4ILQA

2.60a resolution structure of ct771 from chlamydia trachomatis
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
147
structure length
147
Chain Sequence
TKHEYSFGVIPIRFFGTPDRSTLKACFICHTDGKHWGFPKGHAEEKEGPQEAAERELVEETGLGIVNFFPKIFVENYSFNDKEEIFVRKEVTYFLAEVKGEVHADPDEICDVQWLSFQEGLRLLNFPEIRNIVTEADKFVQSYLFAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CT771
publication title Chlamydia trachomatis CT771 (nudH) Is an Asymmetric Ap4A Hydrolase.
pubmed doi rcsb
source organism Chlamydia trachomatis
molecule tags Hydrolase
total genus 30
structure length 147
sequence length 147
ec nomenclature ec 3.-.-.-:
pdb deposition date 2012-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 4ilqA00
3O61A 4V14A 5ANUA 3WHWA 3COUA 3HYQA 3P5TA 3EESA 1PUNA 1KHZA 3BM4A 4ILQA 3DUPA 4S2WA 4C9WA 4DYWA 5ANSA 3Q2TA 2B06A 1NFZA 1RYAA 2Q9PA 2A8TA 2XSQA 3MGMA 2DSDA 3FK9A 3ZR1A 5IW4A 1Q27A 1PPXA 4YPHA 1R67A 4JZVA 3X0LA 3BHOA 5GHMA 3F6AA 4JZTA 3J7Ye 2PQVA 4JZSA 4N1TA 1MK1A 2B0VA 2A8PA 4HFQA 1PUSA 3A6SA 2AZWA 5FSLA 2I6KA 2KDWA 2DSCA 1U20A 2ICJA 5DPKA 5FSMA 5CFIA 3P6YA 3A6TA 1Q33A 1TUMA 2G73A 2YVPA 1Q54A 3A6VA 3SMDA 3X0JA 4S2XA 1SOIA 2G74A 1VIQA 2I8TA 2DUKA 3R03A 5GHQA 4MPOA 1PPWA 1X51A 2I8UA 2A6TA 4S2VA 4JZUA 1MQWA 2O5FA 3SHDA 5ANTA 1QVJA 3A6UA 5FSKA 5ISYA 2FKBA 3Q2SA 3FFUA 2DSBA 3Q4IA 5CFJA 5GHPA 3GZ5A 2YVOA 1GA7A 3X0NA 2GT2A 3O52A 5DD4A 3O69A 2A8RA 1JRKA 1V8WA 5HZXA 3EF5A 3F13A 3HHJA 3X0PA 1VCDA 3U53A 2FVVA 5GHOA 3KVHA 1HZTA 1KTGA 3ACAA 4ZG0A 5C8LA 4HVYA 2PNYA 3BAPA 4C9XA 5C7QA 4N1UA 3O6ZA 1VC8A 5GHJA 3X0OA 5GHIA 1VHZA 1HX3A 2W4EA 1IRYA 3GZ8A 3OGAA 3X0KA 3Q91A 1MP2A 2DHOA 2YVNA 1V8VA 3FSPA 3ID9A 3QSJA 1NQYA 1PPVA 5LPGA 3I7UA 3X0IA 1V8RA 1PUQA 4KYXA 5FSNA 3O8SA 2ICKA 1XSAA 5C7TA 1I9AA 2O5WA 1SZ3A 2RRKA 1MQEA 1X83A 4NFWA 1V8LA 2R5WA 4KG4A 5BS6A 4YOQA 4IJXA 1OW2A 2GB5A 1XSBA 1SJYA 2FMLA 3H95A 4YPRA 1V8TA 1VRLA 1V8SA 3G0QA 2YVMA 3X0RA 1K26A 1VIUA 3FCMA 3E57A 1MUTA 1X84A 3ZR0A 5FSIA 3GG6A 3MCFA 3Q93A 5ANWA 3FJYA 3X0QA 