHB 5LQBH 3W39B 1CT8A 4M5SA 2AVGA 2X3BA 4XP5H 3W11D 3EH2A 4U7SA 4ZXBD 5TJWK 2V2WA 1J87A 2O5XH 4J6IA 4DFIA 2P80D 4AYBD 1YN6B 1B4JH 3DV6A 1AH1A 1ROWA 4GUPB 2B08A 3B7TA 5C0RH 1T2QH 2AEQH 2YBGA 3L7EA 1UH4A 5T1MA 4OLZH 1EH9A 4ZW6A 1UV7A 3IT8D 4NENB 5DEFA 1IAMA 4WGWB 1IM9A 1C1EH 3QC5X 4ANUA 3APDA 4Z7QB 3OEPA 3AREC 2DEWX 4HUNB 1CK0L 4N26A 4XCEA 3TTSA 3WNMA 2YBRB 3T0EA 5F88A 5DFAA 1WISA 2ZOWA 1R3HA 1AY1L 3QIBC 5CP7B 1BV8A 2AAAA 4AVHA 3QQ4B 4XVOA 4Y0GA 3SDDD 4GKNA 1SHXA 2VN4A 4L8SB 7FABH 3MRLA 4RAVA 1YNLH 4K15A 4KXZI 2CH8A 1IGFH 1A4JA 5KANG 2NQ3A 4F7KA 1OAYL 5E70A 2B5IB 1AG0A 3UTSE 3LN4B 3RL2B 4YSEA 2CBOA 5EPMB 3JWDC 1EXHA 3F01A 2QLYA 1VADB 2AANA 1UKTA 1K5NB 2C1OB 3DLQR 3NCCB 4PJ5A 4PPTA 5EEUA 4LLDA 2VZVA 1LNUB 2J8UB 4BFOA 4XCFH 1X7TA 3T00A 1ZGLP 1ORQA 5FA3A 4H8WC 1I8KB 1IAIL 4KDVA 4WKZA 3IJHB 1MI5B 4G6FB 5FO8A 1FVDB 3L5WA 4LSVL 1IGTA 3BSZL 1DJXA 1MAKA 3TCLA 4AQAB 1UWXK 3QXUA 4M5ZL 5C0EB 3V0EA 1BHGA 1B0WA 2OCCB 2C4FT 1IGIH 3FQTA 3BEVA 4NZUH 4PJHF 3IAGC 1NC2B 4OZGA 4QRPB 5PAZA 1E40A 1V7MH 3K5RA 1KY7A 5H4YA 1LEGB 1KPVB 3VI4B 1DUYA 4PJAA 4P4RB 3AD7C 2WZAA 4XP1L 1T1XA 2VWEE 5EU5B 2HLFC 2OK0L 3IU3A 4WUUB 2Q3XA 3E6FB 1MCOH 4RISH 2BY0A 2ICWA 5KJ4A 4WI9A 1IC4H 3OPZL 2CBPA 5IHZA 1KC5L 2HRGA 3ZTJH 3P3YA 4IU3B 3H1ZA 3EGXA 4WVRA 2Y1ZA 3SE4A 1TMCB 1A6VH 1SMYA 4KPHL 3KWVA 1UUNA 4LOFA 1FVEA 3L3IA 4PLNC 1TITA 1KEGH 4WJ5B 1ADQL 1H8NA 2BWQA 1GRWA 1MCBA 3BSZA 4NSKA 1AOZA 3GTPC 3P9WB 3HS0A 4AYFA 1JBJA 3L4KA 1OSZA 3W9DB 4JY6A 3UMNA 1KIUA 2PO6A 3B1TA 2VKXA 3OAUH 4IOSA 2JA7A 4QR7A 3N85L 2BVOB 2YGVA 3ZKND 3O45B 2YU9C 4ATWA 3NMEA 3RGVB 1U92B 2BW4A 3HI5L 3DHMA 1ZA3A 4TNGA 1DZBA 3ARFB 3QJRB 4XX5A 5KEZA 2OSYA 1FV1B 1SOSA 2EADA 5FGCB 2OI9B 3WFEL 1WC7B 3O3UN 4PJ9C 3MV01 1CLCA 1DVZA 5FYJD 4C45A 3PXLA 2E56A 5T1DH 5ABDE 3VA6A 3GTGA 5D6CB 3OAYH 3DJSA 3UBHA 4PJGB 1MCEA 1NKGA 5C0BB 1MELA 1PZ5B 3W5NA 1MPAL 1W91A 3TJEH 4LSPH 3GLEA 1CPUA 1TEYA 1WBYB 1K9TA 4GRLB 4Y4KD 4D0DA 5CU9A 5FOBB 5TMFA 3SGJA 1DFBH 2WV3A 6PCYA 3FU3A 4M03A 5I1EL 1JG9A 5J11C 2EO1A 3QG7L 3ZYOA 1KCVH 3HOWC 4OZIA 1U2CA 2C7UA 2FVNA 3PWUB 4YAQB 5DSCA 4ANXA 2AJZA 2A69A 1ZSDA 2APWA 3MRCA 1TJXA 4P2QE 1YN7B 4NB7A 4KFMA 4ONHB 1MRFL 2Q8BH 5DK0A 3LD8B 1A02N 3VRIA 1A6PA 4NFBA 4LAQL 3NZSA 1VEPA 1NIFA 2GI7A 5EO1A 5JORB 1QA9B 1RJLA 4XMPL 5EN2B 1ZT1A 1OARH 4J3OD 5KWYC 4Y52K 5DS8A 2V2TA 1ZBSA 3DV4A 5F7HA 3MRJA 4M6OH 1D7CA 1OVZA 5AB2A 1SJEA 3ECWA 4FG6C 4M7ZC 1T4KA 3FRUA 4RLDA 4X8CA 5FHAH 3QJHB 3FPXA 4ZDHA 3LKNA 4DW2L 6TAAA 4OKVB 3RY6A 2X10A 2FB4H 2HX9A 3HZMA 4FQLH 1I8MB 3HOUC 2BSCA 5TGBA 1DCOA 3A5VA 3QUYB 1VEMA 4UB0L 2BXYA 1ZTXH 2YN3A 3JV4A 2WZ0A 1AGBA 1OSPH 2NY0C 3JWNG 4GXUM 3VWKC 2P7TB 4DO4A 5TMCA 2WLMA 3ILPB 3ATDA 2YSSA 4ZI8A 5JPMA 1XFPA 3AAZB 5IFJB 1NDMA 5JOPD 4FNPA 1U42A 1PVHA 5E4AA 2LV4A 1AS7A 2IQ9H 1MIEH 1ULVA 3ABKB 2F18A 5E8OA 1V5JA 5AVSB 3VFNA 3FT4B 4GP8B 3H7BB 2GUYA 3UTSA 1CFVH 2HPOA 4TUOB 4QXGH 2L7JA 4PJ5D 4XVTH 3LH2L 3P4OB 2OMTB 1NBCA 2V6TA 1E28A 3BMWA 1E8XA 3FSWA 2XI9A 2AXGB 4N2NA 1NPUA 1WITA 4LQ1A 1X5LA 3KXFD 1M4KA 1GGBH 3CBKB 5DI8B 4DTGL 3Q1SL 4XLPA 1U4FA 2AXWA 5DZ9A 1R0AL 3L5HA 2F7OA 5E2WH 3S7GA 1DE4A 1CXIA 1W8NA 1GGYA 2WGNB 3IDJB 4N3UA 4X8JA 4ACPA 1D5MA 1E27A 5KVDH 4OINA 3QQNA 1ASOA 3II2A 3L6FA 3LZFH 2VSMB 4XVUC 4U1SA 5FF6A 3HOVC 3LXCA 5FUCC 2NNAA 2EVFA 1Q4NX 1JK8B 1I1CA 2VDOH 1TWGK 5F0MB 5T33H 1NWPA 2D7OA 1DLFH 4K2UL 5IJCC 1D7DA 3BXNB 1QACA 3KJ6H 3L45A 1BVKA 4XPTH 1J9SA 4ICXA 1BGXL 3UAAA 2DWEB 5DQDL 4YSOA 2MHAB 5JIPA 2TAAA 2VLME 2W92A 3IN0A 4PGEB 1EJOL 2CFAB 3WXWL 4BCXA 1UWGL 3SGEI 1LWRA 1SEBB 3UDWA 1WWAX 1KEML 2A6JA 4JCMA 4GKLA 3L3DB 3BZFB 4FZEL 3FKIA 1R3LA 1FORL 1N0XH 2G60H 2ZXWB 5J13C 3LIZL 1IEAA 2NZ9D 2ZAHA 1G7HA 3BIBX 3HS8A 3L9RA 1Q9WA 2WBWB 3FQUA 3GHBL 4H88H 3WMPA 3S8GB 1EHLH 2FO4B 1CFQB 1VRSA 3ARGC 3U1SH 1DVFB 1U6AL 3MBXH 1BDFA 5DUML 3TBSA 1BD2B 4NGHH 1IGCH 1U8PB 2QMJA 3CZLA 1ERNA 4WI0B 4XB8A 4PBVC 4AIZA 5K9KB 4YZFF 3SJVE 2OYKA 3TO4C 3I9GH 2I32A 4RFNC 1NCAL 4HK0A 4OCYH 4PJDE 3CJJA 3DX8B 1BQUA 1Z5HA 2X70B 3DURB 5IJDC 5AZUA 3FRPG 3DO4A 3C60A 2YPKA 1LDSA 3JTTA 1OP3K 1IARB 4NN5B 