4IM0A

Structure of tank-binding kinase 1
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
659
structure length
619
Chain Sequence
GSMQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRNIKPGNIMRVIGEDGQSVYKLTDFGTEEYLHPDMYERVLRKDHATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVMEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase TBK1
publication title Structure of Tank-Binding Kinase 1
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 208
structure length 619
sequence length 659
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF18394 TBK1_CCD1 TANK-binding kinase 1 coiled-coil domain 1
A PF18396 TBK1_ULD TANK binding kinase 1 ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4im0A02
1.20.1270.420 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4im0A04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4im0A03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4im0A01
3CD3A 1JVPP 3C50A 4FV4A 3G9NA 3W1YA 2F9GA 5F95A 3EL7A 4X57B 3ZONA 3CEKA 3OMVA 4FTTA 5I9VA 4AZEA 5CU4A 4X21A 3LAUA 3RJCA 3PHWB 1M14A 5JHBA 3O50A 2BR1A 2EB2A 3P79A 3KN5A 4UMQA 4NZWB 4HVSA 4F9WA 4FKOA 4FADA 1GNUA 4JIOU 3LW0A 4D2VA 3EC8A 3HM6X 3ZTCA 3WAOA 3O7LB 1Y91A 4P5ZA 3ZRCA 2BIKB 4X3JA 5IU2A 3MH3A 2YACA 2H6DA 3GU8A 4CVAA 4DGNA 5AR2A 2EXCX 2FO0A 3DK7A 3SOAA 3K3IA 1XHAA 3M2WA 4HZSA 1UU9A 3WZJA 4FYNA 3QZHA 4GDLB 3TZ8A 2X8EA 4U81A 3N4UA 5ACBC 4WKQA 3LZBA 1VD2A 3KVFB 4Z16A 3WZDA 5IH6A 3LFQA 5DCNA 3UVQA 1NVSA 5HORA 4CFVA 2X7GA 1OGUA 2FUHB 1WF9A 3KVXA 4NAWA 4LG4A 5AAFA 3QHRA 5C1QB 2DS1A 1GZNA 1YJ1A 2ZCCA 1KE9A 2GHMA 4PX6A 1WM3A 5FDPA 4YJRA 3ULZA 3ATSA 4CSVA 4DGGA 2NO3A 4F0FA 2YJRA 1FXTB 4HJOA 3DBDA 3FZ1A 1YOJA 3M95A 3WE4A 4MQ2A 4FKLA 4ITIA 2XM8A 4XHKB 3GCUA 4MD9E 5DHJA 4FG8A 2ITOA 3JXWA 1OIYA 1MUOA 3FMJA 1JKTA 4Z9LA 4O7NA 3TI1A 3PRFA 4FSRA 2NPTA 3K9OB 5DBXA 3FSKA 4KS7A 3EFLA 3CIKA 4MSMB 3RAHA 2BPMA 2YIYA 2WMQA 3IKAA 1V5OA 4XJ0A 1TGZB 3IG7A 2C6TA 3FLQA 5CX3A 3SG8A 3EN4A 4WBBB 4LMNA 5AP3A 5EK7A 2JDRA 2QO9A 2P55A 3CJGA 3L17A 2YAAA 4R77A 2YHVA 3VTWA 4E93A 5BMSA 4YJOA 4DA5A 2JLDA 4FV6A 3BLRA 1KOTA 4XH6A 3FAAA 4ZS0A 5HNIX 4MK0A 1H24A 1RAXA 2RFEA 3LCDA 5J87A 4D5KA 2ERKA 2BTSA 3O8PA 3DTCA 1KJTA 4F9AA 1PJKA 5HO6A 4J98A 5AZHA 2B3AA 3Q3FA 4DBGA 3VBWA 1ZZ2A 2B7AA 2ETRA 2YM4A 4MNFA 4K33A 2DYLA 4MD7E 1EF5A 3NS9A 2OIQA 5CHFA 3TN8A 2X2MA 4Q9ZA 5I9ZA 3BLQA 4C4HA 3ALOA 3GP0A 5CSVA 4FIHA 3L9MA 4X3FA 2GHLA 2PUIA 3R0TA 3EOCA 4G6LA 2KMAA 4EC8A 4EOSA 4YR8A 1EO6A 4MJSA 2Q0BA 4FBJB 3WF7A 3F61A 3VJOA 4YTCA 3KH0A 1UZXB 4ANOA 1R4NI 3DJ6A 3PXFA 4D9TA 4FUYA 1SYKA 3DK6A 5J9YA 3W1SC 4EEWA 4B6WA 4LGGA 4WUAA 4M8NA 3BGPA 1W98A 3R01A 2GQRA 4Y5QA 4FZAB 3OXIA 4O0RA 4NW6A 2O6VB 3DFCB 3P7AA 2DHZA 5L8JA 5I9XA 4IDVA 2G2HA 3PYYA 4EOLA 1WJ4A 2C4GA 2MBOA 2ERZE 1U5RA 5FEEA 1YXSA 2O5KA 2HTHA 5KKRB 2VWIA 4YLLA 3D0EA 3ZTDA 4QMTA 3GCPA 1NW1A 3OEZA 2ZNVC 1KLVA 2Q83A 2KX3A 4I0TA 4IM3A 4UY9A 4O7WA 4JDKA 3PRZA 3H0ZA 5AM6A 5CF8A 3MS9A 5EI2A 2C30A 4CFXA 4L68A 2C5LC 1DAYA 4YZMA 3LFCA 4UX9A 1OIUA 1WBWA 3SX9A 4PS8A 3MW1A 1BUHA 5DPVA 3E62A 2X4ZA 2W5BA 3ZRLA 4RWLA 3GOEA 4AT5A 4ANXA 3KKVA 3DBQA 3UODA 4MXYA 2OIBA 1LP4A 4CLJA 2KQSA 2WMRA 3PVBA 3QX4A 4CMUA 3VUWA 2W9NA 2W4OA 1WZ0A 2J90A 3DCGA 2NP8A 4LQMA 2VTRA 3AMAA 4P5QA 5E90A 4L3JA 4U3ZA 4EHVA 4OGRA 1R4MI 5L2IA 2XUUA 2BDFA 4H3QA 4DBXA 3Q4UA 3SXRA 2R3KA 3RWPA 3QCAA 3LQ3A 4AS0A 1KWPA 1G8AA 3PJ8A 3HX4A 1H1SA 4AZFA 4EH5A 4BC6A 2ESMA 5KZ0A 3QQFA 2VV9A 5LXHA 4D5HA 2ZV7A 4D2TA 5B2KA 2KFJA 3LFNA 2WU6A 4J1RA 3DZOA 2LD9A 5LWNA 4KD1A 2KNBA 3FE3A 3VRZA 4RX7A 4MBLA 4QMQA 4IAAA 3G6GA 1GJZA 3PZDA 3R71A 2ASQA 3VUTA 2CGWA 3NCGA 5BMMA 2CU1A 2WQOA 3C4XA 4Y85A 4EOQA 