2VNPA 5BONA 4KG3A 2A8SA 3EXQA 4K6EA 1V8YA 3RH7A 1VK6A 1V8IA 3AC9A 1K2EA 2QKMB 5GHNA 1RRQA 3GZ6A 1JKNA 1V8UA 3MDIA 5DDGA 3CNGA 5FSOA 1G0SA 1KT9A 1NFSA 3MDGA 1PVFA 1MR2A 1NQZA 2A8QA 3EEUA 1VHGA 5DEQA 2VNQA 2QJTA 1G9QA 3GRNA 4KTBA 5IW5A 3I7VA 3SONA 1SU2A 1F3YA 1V8NA 1V8MA 2J8QA 3N9UA 4NFXA 5ANVA 3L85A 2QJOA 4ICKA 2GT4A 3X0SA 3Q1PA 1XSCA 2CL3A 2KDVA 4S2YA 2O1CA 3N77A 1VC9A 2B2KA 2JVBA 3X0MA 1RRSA 5I8UA 2YYHA 3I9XA 3DKUA 3GWYA
chains in the Genus database with same CATH superfamily
3O61A 4V14A 5ANUA 3WHWA 3COUA 3HYQA 3P5TA 3EESA 1PUNA 1KHZA 3BM4A 4ILQA 3DUPA 4S2WA 4C9WA 4DYWA 5ANSA 3Q2TA 2B06A 1NFZA 1RYAA 2Q9PA 2A8TA 2XSQA 3MGMA 2CZRA 2DSDA 3FK9A 3ZR1A 5IW4A 1Q27A 1PPXA 4YPHA 1R67A 4JZVA 3X0LA 3BHOA 5GHMA 3F6AA 4JZTA 3J7Ye 2PQVA 4JZSA 4N1TA 1MK1A 2B0VA 2A8PA 4HFQA 1PUSA 3A6SA 2AZWA 5FSLA 2I6KA 2KDWA 2DSCA 1U20A 2ICJA 5DPKA 5FSMA 5CFIA 3P6YA 3A6TA 1Q33A 1TUMA 2G73A 2YVPA 1Q54A 3A6VA 3SMDA 3X0JA 4S2XA 1SOIA 2G74A 1VIQA 2I8TA 2DUKA 3R03A 5GHQA 4MPOA 1PPWA 1X51A 2I8UA 2A6TA 4S2VA 4JZUA 1MQWA 2O5FA 3SHDA 5ANTA 1QVJA 3A6UA 5FSKA 5ISYA 2FKBA 3Q2SA 3FFUA 2DSBA 3Q4IA 5CFJA 5GHPA 3GZ5A 2YVOA 1GA7A 3X0NA 2GT2A 3O52A 5DD4A 3O69A 2A8RA 1JRKA 1V8WA 5HZXA 3EF5A 3F13A 3HHJA 3X0PA 1VCDA 3U53A 2FVVA 5GHOA 3KVHA 1HZTA 1KTGA 3ACAA 4ZG0A 5C8LA 4HVYA 2PNYA 3BAPA 4C9XA 5C7QA 4N1UA 3O6ZA 1VC8A 5GHJA 3X0OA 5GHIA 1VHZA 1HX3A 2W4EA 1IRYA 3GZ8A 3OGAA 3X0KA 3Q91A 1MP2A 2DHOA 2YVNA 1V8VA 3FSPA 3ID9A 3QSJA 1NQYA 1PPVA 5LPGA 3I7UA 3X0IA 1V8RA 1PUQA 4KYXA 5FSNA 3O8SA 2ICKA 1XSAA 5C7TA 1I9AA 2O5WA 1SZ3A 2RRKA 1MQEA 1X83A 4NFWA 1V8LA 2R5WA 4KG4A 5BS6A 4YOQA 4IJXA 1OW2A 2GB5A 1XSBA 1SJYA 2FMLA 3H95A 4YPRA 1V8TA 1VRLA 1V8SA 3G0QA 2YVMA 3X0RA 1K26A 1VIUA 3FCMA 3E57A 1MUTA 1X84A 3ZR0A 5FSIA 3GG6A 3MCFA 3Q93A 5ANWA 3FJYA 3X0QA 2VNPA 5BONA 4KG3A 2A8SA 3EXQA 4K6EA 1V8YA 3RH7A 1VK6A 1V8IA 3AC9A 1K2EA 2QKMB 5GHNA 1RRQA 3GZ6A 1JKNA 1V8UA 3MDIA 5DDGA 3CNGA 5FSOA 1G0SA 1KT9A 1NFSA 3MDGA 1PVFA 1MR2A 4J7GA 1NQZA 2A8QA 3EEUA 1VHGA 5DEQA 2VNQA 2QJTA 1G9QA 3GRNA 4KTBA 5IW5A 3I7VA 3SONA 1SU2A 1F3YA 1V8NA 1V8MA 2J8QA 3N9UA 4NFXA 5ANVA 3L85A 2QJOA 4ICKA 2GT4A 3X0SA 3Q1PA 1XSCA 2CL3A 2KDVA 4J7HA 4S2YA 2O1CA 3N77A 1VC9A 2B2KA 2JVBA 3X0MA 1RRSA 5I8UA 2YYHA 3I9XA 3DKUA 3GWYA
