4IM0A

Structure of tank-binding kinase 1
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
659
structure length
619
Chain Sequence
GSMQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRNIKPGNIMRVIGEDGQSVYKLTDFGTEEYLHPDMYERVLRKDHATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVMEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Tank-Binding Kinase 1
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase TBK1
total genus 208
structure length 619
sequence length 659
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF18394 TBK1_CCD1 TANK-binding kinase 1 coiled-coil domain 1
A PF18396 TBK1_ULD TANK binding kinase 1 ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4im0A02
1.20.1270.420 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4im0A04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4im0A03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4im0A01
4IW0A 4W4XA 4BYJA 4FKTA 4DH8A 5AAGA 3II5A 4IXPA 3DVGY 4DFUA 4KB8A 4KKGA 3RALA 2XK8A 3DLSA 2DYBA 3UC4A 4X3FC 3KB7A 4QP9A 3QLFA 3R0TA 1OKWA 4WA9A 5F20A 1SMHA 3OROA 3CPBA 3DAEA 2PSQA 1NVQA 2CN8A 2ZAZA 3E5AA 3Q6UA 2V7AA 3OBJA 5EHOA 4AW1A 4D2RA 3A33B 3D15A 2B54A 4N6ZA 3HM6X 4RPVA 1A5RA 4DBNA 4DCAA 1GG3A 4RZVA 4ONAA 5I3OA 3QK0A 3QAQA 3OVVA 4F65A 3WZKA 3VUHA 1NXKA 5KMIA 3H1UA 4O1PA 5IA0A 3HA8A 3WALA 4F9AA 2QOIA 4M12A 5IQDA 4ANBA 3FV8A 2QU5A 3HGKA 4RIWB 1UA2A 3BHVA 3L9NA 4B6WA 3EN5A 4IC7A 2YVCA 4O0YA 3E3BX 4UWBA 3MESA 2KQSA 1P0RA 3D4QA 3MY5A 3VXWA 2FA2A 3L8VA 4YHJA 1O9UA 1WFCA 3C4WA 4L46A 4CKRA 1H25A 4PDOA 1MG8A 2L7RA 4B6LA 5JH6A 4LMNA 4F0FA 4BKGA 3QUDA 3ZLYA 4GKHA 3PLAE 1KE5A 5FDPA 3DGKA 2KD0A 4MGIE 4IZYA 2YM3A 3RNIA 4ZRIA 3ZDMC 1OEYA 2FIFA 4JBOA 4M13A 4BBMA 4EH9A 5EI2A 1QCFA 3IGOA 3SX9A 5JT2A 2K6QA 2RFNA 4BZOA 4BTFA 4KZ0A 3U87A 4NZWB 4TWOA 4ANVA 5GJFA 3HMPA 2OBJA 2V3SA 1YWVA 4R77A 3KVWA 5E9EA 5E8SA 4X2JA 4MXZA 4ZOGA 2PMOX 3WF5A 3GFWA 4YR8A 5IMEA 3HP5A 1SVGA 5K0XA 4IUMB 2JITA 5DMZA 3FI8A 5AP3A 1TBEA 1ZMUA 2F49A 4O81A 4W9FA 3LXNA 4Y5HA 4CYEA 1IRKA 4CFFA 2IZUA 5TOZA 4C7TA 4HCTA 4EK8A 3NCGA 4NCTC 2D10A 4EEVA 2PE9A 2NBVB 3DFAA 3FL4A 3OP5A 4USFA 5KMNA 3KMMA 3ORPA 3ROCA 2NR2A 3FZOA 4YL8A 3ZTDA 3R63A 1WCCA 2GHMA 5C9CA 2C4GA 2OZAB 2ZZPB 2QKRA 2VV9A 2R3KA 4NIFA 3RPSA 3SKCA 4F4PA 2PL0A 3P7BA 3Q4CA 2XM8A 3A62A 4MF1A 4A06A 2L76A 4BOSC 5KMOA 4ZDVA 2ZMCA 4LRJA 3BYVA 2W4JA 4IDTA 2BYVE 4O0TA 3N32A 1R78A 2ZVNA 3DKFA 3DZQA 3EN4A 5L6WL 2K6DB 3VS1A 2AEHA 2XZSA 4F08A 4DHZB 3ID6C 2KDIA 3A61A 2XVDA 5HNGA 4AWJA 3TV7A 4RZWA 5CI7A 2Z59B 3M2WA 5FGKA 1OL2A 5IG1A 1R0EA 4QRCA 2MWSB 2YM4A 3QKLA 2W1DA 4EOPA 5CTRC 5HO8A 3R7RA 4BCIA 4B9KA 2HIWA 4MQ2A 5HTBA 5CU2A 3VS7A 1M7NA 3PDTA 5FTQA 4IJPA 4BDDA 3BYSA 3R73A 2ZDUA 4QMPA 3UINB 3FLWA 2FB8A 2ACXA 4EHGA 5HX8A 5AR8A 4TWPA 2C7MB 5FXSA 1GZ8A 2DS1A 3LCDA 4WRSA 4K1BA 3KK9A 4XX9A 3ENMA 4DWFA 2BZIB 3GC9A 3PPKA 2DWBA 2RFDA 4D2VA 2ZV2A 5JKGA 2HENA 2RFSA 4XYFA 2PUIA 1ZOHA 3Q60A 4CFNA 1OI9A 3R8VA 3Q3FA 1LP4A 3MTLA 2BALA 5L95C 4NIFB 2GMXA 3ZZEA 3PP0A 2KWUB 3BYMA 2PEAA 3ZSGA 1V81A 1WX8A 2VTQA 3UQAA 3WF8A 1WJ4A 5HEZA 5KNJA 3HL7A 4WG4A 3ZVVA 1ZMVA 2E9VA 5AMNA 3VH4B 3LM5A 3QTZA 4IIRA 4CD0A 3R8LA 2GNHA 2C0TA 3PLVA 3W32A 5C23A 3NPCA 4RIYA 1BYGA 1IR3A 4J71A 3MJ2A 5J9LA 4I6QA 4W9LA 3GU5A 3CY2A 3JYAA 4MXCA 4RIOA 4U3ZA 4BCJA 4E5BA 4EH7A 4R8QA 2I1KA 1YI3A 3PYYA 1Q8TA 5EW3A 4FGBA 2N7DA 2ZEQA 1WGHA 2R3LA 3BU3A 3LFFA 4PQNA 4ANNA 4ANSA 3A7HA 2RL5A 3FZRA 4QYGA 3ZMMA 4BCQA 2CHXA 2K1FA 1G5SA 2V7OA 4MNFA 3NIEA 3TKIA 2R5TA 5AP1A 3CSVA 3KXMA 3R21A 1C1YB 3LJ2A 3DAJA 4PPBA 5T68A 4EZ7A 1E7UA 2YIYA 3LXKA 3NEWA 4MNEB 4BTJA 1ZXEA 4ZY4A 5M06A 3PIYA 4ZTRA 5IUGA 1Z5MA 1OKZA 4FTQA 4D2TA 2KDFB 2IY1B 1W8CA 4FTMA 5HORA 3MFRA 4YC3A 2W96B 1AQ1A 2XJ0A 3EN9A 4JNWA 2DYLA 4ZSEA 2XIRA 3RZWC 1YRPA 3MY0A 4YZDA 3U7DA 2P4IA 1T0YA 4FKRA 4WNOA 4B7TA 3UNZA 2KDEB 4RMAA 4W9CA 4YP8A 3F7ZA 4BHZA 5FR6A 4XV1A 4FNZA 2R3JA 5FBOA 4NL0A 5KHQA 4K2RA 4ACDA 2UZLA 3LLTA 2J0IA 3L9PA 4FKUA 4CFUA 2X2MA 4R6VA 4NY0A 3HV5A 1FMOE 3OXIA 2JKQA 4KABA 2IG7A 2ZV8A 2QO7A 3QGYA 3VW6A 4WWPA 3A4OX 4C38A 3JY0A 3MJ1A 3NLBA 2J2IB 3G6HA 4HYIA 3SXFA 4MXAA 2M1MA 5E8YA 3UGCA 4WT6A 3OC1A 3PPZA 2A0CX 4L45A 4ZSJA 3ZBXA 3EL8A 4JAJA 4CFMA 4KKEA 5IF1A 1VD2A 3NDMA 5DR6A 1NDDA 3DBLI 2XJ2A 4YJUA 5DRBA 1T46A 1K8RB 3N4UA 3K2LA 4QMUA 4AA5A 4YJRA 1E1XA 5AR5A 1PYEA 4S30A 4QMWA 5FDXA 5J5SA 2G01A 2C6TA 3D7TA 3FMJA 3SA0A 1BI7A 4ICUA 5C4LA 1XO2B 2YZAA 2A19B 3EFKA 2J7TA 3HMMA 3RWPA 5GNKA 1OMWA 3IDCA 4C8BA 4FKWA 4TN6A 2ETRA 3AMYA 4JDKA 1GZOA 4QYHA 3V6SA 4C61A 1OQYA 2UZUE 4H39A 2KTRA 1GZNA 3LJ3A 1WM3A 1W0XC 3BKBA 2O6VA 4FZAB 4DBGA 3V5PA 4O27B 3MV5A 4F1TA 4KD1A 2GBKA 3ZW3A 2R3MA 2OXDA 3GU4A 4GL9A 4L7FA 3ZSIA 1EUVB 3D5WA 4JQWC 5EW9A 2W1IA 4J6IA 4Z16A 2YLMA 3DKGA 4M14A 4GK2A 1P4FA 2FSMX 3OY3A 3DPDA 2HELA 2BHHA 2WX1A 4TY1A 4L9IA 3K3JA 3QA8A 4ZTLA 3O8TA 3M11A 1KJTA 2Z0DB 3GC8A 4DGOA 4MD9E 4DFXE 1T45A 4RJ7A 4BKZA 3HK0A 5K0KA 5EHLA 5CY3A 4IB3A 4AP7A 2UW9A 2R4BA 3LFBA 2WMVA 4V0GA 5DNRA 5BYYA 3MHSD 5HG9A 1WGDA 2IZRA 3HUBA 2W4KA 2WNTA 2YLEA 5DHJA 4OTQA 5L6PA 2IBIB 2L05A 3CSTA 3GGFA 3EB0A 3AC2A 3R8MA 