3H0GA 1XZ0B 2B77A 1X6NA 1SOQA 2ZX5A 4RQQB 1I1YB 1RK7A 3DUUA 3LIZA 5IMKB 3HRZA 1FJ1A 5CJOH 2XV0A 4UWQB 3QO0B 4CVZA 2C9AA 2AJXH 3R7RA 3OQRA 5I8OL 2WYZA 4C2MC 3K8LA 1GL4B 5ICXB 5SWZA 4TQEL 3ZGIA 4CADB 1TLMA 1BF2A 3THMH 2JB6A 4U6XA 5DMYA 3VXUA 4W9EC 2EXWD 1I9IH 2JI1A 2ZUQB 3IKKA 3S5LA 5KG9A 4BFEA 1A22B 2ICEB 4AENA 3H0TB 2CBMA 2XC8A 2ZOOA 3NIDE 1UGNA 4RGOH 3GJFB 5F1SA 3RVXD 1RUPH 5DWPA 3O2WL 3OJDB 3P4NA 2FJHA 3WGUB 2VXTL 2EABA 4OLWH 4Y1AE 4ODWB 4TNVF 4TL4A 2NY6B 4LNVA 3MTRA 2E7LA 1TTUA 4FNQA 5TE4H 1VGEH 1UWFA 2Y7OA 3JV6B 5H37G 1M3JA 3TYFB 2A9BA 4GLRH 2FX8L 1OANA 2NCMA 2PYFA 2VDPL 2WUCH 4M1CD 4Z3EA 1YCLA 3GTPK 2X4OB 4FQJL 4P8QA 1QZ1A 3JWOL 1L6PA 2X44D 4JB9L 3X2QB 2A73A 4HUWA 2YU9K 1P2CB 5LN8A 4RRPG 5INCB 4X7TB 1GAFL 3DSNA 3L13A 4AIXA 1SVCP 3S0PA 35C8L 1NH6A 5FYJH 4OQ1A 1AXSA 4G9FB 4Y5VA 2ZYRA 2IPUG 1KQ4A 4MXVF 4RESB 3HUJB 1NOAA 1B88A 3UG3A 3RZCA 4ZSOE 2FR4A 3RAJH 2DMKA 1JMZA 1KGUA 4HX1B 2IFFH 5B38G 4TUKH 4NI3A 4L9DA 3TYGH 3UAFA 4EE2A 4MNGA 1P5VA 4KDWA 5FDYA 3N41F 3MDJA 2WKGA 1IQ0A 3QDGE 4JO3H 1E5UI 3TJPA 1Q72H 1IKNA 3MV9E 1FG2B 4LIQH 4Q4IA 3AM8A 1MW0A 1NZRA 3HNTL 1JNJA 3T4AB 1TKWB 3X3GL 2X2YA 4KHTH 3EFFA 3U0TA 1G4MA 2YXWA 1IE4A 4ZFGL 3LRLA 1NUFA 2E76C 5I1HH 4RRPA 5DD3L 1JZ2A 1MWAL 2P24A 4LSUL 4I0PA 1AMYA 1EIBA 4W4OA 3H3VL 2CUMA 4GS7B 1BZ8A 1KN2H 1R5IA 1XDTT 2JLPA 1KPUB 4J3OH 1KMGA 1UWEL 3FCGA 1PZCA 2GTZB 3NFNA 5IV2B 3P0VL 1RU9H 3CNKA 3PWLA 3FT3A 1GMIA 5JHAA 1H8SA 3T4YA 2XPGA 5B38A 2H0FA 4LRIC 4BLBA 1TZHA 4DFHA 1JZ5A 1WIOA 4TTDC 1LLAA 1N64L 1XWVA 3HOUK 3CHSA 2X12A 1O6SB 2OTUA 5CKAA 1MUJA 1GOFA 1I3VA 3VH8G 1BIIA 4A2GA 3KYMA 4JE4B 5DYOA 4M7KH 4W6WB 1I8LA 4B9ZA 2VN6A 4IDJL 3LRGA 4JZJA 1JPEA 4M3KB 3VFMA 3I75A 2JKJA 3V6OE 4KM9A 1VFAA 4JKMA 1YEKL 3QPKA 3SBWA 3TCTA 3EF7A 3O9WC 3QS2A 4MD5A 4APQC 1TETL 4XNZB 4F7MB 4JN2A 1QVOB 1YRKA 3PE9A 4W6XB 4Z7UF 5EIIB 2I9TA 3LAJA 3VFVB 2YGOA 1CK0H 3D2TA 5I6XB 5DUJA 3AY2A 3DGGB 5KYUA 4M4RB 3BGAA 1N59A 4MFHA 5D1ZC 1XCXA 5IHUL 1Z2KA 4UQAA 1AY1H 4V1DB 3QG6B 1BZDA 3CXDH 4IRJA 3C5XA 3EFOA 5EZIL 3QULB 4XOBA 3MLRH 5I8KL 2F5BH 3CQPA 2CMRL 5D6DA 3S14K 5IB3A 3PJNA 5CIPB 3QZMA 4PP1D 4AM0B 2IV8A 1TSHA 2MTAA 1OAYH 4LARL 3VH8A 3WKNA 3FTXA 3HHMA 1Z9SB 3MGTB 4ELMA 4L8DB 1MVUB 1PJ7A 4RCAA 3VXUD 3HOVK 1BXVA 1TR7A 3FFOA 4TSCL 3SCMB 2AS5M 1QTSA 1NGQL 2JJTA 3QUMB 3FFDA 3CC5A 4NJAL 5CJQL 4LCCA 4LLGA 1R47A 3GZOA 3KVDD 3ZRSA 3PHQA 1Y1UA 4UNTA 3L1EA 2Q2EB 1IAIH 4A6YB 4PB0L 2GY7B 4B9PA 4I4WB 4RVBA 3V0GA 2WC7A 4LSVH 2XXCB 2E8YA 3BSZH 3L4VA 3FHAA 4JJOA 4TN9A 2IH1B 1PZUB 1NQBA 3FNKA 2CUHA 3AACA 3L5IA 4M5ZH 5CN2A 2K78A 1KXQA 4HOXA 3KPNA 4Q7DA 1JNNL 2NPLX 3CHOA 2VXSH 4HULB 3VXNB 1YUHB 1DANT 1T2XA 5AAWA 1P9MC 1WFMA 1MRDH 1HI9A 2RGRA 3N41B 4P48A 1E6OL 3UX9B 4XP1H 1BBDH 3ZSTA 1OGAE 2FBJH 4Y5XA 3HG2A 5IW6A 2OK0H 1MFNA 3K81A 5I8CB 3CDYA 2WQSA 3QP3A 4OFPA 2Y5EA 3QT2A 3IMTA 1KC5H 2XFXB 3NJGA 5EC2A 4AY0A 5GGUA 5HPMA 4KPHH 5MENE 3WI9A 1RU0A 5B1BB 2EBBA 5D7LE 3IFOA 3ALPA 1EFQA 3MNVA 4HJGB 1TQUA 3I4MC 3LKSA 3PDOA 4YHPA 2QZQA 1T5KA 5DF0A 1G9ML 1GGIL 2C9UA 4EOWL 3HAEA 1JNHA 3N85H 1SEQL 3WYRA 1WHPA 3U4KA 2WK2A 3RTQC 5DQJA 3HI5H 2QVFB 3SY6A 2XKNA 4C2MK 4K7PL 5GS0L 3TURA 2XBDA 2XTLA 1NJ9B 3WFEH 3FUNA 2C9PA 1VZGA 2QT6A 4UQDA 4RMVA 4QD2E 2GIYA 5DHXB 3K6SA 2QSTA 4I0PD 5F7EL 2OMXA 2DEXX 3C2SA 2ZG2A 5IMMB 3N91A 2F53B 1I1AA 5IQ9B 1MPAH 1JYXA 1HHKB 1JS4A 5EZLA 5C8JB 5FLMC 5J12B 4E0RB 4QT5A 3HZYB 4HD5A 4Z7UB 3WMQA 1ZVYA 3VQMA 1CLOL 4YG2A 2WBJB 1T7ZA 3QG7H 1AMXA 1U95B 5HI4D 4XBGA 5IJKC 4LSQL 4P5TD 2YGNA 3BH8A 4NBYB 1JDAA 3O4LA 4PYHA 1MIML 4P5MB 2ZF9A 4LDEB 2WQWA 5F96H 1MRFH 1BXAA 2W9DL 3GSOA 8CGTA 3KLHD 4KXDA 4GEIA 3N06B 3VJ6B 1R1CA 3H3VD 1NCCL 4LAQH 2PYEA 3Q3QA 2J71A 3V6OA 1SF3A 4UUJA 4XMPH 5D5ME 5F7NC 3MODL 1G94A 1XO8A 4PGCB 3D4GA 5D4DA 4LB8A 2E6PA 3LOWA 1Y18B 3IFLL 1JVIA 3BIKB 3Q1EA 4MX7B 4RMRA 5BRQA 4PJ7A 1X5ZA 4DW2H 1X44A 1IB5A 1H3TA 4JBSA 4PLKD 1LK2A 2WLLB 3QB7C 3EHBC 3G6AA 3QFJB 4UB0H 4IRJD 3VXTA 4HK3N 3LPGA 1XH3A 4NQDA 2H0JA 3V55A 1TWAC 4YO0A 2XV6B 3V5HA 1LE5B 5D2LE 1AYOA 3JWNH 2ZPKL 5I16B 4I9XA 2JIXB 3U4EA 4XXDB 5CEXA 5CLWA 5KS9A 