4IM0A

Structure of tank-binding kinase 1
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
659
structure length
619
Chain Sequence
GSMQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRNIKPGNIMRVIGEDGQSVYKLTDFGTEEYLHPDMYERVLRKDHATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVMEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase TBK1
publication title Structure of Tank-Binding Kinase 1
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 208
structure length 619
sequence length 659
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF18394 TBK1_CCD1 TANK-binding kinase 1 coiled-coil domain 1
A PF18396 TBK1_ULD TANK binding kinase 1 ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4im0A02
1.20.1270.420 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4im0A04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4im0A03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4im0A01
4I41A 1WBTA 5EK7A 3ZSGA 4AGCA 4ZOGA 4DCAA 1YRPA 2E9UA 2C3JA 3VQIA 4O7RA 5CSVA 2C5LC 4L6QA 4C61A 4AW5A 1UBIA 4FX3A 4TT7A 3PIXA 3OTVA 1H00A 3QRUA 3ATTA 3BE9A 3PVWA 3QF9A 4F7JA 3R1QA 3TT0A 3QD0A 2JKMA 5D7VA 3UIUA 4TY1A 1ZXEA 4EZ5A 4JL9A 4XOYA 1UNHA 3IQ7A 2K1FA 5AP5A 3E8DA 3QKLA 1VYWA 4RSSA 2PE0A 3Q5IA 1MRYA 5DT3A 2IZSA 2FIDA 3S2PA 2NVUI 2IO1B 4FSMA 3CCNA 4TYHB 3AMAA 3FAAA 2RSUA 1JKTA 4YC8A 1P3QU 5IA3A 2N9XA 3L9LA 1PMVA 3VC4A 4YBKA 3LJ2A 4K7UA 5FG8A 1CSNA 5J95A 1WI0A 4B8LA 2XIXA 3AD4A 3L9NA 3SD0A 5DHJA 4ENYA 4Q5HA 3CC6A 5CSPA 1OL6A 3H6NA 4NIFB 5HO8A 2C68A 3ODYX 2V3SA 5L6WL 4D4SA 1FMKA 3WF9A 4AJYB 3FJQE 3H9OA 4IZAA 4H58A 1OEYJ 4MBIA 2GBRA 3M11A 4QPAA 3K9OB 2YDIA 4RRVA 2F2UA 2NPQA 2MQJA 5FWKK 4LRKA 3PY0A 2VGOA 4PL4A 1FVTA 3ZH8A 1YD8U 1FQ1B 3DK7A 2WQBA 3WE8A 5E92A 3QBNA 3CQEA 3I60A 1H1RA 2QONA 3OBJA 4W9WA 4FK6A 1MQ4A 3TUCA 3EJ1A 3MSSA 1E8ZA 3IDCA 3HUBA 3NNVA 5LVOA 3LFBA 3RM7A 3QRTA 2ITXA 3R8PA 1WM2A 5IA4A 3NAXA 4BDBA 4XUFA 2G4SA 4YJUA 4IM3A 3EN7A 2QKWB 2WMAA 3GU4A 1XH4A 4EYMA 2K39A 4MNEA 4AP4C 3O17A 2QLQA 4HJKA 2VX3A 4TQ0A 1Q8WA 4DFUA 5CEOA 3HV4A 3NUPA 4F70A 2R0UA 4CD0A 2EWAA 4D5KA 4A4LA 3MVJA 5HICA 2BWFA 3MVMA 3QLGA 2EB2A 4M12A 3TZ8A 4CQGA 3IDBA 4CG8A 3FEGA 1PXKA 1UU9A 4BOZB 3LLTA 1V5TA 5IKWA 4EOLA 4FSNA 4PDSA 4AGUA 4H1JA 1UU8A 4MBLA 1HCLA 3PHXB 2X8DA 5M4IA 4NM7A 4OLIA 4GT4A 1W84A 3DK6A 3KRXA 3OC1A 4EUTA 3UE4A 3M1SA 5BVWA 2KWVB 4HNIA 3B8QA 3E64A 4DEIA 4MBJA 4JX3A 4PL3A 5LCKA 4FIGA 4OUCA 3CSVA 2OZOA 2IO3B 1WFCA 2CN8A 1YWRA 4L9IA 5M57A 4AWJA 2QOIA 2B9FA 2NRYA 4JQEA 4ZSGA 3HK0A 2K8HA 2OOBB 3DKOA 4E93A 4FR4A 2PE1A 2HAKA 4HVGA 4KBKA 4NAWA 4BDJA 2IWIA 4AZSA 5GZAA 4G3GA 2JY6A 4BYJA 2C6LA 5IQCA 4K77A 5DN3A 1GC7A 2CHWA 4C4JA 5L2QA 1XD3B 3NUSA 4BIEA 3FI4A 4FZ6A 1M2RA 4LRMA 5EYDA 3U55A 1E1VA 1H0WA 5FRIA 3QHTA 3CBLA 3V6RA 1GC6A 2R0IA 3A4SC 2KFJA 5HE0A 4FI1A 5ANEA 3CY2A 1REKA 3F2NA 4XG8A 2K8BA 4ORKA 3BBWA 3ZO5B 5F94A 4R1VA 4NKAA 3NYXA 2C1BA 2RG5A 4P5QA 5HKMA 3LKMA 3R8UA 4RQKA 3VO3A 3U54A 2WX1A 3OJ3A 1MQBA 3O50A 4JQWC 4WKQA 3UJGA 2FUMA 3MH1A 5CHFA 4F9AA 4GIIA 2FCMA 1R0PA 3NSZA 3EQGA 4YZ9A 4JBVA 1Q97A 4M13A 4K6ZA 5KZ0A 4HYHA 3R7YA 1OECA 3ZO3A 4NEUA 3AXCA 4HCNB 3WIMA 3FE3A 2L8JA 3U8WA 4KSKC 2X9FA 5B2LA 3DZOA 1MG8A 4FEQA 3GUBA 3MHSD 5J9YA 2FA2A 4HDQA 1OBDA 3LMIA 4H36A 4I0SA 4Y8DA 2PJHA 3UMWA 3UQCA 4LI5A 3N4TA 3L17A 5HG5A 1WZYA 2QVSE 2C3LA 3LQ8A 2PUIA 1FXTB 3BYMA 3CTQA 4CV8A 1Q8YA 3DS6A 2D2QA 3VF8A 5AP3A 3H3CA 4GUBA 1OIRA 5CI7A 3SDLC 3MV5A 5JK3A 2R3MA 5G1XA 2L0TA 4X57B 4KUJA 4FC0A 4EH4A 2BKKA 1UELA 4GCJA 3VH3B 4IZYA 2Z2WA 4KWPA 3HMPA 1CKJA 5CTRC 3DLSA 3AXWA 4W4YA 3QWZB 1P4FA 3WAPA 3H4JA 1OGUA 4MXAA 4WNOA 4C02A 5BO4B 1R4MI 1AD5A 2XZSA 3A33B 4YURA 1P4OA 4YP8A 4AZTA 3CTJA 4ANNA 3VJNA 3QAME 2X8EA 3UDBA 5DPSA 1APME 1RLFA 2CS4A 3JY0A 3TNIA 4XP0A 4I1ZA 1XH8A 3H7SA 1U5RA 3OHTA 2JBPA 4GVJA 5I3OA 4DXAB 4GDLA 4NNJB 3EFUA 4XG4A 3TV4A 4CYEA 4MX9A 3FC1X 1OTRB 4ZS0A 4Y46A 2D10A 1P2AA 1ZLTA 4MSQB 2IW9A 4ZTMA 3G51A 4KBAA 4UMRA 4K11A 2UZNA 4BCJA 4GRBA 4BGHA 1GJZA 5EM8A 1TBEA 2B4SB 4FE2A 2CHXA 1H8FA 3RGFA 1VR2A 4XZ4A 4FEWA 5HNGA 3W18A 3R9NA 2Y6OA 5JZJA 3EMGA 2R3IA 5IUHA 4FSUA 1M2QA 4ITJA 5ICPA 4IAZA 3NUXA 3BWJA 2WX0A 4BBFA 3S1HA 4I5HA 2V0DA 4I92A 3VTUA 3MPTA 2OFUA 3CKXA 3VS3A 5J18A 3W8QA 3PXQA 4QQ5A 3HM6X 2B55A 2ZJWA 4ZS4A 1Z2MA 3KXMA 5CAOA 4KZCA 1A48A 4BKJA 2DX5B 2O65A 3HNGA 2BIYA 3E93A 4FT9A 5D94A 5E4HA 2HD5B 4C7TA 2QOCA 5L2IA 4Q2AA 4HYIA 3QWKA 4IM0A 1OI9A 4O27B 3EQHA 5AP7A 3FPQA 3TL8A 4UMPA 4X2FA 4L68A 4JAIA 4TYHA 4BY9E 2XBAA 4CKRA 5L2WA 4D28A 4GIHA 1OITA 3SC1A 2KZRA 5C26A 3ZZEA 5DA3A 4NM5A 2DZKA 3C4EA 4HGTA 4X2JA 4YSJA 3O8UA 4XP2A 3NAYA 4IDTA 2QOOA 3C7QA 1CMKE 4A9UA 4XBRA 2F7XE 4XOZA 2K6QA 4A3OA 5FM3A 4RIYB 2RL5A 4YLLA 1KV2A 3W2QA 4R1YA 2BGFA 2MBEA 2OF2A 3RPYA 4XG7A 4CFXA 4J96A 4EZ3A 1RW8A 4A4OA 2PEAA 2F4JA 3IW6A 3PA4A 2ZAZA 1GOLA 4NJ3A 1J7UA 2QHNA 3OEZA 4TYJA 4DFYA 4UB7A 5DH3A 3MFUA 5KNJA 2UZEA 3C0IA 3QQKA 3F5PA 4MWHA 4B9DA 4NU1A 4UN0C 2VWXA 1R1WA 4GYIA 5IA5A 5EHYA 2O8YA 2PMIA 4GEOA 5CYIA 5AUYA 2DAJA 5IQAA 4ZTLA 3ZHPC 3E87A 3WZDA 4CXAA 5DE2A 2JDOA 4FG8A 4YL8A 3R9DA 3A61A 1URWA 3HV7A 3LFCA 2CCIA 1H28A 