4HVBA 5AWMA 4KZCA 4NPNA 4YJOA 4E4NA 4RJ6A 5EQYA 1DAYA 4FTKA 3OFMA 3ZNID 3C4EA 5IZFA 3QWKA 2JDSA 1VYWA 3NS9A 1J19A 3KY2A 5ITAA 2ESMA 4G3DA 4O0XA 2ONLC 4Y95A 5H2UA 5KUPA 2J0MA 4ACMA 5AJQA 2ITZA 5CSHA 3I1AA 5IEYA 4W4YA 1YXXA 3ZU7A 5IUIA 2W5HA 2V0DA 3KXHA 3QTWA 3R00A 2BKFA 2V1YA 2ZVOA 4G3CA 4ZZOA 2CR5A 2VZ6A 1WM2A 4P5QA 4UEUA 2BFXA 4D2PA 2MX2A 3THBA 4GFOA 4YNOA 3BGZA 3RHXA 5HZNA 4W9IA 4JG7A 3PLSA 5IEVA 4EQCA 4GMYA 3QCQA 4MWIA 5GINE 3PVBA 1OM1A 1U4DA 3EC8A 3D2IA 4HCPB 3UMWA 3F5GA 1S9IA 4G31A 3LKMA 4J1RA 3A99A 3DNDA 4OBOA 2KN5A 1SIFA 2KX0A 4FG9A 5D10A 4MYGA 1V80A 5EQEA 5I9XA 1NI2A 1NT2A 5FLFA 2VAGA 3MS9A 3UJGA 3ZC6A 2QOCA 3UIOB 4EH3A 3OJ4B 4XZ4A 2Z60A 3OBGA 4TW9A 1YWNA 1CDKA 4RX8A 4R3RA 1G8AA 3CQEA 3KEXA 3DJ6A 4OGRA 4JJRA 3QGWA 3MVJA 4RVMA 4FJYA 5AR3A 3GT8A 1LPUA 2OJIA 4XP3A 3W1FA 4GDLA 1RJBA 3PZDA 4WJOA 4EEWA 1Z57A 3PVLA 4EOQA 3WA0A 5CENA 5A6NA 3EYGA 5CASA 5HNBA 3NY5A 4AE9A 4XLVA 2C3LA 3OCSA 4GYIA 3NS8A 3PWDA 3KMWA 2YIXA 2QG7A 4O6LA 3QCSA 4RQKA 1U5QA 2YM7A 3SW7A 4JDHA 4G50A 3AD4A 3A2CA 1YWRA 4TYGA 4LM5A 3UQGA 2WMWA 2ITOA 3VAPA 4QP8A 2F9GA 3RUIB 2B9FA 4TYJA 5E8XA 3ZEPA 1R0PA 2KMAA 3LFDA 5HTCA 4BFMA 3DY7A 1SYKA 3KRWA 4CYIA 4KV2A 3QTRA 5AA8A 2LUEA 2QLQA 3IQ7A 4FI1A 3PXKA 4LUEA 4QTBA 5BX0A 4FSTA 4IFGA 2CLQA 2HW6A 2P33A 1R4NI 2LGDA 2C5VA 4G1WA 4YSMA 2XK7A 1M7QA 2YCFA 4WHZA 3TIYA 2QONA 2BR1A 4F63A 3V6CB 2LJ5A 2XNPA 2KZRA 5CF4A 3PRZA 3HV7A 5BVNA 2HXQA 2DZJA 4BTKA 3IKAA 4ITHA 4IX4A 2J0JA 1CSNA 2XIKA 3DQWA 4GSWA 4KSLC 3U30A 4JDJA 3TEIA 1OVEA 1GY3A 3I0QA 3KCFA 5L8LA 4DFLA 4O91A 4PPAA 2JLDA 4L7SA 4RA4A 3OTUA 3FQSA 4IB0A 4WRGA 4IC8A 2RGPA 4FSYA 3OXTA 2QURA 3KREA 5KHOA 2KOXA 3G33A 4AZTA 3LJ1A 4QTEA 3VULA 4YURA 2CHZA 4A9TA 5D1JA 3E7VA 4NM7A 3BV2A 4ZLZA 4HVIA 3NMUF 4NW6A 3QF9A 4W9KA 4DH3A 1QL6A 4FV8A 1FXTB 4F7JA 3JY9A 1G8SA 4WJQA 2QHMA 3W1SA 5M44A 2KJHB 2XCKA 2GQGA 5BNJA 4MEMA 1UNLA 2QVSE 2WPAA 3OWPA 4NCTA 3NW6A 3I3TB 1YX6B 2CKPA 4ASZA 4MSMB 4GCJA 5CTPA 4HDOA 2FO0A 2ZM1A 2JUOA 3FMEA 2C3JA 4CXAA 5M09A 3IPHA 1M2PA 4FSRA 2WQNA 4IH8A 4M68A 4XH6A 3M62B 4IWPA 3WAOA 3E92A 4LRMA 5DT0A 3GU8A 1JKTA 3F9NA 5E92A 4C62A 1ATPE 3MPMA 2VX3A 2AC3A 4D1XA 5K5XA 4AN3A 4C2VA 3OT8A 2XKEA 4F1MA 1S3SG 3S1HA 5CZIA 1TZ1A 2WO6A 5KBQA 4ACGA 5J17A 3R1YA 3QWJA 4EH6A 3KUCB 1OL7A 2KTYA 5ANIA 3S00A 4YZBA 3KYDD 3P1AA 4XX5A 2VTLA 4EHEA 3TI1A 5EM7A 4HCUA 3GB2A 3EZVA 4CTBA 4TUUA 2ITVA 4RQVA 4C35A 3H9OA 4E20A 4QPSA 3TDWA 2QR8A 5C01A 3ZLXA 3TNIA 1S1QB 3ZUVA 3RP9A 2O6VD 2Y6OA 4YNEA 3EKKA 2KJ6A 3I81A 3O2MA 3QBNA 3QUEA 4U81A 2MSED 1P9DU 5GJDA 3MH0A 5HE1A 2RG5A 2JVCA 4AOFA 3PTFC 4KIKA 3ITZA 2WWZA 4A4LA 1WI0A 4FV3A 4A9RA 2VD5A 3QQJA 2UW5A 3HV6A 3DBHI 5DLSA 3EJ1A 3R9HA 4FE2A 2XK4A 3FL5A 4N4SA 1GZKA 4ANQA 2PU8A 3R9OA 4QYFA 3KRLA 4HGEA 3HKOA 4FF8A 4DH1A 1XBAA 2WMAA 2CKQA 1QPCA 4DEDA 3QYWA 2DZKA 1OECA 3TL5A 2QOBA 2YHVA 3C5UA 5ANGA 3G5DA 5BVKA 1M52A 3SW4A 4Q5EA 2DX5B 1HCLA 4JBPA 4KAOA 4RJ3A 5EI6A 3ZONA 3DOGA 4JG6A 3QRIA 4O1OA 3UZTA 3O8UA 3QIJA 4FVQA 3ZEWA 2ZOQA 1Y6BA 3DBRI 3H7PA 3E62A 3F2RA 4ENXA 4DFZE 4UX9A 2P55A 3DQVA 5HU9A 4NKSA 4EK5A 4J96A 2CCHA 4MBIA 4YUQA 4AGWA 4LL5A 4XHKB 3EN7A 3L1SA 3O96A 1KE6A 3L9MA 2Y4PA 5C03A 3DNEA 2PVNA 4AT4A 2C69A 2EVAA 1ZLTA 3MH2A 3B2TA 4DTAA 1KWPA 3D7TB 4IC7B 1L8TA 1I09A 3ZC5A 4ARKA 5I4NA 1RW8A 1K3AA 4DXAB 3PRFA 4BR3A 4MVFA 4DF3A 2F57A 2JRIB 4M66A 4LCDE 4WIHA 4YTHA 4H3PA 4P4CA 4DTKA 5CEPA 3GCQA 2KXJA 2ONLA 3UNJA 4AU8A 4M8TA 1SVHA 4DHFA 3ZNGC 5CEQA 4RFZA 2CPKE 2C47A 2HZIA 2UZOA 2OWBA 3VTVA 4M8NA 5FEDA 4FG7A 3U54A 4I20A 5C27A 4FYNA 2X4FA 3NNWA 5J7HA 5J9ZA 2LVPA 2JFMA 4NQLB 3VFKA 3FKOA 3HYHA 3EIDA 4WNKA 1ERKA 2C6IA 3DFCB 4LDTD 4WD5A 3TM0A 4QNAA 3FZTA 4XG8A 3ZBFA 4UY9A 4HWIB 4CVAA 2VTTA 3K9PB 3CY3A 4JRVA 3V5LA 4QYEA 5CX9A 5KX8A 2OJ9A 2PZIA 4FV0A 2CNVA 5AR4A 3A7JA 3R66C 4QMSA 2JC6A 4D4YA 1OB3A 2VWXA 3I79A 4KSPA 4HOKA 4XG4A 1WMHB 1BI8A 3QARA 1WMHA 4F99A 2ZNVB 4E6CA 3ZUTA 3R04A 4A4OA 2KVRA 4MK0A 3BHHA 4AWIA 2BILB 3MSSA 5ANEA 4U97A 4HGSA 2BYEA 1OUKA 1WBVA 2N1VA 4HZSA 5JGDA 5ETFA 1LFDA 3FUPA 4K7WA 3PHWB 3O50A 2VX0A 5IDPA 4FNXA 3LIJA 3KRXA 5CEMA 1WF9A 2UYZB 2R3PA 4NM0A 3U55A 5F95A 4IAYA 2QC6A 4J99A 4GU6A 1PKGA 4W9WA 5F94A 4PTCA 4DBXA 2PVYA 3B8RA 4FZ6A 2LZ6A 2B7AA 2JAVA 4HPTE 4RIXA 4HVDA 2X8EA 4FSUA 5BYLA 2WYQA 3RBWA 4LV5A 5H8EA 2AL3A 2XMYA 2Z02A 4LFIA 4FT9A 3V5JA 3PXQA 5J9YA 1WGYA 4RM9A 2KFJA 5DA3A 5AZFA 2X7OA 4OT6A 4NAWA 3WE4A 3NAXA 1OBDA 4S32A 3AC4A 2JKMA 4GT4A 4I6HA 2WIHA 3QLGA 4DFBA 2BDJA 3R7OA 2PYWA 3N4VA 4HYHA 5CEOA 3WOWA 4BDBA 3FZPA 1LEWA 1WZ0A 2VU3A 2KK8A 3GOPA 4I6FA 3EFUA 2DYOA 2LRWA 4FV5A 2EUFB 3RJCA 5FEQA 3A9JB 4Z9LA 5BVOA 2IZSA 2OIQA 5CHFA 3V62A 2GBMA 3DK3A 4F8CB 4O86A 1STCE 1UKHA 2HZ0A 2JIIA 2QG5A 3KF4A 2HK5A 5EG3A 4AZWA 4CQGA 3AU5A 4DDID 2BFYA 4M0ZA 4QP3A 5BQ0A 3IDPA 3TUBA 5HD7A 3V04A 5LOHA 3M1SA 4FADA 1KV1A 4P7IA 3LQ3A 4E6AA 2ITYA 4IVAA 2UZWE 3DAKA 1Q8YA 3PXRA 4EZKA 1UWJA 3EL7A 4RC4A 1UU3A 4JGHB 3EKNA 4O7RA 2N9PC 2DHZA 2YEXA 2R64A 1PMEA 3K54A 4O2PA 2O64A 1XR1A 4GIIA 4CQEA 2WOTA 3CBLA 3UO6A 1XH8A 3N51A 3UPXA 2WMBA 3H4JA 4G3GA 4YTFA 4BGGA 5JEBA 4FODA 1V2YA 4D28A 3VS2A 1TTNA 1H24A 1K9AA 1KSWA 3O7LB 