5JHDA 1XBDA 1EQRA 4ENZA 4X42A 3KDPB 2D4DA 4TULL 1WAAE 3I74A 5D7IE 3VXME 4DEWA 4UBDC 5EU6A 3DX0A 5IHLB 3LH2H 4QHLB 1AYRA 3P73A 1E5AA 3OX8A 3LZNA 5D7HA 5HJGA 4YL4A 1NWOA 1D9KB 3EG9A 4IS6B 5EWIL 4ODUA 2FBRA 4P04A 2P4AB 1N67A 5E8DL 1U3HA 2QLVB 3Q1SH 1KLGA 3FW6A 4DTGH 1R0AH 4L5FL 3T0BA 4NO0B 4RGMB 2HJFB 3TBYB 4YHLL 4IGBD 2YOCA 1V3MA 2DYPB 2XHNA 3ARRA 4GUCA 4Q14A 3ULUE 4TXVB 1IU1A 1DQVA 2X1WL 1KXTB 2HG5A 4ISVA 3QFGA 2BNRA 2MQCA 1OW0A 3MPCA 1P7QB 5FYLL 1A64A 4K2UH 4YEEA 1KJVB 4X9GA 4PD4K 2Q6WB 1IKFL 1H9DA 1JPFA 4FXLA 5SV4A 1BGXH 3MROA 5D7EA 5DQDH 1WO2A 2Z8RA 3BCDA 2CDFA 1MFBL 2I07A 5JUEL 1EJOH 3IMVA 2JQMA 3WXWH 1UWGH 1ZTMA 1YDPA 3A22A 4NQCE 4Q6KA 1KEMH 1JQWA 3QIWA 4FZEH 5D72H 2ATKA 1FORH 5EOCJ 5K93A 3WIFB 2HTKD 3LIZH 5E6IB 5D7LA 5A3ID 3Q2LA 4BFNA 4Q9QH 1O2FB 3LH8A 4G9DB 3F7PC 5BOZG 4ODBD 2V5RA 4RDQF 3OJVC 3AG1B 3EOBA 3F62A 4L3AA 5F3HB 1U6AH 5C97A 4NM4L 1BXXA 5DUMH 5TJ3A 2ETWA 3CDFA 2AQRA 2BS8A 3NFPA 5T1KA 1J9QA 4GKOA 5HD8D 1GTNA 3LY6A 3HHRB 5J6HB 1JYWA 1NCAH 4JKPL 1BYOA 5I28A 2PTTB 3ME0A 5ILTL 5GGSY 3RVWD 1NBYB 3LMJL 4YN3A 1XH1A 4PIRF 4BY1C 2JJWA 3FAWA 4GBXD 3O2DL 3IJYB 3AS2A 1QFUL 3KNBB 5I8OH 3KM1A 4CVWA 2WLIB 1WVZA 4E41B 4TQEH 3NCFB 5C07A 3O4LD 2AEIT 4I3SL 1CGXA 2FSEA 4GO9A 5EN3A 5ICYB 5GS0D 5LLIC 4G6AD 1EEYA 3RX9A 3U6RB 2JQZA 3GGWB 5I5JA 1XR9B 4E42B 4QNPE 1B0GB 1OGTA 4EIZC 1CL7I 5LO7A 1LQSR 4XPHL 4PW4A 3I9AA 4U6TA 3O2WH 1T5XA 2BNUA 2VXTH 5F7DA 1G4RA 3DJZA 4UU9B 5F9DC 5E51A 3TVMA 1A4CA 4DK6A 5L2KE 2MQGA 3O2DA 1LMIA 3T2QA 1EEQA 4Y2NA 1A9BA 4GIPD 3I4MK 1OAKL 1EEZA 2FX8H 5CHNA 1AIFA 2FEJA 1ES0B 4LPTA 4YHYC 3VXPA 1AB4A 4M29A 3VYPA 1CS6A 2G75B 3GSWA 3QHFL 4NQDD 4JHWL 4ZUVA 3JWOH 3VI3B 1T0NA 2Z93B 3CSPA 4JB9H 5DCCA 1JYNA 1KN4L 3UGUA 1X5GA 5JHDD 5AALA 1MY7A 2CBQA 4FXKC 1GAFH 3EYVA 4HKJB 2IPKB 4TNEA 35C8H 3BGMB 2O61A 3CPUA 3K6OA 3L08A 1BM7A 2AF2A 5EU6D 1PJ5A 1P7KB 3CK0L 1WAAA 1PAZA 3MR9A 4JO4L 2CW0A 1VLXA 3CN0A 2YAFA 4BBSC 2I26N 2F5AL 3G6JE 4IM8A 3SDAC 4PMEA 1NANI 4NQTA 2E7DA 1EFXA 2Y2TA 2F7IA 4FNTA 2DQEH 2V17L 2ISDA 3V0IA 3O0RL 1YMMB 2LOEA 3O6LL 5FLMK 1BQHG 2A0LD 2EZ0D 4I88A 2Y1VA 3AWGA 2VITB 2XWRA 4YHNB 1AQMA 2ZFZA 1S3RA 4G8IA 4KM8A 4F5CE 1T1WB 2WZPA 3HNTH 3QJSB 5IB4A 3X3GH 1S9XA 1ETB1 1T04A 2OMUB 2HT3D 4NO3B 3SB3A 2BNRD 3CFQA 1TOXA 1DBJL 3QFDB 3ABLB 1ZK5A 4H8UA 4WW2B 3JUYA 2G0LA 5IBLD 1ZT4B 1KXVC 4N85A 2EE6A 4ZFGH 4XZUA 5DD3H 3VA7A 1B3JA 2WANA 4LEOB 3TEUA 2W1NA 1QTPA 3EBHA 1IAKB 3OWRA 3PPSA 1ESOA 2QSQA 1UWEH 2F7PA 3MN8A 2E2IA 2ZZUT 3P0VH 4FLRA 3GSRA 4GG6F 2G3XA 1CGVA 2K4AA 5AW5B 2Y69B 3UP1A 4Y16B 1CR9L 4W9KC 3NCXA 3ZYJA 4BLAA 4XCYA 1JZJA 2EILB 5HI3C 2K9UA 1X5HA 1PFCA 2QGEA 1N64H 1BQHA 4DH2A 2VDMB 3CLEL 2P8LA 3S35X 3T8XA 1AR2A 2B4CL 3WEXB 3WUWA 5BV7L 3CQZA 1FHGA 4PJCE 1EZVY 3MREB 5FYLD 4IDJH 5E8NB 2XY2A 2P5EA 4EZMA 1YEKH 4U1NA 5T1KD 4LSDA 1KULA 1TETH 2WAHA 4N2MA 3C6LB 3A4AA 5D2NE 1FCGA 3UIZA 3OKNB 4JFFD 1YYLH 4KK5D 5ESQA 2YEZA 3OKOA 3BVDB 5ICZB 2XWDA 2CDEB 3ULSB 4N90D 2RBLA 2DI7A 5LHDA 3D69B 5IHUH 5HSFA 5I1LB 1OGPA 1WCBB 1IEHA 1PJ6A 5HDWA 5EZIH 1ZOXA 3H2QA 2MQ3A 4X6FB 5I8KH 4A3DC 3BZ4A 3X11B 1I7TB 2BOLA 3HEIB 4WNQB 3PP3K 5C09A 4ZG1A 3VW3L 1J11A 3B7UX 5F97E 4LARH 3EKCA 4G8EB 4YVNA 3Q13A 3NCEB 5A43C 2K8QA 2FEEL 1S5HA 4TSCH 5DU7A 1KYDA 3ILEA 5HYQA 1J8SA 1QI5A 2WCGA 3F3HA 4XTRD 1NGQH 4KU1A 5MERA 3PV6A 1QWUA 2PP7A 4QRRA 2G5RA 3HC3L 4NJAH 2DQFB 5CJQH 2VC2L 1FSKC 1E4WL 2XWJB 4LSSL 4OCWH 5AW9B 3RKPA 3J8F7 2XQYG 4PB0H 2M2DA 3E7JA 5HHNA 1PZAA 1SLUA 3Q43A 5FDWA 1I1FB 2CIKB 1NCNA 1Z3GL 3RVTD 3RVUC 4Z7NE 4WEEA 2Y1YA 2Z4TA 4G1EA 2ZX6A 5KSAB 4FABL 5L2JB 2FECL 2KLRA 3MRHA 3HAEH 4A93K 1JNNH 1M53A 3NCYS 2ED9A 5E5LA 5G4NA 3WMSA 3C5JB 1AGEB 4AUJA 3CSYB 3OR6A 1DQQA 2Q1EA 2ZXGA 5ABAA 4DPBX 2QKIA 4YFKA 3KPQA 1NMBL 1E6OH 5IWLA 4X50A 4Z7WB 1KGCE 3RBGA 3GYRA 4PG9A 4Y9FA 3M4OC 2ZTBA 3O3AA 1GPOL 1WE5A 4I18C 4JL2A 1FL5A 1VFBA 5TH2B 4G80A 3AG4B 3K72B 3IJ9A 2MOGA 1S7TA 2GSIB 5AFAA 3MUGA 3ABMB 2XQYA 3S88L 4XN5A 5F7LB 2ICES 5HDRA 1NLDH 1JZ6A 3G6JA 1XMWA 2DH2A 2X41A 3T6ZA 4U1JB 4APXB 1GGIH 4EOWH 4BY1K 2BSDA 4JFDE 1SEQH 4KI5C 3VACA 3KWXA 1J5HA 4JO1L 