5EOLA 3UE4A 4D28A 4RC4A 4EH4A 4OTWA 4FSNA 4DH7A 3QHTA 5A46A 3VUYA 3EQFA 3HNGA 5H8BA 4FJZA 2KN5A 2QODA 4M0YA 4BOSC 4ZYNA 2QO7A 2Z7RA 5K0KA 5BVWA 4ZS4A 2YIRA 3F3VA 2I1JA 4TYEA 2QVSE 2RD0A 3KY2A 1WGGA 2CCIA 5CU6A 5M4IA 5CSHA 4YC3A 3WYXA 3TDVA 3NYNA 3OY3A 4L3LA 3DBFA 4BFMA 3IHPC 1LEZA 3FI4A 3GENA 3V8WA 2M17A 2JY6A 3AG9A 5JEBA 2NCNA 4RJ5A 2W0JA 2WMXA 2OGVA 4D9UA 4C36A 4R3RA 4EBVA 2W4KA 4AGCA 5FP6A 1Q8UA 3ZO2A 4CFFA 4JDIA 1UGMA 2MP2B 2R3OA 1WBPA 2CKQA 4JAIA 4FZFB 2IZUA 3ZW3A 4EUTA 3OFMA 2LZ6A 1JKLA 3PPKA 1FMOE 3U4UA 4FTKA 3UG1A 3ZNID 3BQRA 4K0YA 4GOCA 3D32A 5KMKA 4XBUA 4NIFA 4OUCA 5CT7A 3L9LA 3ML9A 3KK9A 3HV7A 3SD5A 4UWBA 4O38A 4IAYA 5IPJA 3PY1A 3NR9A 3QHWA 1WGYA 1FVVA 2Y9QA 1B6CB 2QHNA 3A4OX 4U45A 4L8MA 3RULA 4NM7A 4EOJA 2WMBA 3MY5A 4G31A 2UYZB 4ANLA 4GSBA 1A9UA 2R2PA 5CF5A 3NVKI 5M57A 1FOTA 5BUJA 3RK9A 2NRYA 2MLBA 5GINE 3VULA 1APME 4BB4A 4GDKA 1A48A 2DYOA 2OW3A 1QCFA 3A9KB 3RALA 4AA5A 2J9MA 5DN3A 2BGFA 2EKEC 4PWNA 3NUSA 4A9YA 3NUPA 4ZTNA 4GT3A 4FVQA 4XNEA 3QTUA 5A6OA 4C4IA 4GKHA 4WRGA 4ANMA 4BOZB 4HGSA 3P9JA 4TYIA 3UBDA 1TQMA 3PPZA 5HCZA 3BYOA 2OJIA 4U9AA 3V5JA 3DBCA 5BVKA 3FKNA 5HCYA 4KSKC 4JNWA 1U54B 4AOIA 3Q9WA 2YCRA 4L01A 4CT1A 4AF3A 3NYOA 4DC2A 5K9IA 5HG5A 4DTAA 1ZZLA 5IF1A 4X3FC 3PA4A 4G3CA 3OROA 3A7FA 4KBCA 4OLIA 3VS0A 3OWLA 1M2PA 1STCE 4ACCA 4BTJA 5LXMA 1H08A 5C27A 4N57A 4AG8A 3EQDA 3DTWA 4IFCA 3O0GA 3OUKA 3MA3A 2PMLX 2QLUA 2HWOA 3ZEWA 3U9CA 2WXVA 4BCHA 3U7DA 3ZDTA 1PXOA 4ANBA 3DY7A 4R7HA 5LVPA 3ORPA 5FTQA 5AM7A 3D7TA 2PTKA 2GBRA 1E8YA 3OD6X 3ODYX 5JKGA 4ZEGA 2QOIA 2LGXA 4RM8A 4YMJA 2ITPA 4F64A 3TM0A 2BRGA 2VTNA 3COMA 4W9KA 3CKWA 3RHXA 2QOKA 4GIIA 2K6QA 2XBAA 4RSSA 1H28A 1SIFA 2J6MA 4FTJA 1X1MA 1CDKA 4WJQA 4LRMA 3SXFA 4IX5A 1UVRA 4F09A 5CSPA 3SC1A 4KIQA 3L9PA 3PFQA 5D1JA 4K77A 2HAKA 5KHQA 5DIAA 4C3RA 4L9IA 4FTIA 3P2BA 4JVGA 2WEVA 2YWPA 4PS3A 3E7VA 4AW2A 1E1XA 1WXMA 2IO0B 1RRBA 3KW5B 3ZBXA 2J7QB 3COHA 3GQLA 2O8YA 3ZSIA 2O2VB 2B9FA 2L05A 3GVUA 5E91A 3AC1A 4QO9A 3AT4A 2R64A 5IUHA 5M4CA 5C8NA 4K18A 4H05A 5FBNC 3Q5ZA 3BRBA 3O8UA 4LOOA 4YNEA 3C13A 4I22A 1AGWA 3NW7A 3BWJA 5TOZA 4ACGA 1WCCA 3C0RB 3H9OA 3BYSA 2CS4A 2UV2A 3WI6A 4XMOA 3Q04A 4QD6A 3ZKJC 4XCUA 1T45A 5C03A 3Q9XA 1SGHA 3UIUA 3NUUA 4EQMA 2X2LA 4I4FA 3DLZA 4IW0A 4KSQA 5K5XA 4ACDA 5BX0A 4WO5A 4BDIA 3QC8B 1Y8YA 2YWVA 1RJBA 3UJGA 3BINA 1WXVA 5KMLA 1URWA 4L6QA 4EK3A 4C2WA 3KCFA 3ID6C 2ZDTA 1WBNA 3MJ2A 4FL1A 4AWJA 3H7SA 3PG1A 2GFSA 4DFNA 3WA0A 3R9OA 2L7RA 3QWKA 1XQZA 1ND4A 3ZRMA 5AFVA 3OLMD 3QBNA 2DUVA 3DV3A 5AP4A 3DKGA 5IEXA 5L6OA 4ENYA 4LJPB 3DVNV 4IB5A 3RAKA 3LJ0A 1LM8B 2QKWB 4WNPA 4GSWA 4BZDA 3JYAA 4II3B 4RVLA 5J1VA 3MTLA 5E6NA 4IJPA 4WSYA 1YXTA 2IG7A 4FEXA 5A14A 2PEAA 3LFDA 5AIKA 3OJ4B 3NUAA 3GUBA 2A5UA 1ZYJA 3UZTA 1E8XA 4DH5A 3MVLA 4GK3A 4D4SA 4Z7HA 3UTOA 2B9IA 1MRVA 3NUNA 4RX9A 1NT2A 4X6RA 4BHNA 2UZVA 2KLCA 4EONA 2MQJA 4N6ZA 3ANRA 3OHTA 4B9DA 5CAPA 1VYZA 3PY3A 5BYLA 4MELA 3NX8A 4FA2A 2JITA 2XRUA 1JNKA 2PWLA 1Y57A 3W10A 3EB0A 3DGKA 3W2QA 4PMTA 3T3VA 1M2RA 4RLLA 4CD0A 3Q96A 4NPNA 2PE0A 4I6PA 3R2BA 3WAMA 3MPAA 4RJ8A 3LVPA 2R3MA 4J7BA 3DVGY 3O65B 4OVUA 5IH5A 2VO7A 1AARA 1OI9A 4U79A 3G51A 2W1CA 5IEVA 2XBJA 3MGYA 4KINA 4EK6A 4CG8A 1Q3WA 2K8BA 4J71A 4AOTA 4DEIA 2OLCA 4KKGA 2VWZA 3R3MA 5DPTA 2HZ0A 2VTLA 2WQNA 5L4QA 4IZ5A 4EYMA 1DI9A 1OKWA 3SHEA 4EJ7A 3C1XA 5EI8A 2EXMA 2OJ9A 3PTGA 4FTCA 4FHJA 3KXGA 3DLSA 3BX5A 3ALBA 2J7TA 3NYXA 4B95A 2JKKA 3A2CA 3KMMA 4WG4A 4IMYA 5HIBA 1OL5A 4RFYA 3PVWA 3I5ZA 3VH4B 4FT7A 3FMEA 5CEQA 5HEZA 4HVGA 2ZVNA 4WUNA 1OPLA 2W96B 3HZTA 2XA4A 3KRRA 4ZTQA 3PLVA 2KDIA 5H3QA 3VBTA 5C8KA 4NFMA 4GEOA 2N9XA 3PJ1A 4KRDA 4MM3A 3KL8A 4U41A 1IRKA 5FEQA 5EFQA 4FV8A 3HA6A 