4F0IA 3TMPB 2LGCA 2UWQA 1C3TA 2EB2A 2VGPA 1OPLA 2WQMA 5ICPA 5CSPA 3CR0A 4FTRA 3NUXA 4E5AX 5CYIA 4GK4A 5E8WA 2C0OA 1WGRA 1OIQA 4MD7E 4MGKE 2J51A 2CLXA 2KJRA 2WGJA 3M3JA 2YIRA 3HMOA 3BGPA 3R71A 1E8ZA 2C3IB 3VUXA 2XCHA 2W9FB 3SXSA 2HD5B 5EYDA 3NX8A 4FX3A 4CSVA 2JIUA 2F7XE 2R2PA 4J53A 4YZMA 2AUHA 2WDTB 3ZKJC 3VVWB 2BGFA 1PYXA 2OLCA 4MWHA 3UODA 2Z7QA 3C0IA 3Q04A 4L3LA 3U8WA 4JIAA 4F1OA 1YD8U 2ZPNA 4FOBA 2CSNA 2YWVA 2XRWA 1P14A 4JR3A 4MM3A 2X8IA 2W1GA 4FK6A 2ZCBA 3PRIA 4X2FA 3GU7A 3AXWA 3FAAA 2X4ZA 3TKUA 1XH7A 3EQHA 3QCAA 3WIMA 4K9YA 2XB7A 4QP6A 3L0WB 3U6JA 4I6NB 1LUFA 2F7ZE 1W82A 3ORMA 4HDQA 2IJMA 2B0QA 2OH0E 4YMJA 4EUTA 1Q61A 3HUCA 4BDIA 1U46A 2AWTA 4D0XA 5CNNA 4EI4A 4RG0A 3MWUA 2Y8OA 2HOGA 4BWXA 5I9VA 5LVMA 5I9YA 2Y0AA 2KQ7A 2LASA 2C6MA 3HLLA 1WJ6A 3VQIA 3LAUA 4EH8A 4QMTA 4OTFA 2XEZA 3OWJA 4ZIMA 2J5EA 4BDJA 3O71A 3DV3A 4RBLA 2WD1A 3AOXA 4YJNA 1OL1A 4EQUA 4F6UA 5LVNA 3PG1A 1XD3B 2N1WA 2GNGA 4IVDA 2B9JA 5FP6A 3C0GA 4MEDA 1YW2A 2OH4A 2OIBA 3FC1X 4FTIA 4MGYE 3CEKA 3SHEA 4PS7A 4N0SA 4L43A 1YHWA 2IO1B 1XBCA 4HVHA 4OLIA 2W5AA 5BMMA 3AT2A 3ZTXA 3Q96A 3EQGA 4QTDA 4I6PA 1YDTE 2WTDA 4I6BA 4V01A 2YCRA 5ETIA 3BHTA 3H3CA 4BCMA 2BHEA 3RCJA 2GOWA 2WOUA 5LXHA 3DDCB 3NUAA 4OTPA 5EYKA 4E1ZA 3VHTC 5FXQA 2VGOA 2NNWB 2FSLX 4LGDA 5HICA 2XH5A 2C5OA 5AEPA 2WELA 1Q3DA 1V0PA 1XJDA 3HX4A 3Q9YA 2UZDA 4YJPA 4FV6A 3VO3A 4LDTB 3W2CA 2LXCA 4G17A 4Y8DA 2W1EA 1R3CA 3OS3A 3RM6A 2B4SB 1KE8A 4ERWA 5IUHA 1PXPA 1WR6E 1W7HA 4CFVA 5CSVA 2J0LA 5B7VA 3ETAA 3EQPA 4RX9A 3FPQA 3QQ8B 3HRFA 1YI6A 4MKCA 2G2HA 4FUXA 4AOIA 1I42A 3V6RA 1OIUA 1IA8A 2W0JA 2YM8A 2W1HA 3FLSA 4FSMA 4WNMA 3AC8A 4B9DA 3CE3A 3MY1A 5M55A 4NQKE 3ANRA 4TV3A 2PY3A 3N3KB 3M42A 1J7LA 3HVCA 3NUPA 4OTGA 3PSBA 3VN9A 2BZJA 1YHSA 3ZNZB 2FSTX 3PVUA 4RJ4A 4BRXA 2I1JA 4FULA 2F7EE 3GZNI 3PXFA 5CT7A 5DPVA 3F3WA 3GCPA 2HXLA 3E88A 3IW7A 3NNVA 5DR9A 4L44A 3VIDA 3BELA 5GIPE 3ML8A 4YTIA 2C5XA 1NBFC 4MELA 2CNQA 3LVPA 3R22A 5F1ZA 4ZLYA 3QQHA 2XF0A 2JKOA 4KWPA 3S95A 5A54A 5IEXA 3M95A 4C3FA 3C4ZA 2G9XA 2X9EA 4FT0A 2WMSA 2DQ7X 3GQIA 4WUNA 3IW8A 3D94A 4ZS0A 3GFEA 4X21A 3COIA 5HLWA 5DEYA 2JBOA 4XOZA 5L2WA 2J7QB 3PY1A 4DITA 1YQJA 3ZDUA 2YIWA 3EQIA 4K77A 2R2OA 4F7NA 4C3RA 3F66A 3QL8A 2X39A 4NTTA 4EK3A 5TO8A 5A14A 4JQ8A 5KMJA 4FTUA 2OIDA 2LWPA 4O7VA 4A9YA 4C57A 3F3VA 4PYZA 3Q3BA 3RZFA 1PXNA 3KKVA 2R3NA 5ANDA 4BICA 4IAKA 4FIJA 4O7SA 5L8KA 4N57A 2RFEA 1RDQE 2UW0A 2YERA 4GRBA 4F0GA 1JSUA 2GQRA 3FLQA 4RVKA 2OXXA 1OITA 4NSTA 5HTIA 2X81A 5L2SA 5LWMA 2NP8A 3ZO4A 4K7UA 3KVXA 4XRLA 2NBWB 3TZ8A 4NJ6A 3CQWA 3DPKA 3I0OA 2L8JA 3ULZA 1D3ZA 2XBBC 2BTSA 2FCMA 3P2BA 3CP9A 4GJ3A 3TIXA 4J8MA 2JFLA 3CTQA 3FWQA 3ENHA 3F3ZA 4ACCA 4IDVA 3ZNHB 4O0UA 3IFWB 3VUWA 2Z7LA 3B08A 4IAIA 5IQHA 1PHKA 2UVZA 4ANOA 1LEZA 4APPA 3U9CA 3NW7A 3PA3A 4RRVA 4DHJD 5CU3A 4RVLA 2GNJA 3LCTA 2GBJA 3O0GA 3QTSA 1YXVA 4ZZNA 5DGZA 1URWA 3G2FA 3MN3A 4N6YA 1V86A 5CF5A 4X3FA 4II3B 5DT3A 5J1WA 4IADA 5HQ0A 3CSFA 2Z2WA 1H1PA 2BCJA 3F5XA 2UW8A 3H0YA 4EONA 1QZEA 2WEIA 5IQIA 2DYMA 1G3NA 1DM2A 4EC8A 2X6EA 4GU9A 1UV5A 4HPUE 4RFYA 5CWZA 2WAJA 3IW6A 5AUVA 3RTPA 4IZ7A 3SLSA 4BBEA 5H8GA 3OWLA 1ZZ2A 4KSKC 5CX3A 2CCIA 4R1VA 4JDIA 3E87A 2MBBB 4W9DA 3BHUA 4YO4A 4NM3A 4AA4A 3LQ8A 3AD6A 4Y46A 3W18A 2CDZA 4HZRA 3V8SA 4BI1A 3UTOA 3ZRCA 2Y6MA 2D07B 5LVOA 4A3OA 4IAFA 4AZEA 2UW6A 3DK6A 4LI5A 3R8UA 3SU8X 5AFVA 3RPRA 1V6EA 5JHBA 5HGIA 5BVWA 4DT8A 5AV3A 2C3KA 1JPAA 2YISA 4IVBA 5CALA 4DGLC 3VTWA 2QOFA 3CCNA 1X8BA 5JGBA 3SC1A 4M7IA 1UNHA 2I6LA 4OT5A 4W9JA 2ETKA 3ORXA 4WG3A 1SVEA 3P7AA 1VCBA 4WG5A 4NNJB 2YFXA 3I7CA 2F2CB 3E8NA 3UYSA 4CG9A 4JXFA 4C02A 5HCYA 2JZZA 1P4OA 5TT7A 1UU8A 3FMHA 4IWDA 3Q9XA 4L68A 1KE9A 1TQIA 5GZ9A 1MQ4A 3BWFA 1O6KA 2VN9A 5EDQA 2RF9A 3ZH8A 4RWJA 5J18A 1J91A 2C30A 2IO6A 4II2B 3ZUNA 3QYZA 3UOJA 4L53A 3KUDB 3APDA 5A9UA 3DOWA 4BIBA 4WJNA 3ZDIA 4MCVA 4RWIA 1YDRE 4GN1A 3X0WA 3FEGA 2WXVA 4I4EA 4NJ3A 3WYYA 4Z7HA 4WOVA 3RYTA 2W1CA 4L52A 4YZ9A 4A9SA 2VWIA 3RK7A 4MHAA 3UZPA 4DFYA 2V55A 2AC5A 2BIKB 5D6JB 4LGGA 4AJYB 4FT3A 2QLUA 1VR2A 3OF0A 4D4RA 4MSQB 3V5TA 3KQ7A 5K9IA 1PY5A 2VUWA 3OT3A 4M15A 4E74A 3QC9A 3ZUUA 4DGNA 2KX3A 1ZYCA 4LJOB 1YHVA 3ZO2A 5C1QB 2I0YA 2WTKC 2K8CA 3WZJA 1JKKA 4EH5A 3QWZB 4RIYB 2WHBA 2IW9A 3KMUA 1Z9XA 2C5YA 1J1CA 1VEBA 3LFQA 4D55A 2VX1A 1JNKA 1H1RA 3AI5A 2ZJWA 2CKEA 2RSVA 3C13A 3FI3A 4GSBA 3RGFA 4CLJA 1V5OA 2N7EA 3D32A 3IBEA 4AT3A 4BZNA 4RGJA 3RPOA 2VWZA 3E8EA 2OJRA 2V5QA 4AOTA 2X2LA 4FKPA 5G2NA 1G6JA 4FEVA 5FTGA 3MFTA 3IOPA 5DRDA 4CO7A 1HOWA 4HCVA 4KIKB 4X0MA 3ZS5A 3NRMA 2DZMA 3R8PA 3BV3A 3DK7A 4KBCA 1GNUA 2RSUA 3EFLA 2BAQA 3WZUA 1CKJA 4FR4A 4XG2A 4IFCA 4DT9A 5EFQA 3RI1A 3N4TA 1JAMA 1TVOA 3PZEA 3VBQA 4MXOA 3F2AA 1R39A 2EMSA 2GNFA 4IBMA 2QR7A 4CMUA 3MPTA 4EBWA 3PVGA 3FLNC 4EYMA 1Q0WB 3C50A 4PPCA 2LD9A 1SZMA 3QHWA 5D12A 5C4KA 3QA0A 2HY0A 4PL3A 3SRVB 2WTCA 2N9XA 2ZB0A 3K5VA 4BF2A 5CF6A 3QZGA 3I5NA 3JYUA 2CMWA 3VAWA 3LZBA 2WU6A 2X9FA 3Q4UA 5EKNA 2Y4IB 2CJMA 3NWWA 4R1YA 5AP7A 5FWKK 2FGIA 4IZAA 4B8MA 4CKJA 3ODZX 4AG8A 5JFXA 5LQFA 2FCSA 4WWNA 1J0GA 1YVJA 4O84A 3R9DA 2W9NA 3A9JA 3T9LA 5CVFA 4P2KA 4O0SA 3QX1A 3ZM4A 3E7OA 4AACA 