3B8SA 4OD1L 4YDIH 5EFIA 5AD0A 4PV1C 3MRNB 1UYWL 2WZPD 1XGPB 5EZJB 2UY7B 1NEZG 4K7PH 2B14A 5GS0H 1UGKA 4YBHA 3EXLA 1U58B 2UZPA 3L4ZA 3PHSA 3MJ7A 4HU8A 2LAGB 1S7VA 4WU7B 2CJTA 5BXFA 4BDVA 2F8VA 1O27A 4CVXB 2OXHB 5F7EH 2LVCA 2K8MA 2K0RA 3TBTA 2V5YA 3HI1A 5D8JL 3IGUA 5CNHA 4AGPA 1EAPA 3PL6A 1PY4A 3QI9D 5HHVH 4HPOL 1HI6B 2X9XA 3RL1A 1EAQA 4U3CA 2GVYA 1HAUA 1J8RA 3OD3A 1CLOH 5GIRA 4DUWA 3UL4A 4KTEL 5FKPB 2P26A 1UJ3C 2YK1L 2PP8A 1MG3C 4IBSA 4J3UA 4NO5B 4QY8B 1MIMH 1IQDB 2AQTA 2VDOB 4KKAC 3U9UB 3S5ZA 2NXZB 5GGSA 4I9WD 2NZ1A 1RIVH 2W9DH 5DHYB 5FB8B 5DUBA 4GQZA 2CLRB 2FK9A 2NW3B 1NCCH 3A67H 4A3IK 3VG9B 3P2TA 4HIPA 1GJIA 3QX3A 1EHXA 2X4QB 3MODH 2VXVL 3TA3C 3QPQD 4OZHE 3MV7E 2YD2A 5FYKL 3IFLH 3CFIC 4BBSK 2LLNA 2I9LA 3B8YA 5CD5D 3SPGA 1K83A 2B2XL 3SD2A 3VD9A 1HZHL 1UXMA 1NCBL 3PJSB 1JHTA 3JV0A 3FO2A 2J1WA 1IBZA 4Q56A 3Q5TA 1X9RA 4LPXA 4UQ2B 4X6DA 3U2SB 3LEYL 1KACB 5LAPA 4X4YA 1INEL 4KK8D 5I74B 4W9JC 4FJZA 1OP5K 3H9HA 3GI9L 4DZ8A 4BUGA 4J3OF 2VLKB 4ZMZA 5SWZE 1R3JB 2W07B 2ZSVB 4CMHB 1C12B 2HCZX 1KCLA 1Z9NA 1F4AA 2A6DA 3CX5K 3KPSE 3C9NB 3G5ZB 4XBPB 3WDIA 4BK4A 3ZTEA 2BIMA 2C4FU 3N3EA 1RD6A 5AVWB 2ZWZA 3NSFA 5AL0A 3E9UA 1NFDE 3RWJB 1FYHB 3IJEA 3V0VB 3LYRA 3P11L 5IUSA 4M5TA 4RH4A 2YEQA 5E8DH 5LB1A 3OHMB 4HMDA 2NY4D 4HUKB 4L5FH 5DD6A 2YUVA 5IESL 4MAZA 5CP3A 4QXUL 2Z92A 1A7NL 2YO3A 3DMMA 1W2KT 4Y19E 3JXAA 4IKNA 4YHLH 1EJ6A 2B0SH 4QRRD 5IY5B 3D48R 3TIDB 4MA3A 2E9BA 2ZCHL 4I0KA 4KH9A 4IOFC 1N19A 1YQ2A 5FYLH 3RDTB 2A74C 4KMLB 1CXFA 5BVJB 5ACZA 1S78D 3IGAB 4X6BA 1IKFH 1GVIA 4UTCA 3AREA 4PREB 3S3CB 2IFGA 3FFCD 5GJTL 3RA7H 4H8WL 2XCRB 2PTUA 3DIFB 3PXHA 3PWVB 4Z3FA 4KKQA 1BDYA 1MFBH 5JUEH 1W6LA 1HCZA 3QIBA 5TD4A 3BT2L 5EUKA 3NJMA 2NT1A 1NLBL 2QMKA 2IVFC 2CKBA 2VQUA 5K33A 1RP9A 2H3XC 1QPXA 3MRDA 5C2UB 3CXHJ 3BP5A 2XX1A 5AVRB 3WSQL 4OZGF 2R8SL 1G6RB 2G5UA 3BP8C 1TWFC 3VMNA 2X4UB 2XUWA 4PJAF 4C56A 3TFIA 4POUB 2H45A 3RB5A 3LHPL 1QSED 3PO3C 5IJBC 3S35H 3IETB 2EXSA 3QEQE 4CNIA 3D4CA 3IXTB 2WLKA 2VLJD 6PAZA 4NNPL 1RIHL 1Y1VC 5HJ3B 5BS0A 2J1YA 2WXRA 5HP5A 1WBZB 3QEUB 5MI0B 4JKPH 5ILTH 2OM5A 2WXKA 3FN0L 4HFUL 4KZCA 4OAWA 3LMJH 5DHEA 5FUCE 4BUQA 3PHOA 2HJLB 4UIMA 1FL3A 3IWUA 5C6WH 5LVEA 4A67A 1BFOA 3BAIA 3BN3B 3LSOB 3PL6D 4PRAB 4X9FA 4Y4KB 3O2DH 4JDEA 1FWXA 2IGFL 4G42B 4C83A 5FPIA 1GXEA 4FEMA 4WV1A 4QWWD 1CT8B 3D9AL 5DJ0A 3EYQC 1QFUH 4NRYA 4CJ1A 1YEWA 1QSFA 4BFFA 3ISRA 4GTLA 2FZ3B 1F7UA 4L48A 1JF6A 1OHZA 5GZNA 1FCCA 1FIGL 2APVA 4Q5SA 3DV6B 1PG7X 3S6CA 4B27A 3S97C 2OQJA 3KPRE 3GIRA 4IMLA 5AOLA 3V5DB 1EERB 3L7EB 1QLRA 4OLYH 1EDQA 5I82A 1DSFL 3M4OK 1AR1B 5DEFB 1I9RL 2HVKA 2IMMA 4GAGL 1IM9B 3V2AR 3GXIA 2GJZA 4QYOA 3HZKB 3WNKA 4EN3C 2K6WA 3D52A 3TFKC 3U46A 3TONA 2BZDA 4XCEB 2YU9A 4A3JC 3T0EB 3EJYC 3KWUA 1R3HB 4OZIF 1OAKH 1RZJL 5ALCL 1L7TL 4LOEA 1U8NA 4PS8A 2BSTB 4GKNB 4OQTL 4B95C 5JW4N 2GUOA 3MRLB 2X5PA 3QHFH 4JHWH 1UXWB 4RAVB 2XDHA 4PJ9A 5AYUL 3UPAA 4WI5A 1WQGA 1A4JB 5DFTA 4NIYE 1KN4H 2ZWYA 1ZJBA 4RNRA 3WKYA 1DFXA 3TFBA 4HJJH 1E42A 3AUWB 1FN4B 3KBPA 2YKLL 3WS3A 4L1HA 1KXHA 4JO4H 2F5AH 5FYKD 4NUPA 3CZNA 1VGKA 4HWBL 5FA3B 4DVBA 4WKZB 3VTTA 5E1HB 2V17H 2KC0A 3NJIA 2N7AA 1HNGA 3FOMB 4WCYL 5FO8B 3O0RH 3L5WB 1IGTB 4KDTC 3O6LH 4MAUL 2P8MA 3TCLB 3NFSH 3VGAB 1WSVA 4HJIA 1KCUL 4OQTA 3DMMD 1HJCA 4R6UA 3X1FA 1AD0A 3FQTB 4LNRA 3BEVB 2WN2A 3WEMA 5C92A 1Q0YL 3IMWA 3S4SA 4UOQA 2JH2A 4JO8A 4OZGB 5D96B 1F1GA 1DBJH 3RUGB 1XBRA 4LCWD 4O02B 3LNFA 5DRZA 2E2HK 1T1XB 5LNGA 4L4TE 1XIWC 3ARED 3NJJA 1CLVA 2PNDA 2DEYX 2BPBA 3TJHD 2ICWB 5IHZB 2C4XA 3NN8A 3I6KA 1B2WL 1KELL 4HWBA 2C5DC 1HU8A 3EGXB 3HNSL 3QIBD 4GY4A 4OTXL 4BUHA 4X6AC 1R33A 2B9BA 1V27A 3L3IB 3B83A 2K6YA 3VWKA 4X6CE 3QAQA 3ZN6A 4KVCL 3J2PA 3HS0B 4AYFB 5BNXD 1OSZB 4JY6B 4G0WA 2PO6B 4IJ3C 1EZVX 4K7FA 3SO3B 1OCRB 5B3JE 3BUYA 4C56D 3MNDA 2B4CH 5DJ6A 1BP3B 5GRYA 2KHAA 1ZPUA 1AZBA 2A4EA 5HHMD 3F12B 3SE3C 1J9RA 2FT8A 2WSPA 3GZPA 3BVTA 5DLLA 5F9JB 4AC2A 1HXMA 5BS0D 2YD6A 3VDBA 2JKLA 4WJG3 5HVGB 4O00A 1PCXA 1YNTA 3MKKA 2C3XA 3L3GA 2ZIDA 1XR8A 5TPWH 3ORJA 5SWSD 3K8MA 1S7RB 2VDLB 4N5ED 1C5BL 1T1YB 5DLML 5IM7B 4BYHA 4U1MA 