4ZLZA 4FEVA 3VUDA 4M68A 5DWRA 3D7ZA 4ZJJA 2CKHB 3SW4A 2RFDA 4EK3A 2GS6A 3MPMA 4BBMA 3V3VA 3F2RA 2DZJA 4BOSC 4O1PA 2XUUA 4NW5A 1AGWA 4C62A 2Z8CA 3FMNA 4DH8A 2J7QB 2YCQA 2R3PA 2FSLX 4EOMA 2PTKA 3BWFA 3H9FA 1NW1A 4BFMA 4OVUA 2F57A 3W55A 4S34A 3BKBA 4A07A 2JZ3B 4UYAA 3VAWA 1Q24A 3BI6A 4M69B 2DZIA 3F88A 2CKOA 3COHA 4M67A 3JXWA 1GZOA 3TI1A 2KXJA 4YJRA 4FTCA 2YIQA 3FMDA 4LM5A 3AU4A 5A9UA 1LP4A 2R3FA 5FQDC 4MNFA 3I3TB 4U3ZA 1X8BA 4C2WA 1O6YA 2A19B 2J6MA 2LXCA 2HXLA 2UZUE 4YBJA 5CAUA 1OPLA 2CKEA 3NVMB 2WIPA 3KA0A 4LV5A 2BTRA 2AL6A 3Q2MA 5FTGA 3G5DA 4FSQA 2QKRA 3VW8A 3AG9A 3MFTA 4EWHA 1UNLA 3SOCA 4MDKE 4CMTA 2C7MB 1IYFA 3QZHA 3NOBA 3VUYA 3TN8A 2I40A 3EL8A 1R0EA 3QTIA 3KF4A 4GT3A 4ZK5A 3R9HA 4YLKA 2HY81 5TO8A 2B7AA 2IYDB 1E8YA 4IBMA 4PUZA 4HVHA 4GOCA 5KHXA 3QC8B 2JRHA 3AC5A 2ETMA 3DB8A 4K8AA 2WU6A 2UW5A 3FHRA 4F99A 4FBJB 4MQ2A 3TV6A 3LJ3A 3BYVA 3U6IA 2UVXA 3D2KA 2V22A 2XK5B 4FSRA 1WXAA 3FKNA 5D6JB 4KDIC 1NBFC 3QLFA 1OUKA 3ZW3A 1RDQE 4BRXA 3HKOA 3V51A 4W4XA 3OTUA 4GGQA 4K7SA 2R3OA 1KJTA 4TKNA 1UNGA 3ZFMA 3UBDA 4ZEGA 3ZNZB 2C69A 4RJ8A 1SGHA 3GOPA 5HG7A 1PMUA 4E6CA 2CSNA 3VUWA 2W9NA 2WXVA 1YDTE 1CDKA 4EORA 4FV5A 2YISA 4BWKA 3R7OA 4FNWA 3R30A 3ITZA 4E26A 3ATSA 5CALA 1Q1OA 4OAUC 4HXDA 3WAOA 2YIWA 4RBLA 5LVLA 4ANXA 5AV3A 4Q5EA 2Y4IC 2OW3A 3QQLA 4MXCA 4XHKB 5I9YA 3DPDA 2KULA 4XV1A 2UVYA 2HE7A 2MBHA 4BDDA 5K4IA 4G6NA 4I6BA 3O7LB 2X4FA 2WZJA 1NT2A 4G0NB 5I9VA 4IMYA 3OD6X 1WE6A 3CJGA 3BU6A 1U59A 3DY7A 4S2ZA 4X6RA 3EQPA 4K18A 3VH4B 4FTKA 3WE4A 4C4GA 1G8AA 4N57A 5FTQA 2UW6A 3QZGA 4ZAUA 3HHMA 2NPTB 2VTPA 2G45B 2HK5A 3PPKA 3L9PA 4UWBA 3QHWA 2ZV7A 5H2UA 4DC2A 4APCA 5KCVA 1YQJA 5HD4A 3PIZA 5JRQA 1JBPE 3JW0X 3MY5A 4AT5A 2KDEB 4FA6A 1YWVA 4CFFA 4PRJA 4DT8A 4CTBA 3CXWA 3UQBA 5C4KA 3REPA 5HIEA 5E8YA 5KO1A 5DI1A 4O21A 2MP2A 4EH9A 4FSZA 4QMTA 4YZBA 4CYIA 1NVQA 2MBQA 4B0GA 4FIFA 4O83A 4E6QA 5L6PA 5AP4A 3BINA 3VS7A 5C23A 3A8XA 1UWHA 3O7LD 4EONA 1OL1A 3W10A 2UWQA 2Z60A 2VRRB 3QRIA 2WO6A 3JUHA 1JNKA 3H7PB 3BPRA 4DG2E 4E71A 2YLEA 2CNQA 4L00A 4AX8A 4D0WA 2X0GA 5IMXA 4UMTA 5HQ0A 2LD9A 3HRFA 4OTFA 2VTQA 4P90A 4FV3A 3NPCA 4ACHA 4JLCA 4BCKA 5KBRA 2BZKB 5CZIA 1WJNA 2A5UA 2WTWA 4NZWB 4FTUA 5CS6A 4R3PA 2L76A 2HW7A 4ZJIA 3RPOA 2YJSA 5HX8A 2KX3A 4C4EA 3O96A 3FZOA 2ZCBA 4AACA 3DVGY 4BICA 4GU2A 3SKCA 4AP7A 3Q4TA 4WOVA 2UZLA 3RULA 2QR8A 4ASEA 4CG9A 3TJCA 2PPHA 3GZNI 4JNWA 2QC6A 4UALA 3I5ZA 4CRSA 3VIDA 1IASA 3S00A 2Q0BA 2JLDA 5LXIB 3NIEA 4N0SA 1YXSA 4BDCA 2V4LA 1ISNA 3QYZA 3PRIA 5KMIA 3JY9A 3TWJA 3ZM9A 2VTHA 4RX8A 1LFDA 1JWHA 3SVVA 3PPAA 3QFVA 1M17A 5J9LA 4F7NA 2DENB 2GQGA 4R78A 3FMJA 3KU2A 5JN2A 1IPGA 4HGLA 5CHVC 2Y4IB 3WALA 3R3MA 5CVFA 4WJPA 4O22A 3Q9XA 3DQXA 3KUCB 5D12A 3HAMA 4AA4A 2YN8A 5IA0A 5DRDA 5J5SA 3FUPA 2PZIA 3QCAA 2X2KA 1WM3A 3LOKA 5GJGA 4ICVA 4I20A 3VVHA 3NYVA 2GNJA 1Q5KA 3R0TA 2PU8A 2C6KA 4BBEA 1SVEA 4EK4A 3I5NA 3A62A 3U9NA 1J3HA 4IAIA 3KXXA 4CFUA 4BCIA 4BYIA 3APCA 1D3ZA 4ONAA 4QMUA 3LW0A 5AEKB 4DDGD 1WMKA 3ACKA 4BKSA 3L9MA 3PJ2A 3PZEA 4D2PA 4CFVA 4XV9A 2JC6A 3P08A 2X9EA 4IZ7A 3Q3JA 4S32A 4QYGA 3EQRA 4YGAA 3V60A 2I0YA 5C4LA 4E5AX 3GB2A 2VTMA 3AI5A 4XNEA 5M4UA 1QPCA 3ZKJC 2XEZA 3C4XA 4O2PA 3SX9A 4EOOA 5A4CA 3Q9YA 4F65A 3OEFX 3QKKA 3NNXA 4Y72A 2QI8A 2AWTA 3DAEA 5EOBA 2Z7SA 4PTCA 4RFYA 2JDTA 2OJFE 5FP5A 2WQEA 4LYNA 2YJRA 3PS6A 4W9JA 4ZY6A 1REJA 3G90X 5AX3A 1H24A 2PZYA 3JSVB 5C8MA 2QOBA 3FPMA 4AUAA 3G33A 5DT0A 1MRUA 4QMQA 3G9NA 3OFMA 4NQKE 1Z9XA 5AX9A 4MF1A 3QUPA 2P55A 1YHWA 2CN5A 4PS7A 4YNEA 4I93A 3M95A 4HCTA 3LXNA 4UZDA 1P9DU 1OIYA 2GDOA 4FTNA 2IZTA 3PP1A 5J17A 3JS2A 2I1MA 3KK8A 3TUDA 3CR0A 4GK2A 4PP9A 3DVNU 4FV0A 2F2CB 2JFMA 4EH7A 2QOFA 2QO7A 3BYUA 2M8SA 2PVLA 4RX7A 4ACMA 4FKTA 2RFNA 5CQWA 2XKDA 3FQHA 3CEKA 2XKFA 3CE3A 1XQZA 4WNMA 4L7FA 3Q52A 1Y8YA 4ALWA 3FKOA 1Q8ZA 4RJ6A 3POOA 3TNQB 5AP0A 4YC3A 2PZPA 4J95A 3EZRA 4K1RB 4PF4A 4ALVA 4JX7A 4EHEA 3WILA 3PY3A 1QPEA 3LJ0A 3IECA 1V6EA 3OVVA 5HNBA 2J5FA 4QP2A 5CU0A 4NJDA 1NVSA 3F3TA 2J2IB 4BCGA 3DXPA 4HJOA 2MSED 3P7AA 4JIAA 2HWOA 3HX4A 5EH0A 1W82A 4K1BA 3U4UA 4MH0E 2LRUA 1JOWB 3I79A 4PY1A 1J0GA 2IO2B 3FLQA 5ETFA 2ITYA 4WNPA 3DNEA 2RPQA 4TTHB 3OWLA 1VYZA 3LXKA 3E62A 3MJWA 5C01A 2EXEA 4W9CA 2RF9A 2Y6MA 4JDJA 4ASWC 4RT7A 2KJRA 4QMNA 4EH3A 5E8ZA 2GHMA 4TPTA 3VHTC 3D7TA 4WG3A 1BX6A 4RWLA 2BWES 2GQRA 5CSXA 2K8CA 2UW8A 2XKCA 3Q6WA 4IX3A 1S1QB 3RAHA 4FMQA 3CPBA 3MWUA 4H3PA 3MBLA 2WMQA 1S9JA 2X6EA 4Y85A 3IONA 3ZNHB 5HTCA 1OKWA 3PE1A 2ITOA 3FXZA 4H05A 5JH6A 2LAVA 4PTGA 2XRWA 2SRCA 5GZ9A 1PXMA 5H3QA 1TQPA 4F7ZA 2WNTA 2C5XA 4PYZA 5BVDA 4WJNA 3FMHA 1H27A 1CKIA 4QP9A 4DT9A 4P7EA 5T68A 3NS9A 2VWUA 1M14A 3DPKA 4Y5HA 1EF5A 3H9DA 3N32A 4IX6A 4QMWA 1UA2A 3AC1A 2YDKA 4O0RA 4C38A 4LGGA 5DPRA 3BYSA 3ZBXA 4EEWA 4W4WA 5HTBA 5BUIA 4FIEA 3L8VA 3WBLA 4U41A 2OJIA 4U80A 3GU7A 5JZNA 3CSFA 4M3QA 2EB3A 1ZYLA 3V5QA 5KX8A 3Q04A 3EWHA 4IZ5A 4WA9A 2GBMA 2LVOA 5L2SA 4G2FA 5L83A 2ZEQA 2ZDUA 2UV2A 3A7JA 2OXXA 2BYEA 2BHHA 3VS6A 2QURA 4QMVA 1PY5A 3HV6A 4I22A 2A4LA 1H0VA 4ASDA 3H0YA 4BDKA 5HBHA 2VAGA 3QCXA 4PS3A 3KREA 1NDDA 3OUKA 4O7VA 2XCKA 1WXMA 4F1TA 4ZLOA 3TV7A 3UOJA 4D9TA 5K3YA 1WE7A 1V0PA 4PX6A 