4C4JA 5FM3A 1ZMWA 3GOKA 1F5QA 3OOMA 3LE6A 1MRUA 4Q5HA 2GQSA 2R0IA 1H0VA 2YCQA 3R6XA 2VTHA 5ANJA 3GVUA 3Q9WA 3EQBA 3O8PA 4WBOA 1UU9A 4KS8A 2BRBA 3P0MA 4H58A 3W2QA 3PP1A 1Q8UA 4AXAA 4OVVA 1FMKA 3QKMA 4ICVA 3LFNA 1PXKA 4A3PA 4S34A 2PUUA 3HMIA 3ZO3A 3ORNA 2W7XA 4G9RA 5LCJA 3Q5ZA 4EFOA 4LV8A 4GFMA 1JBPE 1H08A 2KFKA 4HLEA 5AP2A 2Z7RA 5CS6A 1F3MC 4E5WA 4DINA 3UDBA 4MD8E 2R9SA 3JVRA 5AX3A 1WJNA 1REJA 4QT1A 3U8ZA 4I22A 3EZRA 4FTLA 3UOLA 3VWAA 4JAIA 4FV4A 1ZOGA 3EWHA 3UIMA 2CGUA 1M2RA 4XEYA 2C6LA 2QO2A 2O65A 4XRJA 4BCNA 4EOKA 2BROA 3ZIMA 1F0QA 4MXXA 4RIWA 4ZTQA 4EORA 2R0UA 5D2MB 5F9EA 2GHGA 5TR6A 2IVUA 4FVRA 3SD5A 1WBSA 3EFJA 3OCTA 3L8XA 5EH0A 2VRXA 5M4FA 3K9OB 2R3RA 2OGVA 1XQZA 3D83A 5E6NA 2HZ4A 3A1QA 2GNLA 4IHPA 1X1MA 1MRYA 5G55A 4UMUA 3OAWA 5E90A 3OUNB 3I6WA 2GPHA 2KHWB 4W8EA 4Y83A 2O2VA 3EH9A 2UZTA 3FJQE 3VQUA 5IH5A 1EF5A 2YAAA 2KO3A 3ZTCA 4BDFA 2DAJA 3PPAA 5ACBC 4AZFA 4ZEGA 3OJ3A 5CEIA 4CV8A 3E8DA 4R5SA 4R78A 3TNWA 2OXYA 3KU2A 3BYOA 4F6WA 2BWES 2JT4B 2XP2A 4K11A 4G3FA 3TL8A 3U4UA 3HMNA 4D9UA 5KCVA 4F9CA 5L6OA 3LFSA 3QQUA 4TNBA 4XOYA 2KDBA 2FNJB 1H07A 3KW5B 4NT4A 3CQUA 3AU4A 4CMOA 3T9IA 3LMIA 2MW5A 4Y85A 4DE4A 4G2FA 2HWPA 4CTCA 5KKRC 3BY4B 3ONSA 3SV0A 2WZJA 4JX3A 4K0YA 3EQCA 2MBEA 5G6VA 4O0VA 3PIXA 4FSQA 3W1YA 4I5MA 4BKTA 2R7IA 5CNOA 1KUTA 2KULA 2QQ7A 4O0RA 4QMMA 4I6LB 4CCUA 3P08A 5IA3A 3S3IA 4AE6A 2AL6A 2DUVA 1OL5A 5IA5A 3MTFA 3ENEA 4AP4C 3QC4A 5HG8A 4PDPA 3TZ7A 2AYPA 2YM6A 4X2GA 5EM5A 1XQQA 2BRHA 4FIFA 3BBTB 3DKOA 3RVGA 4CT2A 4DEHA 3GOEA 4IAAA 4J7BA 1BL6A 4BIEA 2UUEA 5HD4A 2KMCA 4G6LA 4F7LA 3CD8A 2X7FA 4PY1A 4QO9A 4NJ7A 3SHQA 3VUDA 3H7PB 4JLCA 3VBYA 5ETAA 1ZAOA 3PV1A 2ZM3A 3EECA 3WARA 4JBQA 4TYHA 1J1BA 5AZHA 5DG5A 5AV1A 3DTWA 3HV3A 1BMKA 4ZTNA 3R7YA 4GXBA 5FD2A 2I7QA 2C5NA 5LVLA 4ANLA 3FMKA 5D11A 1A48A 3TACA 3FMDA 3BYUA 4QP2A 2GTMA 3FHRA 2GSFA 3TNQB 3JS2A 1Y91A 4OTHA 3V51A 4XV2A 3WILA 4CMTA 3B0AA 3AXCA 2HWOA 4UWCA 5LXMA 2MA9B 1QMZA 2PZPA 1BX6A 4QQJA 3REPA 4BVUA 4W9HA 3EFWA 1YQBA 2J4ZA 3TCPA 4I5PA 3DJ5A 2VTPA 3MTNB 3GNIB 4IQ6A 2O2UA 4MDKE 2RG6A 4HJOA 4CKIA 4PS8A 3NGAA 3ATSA 3HDNA 3PG3A 2AYOB 4AFEA 2J6MA 3DDPA 4FV1A 4HPLB 3VUIA 3V60A 2I0HA 2PE2A 5AEKB 5L83A 3L17A 5GMVA 1ND4A 2CGWA 3AMBA 3DS6A 4U79A 5CXHA 1WX9A 3EHVA 3Q6WA 4M97A 4I41A 4QMQA 2CGXA 5LXIB 4F9WA 5IH6A 4G6NA 3CGOA 5GZ8A 3RAKA 3LCSA 5LVPA 4BVUC 1OPKA 5E8TA 2ZPYA 1FVTA 2VO6A 3VBTA 3A7FA 4BDCA 4BHNA 3IOKA 3QC8B 1OGUA 4FNWA 4EC9A 5L4QA 2O3PA 3UMXA 4C59A 1L7YA 3ORIA 4BCKA 3LOKA 4CZYB 5HIBA 3TZ9A 1V0BA 2O8YA 2XEYA 3OW3A 5KBRA 4UXLA 5ANOA 2WX0A 1V0OA 2A1AB 5EOLA 5JRSA 4CRSA 5AUZA 2EXEA 3G0EA 3IG3A 2QCSA 2IVVA 3F6XA 2ITNA 4L67A 3E3PA 4HGLA 5KE0A 1TGZB 4BI2A 2BF8B 3HM3A 3KVFB 3PXYA 4D9TA 3VRYA 2HJ8A 3KK8A 4FL2A 2YJSA 4G9CA 5IAAC 4IX6A 3L54A 1SNXA 3R28A 2ZV7A 2MCNB 3NVMB 4PMMA 3NVKI 4EJNA 1PXMA 3HV4A 4IM3A 5HESA 2KTRB 2A4LA 2H34A 3C0RB 3GC0A 5DI1A 4NFMA 3MA3A 4BDEA 1KM7A 2PVLA 3QQLA 2B1PA 3QRJA 3GCUA 4MXYA 4R5YA 4XJ0A 5HG5A 5CAUA 2MRPA 1KOBA 3R7GA 4GVAA 1L3RE 2HTHA 4F09A 1HE8A 3TTJA 2WB8A 5IQGA 3IDBA 3ZLWA 3W2RA 4L01A 4U9AA 3BBWA 5AAFA 1GIJA 2PZRA 3ZHPC 4DFNA 3I5ZA 4JOAA 4U6RA 3Q4ZA 5T6KA 3ZRLA 4USEA 1PMNA 3JXWA 2UV2A 4F9YA 4LG4A 4EOLA 5D7AA 4KSQA 3IECA 3QU0A 3A60A 4FV7A 2MBOA 1WXVA 4ENYA 3PRMB 3NYOA 4LOPA 2ERKA 4C58A 4MF0A 3ZO5B 4ERKA 3NYVA 5T3QA 3RAHA 1URCA 2XNEA 3ACJA 5E1EA 3QJZA 3Q2JA 4Z55A 3COMA 4LGHA 3RZBA 2MQJA 3UQFA 3KUZA 4GDLB 4ANWA 1ZY5A 4BI0A 5C8MA 4O6EA 3MDYA 4LRKA 5A3XA 1UGMA 3DJ7A 3QRUA 3G51A 1OGWA 3UP2A 3QZHA 2HYYA 4UXQA 4YTCA 4EJ7A 4EOMA 4HXDA 3TJPA 3C4XA 3GBZA 3FZ1A 3GU6A 4JVGA 2QI8A 3CPCA 3TNPC 3MBLA 2B52A 4PWNA 2KFKB 2PTKA 3W8LA 2J90A 2XIZA 4TTHB 3EYHA 5EYCA 4WSQA 3ZRKA 4I0TA 4R7BA 4PP7A 2HCKA 3IW5A 1LXDA 3RHKA 4FZDB 3FYKX 4R7IA 2OFVA 3BI6A 4W9XA 2OSCA 1QPJA 3VUGA 3G9NA 3QTIA 4J95A 3D5XA 4CV9A 3TUDA 1FBNA 2BUJA 2J5FA 2XKFA 3MIAA 4FIGA 4RX7A 2PVMA 3QRTA 5M56A 4G3XB 3FHIA 2EWAA 4KIPA 1K2PA 4RT7A 4YLLA 3UGBB 3LCOA 2WMRA 2F2UA 3FXXA 1GJOA 3LM0A 3PVWA 4LMUA 4IB1A 3SVVA 2IZVB 4FKOA 2A27A 4U8ZA 2N9EB 4HPMB 2XYUA 3NYXA 4FL1A 3VUKA 4FEWA 4FA6A 2PWLA 2Y9QA 5M4IA 3QQKA 4KS7A 4RMZA 4UBAA 2JAMA 2JZ3B 4GMVA 3LHJA 4FVPA 1UH6A 4M69B 3BEAA 5C8KA 1YJ1A 1JLUE 2EU9A 2MLBA 4TRLA 4USDA 4O21A 2BAJA 4ZSGA 5DT4A 4JBVA 4HCNB 1ZKHA 1BLXA 3DQXA 3RPVA 3DB8A 3UE4A 4DLIA 3RD2A 4XBRA 2GDOA 1WBPA 5IQEA 5JZJA 1RLFA 5LWNA 1W98A 1XH5A 4CRLA 3B2WA 3F3UA 2P3GX 1JVPP 4C37A 2J0MB 1WBWA 2XA4A 2VNWA 4U5JA 4UN0C 5J79A 4FTJA 3ZXZA 5IA2A 5KHWA 5IQBA 2BRGA 1HCKA 2ETMA 1XBBA 1P3QU 3PUPA 3KULB 3ACKA 3H9FA 2ZYBA 4LL0A 1GOLA 3W10A 3WBLA 3ZYAA 5JSMA 4FN2A 2FH9A 2YN8A 3S2PA 2XEWA 3WZDA 3WZEA 3BPRA 2FYSA 4U44A 3GXLA 4C3PA 2XNGA 4FT7A 2L0FA 3G15A 3CGFA 4I1ZA 3QTXA 4YHFA 4DEAA 2YDJA 3MYGA 4GOCA 5CI6A 4W9GA 4AZVA 1E8WA 5ANKA 5DR2A 5C1ZA 4BWPA 2XUUA 2KWVB 5E6PA 3ROYA 1NA7A 1UNGA 2MBHA 4NK9A 4FICA 5K4JA 2VTRA 2NPTB 3S2AA 3ZCLA 3QHTA 3DT1A 2YDIA 4OVUA 1Q5KA 3RT3B 2X0GA 2C1BA 3TJDA 1H1WA 3R7VA 3TIZA 2VRRB 5DPSA 4ZRKA 4RC3A 2WTIA 5EKOA 3R8ZA 1RAXA 5CF8A 3MH3A 5HI2A 4EWHA 5KMMA 1FVRA 4F1SA 3PS6A 3A4PA 4KKHA 3M63B 2CKOA 3OOGA 4PV0A 5HIDA 3L9LA 1JOWB 5D7VA 1WZ3A 