1CMKE 5ANEA 2IYDB 3ENHA 4F1OA 2Y7JA 4IZYA 2XNOA 4GCJA 3G0FA 4E4MA 3DVGX 4WRSA 4O22A 3TL8A 2KFKA 4M68A 3HV6A 3NIZA 4I23A 1O6YA 3MWUA 4R78A 5FP5A 4X2FA 2PVLA 4RWJA 4ALUA 1K9AA 3JYUA 2XF0A 2BAJA 1PMUA 1Q99A 1QMZA 2W1GA 2VTHA 2IO2B 5GZAA 1Q62A 4YNOA 3VWAA 5HBJA 2XZSA 1MG8A 2PVFA 2OF4A 3VTVA 4V04A 1YHVA 3UP7A 2HZNA 4QP6A 4LRKA 4YPDA 3ZC5A 2LVPA 1XH9A 2C6EA 4AQCA 1Q5WB 3R7OA 3WYYA 5E8TA 3KXHA 3WZKA 5AZFA 2QU5A 4A4XA 4DN5A 4FG9A 4YGAA 3WIGA 5AUYA 1J1BA 2GS7A 1UELA 3UQFA 1U4DA 4EHZA 1J8CA 4EYJA 1FVTA 2WTJA 2BPSA 3D83A 4FJYA 4ACHA 3V3VA 4KBKA 3ODZX 2MWSB 3ZLZA 4MX9A 4O27B 4RM9A 4ZJJA 4YTHA 5CEMA 1RQQA 1ERKA 4E5WA 3G5DA 2MP2A 4EFOA 1R1WA 4BTMA 5E1EA 1YQJA 1A5RA 2C7HA 4ALVA 3PUPA 3D14A 4OTFA 3IO7A 4PPCA 4AW5A 4RZVA 4QTAA 3VS1A 1TBEA 2H96A 3MFUA 2YFXA 2K8CA 4FNWA 4TL0A 4O0XA 2KHWB 2PE1A 4IWPA 1GZOA 2VWBA 3D4QA 3HEGA 4I6QA 3CF6E 4FSQA 4FTLA 4RJ3A 4M15A 1I09A 3ZZEA 3DAEA 4FTRA 2OZAA 3F82A 4FUXA 3P1AA 5HZNA 3M63B 3R9RA 4ANWA 2BROA 3R9NA 4G5JA 2HW6A 4F8CB 3NIEA 3MJ1A 4ZK5A 4MWHA 4X2GA 3K5VA 2BYFA 4QPSA 1M7NA 3PLAE 3VBVA 3UDBA 1IG1A 1H1QA 1OMWA 1YI3A 4X2JA 3VS5A 3NWWA 4CQEA 3ZNGC 5KMJA 1WGHA 4II2B 4A9SA 4X6QC 4A20A 4MXAA 4KS8A 5EYMA 1YHSA 4EK4A 3C4ZA 3L16A 2YM5A 4G11A 1SVGA 4RIYB 4W8DA 4FLHA 2WAJA 5HTBA 4I6FA 3H6NA 4PDYA 3A7IA 2MBHA 3W2PA 1KE5A 1CKJA 2VWXA 5TR5A 3W16A 2R3NA 5L2WA 1U54A 3DDPA 4FEQA 4E1ZA 5EW3A 2UVYA 4KKHA 4V0GB 4JOAA 2KMCA 2O64A 5AWMA 3EHAA 2BKRB 5AUWA 4FKGA 2AC5A 3FYKX 5C8MA 1WJNA 3PSBA 3ZH8A 1VR2A 3QA8A 1CSNA 5AR7A 4TYHA 4AT3A 4TY1A 3MHSD 4M69B 5EQYA 2SRCA 2QOCA 4DBNA 5H9BA 3LFEA 2R7IA 4GH2A 2RR9A 2XNBA 2ZPNA 2W4JA 2UZOA 4OVVA 1ZXEA 2I40A 2E9PA 3P7CA 2LI5A 5M51A 3GC0A 2VX0A 3SG9A 4PP9A 2KVRA 3SW7A 1XH8A 1GIJA 3V61A 4AJWA 3PY0A 4O0TA 4FKQA 4YJVA 4OT5A 4FSUA 4IWDA 3I4BA 3NAYA 2L8JA 1JRUA 4C4EA 4AA0A 3UOKA 3FSFA 5I4NA 4TV3A 4C0TA 4JAJA 2FSLX 3HP5A 4ZSLA 4HYHA 3GNIB 3PLUA 2LXCA 1REJA 2PPQA 3UOLA 5CAVA 3MIAA 2O0UA 4GJ3A 4JBQA 2R4BA 2Z7SA 1Z5MA 4MKCA 3KUZA 4ZIMA 4JJRA 4UN0C 4Y72A 5AEKB 3ULIA 2BKFA 4LRJA 4FV0A 3CTHA 4ASXA 3C9WA 3QGWA 3QJZA 5DOSA 4BBNF 4IXPA 3RI1A 1OL6A 3RBWA 3EFJA 3VXWA 4G9CA 4ZSJA 4XOYA 4HCVA 2YA9A 2WTDA 3TJDA 4HW7A 3CJFA 2JWZA 4FNYA 3HIZA 5HVKA 3O8TA 4FKRA 3QIJA 3BKBA 3C4CA 2Z0EB 4G17A 4Z7GA 4O0YA 5BVOA 3HLLA 1EUVB 2KDEB 3VUIA 1XWSA 5CHWA 4NYEA 4BGGA 3EN5A 1QL6A 2X7OA 4OTRA 3R8UA 4TQ1A 1JSVA 4I0RA 1WI0A 2Z59B 3AXWA 4BHZA 1T0YA 5KMNA 4J52A 3P78A 3MSSA 4EOPA 2NS5A 3KA0A 3LJ3A 2VU3A 2ZVOA 1NVQA 3WF9A 3WF8A 2XEZA 4NSTA 2PZPA 1GZKA 1YKRA 3DKOA 2KQ7A 2BILB 1UA2A 3AT2A 1WFCA 5BUEA 3L1SA 3PVGA 2K25A 5BPYA 4HYSA 1PXJA 1G5SA 5FG8A 2J0IA 1M2QA 2FSMX 3HRBA 4K8AA 4ZZOA 1ZWSA 2AUHA 3TNPC 4C7TA 5LVNA 1H8CA 3W1FA 4FTAA 4R1VA 2MW5A 3LXLA 2XKCA 4GYIA 4FE2A 3SQQA 4NM5A 5IQHA 1VEBA 4I24A 2V22A 2JDVA 4Z3VA 4ANSA 3QYWA 3H9DA 3PT2B 3IK3A 2YISA 4K7SA 4I93A 2HOGA 3R7GA 1H27A 3KXMA 2BF8B 2JT4B 3TKUA 2VN9A 4P4CA 4QYHA 4HCNB 5H2UA 1WM2A 4LUEA 2WMWA 1LXDA 3C5IA 5LOHA 4NQLB 4BL1A 4WBOA 2WTKB 3BGZA 2FIDA 3FXXA 5DG5A 1JPAA 2GBNA 2I1MA 3FI3A 3U6HA 4BCJA 1V49A 1PMEA 2WZJA 2NNWB 3TNIA 2CR5A 4GT5A 1WMHB 1LEWA 4MBIA 3ZC6A 3LKMA 2ZPYA 3AOXA 3RPOA 3AD4A 2L0FA 3F88A 3ACKA 5ANKA 3FL4A 5FD2A 3GOKA 4UMPA 3F2NA 5J95A 3OZ6A 4XV3A 3HAMA 4OBQA 4L52A 4WT6A 1UH6A 4GG5A 4F08A 2KJ6A 4MTAA 3RP9A 3HK0A 4NJ3A 3ORIA 5JQ5A 5B0XA 4MNEA 3IBEA 2XVDA 2GQSA 4YJPA 3NHEB 3OCTA 2ZVAA 1IYFA 2UW6A 1SVHA 2WMAA 3N4VA 5JSMA 4BDCA 2P2HA 2OG8A 2C3KA 3D94A 2C5OA 2W7XA 3ZLWA 3VJNA 5BVFA 3UPZA 3KB7A 1JKKA 3ZMMA 5LMBA 4O96A 5CALA 2Z02A 5BVNA 3PJ2A 4EKUA 1H0VA 3OVVA 4HGLA 1KE8A 4RMZA 4KIOA 1FQ1B 3I6UA 4RC2A 3EQRA 1P98A 2GHGA 4NM3A 4MGIE 1WBSA 2FVDA 3CR0A 4ARKA 3JSVA 2W06A 4IEBA 4HNIA 3PIXA 3HVCA 