chains in the Genus database with same CATH topology
3O61A 4V14A 5ANUA 3WHWA 3COUA 3HYQA 3P5TA 3EESA 1PUNA 1KHZA 3BM4A 4ILQA 3DUPA 4S2WA 4C9WA 4DYWA 5ANSA 3Q2TA 2B06A 1NFZA 1RYAA 2Q9PA 2A8TA 2XSQA 3MGMA 2CZRA 2DSDA 3FK9A 3ZR1A 5IW4A 1Q27A 1PPXA 4YPHA 1R67A 4JZVA 3X0LA 3BHOA 5GHMA 3F6AA 4JZTA 3J7Ye 2PQVA 4JZSA 4N1TA 1MK1A 2B0VA 2A8PA 4HFQA 1PUSA 3A6SA 2AZWA 5FSLA 2I6KA 2KDWA 2DSCA 1U20A 2ICJA 5DPKA 5FSMA 5CFIA 3P6YA 3A6TA 1Q33A 1TUMA 2G73A 2YVPA 1Q54A 3A6VA 3SMDA 3X0JA 4S2XA 1SOIA 2G74A 1VIQA 2I8TA 2DUKA 3R03A 5GHQA 4MPOA 1PPWA 1X51A 2I8UA 2A6TA 4S2VA 4JZUA 1MQWA 2O5FA 3SHDA 5ANTA 1QVJA 3A6UA 5FSKA 5ISYA 2FKBA 3Q2SA 3FFUA 2DSBA 3Q4IA 5CFJA 5GHPA 3GZ5A 2YVOA 1GA7A 3X0NA 2GT2A 3O52A 5DD4A 3O69A 2A8RA 1JRKA 1V8WA 5HZXA 3EF5A 3F13A 3HHJA 3X0PA 1VCDA 3U53A 2FVVA 5GHOA 3KVHA 1HZTA 1KTGA 3ACAA 4ZG0A 5C8LA 4HVYA 2PNYA 3BAPA 4C9XA 5C7QA 4N1UA 3O6ZA 1VC8A 5GHJA 3X0OA 5GHIA 1VHZA 1HX3A 2W4EA 1IRYA 3GZ8A 3OGAA 3X0KA 3Q91A 1MP2A 2DHOA 2YVNA 1V8VA 3FSPA 3ID9A 3QSJA 1NQYA 1PPVA 5LPGA 3I7UA 3X0IA 1V8RA 1PUQA 4KYXA 5FSNA 3O8SA 2ICKA 1XSAA 5C7TA 1I9AA 2O5WA 1SZ3A 2RRKA 1MQEA 1X83A 4NFWA 1V8LA 2R5WA 4KG4A 5BS6A 4YOQA 4IJXA 1OW2A 2GB5A 1XSBA 1SJYA 2FMLA 3H95A 4YPRA 1V8TA 1VRLA 1V8SA 3G0QA 2YVMA 3X0RA 1K26A 1VIUA 3FCMA 3E57A 1MUTA 1X84A 3ZR0A 5FSIA 3GG6A 3MCFA 3Q93A 5ANWA 3FJYA 3X0QA 2VNPA 5BONA 4KG3A 2A8SA 3EXQA 4K6EA 1V8YA 3RH7A 1VK6A 1V8IA 3AC9A 1K2EA 2QKMB 5GHNA 1RRQA 3GZ6A 1JKNA 1V8UA 3MDIA 5DDGA 3CNGA 5FSOA 1G0SA 1KT9A 1NFSA 3MDGA 1PVFA 1MR2A 4J7GA 1NQZA 2A8QA 3EEUA 1VHGA 5DEQA 2VNQA 2QJTA 1G9QA 3GRNA 4KTBA 5IW5A 3I7VA 3SONA 1SU2A 1F3YA 1V8NA 1V8MA 2J8QA 3N9UA 4NFXA 5ANVA 3L85A 2QJOA 4ICKA 2GT4A 3X0SA 3Q1PA 1XSCA 2CL3A 2KDVA 4J7HA 4S2YA 2O1CA 3N77A 1VC9A 2B2KA 2JVBA 3X0MA 1RRSA 5I8UA 2YYHA 