4IX5A 3RWQA 4KBAA 3W2SA 4KINA 3VJOA 1WMKA 2K25A 2FAZA 1OEYJ 3TZMA 2K8BA 4ASWC 4O7YA 1YX5B 1E7VA 4O7LA 4ZSLA 5AV4A 4G3EA 4DAWA 2GTNA 3RM7A 1Q97A 2PVFA 5AP5A 3NSZA 4HK2A 2BRMA 3UVPA 5J87A 3KN6A 4FHJA 1EH4A 2W17A 4JT3A 5CU4A 5GZAA 4ASXA 1EF1A 1PQSA 2WMTA 3EQRA 3FLYA 2REXA 2CHWA 4EOIA 5HO7A 1WFYA 1YDSE 3KGAA 1Y8YA 4RLLA 5M53A 4URKA 3SGCA 4GK3A 5FXRA 3ORLA 2HY81 4FV9A 4TT7A 5DEWA 4ALUA 2GU8A 2L3ZA 4RWKA 2X6DA 3PWYA 5I9ZA 2RR9A 4L8MA 1XWSA 2V4LA 3NUSA 4XUFA 4B99A 2YIQA 4EKKA 3R01A 2IPXA 3KL8A 3BCEA 4XG7A 2CU1A 1NW1A 4WO5A 3PSDA 1U5RA 4MNEA 4NW5A 4CHKA 3BQRA 5KKRB 2D11A 3VRZA 2A5UA 3NCZA 5IDNA 4DGMA 2ZB1A 5JFSA 4FEQA 4ANMA 3QD2B 4E4XA 3KFAA 5D41A 2HAKA 2WTWA 3ECIA 2PK9A 3KXZA 3MFSA 5BYZA 2BZKB 4GFGA 4CYJA 4E6QA 4TL0A 1OL6A 5CANA 5CEKA 4OAUC 2IW8A 3QD0A 3VS3A 4AF3A 4BB4A 3H6NA 4D58A 1OKVA 3HIZA 2E9NA 3TNHA 4G11A 3FSFA 5E4HA 4FJZA 3BQCA 3PJ1A 3T8OA 4I4FA 5EQPA 2J0KA 2NO3A 3DBDA 3ZZWA 4J52A 4FKGA 2C68A 4QMYA 5M51A 1FGIA 1YOLA 4RX5A 4CFXA 5A4EA 4DTBA 4D5HA 4EWQA 3F88A 4JIKA 4EHVA 5AP6A 3DBSA 3PJ3A 3MVMA 5BUIA 5K5NA 4K7SA 5AZGA 4ZS4A 2LVOA 1R1WA 2JKKA 4I21A 1U4AA 4O83A 1H4LA 2R3IA 3TCAA 2PVRA 4U80A 5HLNA 1PMVA 3FI2A 2YZLA 3DXQA 4R3PA 4ZTHA 4RFMA 5FTOA 3RCZA 2OJFE 4X7QA 3GENA 4QMZA 3UQCA 2NCNA 3MIYA 4WQOB 4DEIA 3POZA 2C1AA 4IWOA 4WNPA 3RKBA 4BL1A 4EOSA 4XCUA 3NZSA 1CTPE 5CHWA 4U45A 2IY0B 4X2KA 3ZRFA 3APCA 3QD4A 3DVNU 1SGHA 1JSVA 2PMNX 4GV1A 4QNYA 4E71A 3OUKA 2R7BA 1ZWSA 3QRKA 4JS8A 1UELA 4U3YA 4K33A 3VBWA 5JZEB 2KLGA 2PE1A 4FV2A 3NIZA 3OWKA 3Q53A 2BPMA 4V05A 4E4MA 3CKXA 4UB7A 3CC6A 3R7UA 2XK3A 3TV4A 3ZDTA 3NUYA 3QTQA 5AUXA 2LGYA 4BKSD 4UWYA 4FMQA 5EI8A 3VVHA 2PMLX 5I0BA 3D9VA 3TUCA 4OBPA 1M14A 4Y72A 3BWJA 1O6YA 3TN8A 2IZTA 3PIZA 4QQ5A 4GB9A 4AUQC 4QMVA 5LMKA 2BKRB 4K1RB 4PYUA 4PS3A 1SE9A 2YITA 4FYOA 3TXOA 1E90A 4YJQA 3R7IA 2W1FA 3RMFA 2WIPA 4HNIA 2NRYA 1LR4A 2GS2A 4M69A 4Y73A 5KHXA 3ODYX 3RCDA 3KXNA 3AT4A 4X57B 2UZBA 2EXMA 3SRVA 2KC2A 4MJSB 5JQ8A 4RA5A 4NYEA 3UPZA 2BRNA 4L3JA 1Z2MA 3R9NA 3P5KA 1WY8A 1H8FA 5HCZA 4TYEA 4YLJA 2X2KA 2HE7A 2MBQA 2JGZA 1Y8GA 5DPTA 2ITUA 3ULIA 2OO8X 3AC1A 3R83A 4BIDA 4D5KA 3TG1A 3H9RA 4FSWA 5HVYA 3H10A 1E9HA 2LAVA 1O6LA 4WKQA 2ASQA 5HO6A 2Y5BB 2JDVA 2UVXA 3O65B 5LLIA 3TV6A 1MUOA 1IA9A 2IVSA 2QKWB 1Q62A 2XRUA 4P5ZA 2G45B 3W2PA 4WUAA 1QPEA 1DI8A 5AIKA 3UQBA 2D3GA 2GBNA 2IO0B 4JL9A 5HCXA 4H05A 3A8XA 3QD3A 1UD7A 4BCHA 3G6GA 3ALOA 4GEOA 5IQCA 5FQDC 2XK5B 4D1SA 4ZLOA 5EK7A 2JWZA 5DIAA 2W5BA 4F64A 1IAHA 3VJNA 3LXPA 4MX9A 5JFWA 5DVRA 4D2SA 2M0XA 3NOBA 4KIOA 4NTSA 2DAFA 4XP2A 3UP7A 5BPYA 3R02A 1Q4LA 1WBTA 1ZY4A 2VO7A 3QHRA 3GCSA 3R2BA 4RVTA 4YO6A 2BDWA 4GT3A 2H96A 5DPRA 3VW8A 4B4LA 3UG1A 1XH4A 3C0HA 3DTCA 3AG9A 3E8CA 4GYGA 2WTKB 4IM0A 4EYJA 4DG3E 3DXNA 1A06A 2E9PA 3EQDA 1I44A 2XYNA 3QALE 4NWMA 4X6RA 4OBQA 4BYIA 2IO3B 3U9NA 3UYTA 4BC6A 1WBOA 4H1MA 3WE8A 3A9KA 2UZNA 3DCGA 5DCNA 5FBNC 2I0VA 5HE0A 4XV3A 4Z7GA 3PE1A 5CZHA 4ZAUA 1GC7A 2LVQA 3UIUA 3OZ6A 1J3HA 2O0UA 4AZSA 3Q2MA 2H6DA 3CTJA 4JIOU 5TR5A 4DHZE 4BTMA 2OU7A 4B8LA 4EQMA 4GUEA 5ETCA 3U6HA 3VS0A 2DENB 1Y57A 4AGUA 4GVJA 4EBVA 4NKAA 3FI4A 4FZFB 3PSCA 2P2IA 5K3YA 4AOJA 3UVRA 2PE6B 5TKDA 2XKCA 2JXXA 1NVRA 5AV0A 3GC7A 1WBNA 2E9OA 3OTVA 3QKKA 4JI9A 4ZZMA 4B95A 4MBJA 4GW8A 4XG3A 5DOSA 2PZYA 4D1ZA 4PF4A 4E4LA 4PL4A 1GIHA 2REIA 5A6OA 4I0SA 2QHNA 3KXGA 3OMVA 4XLIA 5CSXA 5HBHA 3L16A 2IYDB 4U41A 4YZCA 3PT2B 3N9XA 2C7NB 3KYCD 3CMMB 5DYJA 4DGGA 2ITWA 4IVCA 3BGQA 4YU2A 5LMKC 4AUAA 3C7QA 1AARA 3IO7A 2GS7A 3R7EA 2B9HA 1B38A 4ITJA 3OW4A 2C6DA 3HEGA 4H3QA 4DC2A 1ZRZA 3PLUA 2Q83A 3PJ2A 3FY2A 3TWJA 4RC2A 3OEZA 2BYFA 2QU6A 5I9UA 2RD0A 3W33A 4L42A 3Q9ZA 4DEEA 4KNBA 4M67A 4UMPA 2R2QA 2LRUA 5FUTA 3JSVB 1P5EA 2F4JA 2J50A 4TQ1A 3ORTA 5CQUA 3P23A 5BVDA 4OTRA 4HJKA 3UOHA 4KDLB 4JRNA 4FG8A 4LUDA 2YLFA 4PRJA 4BWKA 3HP2A 2FCNA 2ZMDA 4YJSA 2QD9A 1IG1A 2A2AA 3E93A 4O96A 4BN1A 5IH4A 3QCYA 3FBVA 4XG6A 1M2QA 1PW2A 4E8AA 4HGTA 2KWCA 3F82A 2PULA 2QOOA 3GQLA 5FRIA 3F7WA 1OBGA 2FSOX 5EYMA 5CSWA 4APCA 4HVSA 2C9WB 5IQAA 3SG9A 1JKLA 3I7BA 4H1JA 2ITQA 3EHAA 4I94A 3TTIA 2YJRA 3HA6A 4X3JA 3MA6A 4G6OA 1YOJA 1V1KA 5L2TA 4C2WA 2UW3A 3BIZA 4FA2A 3EQFA 3LFEA 3ZO1A 4UMTA 2ZVAA 4R7HA 3QX4A 1GIIA 1JQHA 1AGWA 3ERKA 3RINA 4ACHA 4F70A 2H8HA 3MW1A 5FEEA 4G16A 5L3AA 1UBIA 1UKIA 3MPAA 4WBBB 4IMYA 2Z0EB 3H9DA 2X8DA 5CHVC 1RE8A 4A20A 4IAZA 3HECA 3UBDA 5IA4A 1Q1OA 4QTCA 3JVSA 4M0YA 5M4CA 3W1SC 4FSNA 4QYYA 4AJWA 1XHAA 2KTFA 2WQEA 4FIIA 2C0IA 2UVYA 4GT5A 3UO5A 1PXJA 4RSSA 2FIDA 3KH0A 3ZFXA 3SD0A 2PUPA 1H1SA 4Q9ZA 3G90X 1Y6AA 4FKVA 4OTIA 5FG8A 5CAQA 4FT5A 3A4RA 3FKLA 4O7NA 2O6VB 4HVGA 1IEPA 2W9ZB 2G2FA 2JDTA 3F5PA 3NUNA 2KLCA 3E64A 3KC3A 2LXAA 4FTTA 5ACKA 5KZ0A 3BINA 4FTAA 4PX6A 4O7TA 2O5KA 2UW4A 3IVFA 4RJ8A 1KV2A 3O51A 4KRCA 5H8BA 5IPJA 1ZYLA 2YDKA 4C33A 3OY1A 4KA3A 4AW5A 2MP2B 4XC2A 2K8HA 3CLYA 4IACA 4GIVA 4QMXA 3T9TA 3KRJA 2OJJA 3JSVA 5JMSA 3JR1A 3CS9A 1DI9A 3VBVA 1ZARA 3VBXA 5E91A 5B0XA 3NZUA 3R1SA 2OF2A 2R3QA 2XNOA 1TQMA 4RM8A 2ZM4A 3MGYA 4JR7A 1OZ1A 1WE6A 3OLMD 1W84A 3K3IA 4M84A 3BHYA 4FOCA 1CMKE 4EK4A 1WE7A 2XK9A 4OR5A 4BCFA 2WMUA 5C8NA 3MB6A 5JFVA 4ZJJA 2NVUI 3VDZA 