2YM6A 1WVWA 3DK3A 5KO1A 4NTSA 2ITUA 3T9TA 5IQFA 2IVTA 5H8GA 4CO7A 4K11A 2QO2A 4PPAA 4WOVA 3R66C 4FKJA 3S0OA 4H58A 4RGJA 3ZUUA 3ZYAA 3GC8A 2HWPA 2C1BA 4XRJA 3K2LA 4M8MA 1Q8WA 1UBIA 2N1WA 2YEXA 4OTPA 1E8ZA 1RDQE 2PULA 3GCSA 2J4ZA 2X39A 4YZ9A 3ROCA 3GU7A 5K5NA 4JQ7A 3ML8A 1KV2A 1OGWA 2ACXA 4BZOA 4DFXE 1UKHA 3FJQE 5CSWA 4QYFA 1HCKA 5CI6A 4RRVA 2VNYA 5TE0A 2ITNA 3HDNA 3VC4A 4RT7A 4BCGA 4FZ6A 1OTRB 3OEFX 4GIVA 5FXRA 4I5MA 3BELA 4E4NA 2WIPA 3I0OA 4RIWB 3Q60A 4LL5A 3V01A 2OXDA 2EB3A 4NKAA 1Q24A 5CEPA 1U5QA 3WALA 3G33A 4XV2A 3TNHA 5CQWA 3TKIA 3C0GA 5HIDA 3AULA 3A8XA 5BO4B 3IW7A 4AJYB 4FGRA 4DDID 3O2MA 3A61A 3R73A 1E7VA 2XKEA 2YCQA 1ZW7A 3SRVB 2JEDA 4QP2A 1YDSE 5EM7A 3KFAA 1YW2A 4OT6A 4BKZA 4FIIA 3QD3A 5EYKA 4FI1A 4CZUA 4D4RA 3ZRKA 1YIWA 2CGUA 1CM8A 2XK6A 3BLHA 4L00A 2PMOX 2QQ7A 2YIQA 3ZRFA 4S30A 4AZVA 3F2AA 3ZUNA 1PKGA 5CQUA 3IW6A 3IECA 5D41A 2XCKA 2Z7QA 2QG7A 4C3FA 2B55A 5DRBA 3VAPA 2PJHA 3MFSA 2E9NA 3C0HA 4UYNA 4CQGA 1J1CA 2BZIB 3BE9A 3KF4A 5DEYA 4MXOA 4GUEA 4G34A 2QOOA 4CFUA 3UIPB 4F0IA 4JRNA 5D6JB 3TV4A 3UNJA 4EH3A 1WZYA 3JVRA 2XEYA 4IB1A 4RBLA 4CEGA 4TNBA 2UZWE 2UZEA 4ZLOA 4FOCA 2V1YA 2GCDA 3BU6A 3W8LA 2KWVB 4UMTA 3QQUA 2UW9A 3A4RA 4MVFA 4L44A 2V0DA 5BQ0A 3EJ1A 4EOKA 4G5PA 2PMNX 4I5CA 1T46A 2X8DA 3PG3A 4IB0A 4EZJA 5J8IA 5K4JA 1Y8RC 3TZ9A 1Q41A 3ONSA 4RIYA 3M42A 1PXLA 2WYQA 4FA6A 3QRIA 3RCZA 4XG7A 5AIRA 3CQUA 4KA3A 3MI9A 1AQ1A 1U46A 5FEDA 2WNTA 4IVCA 4NCTA 4W9FA 5C1ZA 5ETIA 3CQWA 2BZJA 5BNJA 4R5YA 2ZV8A 3DS6A 3LFBA 4DGLC 5DNRA 4FTOA 4G3FA 5K4IA 2RFNA 2HY81 1YX6B 2C5VA 5C4LA 3QX2A 3DQVA 4XLVA 5GMVA 1Y8GA 2C0TA 5JRSA 4RQVA 5E8VA 4MSQB 5J17A 4H39A 1ZAOA 2XK5A 2GDOA 3TWJA 4EC9A 1QPEA 2JKOA 3GCVA 4CFMA 4BCOA 1H1RA 2O2UA 3Q52A 5GIPE 2WU7A 3VQHA 3HV3A 2VX1A 3BIZA 4F7LA 5ACKA 3E7OA 3R22A 2N9PC 3OW3A 4R3CA 4B7TA 2ITVA 2GSFA 3QAQA 2CHZA 4EOIA 4D2SA 2CNQA 2XNGA 4S33A 5EHLA 3EFWA 5LJJA 4BBEA 4CT2A 1R0PA 3S4QA 4ZZMA 4F7NA 2GFCA 1YX5B 4Y73A 1CTPE 3ACJA 3N3KB 4J95A 1NI2A 4QTBA 5CI7A 1WR6E 5G2NA 3QC4A 4UZDA 2HXQA 2N7DA 2O63A 2ZAZA 3TTJA 3FV8A 4FKIA 3KMWA 3PRIA 4XP2A 2VZ6A 5T3QA 3ZDMC 2MBBB 3QQJA 3R00A 4NJ6A 3P5KA 2R3PA 3A7JA 4DH1A 4HPTE 4IANA 4C34A 4LOQA 4YPSA 3D7ZA 2V4LA 4ID7A 2I0YA 1OBGA 2XP2A 4O91A 4E8AA 3VDZA 5DR2A 2E2BA 2R2QA 1EF1A 3B2TA 2W1EA 1W0XC 5FDXA 1XR1A 3QWJA 1M7QA 1WRDB 4K81A 2YLEA 4D2RA 4ZSEA 4F70A 1H00A 1BT0A 2MSED 2XS0A 4FC0A 4EOYA 3WIMA 2X0GA 3TUCA 4F65A 3FQEA 1V86A 4JL9A 4APPA 4EQUA 1WX9A 4WJPA 3CGOA 5EYCA 2YABA 3R7YA 4E3CA 3R8PA 2KZRA 3EZRA 2GS2A 2BRMA 3AXCA 4M12A 3PJ3A 4DXAB 3BHYA 5EQPA 1YI4A 4JQ8A 3VS7A 4CYIA 2ZB1A 4QQCA 4C37A 4W9CA 2UZDA 4FV9A 5TR6A 5IISA 2ITZA 3VHTC 4WD5A 3UF8A 2G4DB 4NEUA 4LL0A 4JG7A 3WARA 3ZNHB 4NK9A 3MV5A 5CZIA 4QMYA 4JX3A 4FR4A 4QP3A 5ANOA 3TL5A 3G15A 3WAPA 1V0PA 4YUQA 1BL7A 4MH0E 4BKSA 5CVHA 1MQ4A 4CYJA 3M11A 3NUXA 3M3JA 3VS4A 4F99A 3QRJA 3PA5A 2NPQA 4TXCA 4YSJA 3C4WA 2CLXA 3R7IA 2VTIA 5CASA 4BBMA 4KABA 2MA9B 3I7CA 2Y5BB 3R1SA 4MWIA 3O51A 3FKOA 3AU5A 1PF8A 4X2NA 4A3OA 3EN7A 2XIYA 5JFXA 3FEGA 3CC6A 1OBDA 1BLXA 3W55A 4A07A 2XCHA 3FLZA 3QZGA 2C1AA 4ITHA 4P7IA 5I9UA 1VCBA 3RGFA 2KX0A 3O17A 2YCSA 4FKSA 4DEGA 4YJNA 2VAGA 3FQSA 2CHLA 3OOMA 3S2AA 4LDTD 2W9ZB 4M66A 3TG1A 3COKA 4MXXA 2QURA 1Z57A 3KRJA 4F1TA 4L7SA 4BGHA 5CAOA 1LPUA 2P33A 3GCQA 3ORMA 3UNKA 3X23A 3MFTA 2W1HA 2MBEA 3U6JA 3W33A 2P4IA 2OOBB 4HXDA 2N1VA 5IA0A 2DWBA 4L53A 3K5UA 1ZYLA 2Y0AA 5DLSA 4UALA 3BY4B 4I3ZA 1ATPE 5D11A 4QP9A 4OW8A 2PUNA 4BCMA 5EDQA 2IPXA 4D2WA 1CMXB 5BVEA 4YURA 4DCAA 3RINA 4WJNA 2PVKA 2EWAA 5A9UA 2I0VA 2KTRA 1H1PA 2R9SA 3VBXA 2ZNVB 2B9JA 2Z60A 3DOGA 5EW9A 3FWQA 3NY5A 3KUCB 3N32A 2OJRA 4ANUA 4FKWA 4XOZA 2ZOQA 5J5TA 4DEEA 2HY0A 2JIUA 