3T8MA 5AV4A 5EI8A 4ANOA 3GENA 4HNFA 4KV2A 2AL3A 4LOQA 1JPAA 1DI8A 4E8AA 3LFSA 4AN9A 2YITA 3E5AA 2GHGA 3FQSA 5EQEA 2D07B 3QJZA 3QGYA 2ZJDA 3FI3A 4MQ1A 2VX0A 3IW5A 3UIPB 5HNIX 2YHVA 1W8CA 3GCPA 1S3SG 5CF4A 2HYYA 1WMHA 2DHZA 3UO4A 2KNBA 4FTTA 5HLPA 5J79A 5AZGA 4IVCA 4FKPA 1KOTA 4U7ZA 1XJDA 1H25A 3A4PA 3VF9A 4HCPB 4J97A 3BX5A 1SYKA 3GOKA 1FBNA 4PV0A 3TIZA 5DIAA 4R3RA 3OWPA 3CS9A 4IB3A 2BPMA 3OCGA 5IG1A 5LMAA 5KBQA 4X2GA 3QZIA 2OSCA 3MA6A 4QO9A 4ZRKA 3MFRA 4ASZA 2NR2A 3V5PA 3ENHA 5CZHA 2C5VA 4AW1A 4OT6A 4DFLA 5AEPA 4GT5A 4ERWA 5JQ5A 2ZM3A 2PVRA 1V9JA 3NYOA 1PYXA 3UG2A 1V49A 2XJ2A 2JDRA 2JEDA 4TZRA 1IA9A 2CJMA 3I0OA 4O0TA 5IEXA 3SXSA 3B8RA 4HYSA 1J8CA 3ZSIA 4L53A 4ANQA 1Q61A 4FG9A 3DJ6A 3MVHA 3DXNA 2FSOX 3NLBA 2Z7QA 2ZNVC 3TDVA 3NHEB 4FKJA 5D10A 3NZSA 4BVUC 2J0LA 4DWFA 5JGAA 4DH7A 3RTPA 3QA8A 4KABA 2J7TA 4GKIA 1TGZB 4DF3A 2PMNX 1YWNA 4HPTE 3LDZE 2WGJA 2CHLA 3EQBA 2KO3A 4D1ZA 1XQQA 2GS7A 4CZTA 4QMYA 3TM0A 3NZ0A 2JKOA 4QMPA 4IVDA 4TQ1A 2X7FA 5BVNA 3A9JA 2KC1A 4GSBA 1G8SA 3BLRA 3HV5A 4EI4A 2IPXA 1XH5A 2JITA 5LVMA 3OLMD 4WJQA 2HELA 4AJWA 1KE9A 5TF9A 2XH5A 3ZDIA 2E9VA 3POZA 3UGCA 4DYMA 2ZMDA 1ND4A 2OIQA 3ORIA 3HA8A 1WVXA 3I4BA 4ASXA 2W06A 3D32A 3MTLA 2L00B 4H1MA 3SV0A 2ITNA 3EB0A 3UP7A 3B2TA 3ZUUA 5BMSA 2ZV9A 4FGBA 3E63A 5C03A 2VX1A 4BCFA 4C34A 2HCKA 4Z16A 3JSVA 4MD8E 2XBBC 3RPRA 4DFXE 4ZZOA 3V5WA 3FC2A 4DG0E 5EDRA 2GCDA 2C6MA 1PXOA 4CTCA 3PV1A 3MTFA 4D2WA 3AC4A 4AFJA 5IH5A 4ZIMA 2B53A 2C6OA 3UC3A 5AFVA 4PMPA 1T45A 1WR1A 3UVPA 4EC9A 4F6UA 5B0XA 3TTJA 4WBOA 2XIYA 2QNJA 3R00A 3GCSA 4PPBA 5AR3A 4KNBA 3TCPA 1H1PA 3FQEA 3DQWA 5BYLA 3G0EA 4M0ZA 4YZNA 1PXNA 4G34A 1H1WA 1NY3A 2PHKA 4LRJA 2BRGA 3ELJA 2EXCX 2P4IA 3ZNID 3BE2A 5K5XA 3ERKA 2WMTA 5DCNA 4QMOA 2Z59B 4U40A 2ETKA 2W99B 3ZSHA 3L10B 5M09A 3NNWA 2UZWE 2VNWA 4MGIE 3TXOA 4FVPA 1Q0WB 4FTMA 3EECA 3FMLA 2FNJB 4KIQA 5CEPA 3UVQA 3BZ3A 4EYJA 4FOBA 4KIKB 2REIA 5E8TA 2YM4A 3CD3A 4PNKA 2XNMA 3FMKA 4YJPA 3ZLWA 2X6DA 1Y6BA 4IAAA 3SW7A 2N9EB 2OKRA 3U4WA 4DH5A 2W4OA 3KRJA 4FL2A 4NCTC 4WD5A 5F4NA 2ZNVB 3W33A 4D4RA 4AW0A 4F9WA 1T46A 3CY3A 5B2MA 3OWJA 5T6KA 5LLIA 3H9RA 4IB1A 4RWJA 3QC9A 3R8ZA 3DDPA 3I7BA 4E6AA 4X7QA 5A14A 4QP3A 2OXDA 3JVRA 2QR7A 3TNWA 3HLLA 5G2NA 3NX8A 4G17A 4OTIA 2WYQA 3A60A 1A06A 1EUVB 1LPUA 3ZUNA 4BKGA 3BBTB 2GTNA 2J5EA 4JR3A 1EH4A 3F2AA 4G3EA 1KOAA 5TR6A 1J91A 4KSPA 1Y8GA 4A06A 2MLBA 4DTKA 4EOJA 4F1OA 3JPVA 4W9XA 2CR5A 3ZNGC 3KRLA 2LASA 4QMMA 5EI6A 4EZLA 3ECIA 4FKGA 3KH0A 1HCKA 2N4FA 2GPHA 1Y6AA 3FLYA 4HK2A 4O0YA 3R02A 4Y83A 5E6NA 2W96B 3LXPA 4PMMA 5L8KA 5FDXA 1E7VA 4AA5A 4W9FA 4ZMEA 2ZPNA 3KFAA 4IVAA 3LCSA 3K2LA 5D41A 3EQDA 4QP7A 3SQQA 1WJ4A 3ZEWA 4RMZA 3TIYA 4BI2A 3A1QB 5LVNA 2IY0B 2X4ZA 5HKHA 1Z5SB 2QO2A 5E8UA 3R8MA 5D2MB 5M07A 3V8TA 4P4CA 2X2MA 4TYGA 3QKMA 3JVSA 4IWOA 4NFMA 4DGLC 3ZRCA 2QD9A 2RFEA 2R64A 3MDYA 3PXYA 2XS0A 4TNBA 4JG8A 4Q9ZA 4W8DA 4K2RA 3KCKA 3EKNA 3QAQA 3O8TA 1A5RA 2DYBA 2DYLA 2CLQA 3SRVB 3AT3A 1M94A 4EK6A 3ORNA 4FUYA 2IVTA 4I6NB 2FGIA 4UEUA 1WBNA 1BMKA 1Y57A 5HLWA 3PLSA 4R5SA 4RIXB 5K0XA 4FNYA 3A9KB 3ZTDA 4GVAA 2WKMA 1V80A 2XIRA 4A20A 1PKDA 1GIHA 5LARA 4EOKA 1OKZA 4MJSB 4AOTA 4EOSA 2JIVA 2VTOA 4O38A 2NBVB 4V0GA 4BDIA 3QL8A 3HDNA 3CF6E 4FEUA 5DNRA 5IUIA 3RUIB 5FP6A 3OT3A 2BVAA 3Q4CA 1XBCA 4FJYA 3A7IA 2XK7A 3TZMA 2WMVA 3RK7A 1IR3A 3R8LA 4U97A 3UOKA 2KFKA 2I1JA 4FL1A 1H26A 3ZXTA 3EFWA 1WVWA 2GSFA 3PXZA 3AGLA 2WMUA 3LCTA 3VW6A 2ITQA 4QTAA 2Z7LA 2M17A 2VO3A 2UZOA 5HIBA 4DCEA 4BI0A 1ZKHA 3FZ1A 2OK1A 4PS8A 4BDGA 5HX6A 2P33A 2ITPA 5AIKA 3RPVA 4Z9LA 1UU7A 3NWWA 3D5UA 5IQEA 4ACCA 2W4KA 3VNTA 3IVFA 4BZNA 1BI7A 2WTVA 4MD9E 2B52A 3UC4A 3D15A 2LGXA 4FHJA 3E3PA 3PA3A 5J5TA 2LRWA 3EN5A 4GJ3A 1JVPP 1YXXA 3GCQA 1UVRA 3C0HA 3A8WA 4BCNA 1TZ1A 3EFKA 1KM7A 3P2BA 4RWIA 2W1IA 4UV0A 1SM2A 3NYNA 4B8MA 1XBAA 3FZSA 4BKZA 5H8EA 3DBDA 5IEYA 2KC2A 2OO8X 3EOCA 1OUYA 2BYVE 3H1UA 2WIHA 4LMUA 5I4NA 3VRZA 2J0MB 3DU8A 3L1SA 4C59A 4J52A 1GIIA 3E8NA 2BKRB 4G3FA 2MWSB 5BVFA 3DDQA 1UV5A 4CZUA 4AUQC 5CAVA 1FGIA 3ALNA 2V7AA 4J99A 4RVTA 1ZYCA 5ACBC 2V55A 4GK4A 1R3CA 3LPBA 3WAMA 5IQHA 3X0WA 4IC8A 4QTBA 3DJ7A 5K5NA 1HE8A 2JKQA 2CGWA 4DGOA 4YSMA 5IA1A 4YZMA 3AU5A 2ACXA 2UVZA 3FYKX 1X1MA 2OLCA 1QPJA 4CLJA 3UO6A 4QYEA 4OAVB 4DK5A 5KMLA 2BZJA 3PT2B 1F5QA 4KRCA 2PVHA 4YLJA 4YPDA 1FPUA 5A4QA 2Q83A 4Z55A 1SIFA 3CSTA 3OAWA 4CSVA 2FSTX 5BYYA 3HMOA 3P0MA 3Q4UA 3V5JA 5CEMA 2J4ZA 4M15A 4JIKA 2WQMA 3GU6A 2ITZA 3RCDA 2G01A 3RCJA 4KIPA 1RE8A 1DS5A 3WI6A 3VUHA 3PG1A 1OMWA 1BI8A 1PXIA 3PWDA 2I1KA 3R22A 1ZMVA 1E7UA 4Y95A 3Q3FA 5DMZA 4GL9A 4D58A 3K5VA 2OJJA 2IVUA 1IRKA 1IEPA 3DGKA 4HVSA 4J1RA 5HLNA 4FTQA 3UP2A 5EG3A 3PPZA 4WBBB 4IACA 1Q3DA 5ACKA 2XJ0A 2F9GA 5DGZA 3DK3A 4AXAA 3DZQA 4J98A 3V8SA 2NCNA 2LXAA 2M0XA 2A2AA 1LQBA 5HCYA 4I4FA 2C1AA 5J1VA 3LCKA 1GNGA 3ZTXA 4RZVA 3DOWA 4G9CA 5D11A 3AQVA 2Z0DB 1CMXB 1DM2A 1V81A 4Q9SA 4GW8A 2JIIA 2LVQA 4FSYA 1KOBA 4L3PA 3ONSA 3MY0A 2V5QA 2REXA 4IEBA 2GNFA 2W17A 3OWKA 4MCVA 3PPJA 5AAGA 1UZXB 4EKKA 2V1YA 4C3RA 4YC6A 3PTFC 2FCSA 3ROYA 3W2PA 4M7IA 3ROCA 3LM0A 2X8IA 2EU9A 3MH0A 3BYOA 1GZKA 3TACA 5DLSA 1UGMA 1SNUA 3QTWA 5AAFA 1RFAA 3TKHA 