5EUOB 3CZSA 2Y3AA 1ORSA 3TO2B 4MZ3A 4ODSL 3RIAF 3VW3H 2FL5A 2QFRA 2YMOA 2HLFD 4H44C 1RPUA 1P6AB 4XRCA 3DOHA 1L3NA 3QZWG 5GZND 4ENED 1LEIA 2AJZB 1ZSDB 2VM9A 3MRCB 1OTSC 1XSKA 1TJGL 2ZT9C 5JIMA 4KATA 4YDVA 5DK0B 1UT1A 1MH5B 1R5WA 3HC3H 2BSEA 1A1OA 4UZGA 1IGJB 1B4AA 3EO0A 2VC2H 3VRIB 1J0ZA 3WFZA 2WJ7A 1N6QL 3WV0A 4LSSH 3MXWL 5EO1B 3KPRA 1RJLB 1M56B 1RJCA 1ZT1B 1IAIM 2O5ZL 5T3XL 2V2TB 2X2HA 1MCKA 3DV4B 3MRJB 1Z3GH 2EH7L 4YMPA 4TOYL 3UCRA 3ARGA 4TVPL 3LKNB 1XEDA 2OR8A 4JO2H 2EH8L 3HZMB 2P45B 2G5BA 1YPZA 4FABH 1T7WA 2EDEA 5TGBB 3L81A 4NUGL 1AGBB 3WD5L 3ZE2F 4M61A 3TO4A 1ZVSA 1J5IA 2YSSB 5JPMB 3PO3K 1NDMB 4Y2DA 3STLB 3QZWA 3HG3A 3UMTA 3AU1A 5E8OB 1OAQL 1S9YA 2DQDL 1KBGH 3Q05A 1GPOH 3ETBJ 3CFKA 3UTSB 2FLMA 5D1QA 4N2LA 5LKNA 2Z8WC 1UUSA 3JYBA 4LDOB 1E28B 1FHNA 3VFSA 4HCFA 3S88H 4X4KA 3AT8A 5FCUL 3IMRA 4C55A 1WFJA 1L9TA 4PRID 4OF6A 4BFJA 3V0WH 4ZMPA 5EZOL 3F6IA 3HE6C 5IMLA 1THAA 1O29A 2HJKA 4OD1H 1D5MB 1E27B 3L6FB 3KHQA 3ZZ1A 1JXGA 1BZQK 2NY2C 5E23A 2NNAB 4KO6A 3VYNA 3DVNA 1FZMA 2YAMA 4GP5B 1OF2A 1BF5A 3LVTA 4RETB 4S0HA 4P06A 5IJVB 1MFUA 3R4RA 2TSBA 4U2YA 2EDRA 1TDQA 3RE0A 2XZZA 4DP1X 5KVEE 1BVKB 3WDHA 5DUPL 2ADJA 3V4PL 3ADAC 2MOQA 1URLA 1HCYA 1AJ7L 4BFRA 5D8JH 5FFLA 1MJUL 2Z7WA 3QA3A 2MNUA 3ELAT 3IJSB 4HPOH 3O6MH 5E2UL 3UYPB 1CICD 5LJYH 1IVLA 2YMXL 1SF5A 5EV7A 2A6JB 4QOKA 5DMJB 2ZYIA 3WNIA 4F8TA 1R3LB 3ARDA 4KTEH 4OFVA 1IEAB 3L9RB 1ECYA 3FQUB 2YK1H 3ARUA 2V7NB 1BQKA 2AMGA 4I87A 1Z0NA 1QW9A 4PRDA 1E8WA 3SPCA 5CZVL 5C3IA 2VR4A 2CRZA 4N8PA 3TBSB 1SXNA 4XR8C 4CW1B 3Q5OA 4HC1L 5E9DA 1O9ZA 3Q8BA 4AM0Q 6CGTA 4A7GA 3V4PA 2B1AH 4C59B 2XYBA 3N0AA 5KYYA 2VXVH 4HK0B 1KCRL 4X6EB 4JDZA 3C60B 2XN2A 2PW2A 2BY2A 2B2XH 4GMTL 4KO9A 2XJLA 1HZHH 1SLVA 4M6ML 1LP9E 2R7ZA 2J5WA 4E5XG 4XVUD 2UZYA 4IBQA 3S16C 2JKNA 5CP3H 2YGQA 2NY3D 4CVZB 4HJSA 2JLLA 2PTVA 3LEYH 3C8HA 2B8OT 5T8IA 1INEH 3NGBB 3MYZA 4I8DA 4RFEB 3EH4B 4U6XB 3GI9H 5D9SA 3JSTA 3VXUB 1KYUA 5T5NG 1KV3A 1M05A 3S5LB 4FNRA 4RFOL 2Y4SA 4HC1A 3T6WA 4AENB 2VABA 3HPLA 3HZVB 3R4DA 2DKMA 3QVAA 3ZE2B 4LAJH 2BSED 2FUTA 1FYTE 5M5XK 3WXVH 4F37F 3U4BL 2OJ1A 3P4NB 4A7TA 2FJHB 2B59B 3P11H 4NKMB 1KIQA 4I48A 3R8BB 4HLZG 2CKBH 1NCJA 4JKNA 2ENJA 5LG6A 2H4EA 5IESH 3OAZK 1LO0L 4QXUH 5B4MC 3N42B 4X6AK 1A7NH 1A1NA 1PLAA 4E5XA 3ZDXE 4HOWA 4MJHA 2Q5BA 5BRZE 1SHWA 4N0RA 4ZUTA 4PRPA 1KTCA 4HUCA 2ZCHH 4IKKA 3O9WA 3B2PA 4JY5L 3G5XA 4WFHE 3ZDYF 4APQA 1BEXA 4DGVL 1T66D 3TO4D 5H4ZA 1EZLA 2VISA 3KLKA 1OP3H 3DJRA 4PR5A 2A73B 4HUWB 4Y2DD 5ES4B 3FQXA 2ITFA 4D9QD 1QSZA 1NAKH 5GJTH 4H8WH 5BPPA 1R75A 3DSNB 4UYPA 4MCNA 4FQ2H 5D1ZA 1TJHL 1X5MA 3ZBMA 1SOKA 1V3KA 2F8XC 1M2VA 1YY9D 4HCGA 4Y5VB 5D1QD 1KYAA 3BT2H 3PABA 3UAJD 1WGOA 1NLBH 2VDQL 2EP6A 5T3XD 1OEZW 3RZCB 2FR4B 1C5DB 3QUXA 2H5UA 3FSAA 4OGAD 5E7BA 2BRQA 4OBSA 2HFFA 1XF2A 3BKJL 2WWKO 4JJ5B 3O11B 4TRPL 3WSQH 2R8SH 3PNWB 5ACLA 2WAQL 4I1RA 1ZKAA 2EDQA 4MNGB 1H3WM 3EGSA 3PPEA 3KH3A 1C8QA 3VCLB 3B2VL 4ONOA 1O28A 4KZEH 5DEJA 1L7IL 1IBDA 4HCIA 3ILDA 5D1XC 2NY5C 4HS6A 4NNPH 1RIHH 3EFFB 1TQSA 4YLQT 4FRWA 2P24B 1SNRA 1KBWA 3FN0H 4HFUH 4U0RC 1BEYL 2MPVA 1JVKA 4NS0A 2C9RA 3GJFK 3NFNB 2DL9A 3PWLB 3FT3B 4R26H 2D8KA 2P42B 1ACZA 4KGLA 1X5AA 3KMDA 2WAQA 3WUZA 3L3KB 4GAYA 4QOKD 5B38B 5ISZE 1H3PL 1P9MA 1TZHB 3D9AH 4WI3A 3ARDD 1O6VA 5T1JA 3CFDB 3RI5F 1MUJB 4LP4A 3KGRA 1TVBA 2VRQA 4QHKJ 1FIGH 1HHHA 3GTJA 4JZJB 1IRAY 2FQGA 1QFOA 1VFAB 2KZ1B 2LAAA 3H9SE 2Q7YA 3BVUA 5E9DD 4MD5B 1E7UA 3QQDB 1DSFH 2V6UA 1I9RH 4GAGH 4X80H 4JN2B 2E6JA 3AQXA 3BGFB 2I9TB 5KSBE 1A14L 1P0SE 2BW5A 4JLRA 4BJLA 4ZPVA 4A3CC 3REVB 5KYUB 1N59B 2EDNA 1DVXA 3I6LD 2DV6A 4OVVA 3ARZA 1RZJH 5ALCH 1UQSA 1L7TH 3NIGE 1RJYA 3FO9B 1KCKA 4DUVA 4IRJB 3EFOB 4CAGA 4HFWA 4OQTH 3VTMA 3NPSB 2Z31A 2VUMC 1OT2A 43C9A 5AYUH 5IB3B 3CU7A 1SDAB 3M6DA 5M5YK 2IPTL 2GEQA 1ID5I 1A21A 2EUXA 1NTDA 2A9DA 4ELMB 5ABZA 1AZRA 4N2CA 4GUOA 3L4UA 4NYLA 5FYKU 2OMYA 5MEQA 4KMDA 4BQCA 1BXUA 2YKLH 4RRPM 3KLQA 4PJ7F 3HRPA 3CC5B 1O7DE 4RX4A 3U1PA 3WE1A 2WVVA 1ZHBA 2QZ5A 5JW5B 1FFRA 3LXBA 4P23A 4P3CL 3ZDZF 1MXGA 4HWBH 3B9DA 3NIDB 2PXYD 2CO2A 5IJKA 1FIEA 4WCYH 3TFJA 