3I9XA 3DKUA 3GWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O61 A;  4V14 A;  5ANU A;  3WHW A;  3COU A;  3HYQ A;  3P5T A;  3EES A;  1PUN A;  1KHZ A;  3BM4 A;  4ILQ A;  3DUP A;  4S2W A;  4C9W A;  4DYW A;  5ANS A;  3Q2T A;  2B06 A;  1NFZ A;  1RYA A;  2Q9P A;  2A8T A;  2XSQ A;  3MGM A;  2DSD A;  3FK9 A;  3ZR1 A;  5IW4 A;  1Q27 A;  1PPX A;  4YPH A;  1R67 A;  4JZV A;  3X0L A;  3BHO A;  5GHM A;  3F6A A;  4JZT A;  3J7Y e;  2PQV A;  4JZS A;  4N1T A;  1MK1 A;  2B0V A;  2A8P A;  4HFQ A;  1PUS A;  3A6S A;  2AZW A;  5FSL A;  2I6K A;  2KDW A;  2DSC A;  1U20 A;  2ICJ A;  5DPK A;  5FSM A;  5CFI A;  3P6Y A;  3A6T A;  1Q33 A;  1TUM A;  2G73 A;  2YVP A;  1Q54 A;  3A6V A;  3SMD A;  3X0J A;  4S2X A;  1SOI A;  2G74 A;  1VIQ A;  2I8T A;  2DUK A;  3R03 A;  5GHQ A;  4MPO A;  1PPW A;  1X51 A;  2I8U A;  2A6T A;  4S2V A;  4JZU A;  1MQW A;  2O5F A;  3SHD A;  5ANT A;  1QVJ A;  3A6U A;  5FSK A;  5ISY A;  2FKB A;  3Q2S A;  3FFU A;  2DSB A;  3Q4I A;  5CFJ A;  5GHP A;  3GZ5 A;  2YVO A;  1GA7 A;  3X0N A;  2GT2 A;  3O52 A;  5DD4 A;  3O69 A;  2A8R A;  1JRK A;  1V8W A;  5HZX A;  3EF5 A;  3F13 A;  3HHJ A;  3X0P A;  1VCD A;  3U53 A;  2FVV A;  5GHO A;  3KVH A;  1HZT A;  1KTG A;  3ACA A;  4ZG0 A;  5C8L A;  4HVY A;  2PNY A;  3BAP A;  4C9X A;  5C7Q A;  4N1U A;  3O6Z A;  1VC8 A;  5GHJ A;  3X0O A;  5GHI A;  1VHZ A;  1HX3 A;  2W4E A;  1IRY A;  3GZ8 A;  3OGA A;  3X0K A;  3Q91 A;  1MP2 A;  2DHO A;  2YVN A;  1V8V A;  3FSP A;  3ID9 A;  3QSJ A;  1NQY A;  1PPV A;  5LPG A;  3I7U A;  3X0I A;  1V8R A;  1PUQ A;  4KYX A;  5FSN A;  3O8S A;  2ICK A;  1XSA A;  5C7T A;  1I9A A;  2O5W A;  1SZ3 A;  2RRK A;  1MQE A;  1X83 A;  4NFW A;  1V8L A;  2R5W A;  4KG4 A;  5BS6 A;  4YOQ A;  4IJX A;  1OW2 A;  2GB5 A;  1XSB A;  1SJY A;  2FML A;  3H95 A;  4YPR A;  1V8T A;  1VRL A;  1V8S A;  3G0Q A;  2YVM A;  3X0R A;  1K26 A;  1VIU A;  3FCM A;  3E57 A;  1MUT A;  1X84 A;  3ZR0 A;  5FSI A;  3GG6 A;  3MCF A;  3Q93 A;  5ANW A;  3FJY A;  3X0Q A;  2VNP A;  5BON A;  4KG3 