4KIKA 3QTSA 3VUKA 5TE0A 1XR1A 4I24A 4MXZA 1WGHA 2I0EA 5CU2A 5HCZA 4DBNA 4RC4A 4IC7A 4NH1A 1U54B 2OXYA 4JVGA 3RNIA 1ZGUB 4R6VA 3OOGA 3P79A 3DBEA 2BKFA 4I23A 2DS1A 3BLQA 4PWNA 4G11A 4NL0A 3QUEA 4BVUA 3F5UA 4E73A 4E4LA 3F7WA 3TTIA 2OZAA 1ZYJA 1ZAOA 4D4VA 2D3GA 1WYWB 4A9YA 1BYGA 3KYDD 4C8BA 4YJTA 5BQ0A 3MYGA 2XK8A 3ZRMA 2PULA 1QPDA 4NT4A 3QCQA 3KKVA 2BR1A 3DBFA 4Y73A 5EKOA 3V01A 2CDZA 1P0RA 2QU6A 1OKVA 2GNLA 5K0KA 2C4GA 3DBRI 1W0XC 1KUTA 4O7LA 2CGVA 3QQUA 4MYGA 3DBQA 3ENMA 2J0KA 3O65B 3UQFA 1OVEA 4O84A 3O71A 3OF0A 2XBJA 2VD5A 4IFGA 4RLKA 3D2IA 1YOMA 4JRVA 2DYOA 3CGOA 3ZO2A 3VTVA 4FTOA 4JT3A 2GNHA 3FLSA 4X0MA 4BN1A 5BMMA 4GDKB 4IWPA 3UYTA 4FSWA 1H1QA 1WBWA 5E8XA 4W9DA 4BDHA 4D0XA 4B4LA 5EOLA 3RZBA 3HEGA 3SLSA 3ZRFA 4IANA 4NKSA 4GS6A 3NIZA 4ZRJA 4QYFA 4BTJA 5M06A 4NSTA 3TNPC 2GBJA 1PQSA 3BEAA 2YM8A 2C0TA 4FV6A 2XP2A 3AT2A 5M44A 3A99A 3R9RA 4RIWB 5E90A 4ZTSA 3ZS5A 3IS5A 3A1QA 2R3LA 4L7SA 5EDPA 2JWZA 3MJ2A 2GS2A 4XJ0A 4GU9A 3KRRA 4EL9A 3KVXA 2QOQA 3RP9A 3NCGA 3IW4A 2L7RA 4UWCA 5HO6A 4FTJA 2N7DA 2MBBB 2QHMA 5J7HA 2HW6A 3VS1A 1YQBA 1M7NA 4OTWA 3SRVA 4KBCA 2PMLX 4DG3E 4ALUA 4DGNA 5FEEA 3F9NA 5IUGA 3W1SC 3U30A 1ZYSA 2W9ZB 5D7GA 2XK9A 3KL8A 4FYNA 4FUXA 4E3CA 4FIJA 4HOKA 4IE9A 4AZWA 4GKHA 1PYEA 3A9KA 2G9XA 3QQJA 4TV3A 3QYWA 3TCAA 3UTOA 1E5WA 1SVHA 2GOWA 3KXZA 3LMHA 5HI2A 3UZRA 4H3QA 1WCCA 3R7EA 4FN2A 2RGPA 2OJGA 4CKIA 4BCOA 2BRNA 4EBWA 4BZOA 2ONLC 1OKYA 3HDMA 4ZSLA 1KLVA 3V6SA 4I6LB 2LWPA 5FM2A 5AV0A 3BQRA 2A1AB 4NCTA 2E2BA 3LM5A 2XCHA 3KRWA 4K81A 4XRJA 4WO5A 1IA8A 1PW2A 1TQMA 4CLIA 3N30A 4FKOA 1C1YB 1KWPA 4FV9A 3LFFA 1WR6E 2RGFA 3A2CA 3LMGA 4R3CA 3H10A 1YW2A 1UH6A 3Q4ZA 4MWIA 2VTLA 4FIIA 3M42A 5FR6A 2F49A 2H6DA 4GFMA 4W8EA 4O2ZA 3MB6A 2HIWA 4AZVA 2GFSA 4DGGA 1J7LA 4YTFA 2F7EE 2QO9A 3M3JA 1ATPE 4EOQA 4NJ7A 3VAPA 3OP5A 3FLWA 2FH9A 3TUBA 1BL7A 3IKAA 2BZHB 3KULA 4JIOU 4I5CA 3FI8A 3ANRA 2G3QB 3DXQA 4B7TA 5EW9A 3W2OA 5JSMA 3K9PB 2KK8A 2KANA 4BB4A 2XA4A 3P1AA 3HIZA 3N9XA 2BDJA 4EH2A 4MHAA 3KQ7A 5JFSA 5D7AA 3CKWA 2VTAA 3L8SA 4TXCA 3OJ4B 3NVKI 5DVRA 4FT5A 4C57A 2JXXA 2H34A 5HOAA 4E7WA 3UZPA 2X81A 4A3PA 4AFEA 3TNHA 4QP8A 3DKCA 3Q6UA 3PLVA 4XG6A 4D9UA 3PZDA 3LE6A 4D1XA 5L3AA 4JAJA 5DEYA 4QT1A 3DVGX 4GK3A 2WEVA 3D0EA 2FVDA 2CNUA 4F8CB 4BZDA 5AP1A 4BCQA 2JPHA 1OB3A 4F6WA 3DA6A 4LOPA 3EQIA 4FLHA 4CMOA 2IW8A 5JQ8A 3TDWA 5GIOE 4E4MA 3VBTA 3C1XA 4TYEA 4I4EA 2C5NA 4RFMA 5CVGA 2HY0A 1Q99A 4AWIA 5H9BA 3PG3A 1KE7A 3F3ZA 3WZUA 3L13A 1WF9A 1U46A 4MEDA 4AOFA 4QMZA 5I9WA 4NFNA 2KJHB 3E7VA 5J87A 3LAUA 2PVKA 4GSWA 3U51A 4FZFB 1E8XA 1YKRA 3GQLA 3GVUA 4RA5A 4TRLA 4EBVA 5JEBA 3AC8A 5A4TA 1PXLA 3RWQA 4YNOA 4ZZNA 5LMKA 3OZ6A 3VUIA 3VDZA 2L05A 3CMMB 4F7LA 4YPSA 2R9SA 4C2VA 2BPSA 2W9FB 5EW8A 4EZKA 3Q9WA 5HIDA 3ZOSA 3N3KB 3G0FA 3LLAA 5IQFA 2IZVB 3LZBA 2KQ7A 4RMAA 4FKWA 2W0JA 3MFSA 2E9PA 2BROA 1Y91A 3ET7A 2XK3A 2X7OA 5LMBA 4NIFA 4MELA 1IAHA 4TWOA 3ZIMA 4BTKA 5CASA 3ZDMC 1O6LA 1WX7A 2B9IA 4JQ8A 4FHKA 1WIAA 5CY3A 3SAYA 4KINA 4FICA 4FTIA 2HZ0A 3UYSA 4NAWB 4F64A 3ZC5A 2KWUB 4KA3A 2KTFA 2PZRA 1UKHA 4XLVA 4XX5A 3O51A 4LV8A 5AZHA 3DTWA 3L54A 3DOGA 4M66A 4FKLA 2HTHA 4F6SA 5C9CA 2HJ8A 4L3JA 5JHAA 4LDTB 4KAOA 5DPWA 3A4RA 3W2RA 1YI6A 4BTMA 1LR4A 4JDIA 1H07A 3I7CA 2KKCA 4CFWA 4MXOA 5AM6A 2KD0A 4IWQA 1B38A 2FB8A 3V5TA 4AGWA 4MGKE 2CHZA 4DEAA 4O81A 2WEIA 2J51A 4I6HA 4MSMB 3GC7A 2ITUA 3GFEA 4FOCA 5BVEA 3I6UA 1U54A 2I0VA 1I35A 5GMVA 3I0QA 1YDSE 1OIQA 4L67A 3RM6A 3HMNA 3VVWB 3R7RA 5CEQA 4F1MA 3U6JA 4RJ3A 4UMQA 2IBIB 3LQ3A 2CLXA 2C3KA 2IZUA 2K25A 2NP8A 3R73A 5DEWA 4XH6A 4K33A 4OT5A 4ZXTA 2ETRA 3PYYA 4CZYB 5CXZA 3VS5A 5CAPA 4PQNA 3DAKA 3QQFA 4GU6A 4DH3A 3RCZA 4AZFA 1Z57A 4LDTD 2IN6A 4EOIA 2AC5A 1YXVA 2XRUA 3PRMB 4OTDA 3O23A 4XP3A 5LXMA 1NA7A 2OIDA 5ANKA 4C33A 2WHBA 2ASQA 2VTNA 1XT9B 3NUAA 2FUHB 4D1SA 4WAAA 5E1SA 3V8WA 3RAIA 2KMAA 1FMOE 3NS8A 2OBJA 4FV7A 4XV3A 5KMNA 4C3FA 4OTPA 3WIKA 4EH6A 4F9YA 4Z3VA 4ANMA 1K9AA 4C4HA 3UNKA 1M2PA 3E8CA 4PMTA 1E1XA 1JLUE 2WPAA 4NWMA 2G2FA 2XIKA 3F3UA 3APFA 4O6LA 1DAWA 2ZVNA 2BZIB 4EC8A 1JSVA 4O86A 1L2NA 3RVGA 4IXPA 3CJFA 3OCSA 2IY1B 2Y4PA 3AMYA 4BFRA 3QTRA 3ALBA 4RGJA 4K0YA 3RK5A 1YI4A 1LEZA 3TZ9A 1NI2A 3W1FA 3KXHA 3G15A 4U9AA 5IQDA 3QHRA 4GDLB 4FTLA 4U0IA 2KTRB 4CT2A 4LL5A 1YX6B 4BDEA 3LFQA 3S2AA 2Y8OA 3IGOA 5CI6A 5I9UA 2O64A 3DDCB 4R5YA 1OBGA 2PVYA 4E20A 4EH5A 4CV9A 3C4CA 3U87A 2YCRA 4DLJA 2PVJA 5CX3A 3QIJA 3JYUA 4WJOA 1JQHA 2JKKA 4JDKA 4DFBA 4E4XA 2VWVA 4BF2A 5HGIA 1JKLA 5K4JA 3RK9A 3T3VA 5EKNA 4HGSA 5IQGA 3QXPA 2B1PA 5E9EA 1WZ0A 1WX9A 5ANDA 3EZVA 4PDYA 4NW6A 3IO7A 4AGDA 1ZZLA 4E74A 3ZCLA 2B3AA 2KDBA 4DDID 5L6OA 2JVCA 3RPSA 3WIGA 3P86A 2X2LA 2ITTA 2H96A 4LCDE 2QG7A 2JF5A 3VN9A 3VUXA 2YIRA 3FL4A 3MW1A 3IG7A 4N4SA 1TTNA 2RFSA 2PSQA 2YWPA 3HRBA 4ANSA 5E8VA 3HMIA 5ETCA 2VWWA 1XHAA 3FI2A 5E7RA 1E9HA 3II5A 2BYFA 4FKSA 5DBXA 3OXTA 2KHWB 2GQSA 2YCSA 3P7BA 4F7SA 4BGGA 4O0UA 2KX0A 5JMSA 1KE6A 4CCUA 4F0FA 4I5PA 4A9SA 4P7IA 1L8TA 4BL1A 2AYPA 1ZOGA 2QLUA 4BWPA 5GZ8A 1L7YA 1M52A 3COMA 5IQBA 1DI9A 2EMSA 4M84A 2YEXA 4RLLA 3PFQA 5AP6A 1R4NI 3PSCA 3HMMA 3MH3A 5JKGA 1EF1A 4AF3A 5FXRA 3KYCD 4II3B 2HXQA 2ZVAA 3KB7A 