2CCVA 3QXDA 4MAUH 1QLEL 4Y1AB 4KNQA 1KCUH 1FNEA 1FFQA 3CGTA 5KS9F 1BJ1J 3O4OC 5K1JA 5DRWA 2K1MA 3KPNB 2V3FA 2Y5QA 4RSVA 4HK3J 1NA8A 4PRPD 1Q0YH 2BDNL 2X9WA 4BXXC 4Q9BA 4ZK8A 3BKMH 3OMAB 4I13B 2YRLA 2VMJA 4Y5XB 3EFDL 1BFVL 3Q2NA 4DGYL 1OAXL 4L37A 5KVFE 4LKXA 4P9ML 4WWKA 4TUJA 5ANME 5HTSA 3SDCB 1B2WH 2J72A 2ZXCA 4XVJH 5EC2B 4J1UA 3IYLW 3QPXL 4OTXH 4Q8BA 3QUXD 1TWAA 3TESA 1U41A 3LKSB 2BVQB 4BH8A 3PDOB 4KVCH 1IZKA 2F54A 4ZSOB 1WWWX 2CD0A 2CK2A 2WINB 4OF3A 1HWGB 2FD6L 3HAEB 2N56A 1I6VA 3GMMA 3S16K 2QVTA 1BJ8A 4HEME 4X0NA 2EYSA 3WO4B 3KGUA 1BGWA 4TNVK 8PAZA 2XKNB 5ETUA 5IQNA 5C7ZA 4PH8A 4O51B 5JXED 4N8CL 4QF1A 2YZ1A 5T3ZE 3ZY7A 4LP5A 2FLBT 4HSCX 3K6SB 5JDSA 2OMXB 4OD3L 2GKIA 3LAPA 3FMGL 1RURL 3T6VA 5GGRY 2QBWA 3OL2A 1I1AB 2RAMA 1C5BH 3D07A 5DLMH 4KB4A 1CLYL 5EZLB 4Z7OF 1O7SA 2ZUSA 4QT5B 1WP6A 1T3FA 4WI2A 2FTAA 2UVFA 5JIHA 4AQ1C 3PWJA 4ODSH 2KZWA 3ZYZA 1G7JA 1HHIA 2YQBA 4HJUA 2OCJA 2PCPA 3BH8B 5IVXF 3LEXA 2Z8VC 1EMTL 2QPSA 3PAYA 5DMGC 5EBWA 4UANA 1UD8A 5HVHC 12E8L 1OF0A 2FJFA 4FKEA 1TJGH 2NVYC 1U91A 3WIIL 5TQ0H 3IMBA 3ZE0E 2X6BA 1RFDL 3EJSA 4ZMYA 4ZO7A 2P3YA 3OWEA 2PYEB 1S7XA 1N6QH 2JB5L 4UUJB 4O2EA 2CR6A 2O5ZH 5T3XH 3H53A 4ORZC 4UM8A 1H8LA 2WWOA 2EH7H 1DTUA 4KJWC 4TOYH 3MUZ1 4J8RA 4TVPH 5LWYL 4LVNB 3MI6A 3S1NC 4PV9B 4DEPC 4EDWL 4BKWA 1QMUA 5K1VA 4NN6B 3G6AB 5H35A 1NEPA 2WB7A 4NUGH 3X1GA 2Z31D 1XH3B 1HH9B 4LLMB 4NQDB 3ZQXA 3WD5H 1A5FH 3FUJA 1Y1DA 3PQYE 4YO0B 3B3IA 4PCSA 5ESVA 5ADOL 1NGZA 5CEXB 3U4EB 3Q06A 1YNJA 1KFGA 1OAQH 3HMXL 3QH3A 2QQLL 3QJUB 2DQDH 2O5YL 3RJDA 1XGUA 3B2MA 3B2DC 2DQ6A 5EU6B 1TQCB 2E4FA 2G2NA 1UB6A 2C3VB 1KJMA 4RX4D 4Y7MA 1JN6B 1EBPA 4D8PA 3UEQA 4HJEA 3DX7B 4P23D 2GBUA 2IAND 3EG9B 2VE6A 3F6LA 1F6AA 1CE6A 1ZHLA 1J0IA 4ODUB 5FCUH 5IORA 3TOPA 1DQDL 2X3AA 5C0AD 1U3HB 1KLGB 2WN3A 3VD3A 2APXA 5EZOH 1N0LA 2H41A 2XN9A 4UOZA 4POYA 1E8YA 1N3NA 4GG8A 2GFBA 2HH0L 4XWGL 2HX8A 3EDKA 2W0KA 3X1BA 2BC4B 1ZWIA 3QDMA 1TVDA 5EF0A 5F1KC 2Q10A 1H15A 2HG5B 4ISVB 5IMOA 4MMYA 2BNRB 4Z7VA 3LXUX 5KVGE 3HMXA 5J3HC 1ML0A 3N6YA 2EYRA 4WDIA 4MGXA 4BWTA 1IGML 3A8KA 4GLRI 4QGTA 3WNJA 2ERJB 3MUJA 4XPAL 1DBKL 1JHKL 4LCYB 5C6TL 3MROB 3V4PH 3H8NA 4O58L 4PJBF 1WCMC 4WWKD 2MPAL 1OTUD 3KYKL 1A4KA 2H2SD 2I07B 3B37A 1EX0A 5E2JA 1J7VR 1DQTA 3QYNA 1M7DB 4RAHA 3FU7A 5E2UH 4M8QA 2XG4A 5ANMA 2YMXH 3QIWB 3C87A 2AERT 2ATKB 4GRWH 5AOZA 5MENB 2VMEA 5D7LB 2F54D 2WYIA 4FXKA 32C2A 4AG4L 4R5TA 1UOKA 3MCKA 3NT0A 4CN4A 3ULVE 4Z7OB 1W8EA 4AGQA 2WQXA 2HKHH 4RGNC 5T5FL 4HS8L 5LGYA 1L0XA 5J9PB 4LVHB 4GFXA 3NJXA 3SDAA 4HC1H 2DWDB 5AOJA 4D9LL 3TN0B 4OUUA 1G7QA 4KI5E 4PRHE 3BUIA 5HHPA 1WA0X 3MO1A 4B9YA 3FOLB 3ME0B 1KCRH 2F9BT 1ONQB 4E9WA 2TRYA 5F9WB 4YNYA 3UTTD 3SJVD 4Q6IA 4GMTH 4Y4HC 3RIFF 3LRHA 2E9WA 5L9DL 4H2CA 2CU9A 2IOIA 4YL9A 1U8JA 2XXFA 4G3YL 1A9EB 4JGJA 3FONB 5A6LA 1RZ8B 3K4ZA 1PSKL 2BNQE 2DTMH 2C1PA 3C2AL 4ZTPL 2ZOTA 5JW3L 5T5FA 5C07B 4XX1E 5AG8A 2FSEB 2DPKA 1O24A 1SUHA 4U6HB 2MQ0A 1Q90A 4QJVB 3C5ZC 4RFOH 4BXXK 2I60L 2WWMC 4TLSA 1EEYB 2NY1D 3SO5A 1IMHC 2BP5M 4J2QA 3APNA 1OGTB 3NYKA 3SGKC 4N0CC 3U4BH 2G3MA 2GSUA 4S0SD 3GPEA 1T5XB 2BNUB 5F7DB 4A3FC 2MCMA 3G7TA 2AK4A 2NXYB 5TDOA 1K8DA 2PCXA 3TVMB 2JKIS 3LEVL 3BKYL 1LO0H 1S7SA 4GQRA 4HF5L 1EK8A 4UOW0 4XNXL 4PWFA 1SFOC 4YZWA 1A9BB 4DP2X 1JI1A 3IF1A 4QRBA 1AIFB 1RZKL 4MHHG 1RUQL 4JY5H 5DJAB 1J10A 3K6FA 1JZ7A 5J6GA 3DRTA 5DD5L 4ZUVB 1F93A 2N7BA 1AANA 3TBWB 4DGVH 4Z7QE 1L5GA 3MMEB 1QBML 1T0NB 4GXUN 5CCGE 2H47C 3I84A 2HPTA 4BK5A 1S9VA 5D2LB 3EYVB 4C3IC 3QDJA 2IF7A 2QPDB 2O61B 1MW3A 1PX3A 1TJHH 5CUSL 5FR3A 3O3BA 3BVWA 2AXHA 2NUPA 4NAQA 3V4LA 1SGKA 2VDQH 4ZQKA 5D7IB 5DJ2B 3KJ4B 3VXMB 1U0QA 2R83A 3MLUL 5KANI 1N12A 1UA7A 4X7SL 1ZGLA 3GLZA 3MFFA 2A99A 1EFXB 3BKJH 4TRPH 3Q8EA 1SXBA 4JQXA 2VERN 5I19L 5MEPA 1R24B 2ICWI 4N0UE 2XN9D 1I85C 2VLRA 1TU2B 2P5WA 3B2VH 5EOTA 3MJ9L 2YAOA 3DUSA 4G8IB 3GEHA 1IAII 2J8UE 1LQBC 1OCCB 3VFWB 1L7IH 4K5MA 1QWHA 4XPBL 3MBED 5IB4B 1S9XB 3ZXAC 3QDGD 4OLXH 4FD0A 4HUMB 2ZJSL 3MV9D 1FH2A 3W0WE 3VUAA 2UWEA 4N4YB 5CINL 3BAXA 3GI8L 4OGXL 4XNYL 4XZUB 1LEKA 2EO9A 3VU1A 4KHXL 1QX1A 2XRAL 3MJ8A 