2FA2A 1F0QA 3OJ3A 3RVGA 2D3GA 1LR4A 4TWOA 4O86A 2PY3A 2I7QA 3RAIA 2W5HA 3H7PB 3P23A 4ZTHA 1UNGA 4IAFA 3ORXA 2UZLA 4DE4A 2RGPA 4S32A 4CMTA 5JZEB 3QTIA 1S1QB 3PV1A 1I42A 2JZZA 5IA2A 2XK4A 3D2IA 1A06A 3RAWA 2DENB 1P4OA 4NCTC 2JIIA 2OZOA 4GXBA 3PZEA 4R8QA 3E3BX 3TEIA 4I5HA 1OEYA 3NRMA 2BTRA 4KIKA 5D2MB 3QZFA 4FGBA 3E3PA 3P7BA 5L8KA 2MBQA 4FKPA 4DH3A 4XYFA 3DDCB 4D2PA 3LDZE 2LUEA 5HO8A 4C4JA 4DGMA 2E9UA 3HECA 4Y83A 2N9EB 4CCUA 3B8QA 3KF7A 3LJ1A 5HOAA 5AUXA 4PPBA 3EN6A 5CX9A 3OF0A 5AV3A 4B4LA 2VD5A 3UYSA 3RT3B 3VRYA 3KXXA 4MF1A 4MGKE 4EOOA 1IPGA 4DK5A 3OOGA 3V6RA 3LFSA 3I5NA 4IQ6A 3QQLA 2W1IA 4F9BA 4BCKA 2BWFA 2QHOA 4U40A 2ETKA 4XRLA 2HCKA 1GIHA 1BKXA 4CKJA 5CF6A 1ZMWA 2R5TA 2AL3A 4RG0A 1K8RB 5IEYA 4RIWA 5DWRA 1WGDA 3EECA 3HMPA 5CAQA 3VF9A 3F7ZA 5DPRA 3UINB 2X1NA 3I0QA 4I92A 1UU3A 1CKIA 5J9LA 3C4FA 1WMKA 3MY0A 1OKYA 5L2SA 1ZRZA 5CYIA 1WFYA 4ZP5A 5HLPA 4NKSA 2ZM1A 5ANGA 3VQUA 3FL5A 5C23A 3SRVA 3ZDUA 5TO8A 2C3LA 4USEA 4WHZA 4L42A 3NW5A 4I0SA 2ITYA 4NQKE 3U6IA 1GG3A 4R1YA 1P5EA 3GGFA 2IY1B 3A1QB 3DKFA 4G3EA 1S9JA 4Q9SA 4GU9A 3V5TA 1UKIA 2PK9A 4IH8A 4P90A 4IHPA 1K2PA 1UU8A 5IAAC 2IY0B 1YXXA 4KWPA 4NAWB 3IS5A 4D55A 2W9FB 4G2FA 4QTDA 4RPVA 4RWKA 1TQIA 2BUJA 1ZYDA 3R1NA 4QMUA 3UPXA 1Z5SB 3PRMB 4GVAA 2BYEA 2P0CA 1JSUA 2YDJA 3U51A 1WXAA 4PP7A 3UZRA 4NNJB 2C47A 4MHAA 5IDNA 4O7ZA 3UOJA 4EKKA 1P9DU 4QMZA 3CXWA 1PHKA 3E8CA 2PE9A 4UMUA 4CGAA 5E8WA 3WE8A 4C61A 4JX7A 4HCUA 2RF9A 5M4UA 3OBJA 2W1ZA 4F1SA 3R7UA 5EI6A 3AC8A 4YTFA 1LUFA 1IAJA 3W2CA 3CQEA 2L3ZA 4EBWA 3ORKA 4I4EA 4YO4A 4D1SA 3PP1A 3GQIA 2Y4PA 4Y5HA 4C4FA 4QT1A 5HLNA 4IWOA 5AR4A 4IBMA 3PREA 4CKRA 4BKSD 1U59A 5GHVA 4PTCA 4DLJA 4KUJA 1OM1A 2YERA 5E9EA 1VJYA 4RQKA 3EQGA 2IBIB 3DB6A 3PXZA 2PMIA 3IQ7A 2KTFA 3FLWA 4BYJA 2K39A 2OXYA 4KSLC 4ZRIA 4EL9A 2H8HA 4YO6A 3CP9A 2J51A 3W2OA 4F6WA 2Z2WA 4DHJD 4PUZA 5C01A 3V6EB 3VBQA 4AZSA 2LWPA 2AWTA 2CNVA 4E6DA 3RUIB 4RC3A 1LFDA 1LQBA 2VWWA 4FULA 3LLAA 1SNUA 3CTQA 4RZWA 4EKLA 1JAMA 4APCA 2LRUA 3B0AA 3PZHA 1CKPA 3DAKA 3PP0A 3NW6A 5A3XA 3MVJA 4ANNA 4X3FB 4ASDA 3RWQA 1ZYSA 2LVQA 2BDWA 5JGAA 5HNGA 3HP2A 5FXQA 3R8ZA 3SXSA 2JXXA 2LASA 4KAOA 3VBYA 4AGDA 1SM2A 4MJSB 2UZUE 3UIXA 1HE8A 4ANVA 3FUPA 4YLKA 3KK8A 2XK9A 5AAGA 3QXPA 1WE7A 2H34A 3NOBA 5HU3A 3TUDA 2IZVB 1V9JA 4AT4A 1NXKA 3D5UA 4NU1A 4WG5A 2GNFA 3LXPA 1WYWB 2BYVE 3AMYA 2NR2A 2X81A 5B7VA 1XH4A 4ZZNA 3FMKA 2CLQA 4EHGA 2G4SA 3POZA 3MIYA 1F5QA 3MPTA 4ZTMA 5E7RA 1L2NA 3WIKA 3V5LA 3HUBA 3DBSA 3RTPA 2PVYA 4W4VA 4KNBA 4ZMEA 5JN2A 1F9JA 4WSQA 5ICPA 3A9JA 2YZAA 1MQBA 3H0YA 1JSTA 5J7HA 4ZSAA 1RFAA 3R30A 3ITZA 2OICA 4RA4A 4WJOA 5HNBA 4BCNA 2JRIB 1YOMA 2VTAA 2QU6A 2PVMA 3T9IA 3E87A 3W18A 2OBJA 3DVNU 5KZIA 2EMSA 3ZHPC 1H8FA 3CPBA 3VO3A 5IQEA 4E71A 2QI8A 4F7JA 3PRPB 3QL8A 3KXZA 1OECA 3HDMA 2J50A 1PKDA 1OUYA 4M0ZA 4DFLA 2ITWA 3E8EA 5JRQA 3SD0A 5GJGA 1R3CA 2WIHA 1H07A 5JZJA 3GBZA 4GG7A 5A4EA 5DT0A 5CTPA 3BEAA 3KUDB 2K1FA 5CEIA 4N9F4 4E73A 3QUEA 2KULA 1V0OA 3ZO1A 2FSOX 5IQDA 5AX3A 1XKKA 3OCBA 5HX8A 4URKA 2CN8A 4L3PA 3ZO5B 3MA6A 5HO7A 4HPMB 4PTEA 3I3TB 4B9KA 4DDGD 3GFEA 4G1WA 3CSTA 4QP1A 3NS8A 3CY2A 1JOWB 3JY0A 3MB6A 2GTNA 2R3IA 3V5WA 3TUBA 4LV8A 1U4AA 1F3MC 4D0XA 4IC8A 4DFBA 2R3FA 4HDOA 3UNZA 2A4ZA 4TYJA 3ZCLA 4QMXA 2RG6A 3GXLA 3Q9YA 4A06A 2F7ZE 2F2CB 3SA0A 2QG5A 2CDZA 4NT4A 3F5GA 4K2RA 2CMWA 3FBVA 4E20A 4YC8A 4W9JA 4YZBA 2CHWA 2DX5B 5FQDC 2B52A 2I1KA 1G6JA 3NVMB 4Q5EA 2C7MB 2A0CX 2UW8A 3WOWA 2L00B 4OTQA 2DQ7X 4AUAA 4OTDA 4YZNA 3KEXA 5IA4A 3Q2MA 3EMGA 4DEDA 2G2IA 4IC7B 4KKEA 1ZOHA 2JBPA 4C2VA 1E7UA 3WANA 4GU6A 4JBPA 3A7HA 2JVCA 4FV1A 3R63A 3WBLA 5CU0A 4D4VA 2G3QB 2XNPA 3CTJA 3DPDA 5TF9A 5LVLA 3D5VA 4IACA 3R83A 4ALWA 3LFAA 1WAKA 