1JSUA 3NZUA 5FDPA 4KKHA 3F66A 5F20A 4O7TA 2XKEA 3NRMA 3EN6A 2VZ6A 4EH8A 4J8MA 1E90A 4II5A 5A54A 2N1VA 2GMXA 2N1WA 5AR7A 5ITAA 2KN5A 2CMWA 1CKPA 4FK3A 2LGDA 5EQYA 2OH0E 3LQ5A 2UW0A 5HE3A 4RJ5A 2WMWA 3RD2A 2W1DA 4I3ZA 2WELA 3RZFA 4RPVA 3C4FA 4FT3A 4CGAA 4C4IA 3P5KA 4E1ZA 4A9RA 4S31A 2YM6A 4ANVA 4ANLA 4XX9A 3UMXA 3G2FA 3KMMA 2CU1A 1PMEA 4M0YA 3KUDB 1OPKA 2E9OA 3ZBFA 1OZ1A 2MX2A 1PXPA 1PKGA 4RJ7A 5CEKA 1ZY5A 4EHZA 2YM5A 4YTIA 3DVNV 4NTTA 4QTCA 4WIHA 3DBLI 1U5QA 3RNYA 4IVBA 5LXHA 1H01A 3GU8A 4KS8A 3F7ZA 4ZJVA 3VJOA 4AU8A 4U42A 2PZ5A 3FLNC 3SHQA 4ITIA 3W2CA 4OTRA 1WY8A 3BIZA 3WOWA 5EI2A 3JVZX 3W1SA 4FA2A 3FKLA 3R7UA 1C3TA 3BELA 4ZDVA 2YZAA 3RI1A 5HVYA 4JR7A 4DBXA 3WYYA 3BGQA 3UZTA 4C4FA 3ACJA 5EYKA 3OXIA 2ZYBA 2W1CA 3DTCA 4WSYA 1XH6A 2KWCA 4BI1A 4BBNC 2UZTA 4UXQA 2XNBA 4PL5A 4FZ7A 5JGDA 2VO6A 1Q8UA 4ENXA 1KV1A 4TUUA 2WTDA 5TR5A 3OY3A 3Q3BA 5F9EA 2QHOA 2ONLA 5GIPE 1GZNA 4NQLB 2JT4B 3NUNA 3DFAA 3NUYA 4OBOA 1WH3A 3R1SA 3G6GA 3PY1A 4RIYA 2KVRA 3LXLA 4O82A 4C58A 5CVHA 3PTGA 3P23A 3IDPA 3ZDTA 3MH2A 5M08A 4TL0A 4MF0A 2R2OA 3SOAA 3P7CA 5CU3A 4URKA 3VS2A 4ZTQA 4MGYE 2XYUA 2H9VA 3QA0A 2PVFA 5KHWA 3PXKA 1P1AA 5HO7A 4NK9A 5AUZA 5JH5C 5DPVA 2PWLA 2J0IA 2GBKA 2UW3A 4JG6A 3VXWA 4DEBA 3QTQA 4ZSJA 3PVBA 4IIRA 4OW8A 1QCFA 3FSKA 2KDIA 1BUHA 1U4AA 3LHJA 2BCJA 2KMCA 4QNAA 5M4CA 4IH8A 1ERKA 2W5AA 3U7DA 4DTBA 3FL5A 5HZNA 1WAKA 3LFDA 5C27A 4LGDA 5L4QA 4AAAA 1WBPA 4IJPA 3QC4A 1OM1A 3R1NA 3BV2A 5KMOA 4DEEA 4JBOA 4ZP5A 4FTAA 2A4ZA 1Y8RC 4MXYA 3D5VA 3OW3A 4YU2A 1QMZA 2OGVA 4TKSA 4QMSA 3QD4A 4FF8A 5JT2A 4OBPA 3R7GA 5B7VA 1ZZ2A 2CGUA 5LJJA 4JBQA 4CRLA 3K3IA 2JRIB 2GFCA 3DBHI 5M4FA 2KJ6A 4C36A 5GINE 4M69A 4YJOA 4S30A 4M14A 3QD2B 1JSTA 4QPMA 4MGZE 4YTCA 3HP2A 4GJ2A 5AR5A 4TWNA 1H1SA 5L95C 4O91A 2YACA 1Q41A 5J7BA 4AG8A 2W5BA 4WG4A 5DR6A 3S95A 5BX0A 3TJDA 1Q5WB 4WWNA 3MTNB 2QOLA 2LJ5A 4P2KA 4BR3A 4BDAA 3EFJA 4X3JA 3WYXA 1WVYA 3B0AA 4W9HA 4UY9A 3ENEA 2YAAA 5AUVA 4PTEA 4OBQA 4PP7A 5HBEA 4KVGB 3ZYAA 5LOHA 4D55A 2ZZPB 2VRXA 2UW4A 1GY3A 3FY2A 3NW6A 4DHZB 3ETAA 4USEA 3OY1A 2C9WB 3VHKA 1WXVA 2JUOA 4U44A 3AD5A 5AR2A 1FINA 1WBSA 4J7BA 5C1ZA 4NM0A 1WZ3A 4F08A 4J8NA 4MK0A 3WA0A 3EYHA 3UGBB 4B95A 4FTRA 2KTRA 4K9YA 4EK5A 3R7VA 3BLHA 3R71A 5FGKA 3AOXA 5JFVA 4YJQA 1NXKA 3D94A 2MP2B 2YAKA 2GNIA 2NBUA 4RFZA 4J53A 4QMXA 4RX9A 4ZTRA 4KKGA 3HZTA 3L8XA 4WT6A 4MM3A 2R3KA 4PPCA 2GNGA 3NCZA 2J9MA 2XK5A 3ZZWA 3MI9A 4FG7A 3ZLYA 3QXOA 4MKCA 3LJ1A 5CANA 4PDPA 1XWSA 2JAMA 5CU6A 2IO0B 3P9JA 5I5ZA 4IAYA 3UOHA 2RD0A 3R66C 4RVKA 4AN2A 2HZNA 5IZFA 5E8SA 4CYJA 2ZM4A 4RIOA 2JAVA 2P3GX 4F09A 3O0GA 4GMYA 3SGCA 2BRMA 3ZU7A 3VBXA 4XS2A 5AM7A 2OH4A 4V05A 2D11A 3T8OA 2DAFA 2QODA 5GHVA 4CT1A 3KW5B 3VULA 4TN6A 2WWZA 2OF4A 2VTSA 1TKIA 4G5JA 1MRVA 3UINB 4DTAA 3HAVA 1YVJA 1ZOHA 3TG1A 5FTOA 2XK6A 3RBWA 2W5HA 4AN3A 3UOLA 3VBQA 3ORLA 2X7GA 4BTFA 3ZRKA 4BC6A 4EHGA 3U9CA 4OVVA 4DBGA 4U5JA 3NY5A 3GBZA 1G3NA 5JFWA 3ZO4A 5HTIA 2C60A 4G16A 2O63A 1GAGA 2NPTA 2QQ7A 3UNZA 5FEQA 5DPTA 4DAWA 3WF5A 2ZB0A 3R7QA 3F3VA 1YOJA 2ITVA 3NEWA 4GV1A 3IK3A 1BLXA 3DNDA 3GT8A 2XEWA 5A4LA 5DR9A 4O0SA 4FZAB 4O6EA 3C5UA 3C9WA 3D14A 3T9TA 3SU8X 3DKGA 1QZEA 3W16A 1GZ8A 5E91A 3RINA 3FV8A 4XBUA 5HESA 4ICUA 4RA4A 2ZV2A 4ZTNA 3VRYA 2BF8B 5TOZA 2YFXA 3UO5A 2XNOA 2G2HA 3ZFYA 3MS9A 3BV3A 1UKIA 4HVBA 5J9ZA 3GU5A 1ZRZA 4U45A 1WGGA 2UZBA 3ZDUA 2YCFA 3IOKA 3OMVA 4WRSA 4DLIA 2GMIC 4PNIA 5EYMA 4AOIA 2O2VB 4O7WA 2M4NA 4IADA 3H7PA 4U3YA 3F5GA 3DB6A 3HA6A 3NDMA 4O0VA 3ORZA 4I5MA 4L45A 5ANOA 4AT3A 4H39A 3TMPB 1YXUA 4XC2A 4NM3A 3VS4A 4DHFA 2EKEC 3IOPA 4F9CA 2OIBA 5L8JA 5ANGA 4CMUA 4EZJA 1XH7A 4TWPA 4DEHA 4ZLYA 4NPNA 2CKQA 4F63A 4XLIA 4E4NA 4RM9A 2J0JA 4ANUA 1VZOA 3HM3A 2PYWA 3IW8A 3DCGA 3PRFA 5KHOA 3RHKA 4YO4A 1ZOEA 1LUFA 3EFLA 3BHTA 5TT7A 4GUEA 4GIVA 4U43A 5J8IA 2RG6A 1K3AA 2EXMA 3MA3A 2UW9A 3IGGA 2VGPA 3GOEA 4IW0A 4F1SA 5H8BA 4RC3A 5CT7A 2XJ1A 3IBEA 4WG5A 2IG7A 4BKSD 5AMNA 3O2MA 2FCQA 5DRBA 5HG9A 4ID7A 3MVLA 4KIOA 2DYMA 3PRZA 5M53A 2WMXA 2YDJA 1GIJA 4PDOA 3E92A 5DFPA 2XNGA 3PJ8A 2Y0AA 3FWQA 5I0BA 3T9IA 2J90A 3CD8A 4X2KA 3MY1A 3FXXA 1OPJA 3QTUA 3Q5ZA 5D9HA 2R2QA 2IVSA 4LGHA 3CTHA 4IQ6A 2X1NA 2BAQA 2AC3A 2JIUA 3NW5A 4L46A 1IP9A 2AYOB 5DG5A 2ZV8A 4WHZA 4F9BA 2BKZA 5KZIA 3LVPA 3NNUA 2VNYA 4UBAA 4TW9A 3QQHA 1MP8A 3D9VA 3ID6C 3P4KA 4WWOA 3KGAA 4F0GA 2VO7A 4CFNA 4G9RA 4I94A 4O96A 3D5XA 1WJUA 3W8LA 2ZB1A 1B6CB 3VBYA 5HEZA 3SG8A 2VUWA 4LG4A 5AV2A 3LCOA 4O7YA 3PVLA 5DT4A 5CWZA 4O0XA 4M8MA 3ZXZA 4QYYA 2C6TA 1B39A 4JGHB 3PVUA 5AUTA 2YA9A 1J1CA 4FV4A 2XB7A 2FCNA 3D7TB 4EKLA 1SE9A 1PMNA 4YZCA 3WARA 4DHZE 2VWIA 1DAYA 3APDA 1T0YA 2RKUA 3QALE 1YJ1A 2WTJA 1EO6A 1RAXA 4QP1A 2UW7A 4FV2A 2PMOX 3DLZA 2LVPA 3W32A 3SXRA 2WAJA 4IUMB 3BRBA 2RIOA 5FXSA 5IISA 4DFZE 3BU3A 5CT0A 5CF6A 4FNXA 5A6OA 1W7HA 4R7HA 1OL2A 1I09A 3Q96A 1BKXA 3W1YA 4AE9A 1JKKA 4L44A 4JXFA 3G6HA 1OL5A 4G3DA 4B9KA 3I1AA 4IWDA 3ZVVA 3C0RB 2ERKA 4XRLA 1R39A 3KF7A 4EJ7A 1GNUA 2A0CX 3DAJA 3TEIA 5FD2A 3BGPA 4KSQA 4NYEA 3PUPA 3AGMA 4QP6A 3KUZA 4IB5A 2QOKA 4LFIA 4QD6A 5TKDA 4FEXA 2PL0A 3QWJA 3KMWA 1KSWA 2Y7JA 4XG2A 5CAQA 4NUSA 1V0OA 2KDFB 2YM3A 5G55A 3I81A 3JYAA 4FJZA 