4MNQE 2W95A 1BEYH 4ZO6A 5HGDA 5B39G 3EJRA 5JMRA 3VFOA 4EUPB 3N44B 1V55B 2X42A 2H1LM 5DJXA 2J55A 4YDKL 5J0BA 4QRPE 2IOMA 5C4XK 2RFXA 2ARWA 1U8MA 2X38A 1H3PH 4XCYB 1L0PA 1PNCA 3MJ9A 1KB5L 3P3SA 4WUUE 4E9SA 1QRNE 3AH5A 3S1NK 5HYJA 3QRFM 4ZXBC 1XGYL 3AXHA 3OKKA 3WUWB 3O3EA 4GIAA 3U6XA 4I18A 3E8VA 3P1VA 5I1KL 4R83A 3AWFA 4GPVA 2R69L 2P5EB 1PFOA 3VE0B 5GGRA 4OIPA 3NQIA 3SDAD 1BQRA 3QJVB 4OJEH 4U1NB 1K4DA 4PJIA 3BAWA 2SEBA 4ZO8A 1QLFA 4IBWA 2XBZA 2YEZB 3TU6A 3IK2A 9CGTA 3FCUB 3HE7A 5JXAL 4L8BB 3KPTA 2W5PA 1PS3A 4GAJL 4OFYA 4P07A 4S1DD 1YEDB 4LBAA 3UG5A 1SHMA 1TYJA 3F58L 2JTDA 1OLZA 2G3ZA 2H26B 3N9GL 3ZKMC 1XGQA 1KB5A 5FGCE 3WNNA 2LVEA 3SDDC 3AT9A 2JELL 4P2OB 5C09B 3REWA 2IPTH 3WFDL 1HL9A 3WODA 4MB4A 2R69A 5AZEL 3VGBA 3WKQA 5GZOD 1UEYA 4UAOC 15C8L 2YIHA 1A9VA 5HYQB 3WTXA 5ENWB 1CDUA 3J7HA 3PV6B 5EU4A 3FU5A 1SYSA 4F2EA 4U1LA 4P3CH 1T6BX 2BH0A 3K2UL 5HY9A 4ETYA 2L7UA 4XMUA 1PJ9A 5HI3D 4H5SA 3X13A 1KPRB 5FK9A 1WCMK 4ZH4A 3OB8A 4X6DF 5DHVA 1UJ3A 5HHNB 4BCYA 1J8HA 2AK4D 3QDHA 2LQRA 1IIKA 4HV8B 5IYBK 3U30B 3FH7A 1V5VA 1QLEH 2EDYA 3GIZL 1I3UA 1CTMA 4JRXE 4FGMA 5I15L 5GHWL 3MRHB 5BJTA 1DD5A 4MBOA 5ITBL 2BDNH 3RPIA 3D2UA 4FLOA 4N22A 1CCZA 4F57L 2QKIB 3KPQB 1I7ZA 3LQAC 5C08E 3EFDH 1BFVH 3PWPD 2EC9T 4PG9B 1OAXH 1XZQA 2M83A 3QDJD 4P9MH 1X5KA 5C71A 4Z5RA 4UZSA 1B4TA 4LCUA 1OGAD 2Y25A 3OKDA 3TC9A 3QPXH 3PP3H 4G80B 1CZ8L 1S7TB 2O6CA 1XL6A 3PHAA 5FO9B 4XPGL 3GZQA 5F71A 3G6JB 4AEIL 2GSOA 4AJWA 4IBTA 3ZTNL 2FD6H 2FE0A 4PJHE 3EH3B 5K39A 3TWYA 4NX0A 4XODA 5EFIB 5AD0B 2DLEA 3ZKNC 4JUTA 3GTVA 4WUKL 2WCPA 4M8RA 3VDAA 2V0AA 4QLWA 5E8EA 2QQKL 4KNUA 4FMKA 3LKRB 3MRBA 1MHCA 2EEAA 3MJ7B 4N8CH 5IF0A 3OHXC 1A7BA 1IBGL 1ACCA 3JVFC 3VX0A 5BXFB 4BDVB 4K23L 2FAUA 3OPUA 3FMGH 1RURH 4Z95L 1I31A 4DKEL 2WSDA 2D7TL 3WG7B 4MNQA 4XSZA 1EAPB 1WAPA 1Y0LB 1CLYH 3D0AA 1CD8A 3DPBB 3LKPA 1P7BA 3Q9QA 3ZTCC 3M17B 1UXLA 4A3FK 3RL1B 4HHWA 5SV3A 2CIIA 1TNMA 2A74A 1A66A 3IDGB 3IKCB 1SFOK 3RILA 3RYMA 2BHZA 3UAEA 5HYJD 2NVXC 2APSA 1EMTH 3MHZA 3F5WA 3QCVL 5KBMA 5LGJA 1B4BA 3QORC 1QRNA 5KN5A 4D0CA 3HZ3A 3TLRA 4CL7A 5GGSB 3WIIH 2H3NA 3RHWF 4XNDA 5CJ9A 1JNLL 4EF3A 5DUBB 4AC4A 1RFDH 3K2IA 4ZW7A 4MZRA 5DO8A 4X9IA 1MFCL 3QS3A 2JB5H 2BIHA 5JPNC 1PLGL 2L7EA 1DQKA 3VFPA 4Y4FD 3VWJA 2AV7A 1TWFA 2ED8A 1IFHL 5D71L 3HE7D 5FKAB 3F65A 4W9FC 3WU1A 1QBLH 2KUTA 1IM3A 2QVIA 1BD2E 1RZ7L 1JHTB 4YSRA 3FO2B 1EH1A 1AQ8A 2A6KA 1Y1VA 2DIEA 2ATAA 1CGSL 1PLCA 1OL0A 3QNFA 5ADOH 1HOEA 2W38A 5EBGA 4AZ8A 1XZPA 3H9HB 4DZ8B 3HMXH 2AGJL 3H56A 5IFHL 3HBZA 2O5YH 5IEKA 4JPWH 3QYCA 2A6DB 4H1LB 2DICA 1Y6MR 2VZSA 2V8LA 4WLCA 2ZXBA 4HJTA 2ZONA 1XGTA 3T65A 2QPUA 4HBQA 2RA1A 2OTWA 3IJEB 4DK5A 1DQDH 2L3BA 5DD6B 3IFPA 2HH0H 4KKAD 4XWGH 2NMSA 3ZR6A 1GHFL 2WQAA 4HWEL 4Z7NB 2PCFA 4JRXA 3QEGL 4P9HL 4JZOB 1GYWA 2EC8A 2VDRB 4KK6D 2WWNA 1IGMH 4JRYA 4HEPG 5IYDC 4EN3A 1NIDA 2HRPL 5ITFA 3MUY1 1DBKH 5C3LD 2SODB 1BOGA 1DVUA 5C6TH 3E80A 4O58H 3VMOA 3WL9A 1F4HA 3KYKH 3S1RK 3OXRB 2YS4A 3QIBB 3VDCA 5HYEA 3NP4A 5EUKB 5HHQB 2CKBB 1KBVA 4EMZA 2WIIB 4OZFB 5HGAA 3FTZA 3MRDB 1NCIA 4P4KA 4EZJA 1JP5A 2XTJD 4NQCD 1G9HA 2NZ9C 3F05A 4AG4H 2JA7C 3HJEA 2EYTB 3IXAA 3L4YA 5T5FH 2OMVA 4JFDB 4HS8H 4YHIA 3GXUB 5FEBA 4XB7A 3U82B 4D9LH 4AK1A 3IVKA 3I6GA 4U6YA 2E6QA 3SZ6A 4YDNA 3JVGA 4JUSA 2RQ8A 5FGBC 4F27A 1E30A 3JUZA 4KDTA 1CURA 4OAWB 3GTOC 3GXPA 1JGDB 3PHOB 4UIMB 2EEFA 3R19A 1BFOB 3GMOA 4RAUB 3O8XA 4KUCF 4JDEB 4G3YH 4XOCA 3TA4D 4C83B 5IQ7H 3EO1B 4RIRA 4IOFD 1PD1A 3SGJC 3W56A 4ZTPH 3C2AH 5DJ0B 3B9VA 2X9ZA 1C08B 1QSFB 3L4TA 4QJ3B 3UBFA 3D50A 1PD0A 4JRWA 4EI5C 1J6XA 1AXIB 2PWEA 2WZ5A 5MHSE 1YNTF 4Z9KB 4M56A 4YZFE 3VFUA 2EXWC 1A6ZA 2IDSA 1LO3L 4BA8A 5KYXB 3MKGA 4QKTA 5EU3A 3GINA 4IMLB 4NM8L 1HQ4B 1DL7L 1QLRB 3FB8B 4KH2A 4ZMOA 3WEBA 2Q86A 4A68A 3UYRL 4TQ8A 2HVKB 3VM5A 4XCNB 3VWJD 2GJZB 4QYOB 3T02A 1CYGA 3X14A 4WTQA 3WJJA 3KEDA 4FA6A 2HLAA 3BKYH 3LEVH 3U46B 4HF5H 1JK9A 1RL1A 4XNXH 3LZLA 3LPXA 1M9SA 1OP4A 3RY6C 1CDGA 3SE3A 1YG9A 2MRYA 2OSWA 5L7XH 2GUOB 5DD5H 2DYRB 3S36L 4PJ9B 5B1AB 3K4AA 2AW2A 2NSMA 3ZT6A 5I30H 1TCRB 3K2MC 2X0VA 2C9SA 3DX2A 3N0PB 5F8QC 