4QMLA 1YXUA 2DZIA 2VWVA 4ZYNA 4FEUA 4R3CA 2WMXA 2BKZA 5AADA 3NHEB 1FQ1B 3K5UA 2PPQA 3VQHA 2JD5A 1IASA 4TKSA 3FYJX 2FCQA 2M8SA 3PGEA 5B2MA 5HE3A 2PUNA 3LMHA 4QD6A 1H4RA 2O2VB 4PTEA 3E63A 1CKIA 4LYNA 3DA6A 4RJ5A 4TZRA 2XM9A 4C4FA 5TF9A 1IP9A 3C4CA 3FDNA 4RWLA 4HNFA 2IWIA 2GNIA 4BDAA 5J2RA 1BL7A 2OW3A 4FJVB 5CXZA 4G5PA 5CAVA 2YAKA 3TKHA 4PP9A 3ZFYA 2J9MA 2JEDA 4CCBA 2PZ5A 4C0TA 3ZLZA 4HW7A 4JQEA 3MVLA 4BFRA 1ZZLA 4JQ7A 4U0IA 1UU7A 4AQCA 4GIHA 1XH9A 3LXLA 3UIXA 2I40A 4XV9A 5EM8A 4E26A 3V01A 1WXMA 3L8PA 2FVDA 1FGKA 2R3OA 3P86A 4QTAA 4XG9A 3UG2A 1Q5WB 4DEGA 2C60A 2BWFA 4K8AA 4PMPA 5HVJA 1U54B 2UW7A 5E8ZA 3KCKA 4ALVA 3AGLA 3G9LX 5A4QA 3IG7A 3F5UA 3UO4A 4W9EA 3DBEA 4II5A 5DH3A 5H9BA 4ALWA 4ZTMA 4EOYA 3DXPA 3MH1A 4S31A 1REKA 4PNIA 3H7SA 2C5LC 3SAYA 4MJSA 4U43A 4LOQA 3H30A 3PSEB 3JUHA 3FE3A 4TQ0A 5C26A 3ML9A 2GS6A 5JGAA 4YPDA 1PMUA 4QPAA 3WIGA 4DLJA 4L6QA 3BU6A 4QQTA 3A9KB 1PRYA 4BBFA 1BKXA 4UZHA 4KBKA 5AX9A 1YIWA 1MP8A 2UZVA 2IO2B 1PXOA 4GUBA 4MH0E 4AT5A 3Q52A 3HDMA 4E7WA 4E93A 2RGFA 5CLPA 4MH7A 4L00A 4AX8A 2UZEA 4DEBA 3UOKA 1VJYA 4ID7A 3I6UA 3U6IA 4FNYA 5EOBA 2JDOA 3L13A 4ZTSA 3A4SC 3BLHA 3WAMA 2XBJA 5KMKA 4TXCA 4FKJA 2D2QA 4IZ5A 4IB5A 3KXXA 3BLQA 3PY3A 3TT0A 3V3VA 5KZIA 1WH3A 2JBPA 1A9UA 4K6ZA 2JPHA 3FLZA 3LCKA 3D5UA 5CVGA 1NY3A 3LLAA 3LPBA 5J95A 3DB6A 4C4IA 3P4KA 2VWBA 3N30A 2CN5A 1DS5A 4X2NA 3V6EB 2NPQA 4Y5QA 4HYUA 2ZCCA 5AUWA 2RIOA 4DHJB 1Q41A 3QAME 4IJ9A 5J8IA 3PRPB 4GKIA 4ASEA 1OPJA 1VYZA 4U40A 3VUTA 4AA0A 2HW7A 2XK6A 1YXTA 3NR9A 1V5TA 3WANA 2GMIC 3NYNA 5DE2A 4QQCA 3ZLSA 5HLPA 4EHZA 4FSZA 4J98A 2VTAA 4ZJVA 4EK6A 2ITXA 2Z7SA 4FKLA 4EZLA 3V8WA 1H00A 3PY0A 3HHMA 3NW5A 4YBKA 3WAPA 4CLIA 3L10B 4ANUA 4YSJA 3QCXA 1NVSA 2ERZE 3C9WA 4M0WB 1FVVA 1YXSA 4EL9A 5A4TA 3HRBA 5LMBA 3QXPA 5IU2A 4Q2AA 3GEQA 4QP7A 3SOAA 3C51A 5IMXA 4BBNC 5M57A 5DWRA 1WVYA 3FQHA 3FZSA 5AIRA 4KDIC 4UYAA 4TYHB 1GNGA 3JPVA 4FLHA 1Q99A 3SOCA 3VNTA 4K18A 4D4SA 1IYFA 4IM2A 3OEFX 1FOTA 3MJWA 2A4ZA 2G1TA 1BT0A 1JWHA 3VHKA 1XH6A 4C36A 2I1MA 5FP5A 3Q3JA 1Q3WA 3VC4A 2CNUA 3ATTA 2E9UA 2WQOA 3WF7A 1J7IA 2VTJA 4MQ1A 3TDVA 3S4QA 3BZ3A 3DU8A 4H3BA 4IEBA 5F4NA 3D7ZA 4LOOA 1UZXB 2GHLA 2OOBB 3BEGA 2W1ZA 4OUCA 3IS5A 4W8DA 1WYWB 4CG8A 2X1NA 4Q9SA 3DZOA 4DG0E 1OUYA 3W8QA 1RQQA 3FMLA 4FIEA 4J97A 3WF9A 5CU6A 2OICA 2WMQA 1QPDA 3CJFA 4QOXA 1U54A 5AP4A 2KC1A 1J8CA 4QMOA 3VF8A 4V04A 2CS4A 3HZTA 4MAOA 4OAVB 2OG8A 3U4WA 1H26A 4I24A 4W4WA 4TWNA 4ZP5A 2WTVA 2EB3A 4NFNA 4DH5A 3V61A 1Q8WA 2BTRA 4FTOA 4H36A 3PJCA 3LW0A 4IE9A 4C34A 4MGZE 4A9UA 3UC3A 4ASDA 3L08A 2NRUA 3QTUA 4GGQA 1GAGA 1JKSA 1WIAA 5DN3A 1S9JA 1WVWA 3LFCA 3GP0A 4YGAA 1P2AA 1UWHA 3DLZA 4Z3VA 3OXZA 4XP0A 5BUJA 1RRBA 1ZYSA 3A1QB 3W55A 2FUMA 2VTIA 3F2NA 3Q4TA 2V22A 5EDRA 1E8YA 2XNBA 3NZ0A 1WZYA 2C6OA 1E8XA 2LGXA 2JIVA 4PTGA 1GC6A 4WWOA 4N70A 3FC2A 4X3FB 5B2KA 2W05A 4FKQA 3MB7A 3VS5A 3ZOSA 5CU0A 5KO1A 4I3ZA 1PKDA 1L2NA 5EDSA 5AA9A 3RULA 3VH3B 3CF6E 3O23A 4CEGA 1OKYA 1V49A 3PA4A 5JQ5A 2ZV9A 2LI5A 4BKJA 3MI9A 1YI4A 4EUUA 4BKYA 4BZDA 5D7GA 4ZMFA 2PVKA 3COHA 1H01A 2H9VA 4TNDA 2ITPA 3QFVA 4ZY5A 3MVHA 1UBQA 5AM6A 3FQEA 4GS6A 2XKDA 1B39A 1Z5SB 1KE7A 3LQ5A 2BPSA 5BMSA 4M3QA 2QODA 4I5HA 3SDLC 5GHVA 3VUYA 4DK5A 2QOKA 5M4UA 2P2HA 4BGQA 4UALA 3R7QA 4PDYA 1VZOA 4CT1A 2XBAA 3A7IA 4L3PA 5GIOE 3FXWA 5HU3A 3ORKA 4K81A 5E7RA 2C6EA 5M07A 2VWWA 4GG5A 5AR7A 4C4EA 4KIQA 4XNEA 2XNMA 5LMAA 5M08A 2WU7A 4MBLA 4FKSA 5BVEA 3PZHA 3VF9A 2VTMA 1APME 2XIYA 4NEUA 2GFSA 1ZYDA 5HBEA 3QZIA 4O7WA 2NPTA 3PHXB 3UIPB 5E1SA 5DBXA 5I5ZA 4D0WA 5GJGA 4PNKA 2NS5A 2R3FA 3D5VA 1Y8RC 4E6DA 3W16A 3IHPC 5HG7A 1GUAB 1H28A 3KULA 5L2IA 3ZM9A 5L8JA 2W99B 5CAOA 1LM8B 4J8NA 5LARA 5HKMA 2VTNA 3UVQA 5J5TA 4YZNA 1RFAA 4G5JA 2QOHA 3COKA 3G0FA 3CJGA 5CVHA 3UIBA 1WR1A 4OTWA 5B2LA 5JH5C 2BIYA 3FMNA 2C7HA 3R1QA 2KANA 1BUHA 4ORKA 2CGVA 5H3QA 2VTOA 3A7GA 5HNIX 4AW2A 3P79A 4ZK5A 4DG2E 3BE9A 3VS6A 1MQBA 4I5CA 5LJJA 2K39A 2L0TA 3UF8A 3CIKA 4XS2A 3OCGA 4O0WA 3QZFA 4FTNA 5CT0A 4JG8A 3PFQA 4BCGA 3C5IA 3ALNA 3F69A 3OHTA 1WX7A 3R9RA 3H0ZA 5E6OA 4V0GB 4O2ZA 1EO6A 3JVZX 2VWUA 4FBXA 3EMGA 1P1AA 2M17A 2JF5A 4W4VA 3POOA 4BKSA 5CQWA 3B8QA 1DAWA 4YC8A 1FPUA 1ZOEA 3CKWA 2FUHB 3PPJA 3QXOA 2HZNA 4CGAA 2VO0A 5HHWA 2E2BA 1PXLA 3GUBA 5EHYA 2R3GA 5A46A 4LJPB 1H8CA 2WEVA 2OI4X 3FKNA 4X6QC 1ZGUB 4F7ZA 3FSKA 2BDFA 3DKCA 2B55A 3PE2A 4BDHA 3C4FA 3RAWA 2BVAA 4EZ5A 4QP1A 4GDKA 3WI6A 2OKRA 3AC3A 5AP0A 3L8SA 4EZ3A 5A4LA 3X23A 5BVFA 2OFUA 3FPMA 2GFCA 3PTGA 4AAAA 4D4VA 1SNUA 3NNXA 4A4XA 3CXWA 3AULA 1P98A 2JDRA 3ZFMA 3R1NA 4PMTA 4ZMEA 4BGHA 1ZYJA 3DVGX 1ISNA 2EKEC 2EXCX 5CAPA 4AGDA 3RK9A 2Y4IC 2WTJA 2VO3A 2Q0BA 1FINA 5HVKA 3CTHA 3O7LD 4U42A 3ELJA 3Q5IA 4NH1A 4P90A 2RKUA 5JZNA 4NJDA 5AUYA 4FEXA 3LMGA 3MFUA 4TYIA 4WSYA 4BDGA 4KUJA 5BO4B 5K4IA 4I0RA 4PUZA 4AN9A 4GU2A 3RK5A 2ZNVC 5IA7A 2VNYA 4FK3A 2BMCA 4FL3A 3ZRMA 4C4GA 3DBQA 1OTRB 1XT9B 3ZSHA 3TJCA 4G0NB 3AT3A 3HNGA 3AMAA 3I60A 1Q24A 3QQFA 4EKLA 2O63A 2YCSA 4UZDA 4E73A 4EH2A 3DVNV 1GJZA 2OF4A 2YWPA 3GI3A 3VS4A 3DBFA 4FZ7A 4PDSA 3KRRA 3TBLD 3HAVA 4DN5A 1XKKA 4GG7A 4A7CA 1M17A 4F6SA 5IA1A 2PMIA 4ANXA 1AD5A 4G34A 1MRVA 3ANQA 4FUYA 