1W83A 2YABA 3EHAA 5BNJA 2HWPA 3KCFA 2QOHA 3DBSA 5FXQA 2XIZA 4FKUA 5KHQA 2PVNA 2XNPA 4EK8A 3Q2JA 2XEYA 3Q53A 2W7XA 3WF8A 4B6WA 5LVPA 3VUTA 1Z5MA 3WF6A 3F61A 5EHLA 5IU2A 1G5SA 2ZPYA 2OFVA 3QARA 2EUFB 5HBJA 2ERZE 5HE2A 3ZFXA 2DQ7X 5IF1A 2LZ6A 2DZMA 3C51A 4KKEA 5H8GA 3BHYA 3GGFA 4RZWA 3R8VA 3WF7A 1Q4LA 4EOPA 2W4JA 3RYTA 3MPAA 4UYNA 4OGRA 5FBNC 1WXSA 3UODA 4FSTA 5HVKA 4RM8A 4UWYA 4CVAA 1OEYA 5JHBA 3KVFB 4E6DA 5D1JA 3AD6A 3NUUA 4TYIA 4G1WA 2FO0A 4DFNA 2OJ9A 4CO7A 4LUDA 1K8RB 4N70A 4DH1A 5BPYA 1WMHB 4RJ4A 4BWXA 4JJRA 3PXFA 4LJOB 2K6DB 1H4RA 4AQCA 4IB0A 2VV9A 4O7ZA 4I21A 3D5WA 5BVKA 2UZDA 1LM8B 2I6LA 4GG7A 5AR8A 1P14A 5E8WA 3HV3A 4R7IA 4AZEA 1JKSA 4HZRA 2XYNA 1I44A 3FSFA 3C4WA 1VCBA 4G50A 4AE6A 2XM9A 3ORPA 3FYJX 2JBOA 2C30A 1YHVA 2JFLA 2QG5A 4TWCA 5A3XA 4UZHA 2X39A 3OCBA 4HDOA 5FEDA 1KE5A 4O0WA 3OROA 3K54A 3PGEA 5AADA 4C35A 4DE4A 2C6EA 4W9IA 3B1LX 4CNHA 3FBVA 3ORMA 4FV1A 2Y9QA 1VD2A 4QTDA 3VTWA 3D83A 1H08A 3B08A 4FADA 2B54A 5C8KA 3EKKA 4BCMA 4BCPA 2J50A 4LUEA 4LJPB 3K5UA 1MUOA 5CENA 4KS7A 3PLUA 3GXLA 5B2KA 3M2WA 4C3PA 3M62B 3VUMA 2XF0A 2VWBA 3S0OA 4ANBA 3U8ZA 1ZW7A 1Q8TA 4GG5A 3WANA 3ORTA 4X3FC 2O2VA 3T9LA 4QOXA 1FVRA 1PRYA 2OWBA 3PSBA 3R1YA 2B9JA 4W9GA 3A9JB 4DINA 3TL5A 3CLYA 3S3IA 3NGAA 5HU3A 2OG8A 3R01A 4MTAA 2YIYA 3ULZA 4YJVA 2ZCCA 3DFCB 2UZVA 5F95A 3MJ1A 3R28A 4TNDA 4O7SA 1AQ1A 3PE2A 4ZSEA 3TJPA 2BRHA 1J1BA 4AA0A 1V1KA 4E5BA 4HWIB 4R77A 3L8PA 2BILB 4W9LA 2PE9A 3GEQA 1FVVA 2PY3A 5IPJA 3GC9A 2YVCA 4BIDA 3CQUA 3R04A 4QTEA 5JGBA 3RALA 2C7NB 3ZONA 2C47A 3CIKA 2O6VB 3SA0A 4FL3A 4U6RA 2WMBA 3C5IA 3BGZA 2R2PA 4MXXA 1XO2B 4AS0A 2VTJA 4USDA 5CX9A 3WZKA 1STCE 1Q62A 3GFWA 2BMCA 2KLGA 2FYSA 3ZTCA 3QX4A 3ZLSA 3HGKA 4HPMB 1OGWA 3DCVA 1F3MC 3SXFA 4B6LA 2WMSA 4OTHA 4G6LA 2WTKC 3NR9A 5IA7A 1YHSA 4QQTA 4JOAA 2LGYA 2YLMA 3C4ZA 5HG8A 5DOSA 5CSWA 3EQCA 5CU4A 2R3GA 4IDVA 3OT8A 5KE0A 2BALA 4ZZMA 5EFQA 4CEGA 4WSQA 4IAFA 4GYGA 4XEYA 3UIOB 5EM5A 3ULIA 2P2IA 4CKJA 3QX2A 2O6VD 2LI5A 3UQAA 5L8LA 2H8HA 5HCXA 2ZDTA 4WUAA 3KN5A 2YERA 2VTTA 4D2RA 3EIDA 4I0TA 2W1GA 3N4VA 2YIXA 3E8EA 4FVQA 2KLCA 5KKRC 2CCHA 2DWBA 3R63A 2FSMX 4EQMA 3HL7A 5KMJA 5I3RA 2YWVA 1I42A 2BFXA 2Z02A 3ZUVA 3PWYA 4QNYA 4FVRA 3GNIB 2CPKE 2QCSA 4BKTA 4HVDA 4UMUA 4U8ZA 4I6FA 4XG9A 4ACDA 2C7HA 2VN9A 2C0IA 3TIXA 3UPZA 4BDFA 4FKIA 4Z7HA 4ZTHA 3OW4A 5IAAC 3R83A 3UIXA 4CHKA 1SVGA 5E1EA 3ZC6A 3KXGA 4FYOA 4X3FB 2VWZA 3QQ8B 4EEVA 5AUWA 1WGDA 4XYFA 1UU3A 1WJ6A 2IZRA 2ZVOA 4KZ0A 3AC3A 3PJ3A 4FODA 2C5OA 4FIHA 4V04A 3ML9A 2E9NA 3QRKA 2N9PC 3N51A 3SDJA 4MVFA 3VWAA 4D2VA 2GBNA 4BCHA 3C0GA 3HP5A 3F69A 5LWMA 4EFOA 1CM8A 2R5TA 4O7NA 2NNWB 2XNNA 3V04A 4EUUA 3WZEA 2FIFA 3KN6A 2OJRA 5CLPA 5EW3A 4FJVB 3HUCA 3QCSA 4I6QA 4FKQA 5ETAA 3QK0A 2W05A 4UXLA 2KTYA 2C0OA 4IAKA 4FULA 3ALOA 2PE6B 1V5OA 1F9JA 2DUVA 4U81A 4FV8A 4BHZA 4EKUA 3MESA 2NRUA 4BHNA 3Q32A 2P0CA 5HD7A 3ORKA 2WTCA 2GHLA 1J19A 2PK9A 4O1OA 5KMKA 5AIRA 4YJSA 3OOMA 3BQCA 3M63B 1J7IA 4ZY4A 4M0WB 4EJNA 3RMFA 3GI3A 4X2NA 2CNVA 2BIKB 2WTIA 2BDFA 4MEMA 4C37A 2M1MA 1OIUA 2F7ZE 2WTKB 1R78A 3LFAA 5G6VA 3RAKA 3PSEB 4YR8A 3IPHA 1K2PA 4IX5A 3Q60A 5IMEA 3FMEA 2IW6A 3EH9A 4B99A 4ZRIA 3A7HA 2YM7A 3FXWA 1SMHA 3OG7A 4Z7GA 4ZY5A 4P5ZA 5CTPA 3OXZA 3SD5A 2R3QA 5JRSA 1TVOA 5AV1A 3E88A 1NVRA 3UNJA 2GTMA 3FDNA 3EC8A 3V6EB 3VBWA 3PIYA 3KEXA 5L2TA 2JZZA 1ZMWA 3UG1A 4V0GB 1RJBA 2WD1A 3F6XA 2W1ZA 2XNEA 5EHOA 4LL0A 4GFGA 4ARKA 4EOYA 4QMLA 4L3LA 5LCJA 5KKRB 3EHVA 3AT4A 4ZYNA 3H30A 4U79A 2I0HA 1V86A 3AULA 2KFKB 3U6HA 2MBOA 5IEVA 2ZOQA 3KC3A 1H4LA 2R3HA 3AMBA 5CF5A 2WQOA 4IG7B 1BL6A 2HENA 1RRBA 2QU5A 4ACGA 1KE8A 3L08A 2GU8A 4QRCA 3IW7A 4HCVA 1YOLA 4L42A 2Z0EB 2R3NA 5EYCA 2XVDA 3LFEA 4WUNA 1P5EA 2OI4X 1HOWA 3A7GA 2JDVA 1F0QA 2OICA 4GB9A 3ML8A 5CHWA 4PYUA 1PJKA 3DBCA 3ZUTA 1FOTA 4WNKA 3FZTA 4N6YA 2WFYA 4OTGA 4DN5A 2ITWA 4KD1A 2B9HA 3LIJA 2JGZA 1XH9A 4QP4A 4CFMA 4S33A 4WQOB 2VWYA 3R2YA 3QQGA 1SNXA 3G9LX 4X6QC 5ANJA 2JD5A 3EN4A 2PPQA 2L3ZA 4EQUA 4YUQA 5AA9A 4JDHA 5BVOA 2WQNA 1GJOA 4V01A 3QGWA 4EZ7A 2AUHA 5BUJA 3PVGA 5HU9A 4FBXA 2YZLA 5IH4A 2ZMCA 1G6JA 4IFCA 2HZ4A 4HPLB 4R8QA 3COIA 3MB7A 2L0FA 2PUNA 2UYZB 4RIXA 3CP9A 4YZDA 1URCA 1M7QA 4ERKA 3FZRA 3QUDA 5AA8A 3GC8A 2Q0NA 2VU3A 1YX5B 4H3BA 1ZMUA 2C6DA 5A46A 3R2BA 4MJSA 3KY2A 5CEIA 3HVCA 5BUEA 2CKPA 3RWPA 4PMSA 3T3UA 2XMYA 2NO3A 4JQ7A 3DQVA 4FKVA 3HYHA 4GXBA 1WRDB 3PXRA 3V6CB 3V61A 4NJ6A 1WGYA 1XKKA 3BHUA 5E6PA 2UUEA 2G4DB 4HPUE 4USFA 4L01A 2O5KA 1ZY4A 2BHEA 3HECA 3IG3A 2WOTA 5FBOA 4NY0A 2PVMA 2R7BA 3ZMMA 4HGEA 2NS5A 1H8CA 2O6VA 5HE1A 3QZFA 4UX9A 4ANWA 3PRPB 4RX5A 3BU5A 2R3RA 1FGKA 3SG9A 3PREA 4L8MA 3E7OA 2C6IA 3LCDA 3R6XA 5K9IA 4YMJA 3UPXA 3NMUF 3EL7A 3H0ZA 3PJ1A 2P2HA 3OBGA 1U4DA 2R4BA 5A6NA 3E3BX 3VS0A 3RT3B 3WZJA 1TQIA 3TBLD 3QD3A 3CGFA 5CNOA 4ITHA 3QX1A 4G3CA 3Q9ZA 4W9KA 4C0TA 3RJCA 5AWMA 4MD7E 3PLAE 2G15A 3PSDA 4JG7A 1JRUA 3PHWB 4FGRA 4RVLA 4OR5A 5EM6A 3UVRA 4EQCA 5EM7A 3I6WA 2J0MA 4YHFA 3GCUA 3MGYA 4FT0A 1GG3A 4J71A 2I7QA 3PJCA 4A9TA 2W1FA 5T3QA 5M56A 4NTSA 3V62A 4I6PA 4F0IA 3ZRLA 3FHIA 4L43A 1QL6A 3L16A 3GCVA 2O2UA 1WBOA 5AP2A 4J6IA 3D4QA 4IC7B 2ZM1A 3TKIA 1S9IA 3EN9A 5BYZA 3N4UA 