A;  2A8S A;  3EXQ A;  4K6E A;  1V8Y A;  3RH7 A;  1VK6 A;  1V8I A;  3AC9 A;  1K2E A;  2QKM B;  5GHN A;  1RRQ A;  3GZ6 A;  1JKN A;  1V8U A;  3MDI A;  5DDG A;  3CNG A;  5FSO A;  1G0S A;  1KT9 A;  1NFS A;  3MDG A;  1PVF A;  1MR2 A;  1NQZ A;  2A8Q A;  3EEU A;  1VHG A;  5DEQ A;  2VNQ A;  2QJT A;  1G9Q A;  3GRN A;  4KTB A;  5IW5 A;  3I7V A;  3SON A;  1SU2 A;  1F3Y A;  1V8N A;  1V8M A;  2J8Q A;  3N9U A;  4NFX A;  5ANV A;  3L85 A;  2QJO A;  4ICK A;  2GT4 A;  3X0S A;  3Q1P A;  1XSC A;  2CL3 A;  2KDV A;  4S2Y A;  2O1C A;  3N77 A;  1VC9 A;  2B2K A;  2JVB A;  3X0M A;  1RRS A;  5I8U A;  2YYH A;  3I9X A;  3DKU A;  3GWY A; 
#chains in the Genus database with same CATH topology
 3O61 A;  4V14 A;  5ANU A;  3WHW A;  3COU A;  3HYQ A;  3P5T A;  3EES A;  1PUN A;  1KHZ A;  3BM4 A;  4ILQ A;  3DUP A;  4S2W A;  4C9W A;  4DYW A;  5ANS A;  3Q2T A;  2B06 A;  1NFZ A;  1RYA A;  2Q9P A;  2A8T A;  2XSQ A;  3MGM A;  2CZR A;  2DSD A;  3FK9 A;  3ZR1 A;  5IW4 A;  1Q27 A;  1PPX A;  4YPH A;  1R67 A;  4JZV A;  3X0L A;  3BHO A;  5GHM A;  3F6A A;  4JZT A;  3J7Y e;  2PQV A;  4JZS A;  4N1T A;  1MK1 A;  2B0V A;  2A8P A;  4HFQ A;  1PUS A;  3A6S A;  2AZW A;  5FSL A;  2I6K A;  2KDW A;  2DSC A;  1U20 A;  2ICJ A;  5DPK A;  5FSM A;  5CFI A;  3P6Y A;  3A6T A;  1Q33 A;  1TUM A;  2G73 A;  2YVP A;  1Q54 A;  3A6V A;  3SMD A;  3X0J A;  4S2X A;  1SOI A;  2G74 A;  1VIQ A;  2I8T A;  2DUK A;  3R03 A;  5GHQ A;  4MPO A;  1PPW A;  1X51 A;  2I8U A;  2A6T A;  4S2V A;  4JZU A;  1MQW A;  2O5F A;  3SHD A;  5ANT A;  1QVJ A;  3A6U A;  5FSK A;  5ISY A;  2FKB A;  3Q2S A;  3FFU A;  2DSB A;  3Q4I A;  5CFJ A;  5GHP A;  3GZ5 A;  2YVO A;  1GA7 A;  3X0N A;  2GT2 A;  3O52 A;  5DD4 A;  3O69 A;  2A8R A;  1JRK A;  1V8W A;  5HZX A;  3EF5 A;  3F13 A;  3HHJ A;  3X0P A;  1VCD A;  3U53 A;  2FVV A;  5GHO A;  3KVH A;  1HZT A;  1KTG A;  3ACA A;  4ZG0 A;  5C8L A;  4HVY A;  2PNY A;  3BAP A;  4C9X A;  5C7Q A;  4N1U A;  3O6Z A;  1VC8 A;  5GHJ A;  3X0O A;  5GHI A;  1VHZ A;  1HX3 A;  2W4E