4I23A 3W2OA 1H0WA 2B53A 5KMLA 4U7ZA 1H1QA 3IW4A 2GBRA 2KNBA 4NM5A 1E1VA 4ZY6A 5JRQA 4BCPA 3FXZA 4RLKA 1PXIA 1JRUA 4QMNA 2IVTA 2CKHB 3P7CA 3SQQA 5JN2A 3ALBA 4ZRJA 1WGGA 2G4DB 3T3UA 1U59A 2OJGA 4PMSA 2Y7JA 3C1XA 4AN2A 3PREA 3DBCA 4ZJIA 1ZW7A 2WFYA 3BU5A 4IWQA 4S2ZA 1WVXA 4PL5A 1IPGA 2BKKA 2I0EA 4ITIA 1KOTA 4MTAA 2BAKA 1H27A 3KF7A 5D9HA 2ITTA 4YLKA 2X7GA 2QOQA 3BLRA 3AC5A 3Q32A 4AFJA 1J7UA 4FKIA 5LCKA 4FGRA 4BOZB 3V8TA 2JRHA 4TWCA 2ZDTA 5HOAA 2VTSA 2MP2A 2PJHA 2EMTA 2W06A 4A07A 4GH2A 2QOLA 4CNHA 5J7BA 2XK5A 4M8MA 3UZRA 3VUMA 2G4SA 5I3RA 4CZUA 3AD5A 5G1XA 1WXAA 3HAMA 3DDQA 3EOCA 4OW8A 5AR2A 3D0EA 3FMMA 4I92A 4YC6A 5AAEA 3KA0A 5HIEA 2PHKA 2BZHB 3OCBA 4LQMA 2OK1A 1WRDB 2L00B 3ORZA 1Q8ZA 4CFWA 5I9WA 4O82A 3AQVA 2XIXA 5DFPA 3R3MA 3NUUA 4WAAA 3EN6A 2G15A 3GCVA 3IGGA 4F7SA 2M4NA 5EDPA 2R3HA 4AS0A 1R4MI 3D14A 4YPSA 4GDKB 5IISA 1F9JA 1V9JA 3ET7A 4O7ZA 1YKRA 3O17A 4BCOA 4DYMA 2IN6A 5JK3A 4IG7B 2G2IA 4KVGB 4YBJA 5EM6A 1CMXB 3S0OA 4GJ2A 1TQPA 4XBUA 3JW0X 2OZOA 4ZSAA 4BY9E 3AGMA 1WJUA 5JHAA 4DCEA 4AGCA 1PJKA 5AUUA 3R30A 2WQBA 3WYXA 1KLVA 4EOJA 3QQGA 4WJPA 3OD6X 4KRDA 5HBJA 4BBNF 4N9F4 4OTDA 4D2WA 2XNNA 2PVJA 1CM8A 3WF6A 3A8WA 3BX5A 3QUPA 5AV2A 2V62A 5DPWA 4DH7A 2GCDA 2YA9A 2YABA 5L2QA 4JX7A 5EW8A 3KN5A 3APFA 4O38A 5BUEA 3NAYA 3BRBA 2QO9A 1OIRA 1PF8A 1M94A 4IX3A 3VHEA 2ZJDA 4TPTA 1UVRA 4EZJA 4QPMA 3PJ8A 1SM2A 3PXZA 1W83A 2OZAA 4B0GA 4BDKA 1CKPA 4FHKA 2XS0A 2RPQA 3DCVA 3IK3A 3LJ0A 4QP4A 3IONA 4UV0A 4UYNA 5A4CA 4EKUA 1B6CB 3SDJA 4UMRA 3R2YA 2YM5A 1WXSA 4NAWB 3T8MA 3VTUA 4EOOA 2QHOA 3UNKA 2B3AA 5IQFA 3P9JA 3NNUA 2CHLA 4C4HA 5D94A 2Z8CA 2PE0A 2PPHA 5TE0A 2QNJA 4NUSA 3WIKA 4EH4A 4YJTA 1I35A 5AUTA 3LFAA 3SXRA 2SRCA 3P78A 2VWYA 3OG7A 3RPYA 5AM7A 4YJVA 4DA5A 4AW0A 4NU1A 3HRCA 3RAIA 1JSTA 3CD3A 1LQBA 4P7EA 5E8VA 2YACA 4F9BA 4FTCA 4O22A 1WAKA 2B9IA 5HKHA 4CZTA 3BE2A 2IW6A 4HYSA 3ZXTA 1KOAA 2WKMA 3V5QA 2XJ1A 4DDGD 4I93A 4FBJB 1YOMA 5HE2A 2Q0NA 3V5WA 2N4FA 3SG8A 2JY6A 3U51A 3F61A 2NBUA 5HX6A 3B1LX 4TKNA 3RNYA 2W4OA 2PVHA 4S33A 3T3VA 4IANA 1E5WA 1OIYA 4FIHA 4UMQA 4RIXB 4XMOA 1IAJA 2C6KA 5IKWA 5J1VA 3I4BA 3LDZE 3PA5A 3FY0A 3QX2A 4FC0A 4ZXTA 4YHTA 1TKIA 2G3QB 3D2KA 4E3CA 3F3TA 5FM2A 5E8UA 2P0CA 2KKCA
chains in the Genus database with same CATH superfamily
1ZP0B 3II5A 2XK8A 3QLFA 5F20A 3O3OB 3OROA 3VKHA 2PSQA 4AW1A 3HM6X 2X0PA 5I3OA 3RFZB 4F65A 3WZKA 3VUHA 5KMIA 3WALA 4F9AA 5T8IA 3HGKA 1UA2A 4B6WA 2YVCA 3E3BX 2KQSA 3MY5A 2FA2A 4YHJA 1O9UA 4GKHA 4LMNA 4F0FA 3ZLYA 1KE5A 5FDPA 4NAMA 3DGKA 2FIFA 3KWVA 2OBMA 3SX9A 3U87A 4NZWB 4TWOA 4ANVA 4R77A 2OBJA 5E9EA 5IMEA 4MXZA 4ZOGA 2PMOX 4YR8A 3HP5A 3FI8A 4Y5HA 1IRKA 4HCTA 4ITKA 2NBVB 3DFAA 3ROCA 3FZOA 2WXHA 3ZTDA 4NIFA 2PL0A 4MF1A 2L76A 4BOSC 3BYVA 4O0TA 3R2TA 3EN4A 2XZSA 4F08A 2KDIA 5HNGA 2XVDA 5FGKA 2YM4A 3QKLA 5CTRC 4BCIA 4HROA 3R73A 1L4ZB 2GRIA 2C7MB 1GZ8A 4WRSA 1FCCC 3GC9A 2RFDA 4D2VA 2RFSA 4S0RA 3Q60A 1OI9A 3R8VA 2BS2B 3MTLA 2BALA 4NIFB 2KWUB 1WJ4A 1ZMVA 3R8LA 2GNHA 3NPCA 1IR3A 4MXCA 4R8QA 1Q8TA 4PQNA 4DE4A 3A7HA 4BCQA 2K1FA 3TKIA 2V7OA 3CSVA 5AP1A 3VR9B 4PPBA 4EZ7A 2YIYA 3U4EG 5M06A 4ZY4A 5IUGA 4D2TA 4FTQA 5HORA 3MFRA 2XJ0A 4JNWA 1YRPA 3MY0A 4YZDA 1T0YA 4WNOA 4B7TA 3UNZA 4RMAA 4W9CA 4YP8A 5FBOA 2UZLA 3LLTA 2X2MA 4NY0A 2JKQA 3VW6A 1E2UA 4LTUA 4WT6A 2A0CX 3ZBXA 3EL8A 4JAJA 3NDMA 1NDDA 4YJUA 2W55A 4QMUA 1PYEA 5FDXA 4QMWA 5J5SA 2G01A 3FMJA 1XO2B 3HMMA 4LJPB 5GNKA 1OMWA 4C8BA 4TN6A 4JDKA 3AMYA 4RGNA 4C61A 2KTRA 2UZUE 4ATMA 4F1TA 3ZW3A 2OXDA 3GU4A 4JQWC 4J6IA 3D5WA 4M14A 2AEGA 4GK2A 2WX1A 4TY1A 3K3JA 3O8TA 4DGOA 3I39X 4BKZA 3HK0A 1MPEA 4AP7A 2R4BA 4QDEA 2WMVA 4V0GA 1WGDA 3P42A 2YLEA 3CSTA 4P1CC 3C4EA 3KY2A 5ITAA 4O0XA 5H2UA 4ACMA 5AJQA 5CSHA 3ZU7A 2W5HA 3QTWA 3EFUA 3R00A 4ZZOA 1OQRA 1U4DA 4HCPB 1S9IA 4OBOA 4FG9A 5FK9C 3D4ZA 3UJGA 3ZC6A 1CDKA 4R3RA 4JJRA 2F7PA 3MVJA 3GT8A 4EEWA 4WJOA 1RJBA 3PVLA 3WA0A 5CENA 5CASA 2X3XA 2YIXA 3VAPA 2B9FA 4TYJA 5E8XA 3ZEPA 3DY7A 4FI1A 4FSTA 1K53A 2C5VA 4G1WA 4HVIA 2XK7A 2BR1A 4F63A 1HTYA 2XNPA 5CF4A 3HV7A 2DZJA 4BTKA 1ZDVA 3D51A 4DFLA 2JLDA 4L7SA 4WRGA 2K9XA 5TSSA 2KOXA 3G33A 4QTEA 3VULA 5D1JA 4NM7A 4NW6A 4YSZB 1QL6A 1GB4A 4WJQA 2QHMA 5M44A 2XCKA 2GQGA 5BNJA 1UNLA 2WPAA 4GCJA 2FO0A 2ZM1A 4CXAA 3DX3A 4M68A 4XH6A 4LRMA 5DT0A 1I49A 4D1XA 3OT8A 3S1HA 4ACGA 3KAWA 1OL7A 3KYDD 4XX5A 3PLTA 4CTBA 4TUUA 3H9OA 3ZLXA 1CZPA 2O6VD 3ZUVA 4YNEA 2JVCA 5HE1A 3ITZA 1IGCA 2WWZA 3HV6A 4FE2A 4N4SA 1GZKA 4ANQA 3R9OA 3KRLA 4DH1A 1XBAA 3U52E 4G6QA 1OECA 4AKVA 1YOVB 4JG6A 3QRIA 3UZTA 1Y6BA 4UX9A 4NKSA 4EK5A 4J96A 3HAHA 1JWSD 3EN7A 3L1SA 3O96A 1KE6A 2Y4PA 3DNEA 4AT4A 2KDMA 3URYA 4IC7B 1I09A 4ARKA 1RW8A 1K3AA 4DF3A 3PRFA 4LCDE 4WIHA 2ONLA 3UNJA 4M8TA 1SVHA 4F00A 2C47A 2HZIA 2UZOA 3VTVA 4M8NA 4M0MA 3U54A 3UDZA 2Y5PA 5J7HA 3P63A 2LVPA 3DFCB 2VTTA 3CY3A 3V5LA 5CX9A 2OJ9A 2CNVA 5AR4A 3A7JA 4QMSA 2AQ3B 4TV3A 4E6CA 2KVRA 2C08A 2N1VA 5ANEA 5JGDA 1LFDA 2JZPA 3FUPA 3OWEB 1ESFA 3O50A 2G9HD 1WF9A 2UYZB 2R3PA 4IAYA 4EZYA 2X8EA 4FSUA 4FT9A 3V5JA 3PXQA 1WGYA 5AZFA 5DA3A 4OT6A 1F1HA 3HAJA 3AC4A 2BDJA 2PYWA 3N4VA 1WZ0A 1PUTA 3GOPA 4FV5A 3A9JB 2IZSA 1FEHA 3V62A 2QG5A 