1OL7A 4MNEB 5EDQA 3AC2A 5CF8A 5DYJA 4RVMA 5EDSA 3ORXA 4QPSA 2IJMA 2W1EA 4A7CA 4G6OA 3JR1A 3HRCA 2Z7RA 4AW2A 1IAJA 5CSHA 3GC0A 5JFXA 4RWKA 3RZWC 1V2YA 2BAJA 4OTQA 2OZAB 3PA5A 3DKFA 4KDLB 4FNZA 4D2TA 2G2IA 4WRGA 3K3JA 1YDRE 4MAOA 4LMNA 4W9EA 5IQIA 5DR2A 1VEBA 3VHEA 4X3FA 2G1TA 1GUAB 3GP0A 5I9XA 4F4PA 3VFKA 3PDTA 1WBVA 1P98A 2MRPA 5F1ZA 3S4QA 2BRBA 3LFNA 3C13A 2IVVA 5IH6A 4XV2A 2HOGA 3OS3A 4QQCA 4XG3A 3KXNA 1WGRA 2W1HA 3UQGA 4DITA 4YTHA 3BY4B 3W2SA 3PZHA 1YI3A 3FZPA 5AUXA 4HZSA 5ANIA 2RR9A 4EWQA 4YJNA 3BHHA 4A4XA 1A9UA 4GMVA 4G3XB 2NBWB 5A4EA 3THBA 4BGQA 4FKRA 4BBNF 1PHKA 2B0QA 1AARA 3FY0A 1PF8A 5IDPA 3KVWA 4FT7A 2FAZA 2O3PA 2A27A 5I9ZA 3IHPC 5AJQA 1UBQA 1WFYA 4M8NA 2XK4A 1IG1A 2BAKA 2EVAA 3ZLXA 3VUGA 3VQHA 4DEDA 1ZWSA 2MW5A 5IDNA 4JRNA 3NW7A 5AAEA 3QTZA 1ZYDA 2AEHA 3UIMA 4KRDA 3CPCA 2BFYA 2WDTB 4GFOA 4ZSAA 3ZO1A 4RC2A 5CQUA 2XM8A 4RG0A 4IHPA 5C1QB 4K7WA 4LQMA 3FMMA 4E5WA 4JBPA 2LGCA 2C3IB 1Q3WA 5CNNA 4HYUA 2RSVA 4II2B 4JS8A 1BT0A 3ANQA 3R9OA 5LWNA 4HLEA 2WB8A 3TZ7A 1O9UA 4CQEA 3DV3A 2WMRA 3V5LA 4D4YA 4M97A 4AT4A 3RKBA 3VBVA 1PXJA 3GQIA 5J1WA 3R7IA 3EYGA 5AZFA 4IX4A 4HW7A 2EMTA 5E6OA 4EHVA 3BCEA 4W4VA 5J2RA 2V7OA 2C5YA 4QQJA 3OUNB 4BKYA 3QU0A 1ZARA 3F5XA 2IO6A 5HORA 2VTRA 3KK9A 2MA9B 2YLFA 1VJYA 3X23A 1W98A 4ZMFA 4N6ZA 4IM2A 5FUTA 5LMKC 4G5PA 3EQFA 1CTPE 1UD7A 2Y5BB 2OU7A 5KMMA 2KOXA 1YIWA 4X21A 5KUPA 3A7FA 4DHJB 2PUPA 2VO0A 4XMOA 4APPA 3C50A 2WU7A 1OQYA 5EQPA 4R7BA 1V0BA 3COKA 5C8NA 2V62A 5AUUA 4KSLC 5JZEB 4HCUA 2JDSA 3A4OX 4M8TA 2KQSA 1L3RE 3R21A 2BUJA 3BHVA 1LXDA 3RHXA 3FLZA 4DA5A 1YXTA 2ESMA 4I0RA 2LUEA 3CQWA 4PPAA 2O0UA 3PP0A 4GDKA 1RQQA 2VTIA 4YO6A 4CCBA 5M55A 3TKUA 4YHTA 5IA2A 2CGXA 4IJ9A 4DGMA 3BEGA 4D2SA 3DJ5A 4XCUA 1E8WA 3DT1A 3MN3A 5GJDA 5FLFA 4RIWA 3B2WA 3F3WA 3ZM4A 1LEWA 2BTSA 4HVIA 3RAWA 4WWPA 4YHJA 5LQFA 3KULB 4MH7A 5HHWA 3P78A 4KB8A 5GJFA 3SHEA 3UIBA 3VQUA 4AOJA 4DHJD 5ETIA 3UF8A 3KMUA 2PUUA 2BDWA 2R3JA 2PE2A 2HZIA 5M51A 3QRJA 3L0WB 4QYHA 1SZMA 4RQVA 3QTXA 3ODZX 4JI9A 4G31A 3QCYA 3ZLZA 5CXHA 3IFWB 1UWJA 3ZEPA 3MIAA 3F82A 5GNKA 4N9F4 2R7IA 4DEGA 4L52A 3O8PA 5AR4A 1O6KA 3MIYA 4FZDB 1JAMA 5HVJA 4LOOA 4BIBA 4GH2A 1WX8A 2N7EA 3OCTA 4D5HA 2MCNB 4Y5QA 2WOUA 1XBBA 4GN1A
chains in the Genus database with same CATH superfamily
4I41A 1WBTA 5EK7A 3ZSGA 4AGCA 4ZOGA 3O5AA 4DCAA 1YRPA 2E9UA 2C3JA 3BK2A 3VQIA 5CSVA 4O7RA 1JMLA 2C5LC 4L6QA 4C61A 4AW5A 4L2YA 1UBIA 4FX3A 4TT7A 3UDTA 3PIXA 3OTVA 1H00A 3QRUA 3ATTA 3BE9A 1XLPA 2OW7A 3PVWA 4EZOA 3QF9A 4F7JA 3R1QA 3TT0A 3QD0A 2JKMA 5D7VA 3UIUA 2KACA 4TY1A 4LNIA 1ZXEA 4EZ5A 4JWUC 4AZCB 4I6LA 1VZ6A 4JL9A 4XOYA 1UNHA 3IQ7A 2K1FA 5BMGA 5AP5A 3BLBA 3E8DA 3QKLA 4UDXX 3GE3C 1VYWA 4RSSA 2PE0A 3Q5IA 1MRYA 5DT3A 2IZSA 2FIDA 3S2PA 2YIBA 1TKGA 2NVUI 2IO1B 4FSMA 3CCNA 4TYHB 4HEA1 5BYQA 3AMAA 3FAAA 2RSUA 1JKTA 4YC8A 1P3QU 1FM0D 5IA3A 2N9XA 3L9LA 1PMVA 3H8HA 4R3DA 3VC4A 4YBKA 2IGHA 3LJ2A 4K7UA 5FG8A 3BUPA 1CSNA 5J95A 1WI0A 4B8LA 3EJTA 2XIXA 3AD4A 3L9NA 1MHXA 3SD0A 5DHJA 4ENYA 4M02A 4Q5HA 3CC6A 2LGIA 5CSPA 1OL6A 3H6NA 4NIFB 5HO8A 2C68A 3ODYX 2V3SA 5L6WL 4D4SA 1FMKA 3WF9A 4AJYB 3FJQE 3H9OA 4IZAA 4H58A 1OEYJ 4MBIA 2GBRA 3M11A 4QPAA 3K9OB 2YDIA 4RRVA 2F2UA 2NPQA 2MQJA 3PZ8A 5FWKK 1R34A 4LRKA 1MHHE 3PY0A 2VGOA 2BW2A 2WDRB 4PL4A 3DBHB 1FVTA 3ZH8A 1YD8U 1R5EA 1FQ1B 3DK7A 2WQBA 3WE8A 5E92A 3QBNA 3CQEA 3I60A 3BVUA 1H1RA 4GLSC 2QONA 3OBJA 4W9WA 4FK6A 2IJ0A 3BL7A 1MQ4A 3TUCA 2YL9A 3EJ1A 3MSSA 1E8ZA 3IDCA 3HUBA 3NNVA 5LVOA 3LFBA 3RM7A 2K0PA 3QRTA 2ITXA 3R8PA 1WM2A 5IA4A 3NAXA 4BDBA 4XUFA 2G4SA 4YJUA 3E9SA 4IM3A 3EN7A 2QKWB 2WMAA 3GU4A 2NCZA 4QDVA 1XH4A 4EYMA 2K39A 4MNEA 4AP4C 3O17A 2QLQA 3O13A 1B1ZA 4RNAA 4HJKA 2VX3A 1YN4A 4TQ0A 1R4MB 1Q8WA 4DFUA 5CEOA 3HV4A 3NUPA 2WINM 4F70A 2R0UA 4CD0A 2WQYB 4EE2A 2EWAA 4D5KA 4A4LA 3MVJA 5HICA 2BWFA 3MVMA 3QLGA 2EB2A 4M12A 3TZ8A 4CQGA 3IDBA 4CG8A 3FEGA 1PXKA 1UU9A 1G8KA 4BOZB 3LLTA 1V5TA 5IKWA 4EOLA 4FSNA 4PDSA 4AGUA 4H1JA 1UU8A 4MBLA 1KF6B 2F1BA 1HCLA 3PHXB 2X8DA 5M4IA 4NM7A 4OLIA 1DKXA 4ZOHC 4GT4A 1W84A 3DK6A 3KRXA 3OC1A 4EUTA 3UE4A 3M1SA 5BVWA 2KWVB 1ET6A 4HNIA 3B8QA 2KAJA 3E64A 4DEIA 4MBJA 4JX3A 4PL3A 5LCKA 2X0PA 4FIGA 4OUCA 3CSVA 2OZOA 2IO3B 1WFCA 2CN8A 3N9YC 1YWRA 4L9IA 5M57A 4AWJA 3URYA 2QOIA 2YKTA 2B9FA 2NRYA 4JQEA 4ZSGA 3HK0A 2K8HA 2OOBB 2V9HA 3DKOA 4E93A 4FR4A 2PE1A 2HAKA 4HVGA 4KBKA 4AXDA 4NAWA 4BDJA 2IWIA 4P6VF 4HROA 4AZSA 4FRFA 5GZAA 4G3GA 3W5VB 2JY6A 2XAOA 4BYJA 2C6LA 5IQCA 4K77A 5DN3A 5EE3A 1GC7A 2CHWA 4C4JA 5L2QA 1XD3B 3NUSA 4BIEA 3FI4A 4LDTA 4FZ6A 1M2RA 4LRMA 5EYDA 1VZ8A 3U55A 1E1VA 1H0WA 3RPFC 5FRIA 3QHTA 3CBLA 3V6RA 1GC6A 2R0IA 3A4SC 1ZDXA 2KFJA 5HE0A 4FI1A 5ANEA 3CY2A 1REKA 3F2NA 4XG8A 2K8BA 4ORKA 3BBWA 3ZO5B 5F94A 4R1VA 4NKAA 3NYXA 2H89B 2C1BA 2RG5A 4P5QA 5HKMA 1E6EB 3LKMA 3R8UA 4RQKA 3VO3A 3U54A 2WX1A 3OJ3A 1MQBA 3O50A 4JQWC 4WKQA 3UJGA 2FUMA 3MH1A 3KAVA 5CHFA 4F9AA 4GIIA 1TQSA 2FCMA 1R0PA 3NSZA 1OQRA 3EQGA 4YZ9A 4JBVA 1Q97A 4M13A 4K6ZA 5KZ0A 4HYHA 3R7YA 1OECA 3ZO3A 4NEUA 4H6IA 3AXCA 4HCNB 3WIMA 1I4QA 1WRIA 3FE3A 2L8JA 1E7PB 3U8WA 4KSKC 2X9FA 5B2LA 3DZOA 1F52A 1MG8A 4FEQA 3GUBA 3MHSD 5J9YA 2FA2A 