A;  1IRY A;  3GZ8 A;  3OGA A;  3X0K A;  3Q91 A;  1MP2 A;  2DHO A;  2YVN A;  1V8V A;  3FSP A;  3ID9 A;  3QSJ A;  1NQY A;  1PPV A;  5LPG A;  3I7U A;  3X0I A;  1V8R A;  1PUQ A;  4KYX A;  5FSN A;  3O8S A;  2ICK A;  1XSA A;  5C7T A;  1I9A A;  2O5W A;  1SZ3 A;  2RRK A;  1MQE A;  1X83 A;  4NFW A;  1V8L A;  2R5W A;  4KG4 A;  5BS6 A;  4YOQ A;  4IJX A;  1OW2 A;  2GB5 A;  1XSB A;  1SJY A;  2FML A;  3H95 A;  4YPR A;  1V8T A;  1VRL A;  1V8S A;  3G0Q A;  2YVM A;  3X0R A;  1K26 A;  1VIU A;  3FCM A;  3E57 A;  1MUT A;  1X84 A;  3ZR0 A;  5FSI A;  3GG6 A;  3MCF A;  3Q93 A;  5ANW A;  3FJY A;  3X0Q A;  2VNP A;  5BON A;  4KG3 A;  2A8S A;  3EXQ A;  4K6E A;  1V8Y A;  3RH7 A;  1VK6 A;  1V8I A;  3AC9 A;  1K2E A;  2QKM B;  5GHN A;  1RRQ A;  3GZ6 A;  1JKN A;  1V8U A;  3MDI A;  5DDG A;  3CNG A;  5FSO A;  1G0S A;  1KT9 A;  1NFS A;  3MDG A;  1PVF A;  1MR2 A;  4J7G A;  1NQZ A;  2A8Q A;  3EEU A;  1VHG A;  5DEQ A;  2VNQ A;  2QJT A;  1G9Q A;  3GRN A;  4KTB A;  5IW5 A;  3I7V A;  3SON A;  1SU2 A;  1F3Y A;  1V8N A;  1V8M A;  2J8Q A;  3N9U A;  4NFX A;  5ANV A;  3L85 A;  2QJO A;  4ICK A;  2GT4 A;  3X0S A;  3Q1P A;  1XSC A;  2CL3 A;  2KDV A;  4J7H A;  4S2Y A;  2O1C A;  3N77 A;  1VC9 A;  2B2K A;  2JVB A;  3X0M A;  1RRS A;  5I8U A;  2YYH A;  3I9X A;  3DKU A;  3GWY A; 
#chains in the Genus database with same CATH homology
 3O61 A;  4V14 A;  5ANU A;  3WHW A;  3COU A;  3HYQ A;  3P5T A;  3EES A;  1PUN A;  1KHZ A;  3BM4 A;  4ILQ A;  3DUP A;  4S2W A;  4C9W A;  4DYW A;  5ANS A;  3Q2T A;  2B06 A;  1NFZ A;  1RYA A;  2Q9P A;  2A8T A;  2XSQ A;  3MGM A;  2CZR A;  2DSD A;  3FK9 A;  3ZR1 A;  5IW4 A;  1Q27 A;  1PPX A;  4YPH A;  1R67 A;  4JZV A;  3X0L A;  3BHO A;  5GHM A;  3F6A A;  4JZT A;  3J7Y e;  2PQV A;  4JZS A;  4N1T A;  1MK1 A;  2B0V A;  2A8P A;  4HFQ A;  1PUS A;  3A6S A;  2AZW A;  5FSL A;  2I6K A;  2KDW A;  2DSC A;  1U20 A;  2ICJ A;  5DPK A;  5FSM A;  5CFI A;  3P6Y A;  3A6T A;  1Q33 A;  1TUM A;  2G73 A;  2YVP A;  1Q54 A;  3A6V A;  3SMD A;  3X0J