4CQGA 3TUBA 5HD7A 3M1SA 2ITYA 4IVAA 2IEWA 1X04A 3PXRA 3DAKA 4EZKA 4O7RA 3AE2B 2N9PC 3K54A 2O64A 1XR1A 4CQEA 3H4JA 1K9AA 1KSWA 1C3TA 2EB2A 3LB8C 1OPLA 2WQMA 5ICPA 3E9SA 1MHHE 3CR0A 4HYBA 4GK4A 5C3JB 3M3JA 3VUXA 3BGPA 3R71A 4HEA1 1VJKA 2F7XE 2R2PA 4J53A 4JWEA 2WDTB 2OLCA 1PYXA 4MWHA 3GS2A 2CSNA 4MM3A 4FRFA 4FK6A 1TYGB 2XB7A 3U6JA 2F7ZE 1TFFA 4HDQA 1Q61A 3HUCA 4EI4A 2C6MA 4EH8A 4QMTA 2XEZA 3OWJA 3O71A 4FA6A 3C0GA 4FTIA 4N0SA 4K3BA 4L43A 1XBCA 4HVHA 3Q8FA 5JXVA 2BHEA 2WOUA 5LXHA 3NUAA 2NNWB 2FSLX 4LGDA 2XH5A 2C5OA 5AEPA 3Q9YA 2UZDA 4FV6A 3RM6A 4AXEA 1W7HA 3D52A 5CSVA 3ETAA 1YI6A 3V6RA 4FSMA 4WNMA 3MY1A 4NQKE 3VN9A 4BRXA 4FULA 1SJED 3F3WA 3GCPA 3E88A 5DR9A 3VIDA 3ML8A 3R22A 3M95A 5A54A 3PZ7A 3C4ZA 2BTEA 2DQ7X 3GFEA 3MFGA 3PY1A 1NENB 3F66A 3QL8A 2X39A 3MC0B 4EK3A 5KMJA 4A9YA 1PXNA 2R3NA 5ANDA 4FIJA 4O7SA 2YERA 4GRBA 2GQRA 5HTIA 5LWMA 3KVXA 1ZOYB 4CQNA 3DPKA 3ULZA 3FWQA 3VUWA 4ANOA 3NW7A 4RVLA 4KX6B 4H6HA 3MN3A 4N6YA 4II3B 4IADA 4MT5A 2WEIA 5IQIA 2X6EA 4GU9A 5AUVA 4R1VA 4JDIA 4HZRA 2UW6A 4LI5A 3W0OA 1ROEA 3RPRA 1V6EA 4DT8A 5AV3A 2C3KA 3CCNA 1X8BA 3SC1A 2QDFA 4OT5A 2ETKA 3P7AA 4NNJB 3UYSA 1JCKB 3ER8C 4JXFA 2ALWA 4RF0A 2ONQA 5TT7A 4DQOC 3APDA 4BIBA 4WJNA 1YDRE 2WXVA 4I4EA 4Z7HA 4YZ9A 1QWUA 2VWIA 3UZPA 2AC5A 1VR2A 2VUWA 3OT3A 3ZO2A 5C1QB 3QWZB 4EZJA 1Z9XA 2C5YA 1J1CA 3LFQA 3AI5A 2CKEA 4CLJA 3RGFA 4AT3A 3E8EA 1G6JA 4FKPA 4FEVA 4E81A 3IOPA 3ZYYX 3ZS5A 3NHEB 3NRMA 2DZMA 2RSUA 3BV3A 3WZUA 2BAQA 5BV3A 3PZEA 2EMSA 2QR7A 4ZYSA 3FLNC 1Q0WB 2YL9A 4PPCA 5C4KA 3SRVB 2N9XA 2ZB0A 3K5VA 3QZGA 2CMWA 2X9FA 5FWKK 4AG8A 1J0GA 1YVJA 3T9LA 3A9JA 4P2KA 3QX1A 3ZM4A 2R61A 1MRUA 3R6XA 1UU9A 2BRBA 4H58A 3IAM1 1Q8UA 3QKMA 4A3PA 3ZO3A 5LCJA 3U2SC 3Q5ZA 1PGBA 4E5WA 4I22A 3VWAA 4JAIA 1ZOGA 2C6LA 2QO2A 2O65A 3ZIMA 3BLBA 3ZJVA 4EORA 5TR6A 5IKCM 1WBSA 3EFJA 1YMHE 2OGVA 5E6NA 2HZ4A 3A1QA 4UMUA 2RT6A 1K52A 3B51X 3EJPA 4BDFA 3OJ3A 1TS3A 5CEIA 4CV8A 4F6WA 2JT4B 2XP2A 4K11A 4BVUC 4F9CA 3QQUA 2KDBA 1H07A 3CQUA 3AU4A 3LMIA 4G2FA 1FM0D 3EQCA 4I5MA 1KUTA 1STEA 4O0RA 1F0ZA 3P08A 1OL5A 3MTFA 3TZ7A 2AYPA 3VONA 4WPCA 1QOBA 3BBTB 3RVGA 2FBWB 4IAAA 4F7LA 4JLCA 5ETAA 3EECA 3WARA 4JBQA 1GAQB 5AZHA 5AV1A 1BMKA 4RCOA 5D11A 3BYUA 2GTMA 3FHRA 4AZGA 1Y91A 3B0AA 2MA9B 4QQJA 1YQBA 3MTNB 4IQ6A 3ATSA 3PG3A 1KFYB 4HPLB 3VUIA 3V60A 5L83A 5CXHA 1FMAD 1WX9A 4I41A 5LXIB 1FVTA 4BHNA 3A7FA 4ZMFA 4NJ6A 5L4QA 3UMXA 3PO0A 2BW2A 3TZ9A 4UXLA 5ANOA 2A1AB 4CRSA 5AUZA 2BBCA 3G0EA 3IG3A 2QCSA 4RNAA 3PXYA 4D9TA 3VRYA 4G9CA 2ZV7A 1T3QA 3NVKI 3C0RB 4R5YA 4XJ0A 1HTOA 2TSSA 4F09A 1HE8A 1N62A 1K51A 3ZLWA 5AAFA 2B76B 2LGIA 4LG4A 3PRMB 4ENYA 2ERKA 4C58A 5E1EA 2PVGC 4FJVA 3RZBA 3KUZA 4BI0A 4LRKA 1UGMA 3DJ7A 3QZHA 4EOMA 4HXDA 3GU6A 1YN3A 2QI8A 3CPCA 3TNPC 3MBLA 2KFKB 4WSQA 2CJNA 3FYKX 4R7IA 3VUGA 4CV9A 1SU8A 3RNGC 2XKFA 2ZVOA 4U8ZA 4HPMB 4FL1A 4KS7A 2JAMA 5C8KA 2YIAA 2QKWA 2LMCA 4USDA 4O21A 4ZSGA 2PMVA 1BLXA 3UE4A 3AH7A 1WBPA 1RLFA 5LWNA 1W98A 1XH5A 1JVPP 1WBWA 3ZXZA 5KHWA 1JROA 3PUPA 5IP4D 3ACKA 2ZYBA 3WBLA 5JSMA 3L4PA 3S2PA 3RNEC 3GXLA 2XNGA 1MHXA 2YLLA 3NS1A 4AZVA 1E8WA 4EZZA 3AE9B 4OVUA 3R7VA 5DPSA 5CF8A 5HI2A 3NVWA 4F1SA 3M63B 1QKZA 4IX5A 2FAZA 1OEYJ 1YX5B 4GLSC 3RM7A 3M3WA 4HK2A 5GXGB 4ASXA 1YDSE 1Y8YA 4TT7A 4FV9A 4LNFA 4L8MA 2IPXA 1NW1A 1U5RA 1YQ4B 4FEQA 2PK9A 4E6QA 4TL0A 4ZHPA 4AF3A 3VS3A 4BB4A 3HIZA 4AZCB 2E9NA 4G11A 3FSFA 3O5AA 2XALA 3ZXRA 5M51A 1YOLA 5A4EA 4DTBA 4JIKA 4EHVA 4K7SA 4O83A 1H4LA 3TCAA 5HLNA 3FI2A 4RFMA 5FTOA 2OJFE 3MIYA 3RKBA 3NZSA 1CTPE 3APCA 1JSVA 2PMNX 4E71A 3DBHB 2PE1A 3Q53A 4UB7A 3NUYA 5EI8A 3TUCA 2X5CA 4OBPA 2GAFD 3PIZA 4QQ5A 2BKRB 4PYUA 1SE9A 2NRYA 3KXNA 2KC2A 2EXMA 5JQ8A 4RA5A 3UPZA 2BRNA 1WY8A 4EE2A 2WINM 5HCZA 4YLJA 2X2KA 2F18A 2MBQA 2JGZA 4BIDA 4FSWA 3H10A 1E9HA 3TV6A 1MUOA 1IA9A 2IVSA 2QKWB 2XRUA 1QPEA 2IO0B 2GBNA 1UD7A 2INNE 3ALOA 5IQCA 4D1SA 1N63A 2JWZA 1C4PA 3LXPA 5DVRA 4NTSA 4EZRA 4XP2A 2DAFA 1ZY4A 2VO7A 2BDWA 4GT3A 4B4LA 3C0HA 4IM0A 3KWLA 2E9PA 4NWMA 4X6RA 3WE8A 1RWSA 3IT6B 5FBNC 2LVQA 5CZHA 4AZSA 1GN9A 4JIOU 2GF4A 4GUEA 5ETCA 3VS0A 3FI4A 4B95A 2E9OA 4JI9A 4ZZMA 4XG3A 4YL8A 4PL4A 5HBHA 1C76A 2IYDB 3KYCD 1AARA 3IO7A 2JX5A 2B9HA 1B38A 2WXPA 3OW4A 2C6DA 3HEGA 4DC2A 2Q83A 4DXFA 4RC2A 3OEZA 2QU6A 3Q9ZA 4DEEA 5FUTA 3JSVB 4TQ1A 3P23A 4LUDA 1FNWA 2FCNA 2ZMDA 2QD9A 2W82A 3FBVA 4XG6A 1M2QA 4PO2A 3F82A 2PULA 5FRIA 5KBPA 5CSWA 2C9WB 1JKLA 3TTIA 4AXDA 1V1KA 2EELA 3ERKA 2H8HA 3MW1A 3MPAA 5CHVC 4IMYA 2X8DA 3UBDA 3W1SC 1CQVA 4GT5A 2K3UA 3UO5A 1PXJA 4JE3B 3G90X 4OTIA 3A4RA 4O7NA 4HVGA 2LXAA 2W9ZB 3NUNA 3E64A 3BINA 4FTAA 4PX6A 2O5KA 2UW4A 3IVFA 1ZYLA 4AW5A 4XC2A 2K8HA 4GIVA 3B2GA 2OJJA 5JMSA 3CS9A 1DI9A 1ZARA 3VBXA 3R1SA 4RM8A 1FBNA 2XNOA 4IDIA 2ZM4A 3IAS1 4OZBA 3BHYA 2WMUA 5C8NA 1XMLA 1KF6B 4QMLA 4R3CA 2PPQA 3K5UA 2M8SA 3FYJX 2FCQA 2PUNA 2WXLA 1CKIA 4C4FA 1WYGA 3C4CA 2PMRA 1BL7A 2OW3A 3N1YC 1SBBB 4G5PA 5CAVA 3ZFYA 2JEDA 3T4AG 4JQEA 4BFRA 4U0IA 3BL7A 5E84A 3QNIA 3UIXA 4XV9A 1XMMA 2FVDA 3VVWB 3W5UB 2C60A 3UG2A 4DEGA 4NJCA 2BWFA 4PMPA 1U54B 3AGLA 3EJUA 3Q8EA 5H9BA 4ALWA 2C5LC 3SAYA 3HRDD 4LOQA 3PSEB 3JUHA 3FE3A 3ML9A 3WIGA 4DLJA 4NZLB