3H10A 4YJUA 2PZRA 3FI8A 1MRYA 1RE8A 4U7ZA 3W1SA 4AZWA 3SLSA 3FHRA 1YOLA 4KZCA 1Z2MA 4GDLA 3UO4A 3FZOA 2CKHB 4FN2A 2WTIA 4AZTA 3PVUA 4NY0A 3QKLA 2PVRA 4QTEA 3H9FA 2YM3A 4GUBA 4BTFA 3OCGA 4A3PA 2FYSA 4QOXA 5HQ0A 1M94A 4DLIA 4NIFB 5CAUA 2WHBA 4EOMA 3BV3A 4ACMA 2NVUI 5L6WL 4A7CA 1YRPA 2G1TA 3S00A 3MB7A 4JT3A 3TBLD 2V5QA 1E5WA 3I6WA 4ZJIA 4PYZA 2HXLA 2VTMA 3ZVVA 4GW8A 4U3YA 2HJ8A 4QRCA 3DXQA 4TKSA 2UZBA 1WJ6A 5D7VA 4FJVB 3BHUA 3RM7A 3AGLA 5IA1A 5AP6A 3QRKA 3HM3A 3PSCA 4TWPA 4QP8A 3E88A 4GK4A 4AP4C 1KUTA 3VIDA 4EUUA 3HGKA 4O1OA 4DG2E 4AACA 1ZYCA 1DM2A 5AR8A 3DCVA 2VTPA 3DNDA 5L2TA 2JPHA 3VNTA 4HGEA 2WTVA 3Q3BA 5HG9A 5IKWA 3HV5A 1PY5A 1SZMA 3POOA 5K3YA 3CBLA 3F7WA 3B08A 4RJ7A 4E6AA 1WJUA 2GNLA 4WA9A 3VUKA 1FGKA 3BQCA 3Q6UA 4I5PA 5KCVA 4HCTA 2XNMA 3RCDA 3V8TA 1SVEA 4OAUC 1KM7A 3SOCA 4ZY5A 4CG9A 2BKZA 3GOPA 3LCTA 5HKHA 4LYNA 1XBAA 4FICA 4UZHA 2BHEA 5DPWA 2BWES 5C4KA 2KWUB 2VTQA 4YZDA 4JXFA 2XMYA 4FSTA 3Q53A 2M0XA 4HVHA 4QMVA 4MQ1A 4FSMA 2C5XA 2X4FA 1UBQA 1BI8A 1Y6BA 3H30A 3CPCA 5E6OA 2IO3B 2J5FA 3FHIA 1IEPA 3DA6A 4QMWA 3R7VA 4CYEA 3DFAA 3IW4A 4UBAA 1Q5KA 5L6PA 5AUTA 3PHXB 2GNIA 3B2WA 2C5NA 3FMLA 1WR1A 1Y6AA 3LCSA 5ETCA 3COIA 3BHHA 3SAYA 4F9YA 3UQGA 3MJWA 1R78A 4QNYA 3HAVA 3RK7A 2JF5A 2RL5A 4FL3A 4DHZB 2XIKA 2OK1A 3D7TB 2BHHA 3ZO3A 4Z55A 2CHXA 4FT0A 5M08A 4QNAA 4YJTA 2R3GA 2FIFA 4LM5A 4NWMA 3H4JA 1OQYA 2IJMA 4XG8A 1FBNA 2UW0A 2ZCBA 3UGBB 2G9XA 3RHKA 2X7FA 2BRNA 4U42A 1V80A 3ZLXA 4JBOA 5HD4A 4BYIA 5GZ9A 4DAWA 3LCKA 3NPCA 3QTSA 4LOPA 2WWZA 2O6VA 5DYJA 4G50A 5DR9A 4RFMA 1H1WA 3L8XA 3R2YA 3IGGA 4H1MA 3A1QA 4BI1A 4CXAA 5EQEA 2Y4IC 4UXLA 4FT5A 2A27A 4XV9A 4FZ7A 4PL3A 5HVYA 3EQCA 4GFOA 3WF5A 3UQBA 3BPRA 5LQFA 2UVXA 3MVMA 4J53A 1Q3DA 5AA8A 5CHVC 3OG7A 2JKMA 2C6LA 4U80A 2UW5A 2GBKA 4EZLA 3NAXA 3N4TA 4BCFA 4JQEA 5KMIA 2M4NA 3SDJA 4G3GA 1GOLA 2EUFB 4YU2A 2XJ2A 2DYBA 3ZNZB 3U9NA 2LRWA 5D7GA 3UYTA 2PL0A 3Q4TA 4QMMA 1R39A 3VS6A 5I5ZA 3T8MA 4F1MA 2BFYA 4TPTA 1PQSA 3NCZA 2B0QA 5D94A 4TWNA 5B2LA 2VRRB 4FTMA 4UWCA 2XIXA 5AP7A 3QALE 2WQMA 3QTRA 4W9WA 3NUYA 5L8LA 2VWVA 2W1FA 3PA3A 3IDBA 3D5WA 4GL9A 4XX5A 4FZDB 3E5AA 3IDPA 3GZNI 3PE2A 2IO1B 4AUQC 2QKRA 3O23A 4GGQA 4DYMA 4OBOA 1ZOGA 3Q4ZA 2C7NB 5IA5A 4YC6A 4GFGA 5LXIB 2OU7A 2YAKA 1J0GA 2G15A 4LMUA 4BY9E 3IFWB 4MYGA 2M8SA 4Q2AA 2BMCA 2V55A 1NBFC 5AP5A 3UOHA 2HW7A 1J7UA 1ZARA 3M1SA 3QU0A 2RFSA 4IX4A 5IQCA 3NNVA 3O7LD 4YLJA 1L8TA 5CXHA 4DCEA 2MCNB 5JGBA 3SHQA 5G55A 5HI2A 3IW8A 5A4TA 1XT9B 4PNKA 2XBBC 1FINA 4UYAA 3Q3JA 3DKCA 5HHWA 3WF6A 1FMKA 4ENXA 4C02A 2BALA 4O7VA 3JVZX 4X0MA 3DJ5A 3DQWA 3PLSA 3KRXA 3BYUA 3QA0A 4NJ7A 3OP5A 3UMXA 1YD8U 3D9VA 1OIQA 4YJQA 1OEYJ 4A4LA 4XG2A 3U87A 4XG6A 3FMDA 2XIZA 3UIMA 2F7XE 2OH0E 5BUIA 4KDLB 2PU8A 4CZYB 2GMIC 2JAVA 3LCOA 2CGXA 3LMGA 4B8LA 5KHXA 2BAQA 4QQTA 5JH5C 1YWVA 2OWBA 5I9WA 4J97A 1OB3A 4WNOA 3V6SA 2JFMA 1MP8A 4S2ZA 4IAZA 2DZIA 4YHJA 3KYDD 3B1LX 3I7BA 4S34A 3TMPB 3QCSA 3A4PA 4FV7A 2HIWA 4O2PA 4PDPA 3RKBA 3LHJA 2IW8A 4HWIB 4W9HA 5I3OA 2J2IB 2RSVA 4HOKA 3TT0A 2BDJA 1W83A 2JKQA 2ZEQA 3HMNA 3QGYA 4RJ4A 3TCAA 4TT7A 3OXZA 3R1YA 4QP4A 4O7RA 5AR3A 1XH5A 2CGVA 4WNMA 2XNEA 1WX7A 4AGWA 1YI6A 5A4LA 3QTQA 4J8NA 2BZHB 5M07A 3DXNA 4C62A 3A33B 2AYOB 4DTKA 4EZ3A 3OC1A 3AMBA 3BU5A 4F0GA 4N6YA 4ZTLA 4FSYA 3U55A 2YLFA 2FGIA 2WMSA 1KOBA 4FIEA 1UNLA 3ELJA 3A9KA 1I35A 5ETFA 4BN1A 5B2MA 4H3PA 4M3QA 4ZY6A 1J19A 2IZSA 2CNUA 2UW3A 3IGOA 2JUOA 3MBLA 4O1PA 3TJPA 1NDDA 5DVRA 4ASEA 2X2KA 2BVAA 3R8MA 2KFKB 2WEIA 1VYWA 3LXKA 3F9NA 3KREA 4AE6A 3OY1A 2C68A 4CKIA 4RVKA 3L08A 4O6EA 4QP7A 4X7QA 4NUSA 1H25A 4PRJA 3AD5A 4NL0A 5HBHA 3U8WA 2GBMA 1AD5A 4BCPA 3ENMA 1DAWA 3UVPA 4U6RA 2MX2A 5LARA 2H9VA 5HBEA 2PUUA 2J5EA 3QYZA 