4HDQA 4MH8A 1OBDA 3LMIA 4H36A 4I0SA 2XANA 4Y8DA 2PJHA 3UMWA 3UQCA 4LI5A 3N4TA 3L17A 5HG5A 1WZYA 2QVSE 2C3LA 3LQ8A 2PUIA 1FXTB 3BYMA 3CTQA 4EZQA 4CV8A 1Q8YA 3DS6A 2INDC 2D2QA 3VF8A 5AP3A 3H3CA 4GUBA 1OIRA 5CI7A 3SDLC 3MV5A 5JK3A 5BYSA 2R3MA 5G1XA 2L0TA 4X57B 2V0GA 4KUJA 1UF0A 4FC0A 4EH4A 3RNBC 2BKKA 1UELA 4GCJA 3VH3B 4IZYA 2Z2WA 4KWPA 3HMPA 1CKJA 5CTRC 3DLSA 2IEWA 2ACZB 3AXWA 4W4YA 3QWZB 1P4FA 3WAPA 3H4JA 1OGUA 4MXAA 4WNOA 4C02A 2N3KA 5BO4B 2AQ2B 1R4MI 1AD5A 1W2DA 2XZSA 3A33B 4YURA 1P4OA 4YP8A 4AZTA 3CTJA 4ANNA 3VJNA 3QAME 2X8EA 3W0NA 3UDBA 5DPSA 1APME 1RLFA 2CS4A 3JY0A 3TNIA 4XP0A 4I1ZA 1XH8A 3H7SA 1U5RA 3OHTA 2JBPA 2X0OA 4GVJA 5I3OA 5TKYA 4DXAB 1TQUA 4GDLA 4NNJB 3EFUA 4XG4A 3TV4A 4CYEA 4MX9A 3FC1X 1OTRB 4ZS0A 4Y46A 2D10A 1P2AA 1K53A 1ZLTA 4MSQB 2IW9A 4ZTMA 3G51A 1I49A 4KBAA 2ONQA 4UMRA 4K11A 2UZNA 4BCJA 4GRBA 2OBLA 4BGHA 1GJZA 5EM8A 1TBEA 2B4SB 1B9RA 4FE2A 3AEAB 2CHXA 1IGCA 1H8FA 3RGFA 1VR2A 4XZ4A 4FEWA 5HNGA 3W18A 3R9NA 2Y6OA 5JZJA 3EMGA 2R3IA 5IUHA 4FSUA 1M2QA 4ITJA 5ICPA 4IAZA 3NUXA 1CJEA 3BWJA 2WX0A 4BBFA 3S1HA 2R61A 4I5HA 5D3DA 2V0DA 4I92A 2BS3B 3VTUA 3MPTA 1GOZA 2OFUA 3CKXA 3VS3A 5J18A 3W8QA 3PXQA 3RNEC 1J7BA 4QQ5A 3HM6X 2B55A 2ZJWA 3AE3B 4ZS4A 1Z2MA 2YLLA 2RDHA 4AZGA 3KXMA 5CAOA 1XCQL 4KZCA 1A48A 3MC9A 4BKJA 2DX5B 4O4EA 2O65A 3HNGA 2BIYA 3E93A 4FT9A 5D94A 5E4HA 2HD5B 4C7TA 2QOCA 5L2IA 2YEPF 4Q2AA 4HYIA 3QWKA 4IM0A 1V1PB 2J4XA 1OI9A 3VR8B 4O27B 3EQHA 5AP7A 3FPQA 3TL8A 4UMPA 4X2FA 4L68A 4JAIA 4TYHA 4BY9E 2XBAA 1F2RI 4CKRA 2JZPA 5L2WA 4D28A 4GIHA 1HA5A 1OITA 3SC1A 1YQ4B 2KZRA 5C26A 3A98A 3BL9A 3ZZEA 2ALWA 5DA3A 4NM5A 2DZKA 3C4EA 3SYVA 4HGTA 4X2JA 4YSJA 3Q6BA 3O8UA 4XP2A 3NAYA 3LMFA 4IDTA 2QOOA 3C7QA 2XNAC 4C56C 1CMKE 4A9UA 2PMVA 4XBRA 2F7XE 4XOZA 4QAYA 2K6QA 4A3OA 5FM3A 4RIYB 2RL5A 4YLLA 1KV2A 3W2QA 4R1YA 2BGFA 2MBEA 2OF2A 3RPYA 4XG7A 4CFXA 4J96A 4EZ3A 1RW8A 4A4OA 2PEAA 2F4JA 3IW6A 3P5JC 3PA4A 2ZAZA 1GOLA 4NJ3A 1J7UA 4WAFA 2QHNA 3OEZA 4TYJA 4DFYA 4UB7A 5DH3A 3MFUA 5KNJA 2UZEA 3C0IA 3QQKA 3F5PA 4MWHA 1HZ6A 4B9DA 4NU1A 3NG0A 4UN0C 4KX6B 2VWXA 1R1WA 4GYIA 4JWIA 5IA5A 5EHYA 2O8YA 2PMIA 4GEOA 5CYIA 5AUYA 5E6JA 2DAJA 5IQAA 4ZTLA 3ZHPC 3E87A 4MUQA 3WZDA 4CXAA 5DE2A 1I4DA 2JDOA 4FG8A 4YL8A 3R9DA 4OZBA 3A61A 4RF1A 1URWA 3HV7A 3LFCA 2L1AA 2CCIA 1H28A 1UUPA 4ZLZA 3ZGZA 1L0XB 4FEVA 3VUDA 4M68A 5DWRA 3D7ZA 4ZJJA 2CKHB 3SW4A 2RFDA 1JROA 4EK3A 2GS6A 3MPMA 4BBMA 3V3VA 3F2RA 2DZJA 2EELA 4BOSC 3EUB2 1STEA 4LNFA 4O1PA 2XUUA 4NW5A 1AGWA 4C62A 2Z8CA 3FMNA 4DH8A 5H8YE 2J7QB 2YCQA 2R3PA 2FSLX 4EOMA 2PTKA 3IT6B 3BWFA 3H9FA 1NW1A 4BFMA 2F57A 2TSSA 4OVUA 3W55A 4S34A 3BKBA 4A07A 2JZ3B 4UYAA 3VAWA 1Q24A 3BI6A 4M69B 1NYRA 2DZIA 3F88A 1XCTL 2CKOA 2LGSA 3COHA 2PY6A 3BUDA 4M67A 3JXWA 1GZOA 3TI1A 2KXJA 4YJRA 4FTCA 2YIQA 3FMDA 2DWQA 4LM5A 3AU4A 2K22A 5A9UA 1LP4A 2R3FA 5FQDC 4MNFA 3I3TB 4U3ZA 1X8BA 4C2WA 2WYHA 1O6YA 2A19B 4EZZA 2J6MA 2LXCA 3Q8AA 2HXLA 4M01A 2UZUE 3U2SC 4YBJA 5CAUA 1OPLA 2CKEA 3NVMB 2WIPA 3KA0A 4LV5A 2BTRA 2AL6A 3Q2MA 5FTGA 3G5DA 4FSQA 2QKRA 3VW8A 3AG9A 3MFTA 4EWHA 1UNLA 3SOCA 4MDKE 4CMTA 2C7MB 1IYFA 3QZHA 3NOBA 3VUYA 3TN8A 2I40A 3EL8A 1R0EA 3QTIA 3KF4A 4GT3A 4ZK5A 3R9HA 4YLKA 2HY81 1L0VB 3RNGC 2QDFA 2O0I1 5TO8A 2B7AA 2IYDB 1E8YA 4IBMA 4PUZA 4HVHA 1XF5L 4YSYB 4GOCA 5KHXA 3QC8B 2JRHA 3AC5A 1SU8A 4EZVA 2ETMA 3DB8A 1MVKA 5C2TB 4K8AA 2X5CA 2WU6A 1SE3A 2UW5A 3FHRA 3C19A 4F99A 3PLTA 4FBJB 4MQ2A 5BYRA 3TV6A 3LJ3A 4MM3B 3BYVA 3U6IA 2UVXA 3D2KA 3GZNB 2V22A 3AB5A 2XK5B 4FSRA 1WXAA 3FKNA 5D6JB 4KDIC 1NBFC 3QLFA 3DHHC 1OUKA 1BUIC 3CZSA 3ZW3A 1RDQE 4BRXA 3HKOA 3ZJVA 3V51A 4W4XA 3OTUA 4GGQA 4K7SA 2R3OA 1N60A 2C08A 1KJTA 4TKNA 1UNGA 1FNUA 3ZFMA 3UBDA 4ZEGA 3ZNZB 2C69A 4RJ8A 1SGHA 3GOPA 5HG7A 1ZXIA 1PMUA 4E6CA 2CSNA 3VUWA 2W9NA 2WXVA 1YDTE 4XE0A 1CDKA 4EORA 3HAJA 4FV5A 2YISA 3DYTA 4BWKA 3D52A 3R7OA 4FNWA 5FIGA 3R30A 3ITZA 4E26A 3ATSA 5CALA 1Q1OA 1YJIA 3AEBB 4OAUC 4HXDA 3WAOA 2YIWA 4RBLA 5LVLA 4ANXA 5AV3A 4Q5EA 2Y4IC 2OW3A 3BVWA 3QQLA 2CU3A 4MXCA 4XHKB 5I9YA 4P1BC 3BVTA 3DPDA 2KULA 4XV1A 3B52X 2UVYA 2HE7A 2MBHA 4BDDA 5K4IA 5C5BB 4G6NA 1DKZA 4I6BA 3O7LB 2X4FA 2WZJA 1NT2A 4G0NB 1W9MA 5I9VA 4IMYA 3OD6X 1FNVA 4AZ6A 1WE6A 3CJGA 3BU6A 1U59A 3DY7A 4S2ZA 4X6RA 3EQPA 4K18A 3RNCC 3VH4B 4FTKA 3WE4A 4C4GA 1G8AA 4N57A 5FTQA 2UW6A 3QZGA 4ZAUA 3HHMA 2NPTB 3LB8C 2VTPA 2G45B 2EX3B 2HK5A 3PPKA 1FIQA 2MH7A 3L9PA 4DHZA 4UWBA 3QHWA 2ZV7A 5H2UA 4DC2A 4APCA 1MFWA 5KCVA 3MJ5A 1YQJA 3Q8FA 5HD4A 3PIZA 5JRQA 1JBPE 4PO2A 3JW0X 3MY5A 4AT5A 2KDEB 4FA6A 1YWVA 4CFFA 4PRJA 4DT8A 4CTBA 3CXWA 3UQBA 5C4KA 3REPA 5HIEA 5E8YA 5KO1A 5DI1A 1ZOYB 1ACCA 4O21A 2MP2A 4EH9A 4FSZA 4QMTA 3P42A 4YZBA 4CYIA 1NVQA 2B76B 2MBQA 4B0GA 4FIFA 4O83A 4E6QA 5L6PA 5AP4A 3BINA 3VS7A 5C23A 3A8XA 1UWHA 1JALA 3O7LD 4EONA 3RV0A 1OL1A 1IUEA 3W10A 2UWQA 2Z60A 1DOYA 2VRRB 3QRIA 1T0RC 2WO6A 3JUHA 1JNKA 3H7PB 3BPRA 4DG2E 4E71A 2YLEA 2CNQA 4L00A 2N9KA 1PYWD 4AX8A 1KLGD 4D0WA 2JYEA 2X0GA 5IMXA 4UMTA 5HQ0A 2LD9A 3HRFA 4OTFA 2VTQA 1EU4A 4RGMA 4P90A 4FV3A 3AE9B 3NPCA 4ACHA 1ZP0B 2QILA 4JLCA 4BCKA 5KBRA 2BZKB 5CZIA 1WJNA 2A5UA 2WTWA 4NZWB 4FTUA 5CS6A 4R3PA 2L76A 2HW7A