5IEHA 5C86A 3UCQA 4OIIL 1BZOA 4XBEL 1T6VN 5CUSH 2CM6A 4OF7A 3WS3B 4DEUA 5SWZB 1F9NA 2YPLE 2NQCA 1NMAL 4FXTA 1P6WA 1IBBA 5D4HA 4KK9C 1YPZF 4CMMA 1RUAL 3CVHB 3MLUH 3GDCA 3H3KA 4ZMNA 1FRGH 4X7SH 3KL0A 5TTRA 5J11B 4DVBB 5T1LA 2WXMA 4HAKA 1NFDB 2NNXA 5I19H 4I77L 5L4IA 2CLZA 4TVSa 2XNAA 4A3KC 2P8MB 3AFLA 3DTDA 3K4DA 4X9YA 5I1DB 2NVYA 3VAEA 1GJUA 3MJ9H 1OPOA 1AI1L 4FHJA 3NTCL 1AD0B 2E0PA 2RH0A 4XPBH 4UTBL 3S4SB 3PFUA 3JWNC 1CDYA 3PCYA 3BUQA 2BP0A 3FSZA 2BIPA 2ZJSH 4FZ8H 1H6EA 3Q9PA 2NVXK 5K9QG 3DBSA 4NUQA 5DRZB 1S7WB 3GI8H 4XNYH 2R93C 4M7JL 2CR0A 4KHXH 4M7ZB 1SMDA 4NP9A 2J3SA 4FTVA 4CN1A 3L2MA 3NN8B 2JMRA 1RZFH 3I6KB 3L5XL 5DWUL 3WOVA 3WTYA 2K45A 4YDKH 2XZQH 1QUNA 1G7LA 2L8AA 3LV3B 4MD4B 2RHEA 2W59A 2C9QA 2GJPA 2A38A 2NY0B 2VGLM 2VR9A 3R7QA 1II4E 3VWKB 4KRLB 3ZHKA 3LX9A 3UDWC 3D85A 4P4KD 2NY7L 2Y2WA 3MGAA 3Q6FA 1KB5H 1T5WA 2J7LA 1P5UC 4K7FB 4MNHA 4RMSA 1XGYH 4U1HA 3BUYB 4XAWH 3N04A 4UTBA 2IG2H 5AW1B 5DJ6B 2R1XB 4IEFA 3L4CA 1EO5A 2FYYB 4FLHA 5HGHA 5DQ9A 5I1KH 1T22B 3UTQB 1KWGA 4QRTA 5F1NB 2R69H 2ALWA 3F7YA 3GWJA 3NSYA 3QEQB 1E4XL 3NK4A 4XNUH 1D6EB 1HXMB 4Q97A 4DCQB 4UNVA 4G7RB 2CHXA 3SYQA 2OL3L 2QADD 3GSVA 4KQ0A 1YNTB 1IIIA 3L3GB 3HE6A 5JXAH 1JERA 1JPGB 5AW2B 4NZRL 3GBDA 4GAJH 5D1XE 2FQOA 5DHVH 3O6FD 2NYYD 5FLVA 1KYOJ 3FUEA 2X7LA 3O8XD 5AYQA 3H0GC 1N5AA 3F58H 3N9GH 4MA1C 5FV1L 4HKXA 4OV5A 4U1MB 5F7AA 1ORSB 3HRZC 2GPZA 4H25A 2YD9A 1OE2A 1HEZA 2QQNL 2BE5A 1QFWL 2FL5B 5F7FA 2FSDA 3I6SA 2CXKA 1CIDA 2OULB 4A7GF 1OIOA 2F53E 2Z0BA 4XRCB 5AZEH 1XVSA 3RZWA 5CGYC 1Z9PA 1HTYA 15C8H 5L88H 3V0HA 3DTUB 3ZKQD 4NQVB 4MXWL 1FFOA 4NQEA 2OL3A 1B4RA 4Z7UE 1R5WB 3LN5A 3VSVA 5C0CD 3JZYA 4GMSL 5BUPA 5IYDK 1EGJL 4GRWF 3K2UH 4LLWA 3IDNA 3WNLA 4LLYB 1FNFA 3KPRB 5J13B 4ZX3A 3BYYA 4WHYG 5IQOA 4WSKA 5B7MA 3QZNA 4ADJA 3ARGB 4I1PA 3GIZH 3O6KH 2E7LC 2FGWH 5IVZA 5I15H 2G5BB 3M45A 4WU5A 5EEWA 5GHWH 1Q1JH 1EXGA 3ARVA 5ITBH 1E7VA 3FTVA 3O0LA 3C6SB 3MYJA 4KARA 2ZICA 4M61B 3TO4B 1JRHL 1ZVSB 2JA7K 4RFNB 1P84J 3LQMA 4GKSA 4KBPA 3ES6A 3QZWB 3AU1B 5D4JA 3KLDA 1S9YB 3W38A 3CFKB 3QXTA 1EGJA 4JRLA 2MNJB 1KGCD 5AB1A 1YEJH 2BP8A 5TE6L 2D3LA 2HMID 3BO8A 2Z35A 1CZ8H 1JXKA 3FQ2A 3VFSB 3K6NA 3CAFA 4XPGH 1AKJB 3GTGK 4BWUA 5T1LD 4AEIH 1DQIA 3ZTNH 2ITDA 4MLIA 1DN0B 2VM3A 5BZDA 3VYOA 5C0GA 4C3JC 5IMLB 1R17A 4Y8AA 3F00A 2HJKB 2VR7A 1A2YB 3SPVA 3OXSA 3W3BA 1WIUA 4WUKH 3OF6A 1BAFL 4UM9B 1N2RB 1U9KA 3GUFA 1NFIA 4OU3A 1OZTG 1M2OA 2QQKH 5E0QA 1FZMB 4FFZL 1AP2A 1OF2B 5J06A 4NI6A 3RX8A 1IBGH 4UV4L 3RFZC 5IP7C 2ZCKL 4K23H 3BPOC 5FW6A 4I0PC 3N1FC 4DKEH 1ISEA 4G1MA 1HSAA 4FTVD 2AV1B 2D7TH 4XMKL 4R96A 1SJVA 2EIZB 3QA3B 4N9GA 4MA8L 4A3LC 4KRMB 5IOQA 4Q9RL 1V3JA 3V6ZA 1GSKA 2E7BA 5CZKA 3NZ8A 5KZCD 4DSYA 4GOSA 1PBYA 3AQOA 5IK3B 2NY5L 2ZX7A 3P77A 3JQOB 5HI4C 4P5TC 3QCVH 2VN7A 2O72A 4YFDB 1ZVUA 4GAAA 4PRDB 2DBJA 2YWYA 1A7PH 4FFZA 1KY6A 2VQTA 3WJMA 1JNLH 2B3IA 5ID0B 1M3IA 3KLHC 3AB0C 1YQVH 5CEZE 3SBWC 1S8DB 3PUUA 2ZNXA 3V4PB 1PLGH 4KROD 1PY9A 2NZIA 5KYYB 4UDUA 3CDGA 5CGMA 1T03L 1YLBB 1WIPA 1F5WA 2GJ6A 1INNA 1IFHH 5D71H 3HE6D 2CAKA 4PJ8D 5DRNA 3FOFA 3BH9A 2X6MA 4B9KC 2PW2B 3HOXC 3WFHA 1FPTH 2UXVA 2WTRA 4S10A 4QUOA 1RZ7H 1Z5YD 4N68A 4JEGB 3RU8L 2NY2D 2UZYB 2KH2B 2ZNWA 2OLDA 1CGSH 1FAIH 1G0YR 1NBVL 2R9HD 4KRNA 4Q0XL 4A3KK 4O2CB 3MNWB 5D6DC 2PA8L 4N25A 4LPYA 4ZS6D 5D9SB 5D7SL 5IFHH 2AGJH 1M05B 3K71A 2YRBA 4KOBA 2VABB 3HPLB 4DP0X 1TTRA 1BAWA 4NQED 3BWZA 1U2HA 5KTEL 2JJTC 3S8WA 2R93K 4LSTL 3O2VL 3BPCA 1R19A 3P4LA 1OKEA 4LCCC 4EAEA 3GUTA 3VG0H 5DMIL 1KIQB 2J1XA 1LM8V 1ZV9A 2VM4A 4FNLL 3G4AA 1BVZA 4JFHE 2W0PA 1UA3A 4IGBC 5I6PA 3FKIK 3MBWB 3O9WB 4U4IA 2OJZL 3G5XB 3M7FB 4APQB 3TV8A 1UACL 4L1SA 3MCG1 4P9HH 2VISB 2ZE0A 2QHLA 4PR5B 1M7IB 2OXGB 1FFPA 1OAUL 3FQXB 2RCSL 4XXCC 1QI3A 3CX5J 2EVHA 3SPJA 4AEHL 2VYRE 3KPLA 1P4UA 5D1ZB 3NJFA 4UQ3A 1M2VB 2V9RA 4UV7L 3RIAK 2Y22A 1YEEL 2PHCB 1N8OE 2NVTC 3ECUA 2Z7YA 2VUMA 1YYML 4AXWA 1SYVA 5KW9L 5GGVY 3Q6GL 1XF2B 3NSDA 5LBVA 4L4VE 1CG9A 5EBLA 4DZBA 3W5MA 5A3IC 4G43B 3H0GK 3N0BA 3FB6A 1IBFA 4GSXA 4F2MA 3V7MA 3KLLA 2CO4A 2M26A 2PN5A 3UYOD 1I3QC 5CZXD 4NAMA 1K8IA <