A;  4S2X A;  1SOI A;  2G74 A;  1VIQ A;  2I8T A;  2DUK A;  3R03 A;  5GHQ A;  4MPO A;  1PPW A;  1X51 A;  2I8U A;  2A6T A;  4S2V A;  4JZU A;  1MQW A;  2O5F A;  3SHD A;  5ANT A;  1QVJ A;  3A6U A;  5FSK A;  5ISY A;  2FKB A;  3Q2S A;  3FFU A;  2DSB A;  3Q4I A;  5CFJ A;  5GHP A;  3GZ5 A;  2YVO A;  1GA7 A;  3X0N A;  2GT2 A;  3O52 A;  5DD4 A;  3O69 A;  2A8R A;  1JRK A;  1V8W A;  5HZX A;  3EF5 A;  3F13 A;  3HHJ A;  3X0P A;  1VCD A;  3U53 A;  2FVV A;  5GHO A;  3KVH A;  1HZT A;  1KTG A;  3ACA A;  4ZG0 A;  5C8L A;  4HVY A;  2PNY A;  3BAP A;  4C9X A;  5C7Q A;  4N1U A;  3O6Z A;  1VC8 A;  5GHJ A;  3X0O A;  5GHI A;  1VHZ A;  1HX3 A;  2W4E A;  1IRY A;  3GZ8 A;  3OGA A;  3X0K A;  3Q91 A;  1MP2 A;  2DHO A;  2YVN A;  1V8V A;  3FSP A;  3ID9 A;  3QSJ A;  1NQY A;  1PPV A;  5LPG A;  3I7U A;  3X0I A;  1V8R A;  1PUQ A;  4KYX A;  5FSN A;  3O8S A;  2ICK A;  1XSA A;  5C7T A;  1I9A A;  2O5W A;  1SZ3 A;  2RRK A;  1MQE A;  1X83 A;  4NFW A;  1V8L A;  2R5W A;  4KG4 A;  5BS6 A;  4YOQ A;  4IJX A;  1OW2 A;  2GB5 A;  1XSB A;  1SJY A;  2FML A;  3H95 A;  4YPR A;  1V8T A;  1VRL A;  1V8S A;  3G0Q A;  2YVM A;  3X0R A;  1K26 A;  1VIU A;  3FCM A;  3E57 A;  1MUT A;  1X84 A;  3ZR0 A;  5FSI A;  3GG6 A;  3MCF A;  3Q93 A;  5ANW A;  3FJY A;  3X0Q A;  2VNP A;  5BON A;  4KG3 A;  2A8S A;  3EXQ A;  4K6E A;  1V8Y A;  3RH7 A;  1VK6 A;  1V8I A;  3AC9 A;  1K2E A;  2QKM B;  5GHN A;  1RRQ A;  3GZ6 A;  1JKN A;  1V8U A;  3MDI A;  5DDG A;  3CNG A;  5FSO A;  1G0S A;  1KT9 A;  1NFS A;  3MDG A;  1PVF A;  1MR2 A;  4J7G A;  1NQZ A;  2A8Q A;  3EEU A;  1VHG A;  5DEQ A;  2VNQ A;  2QJT A;  1G9Q A;  3GRN A;  4KTB A;  5IW5 A;  3I7V A;  3SON A;  1SU2 A;  1F3Y A;  1V8N A;  1V8M A;  2J8Q A;  3N9U A;  4NFX A;  5ANV A;  3L85 A;  2QJO A;  4ICK A;  2GT4 A;  3X0S A;  3Q1P A;  1XSC A;  2CL3 A;  2KDV A;  4J7H A;  4S2Y A;  2O1C A;  3N77 A;  1VC9 A;  2B2K A;  2JVB A;  3X0M A;  1RRS A;  5I8U A;  2YYH A;  3I9X A;  3DKU A;  3GWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...