2ETMA 3FZSA 3T8OA 3RMFA 3BEGA 3ORZA 1O6KA 4HLEA 5FGKA 2JRHA 4KBAA 3RCJA 3NZSA 3K9PB 2ZZPB 2B9HA 1W8CA 4WG3A 5CU2A 3O96A 3QTWA 1W84A 5A54A 3ET7A 4W9DA 2O6VD 3TNQB 2RSUA 4QYGA 4DHZE 1XBCA 1J3HA 1H0WA 4XUFA 2GPHA 4IC7A 4HYIA 3GC7A 5L3AA 5AUVA 5AV4A 5FTGA 3V51A 2D2QA 3TV7A 3DOWA 4IM0A 2QOBA 3LMIA 3AU4A 4XC2A 1UV5A 5IQAA 3VF8A 4Q5HA 2UW4A 3FZRA 2ZMCA 4J96A 5M55A 3H1UA 3ZO4A 4R6VA 3TCPA 5KKRC 2C6MA 3TIZA 4B8MA 3QAME 4DF3A 4WAAA 2IO6A 3R21A 4EH6A 1P2AA 3NNUA 3RK5A 4BWXA 2ZM4A 3R9DA 4IX6A 4GYGA 5HGIA 2R2OA 3F3TA 4UV0A 3VHKA 2OJGA 1XO2B 4F7ZA 4C4GA 3MTNB 4AOJA 3ZZWA 4JIAA 5IZFA 2OH4A 2PUPA 3FLYA 4MD8E 3AQVA 4NH1A 3DJ7A 4KRCA 2XB7A 2C0OA 4BI2A 3FZPA 1XH6A 3KXNA 2JDTA 3FPQA 4DFYA 3VH3B 4YBKA 2O2VA 5HTCA 3SU8X 3JS2A 3II5A 5EDSA 3VS2A 2Y6MA 2JDSA 2JFLA 2PVNA 4U43A 4BDDA 2OZAB 1DS5A 4AFJA 1WGRA 3EQIA 4E6QA 1M52A 3GI3A 4BWKA 4M7IA 1IA9A 4P7EA 5HU9A 2FCNA 3AGMA 3V04A 4W9EA 5CWZA 1GY3A 4O7SA 5K0XA 1KOAA 3MDYA 4IB3A 1FVRA 2R3JA 4ZRJA 2IZTA 4TWCA 3S95A 5AR5A 3EQBA 2PZYA 2LGYA 4FMQA 1KSWA 1TZ1A 5DPSA 5DEWA 1Q61A 3ORLA 3NGAA 3AT3A 4AN3A 1Q8YA 4HK2A 3IONA 2RG5A 1L7YA 1V5TA 3SGCA 4O6LA 5HD7A 2VWYA 4G0NB 4AGUA 5JFSA 1H26A 3SV0A 4CHKA 4AN2A 5DRDA 1ZMUA 4BRXA 4KDIC 2OI4X 4ZSGA 3QLGA 3BBWA 1WX8A 4NFNA 1SE9A 1BI7A 4KVGB 3W32A 2XJ0A 4TTHB 3S3IA 5HVJA 3PJCA 3C4EA 2X9FA 4HPLB 4TYHB 4BKTA 5FM2A 4UB7A 4MGZE 4MBJA 2FCMA 4AOFA 3EYGA 4GT4A 4FNZA 2PPHA 3VHEA 4A4OA 3BCEA 5CENA 3KYCD 3TTIA 5F9EA 4M0WB 3EWHA 4BDHA 2QOHA 2I6LA 4JR3A 4B99A 4PMSA 3JR1A 3OCSA 2WOTA 1WVXA 1V1KA 1WBTA 2XM9A 3VTUA 3GU5A 4AN9A 2P2IA 2XYNA 3Q4CA 2AEHA 3RYTA 3ZDIA 3V62A 2FNJB 3QCQA 5LWMA 3L10B 2QD9A 4DEAA 2XH5A 4RLKA 5AV0A 1GC7A 4N0SA 2JGZA 2B1PA 4IX3A 5C9CA 5IUIA 5IG1A 3QD2B 4S31A 1ZOEA 2HELA 2VTJA 1X8BA 3RPYA 2VTTA 4V05A 5IQGA 4UMRA 2QOQA 5IA3A 2FAZA 2WMTA 2A1AB 4ZRKA 1D3ZA 5ITAA 2HD5B 4W9GA 2PZ5A 4FIJA 5JZNA 2O65A 3QWZB 2WD1A 2QONA 2D07B 4E5BA 2WQBA 4C8BA 1B39A 2R0IA 3CSFA 4IAKA 1OL2A 4QQJA 1UNHA 2XKDA 4LFIA 5IDPA 5M06A 5T6KA 3RD2A 4X2KA 4BIBA 4XG3A 5FWKK 2IVVA 2LJ5A 3ZBFA 2KO3A 1G8SA 4I6HA 3L13A 4GRBA 3QTZA 3ENEA 5KBQA 5HX6A 5HE0A 4JBVA 1TQPA 5DA3A 4QPMA 4FK6A 4HGTA 4BDBA 4ZDVA 3QRTA 4QMSA 2XK8A 2R3RA 5CU3A 4GKIA 2VO3A 2UUEA 3R8VA 3MPMA 5CLPA 3T3UA 5EM6A 3ZIMA 1URCA 5AAEA 4FTUA 4W4WA 4B0GA 3ZOSA 4W9IA 2OFVA 3LMHA 4BWPA 2R3LA 2HZIA 3DXPA 2EXEA 3F3WA 4OTHA 2Y8OA 5EHYA 2BKKA 3ZTXA 4EH9A 2BFXA 4CMOA 5AUZA 1ZMVA 3LFFA 2QC6A 2KDFB 3KQ7A 1HCLA 3QD4A 3RNIA 1WXSA 5ANJA 4IVBA 4UXQA 3SKCA 3R7RA 3FY0A 4FK3A 2HENA 5J2RA 5HE1A 2BAKA 4MCVA 3QZIA 1BMKA 1IA8A 3GT8A 3R8LA 3EFKA 5IH4A 4ZOGA 4BFRA 3OT8A 3HRCA 2PYWA 2UWQA 4L7FA 3PE1A 5GJFA 3LM0A 1PRYA 3B8RA 4ZMFA 3FMMA 4XG9A 1JBPE 3QLFA 2QR7A 4XS2A 5I3RA 3E92A 3QFVA 1SMHA 3V6CB 2RGFA 2W5AA 2PE2A 4HCPB 4U44A 4ASZA 5AZGA 4L46A 3N30A 4ZJVA 1IAHA 3DDQA 1YDRE 3U4WA 4W4YA 3RNYA 1QPJA 3A8WA 4HJKA 1YVJA 1E1VA 5J79A 4D1ZA 3PXQA 4EH2A 5HESA 3Q5IA 1IASA 3PGEA 4AP7A 5G1XA 4YBJA 2J0MB 5FXSA 1W7HA 4FYOA 1REKA 2ZMDA 4Y95A 2CKOA 3U30A 4QMNA 3QQHA 3PXRA 3D2KA 4DEBA 3GC9A 3L0WB 2F2UA 3UQAA 4I1ZA 4C38A 4U0IA 4XV1A 3HYHA 4BKJA 1GNGA 2GS6A 3LQ8A 1PXPA 4O7TA 3PPJA 2GNGA 3UG2A 1OL1A 2X6EA 2OF2A 2OXXA 2WTWA 3R28A 4HVIA 3ZSGA 5F20A 4YSMA 5ANDA 4FKUA 4IFGA 2BIYA 1OZ1A 2K6DB 2WTCA 3LPBA 3MFRA 3QK0A 5J5SA 3TV6A 4FEUA 2JDOA 3KRLA 4EZKA 2MRPA 2BCJA 2HK5A 4AWIA 5AV1A 3QD0A 4D4YA 4DEHA 4XG4A 2YM8A 4O0SA 3G0EA 5HE2A 3W8QA 2YJSA 3PXKA 5FM3A 5LMKA 1WY8A 4R5SA 4WWPA 3ETAA 2ITQA 2O3PA 2G45B 3DBEA 4E6CA 4B6LA 2KD0A 2HE7A 4MNEB 4I6BA 4PY1A 3TJCA 5GJDA 3FZTA 1R0EA 3FI2A 4I94A 4NTTA 3MN3A 4RX8A 5HKMA 2EMTA 4BKYA 2OKRA 3GB2A 2LVOA 4IIRA 4M8TA 2WMUA 1YHWA 4HVBA 2PSQA 1XBBA 2XKFA 5DMZA 4XX9A 2YDIA 4ZLZA 3RPSA 2WQEA 4RJ6A 5DFPA 4F63A 3R1QA 4M14A 2KKCA 1K3AA 2X6DA 4O2ZA 2FH9A 1OUKA 3RZBA 3BYMA 3V8SA 3OTVA 4EJNA 2EVAA 2JBOA 4FBXA 4DG3E 3VUXA 3CY3A 4G6OA 3JSVB 2ZM3A 2CKPA 3JPVA 4F4PA 3PXYA 4E4LA 2DYMA 4ZXTA 2CSNA 3DNEA 2OIDA 4PMPA 4FSZA 2QCSA 2F4JA 3LQ5A 1WE6A 3P4KA 4OTIA 5CVGA 5E8ZA 2CKEA 3JUHA 2GNJA 4J8MA 4BDEA 1BYGA 2DAFA 2AYPA 4JDJA 3UZPA 1O6LA 5E8UA 4V0GA 3VAWA 5G6VA 1ISNA 2R0UA 4AAAA 2CJMA 5CEOA 4RIOA 4AXAA 2DZKA 3CSVA 2X8IA 1YWRA 1TVOA 1OITA 4EH7A 1GIIA 5LCKA 4BICA 3EL8A 5LCJA 1I44A 2FCQA 3ERKA 1P4FA 5KNJA 4QTCA 2Z8CA 5CNNA 3PIZA 4LGDA 4M69A 5IA7A 3HL7A 3P08A 4P2KA 4CFNA 4HPUE 3NEWA 4BDJA 4FHKA 3FMHA 5M44A 2XEWA 2IZRA 1ZKHA 5CS6A 3TDWA 1GC6A 3AI5A 3Q9ZA 4AW0A 5CANA 3HMIA 1P0RA 2JIVA 3TXOA 4ZTRA 3QF9A 2VGOA 3R04A 2KJRA 3M62B 3MH0A 2KXJA 4H3BA 4ZAUA 4G9RA 1PXKA 5FUTA 2ZYBA 3UVRA 4I6LB 2PVJA 5FR6A 4JG6A 5LLIA 4BIDA 3BZ3A 4RFZA 4F9CA 3S1HA 5HIEA 2HZ4A 3U8ZA 5E1SA 4AX8A 4LDTB 2WB8A 2VTOA 4YHFA 3N51A 4QYYA 4I6NB 3KULB 5AV2A 4JGHB 1V6EA 3VW6A 4QQ5A 4YL8A 2V7OA 4FL2A 5AP1A 4IAIA 3OAWA 2WFYA 2KC1A 3KVWA 4IVDA 5CZHA 2JAMA 3BWFA 2KANA 4USDA 1KE6A 4ASWC 3S2PA 1QZEA 3K54A 3MYGA 2W17A 3E8NA 4D1XA 3QC9A 4W9XA 4KV2A 3ZUTA 2PZIA 4PNIA 1ZY4A 3RPVA 3QQ8B 2WDTB 3Q2JA 5AUUA 4GK2A 4JI9A 4M13A 4DHFA 3CLYA 4ZLYA 3EH9A 4DINA 1H4LA 3AC4A 5I0BA 3BBTB 2NBWB 4FKTA 2JC6A 5HTIA 4MDKE 2YITA 4I20A 3NYVA 4M67A 1XJDA 3F3ZA 1YXUA 5KMOA 3ZLYA 2C6KA 1W82A 3I1AA 4R7BA 1P3QU 4QMLA 4E26A 5AJQA 3VVHA 3T9LA 3WZEA 2FSTX 3KMUA 3SVVA 4IZAA 5ANIA 4DG0E 3JVSA 3CE3A 4MEMA 5EOBA 3KGAA 1L3RE 2JZ3B 1ZY5A 4EWQA 4DGOA 3W2SA 2OJFE 4XZ4A 4V01A 5BYZA 5D12A 3CMMB 3F6XA 1OKZA 3IVFA 2UZNA 5D9HA 4E4XA 3L8SA 2W05A 4OAVB 4EH8A 3OT3A 1NA7A 3G90X 4AE9A 4IUMB 3OXTA 4GFMA 3LIJA 3MY1A 4PTGA 5KHOA 4EQCA 3F69A 3MVHA 4O84A 1DI8A 2XK5B 4FEWA 2WX1A 4YHTA 1GUAB 1J91A 2GOWA 3ZFXA 3OWPA 4N70A 4HYUA 4HZRA 2F7EE 2WMVA 1Q8TA 2LGDA 3HRFA 3I81A 2Z0DB 2RPQA 2XIRA 2CCHA 5JT2A 3NNWA 5DT3A 2ZV2A 5E92A 3ZEPA 4F6UA 3FLNC 4ITJA 4CZTA 2GU8A 3Q32A 1UWJA 5IMEA 3VW8A 2PHKA 4C33A 1JLUE 3PDTA 4G16A 3R6XA 4W4XA 4LI5A 5J9ZA 3L8VA 2IWIA 3EQHA 2DAJA 3I60A 3NZ0A 2E9OA 2YN8A 4NW5A 2D11A 5E8YA 2W1DA 2QOLA 4EK5A 3DPKA 5LMKC 2VNWA 2QHMA 3QQGA 4EWHA 4LUDA 4EZ7A 3F3UA 3UO5A 4O0VA 5FLFA 4RIXB 3PSDA 5HICA 4K7UA 4YTIA 4KIPA 5T68A 2HYYA 2BZKB 4II5A 1WMHA 4FVRA 2J0KA 2OSCA 5A4CA 2ITXA 3BHTA 2WGJA 3CGFA 3SW4A 4PDOA 1PXIA 4HVDA 4DT9A 1QPCA 3UP2A 4XP3A 1UWHA 3PWDA 1SNXA 5JMSA 3D5XA 3VUMA 4BDGA 5FBOA 3A7GA 3UC3A 3ZS5A 3HV4A 3WILA 5C26A 3G9LX 4TNDA 4QYEA 3DT1A 1C3TA 3R7QA 3VUGA 2UVZA 1Q8ZA 3L54A 3CS9A 1FPUA 3FC2A 3ALNA 4K6ZA 4GU2A 4IZ7A 3IG3A 5CEKA 4C57A 3TIYA 3C51A 1OPJA 3L8PA 4DT8A 4MF0A 3VQIA 2FCSA 5EDRA 1H01A 3A60A 3PPAA 3APCA 3BE2A 1G3NA 3DBRI 4JS8A 2ONLA 3HA8A 2WPAA 3ROYA 3OUNB 4MXZA 1P14A 2KOXA 2OO8X 2XRWA 4FV2A 1O9UA 3F5XA 2N4FA 1QPDA 2PE6B 3EFUA 3NLBA 2ZV9A 2C3IB 2F49A 5AMNA 1RLFA 1TKIA 4BTKA 2ZJWA 2VGPA 4UWYA 1HOWA 2REXA 2CN5A 2C60A 5EH0A 5IMXA 2VO6A 2C3JA 3PSEB 4EORA 4W9LA 3UMWA 2GBJA 4JLCA 4BI0A 3PVLA 3BI6A 4FSWA 2YM7A 4FG7A 5EM8A 4BKGA 3QRUA 5M56A 3HKOA 4O7YA 2IW6A 2AC3A 2K8HA 4CLIA 2C5YA 4DFZE 3RZFA 4DHJB 4H1JA 2LXAA 2KJHB 4PQNA 3VS3A 3DZQA 1GJOA 3QTXA 3U54A 4GB9A 2ITTA 2ZJDA 4I41A 3TIXA 1V2YA 3R9HA 4IJ9A 2DZJA 3ECIA 2J0MA 3ORNA 1RW8A 4NJDA 1C1YB 3FMNA 5EYDA 4FODA 2UZTA 4C58A 4KB8A 4FNXA 1PXNA 3FKLA 1PW2A 4Y46A 5E8SA 5GZ8A 2R3HA 2QLQA 5HE3A 4C3PA 3EZVA 4FF8A 3QCXA 3W2RA 1EH4A 5FRIA 2I0HA 4OBPA 4FT9A 3MESA 1OL7A 2R3QA 2A4LA 2WO6A 3ZLSA 1UU7A 3ZSHA 3KU2A 1H4RA 3D15A 3BV2A 2C6DA 2IVUA 3Q6WA 3AC3A 5M4FA 4ERWA 3IDCA 4LJOB 4G3XB 4PDSA 2OFUA 3TZ7A 3EHVA 1WZ3A 3SDLC 3APFA 1OIRA 3VFKA 3OW4A 4GVJA 5E6PA 3ORTA 5I9YA 2KTRB 4K9YA 3LE6A 4XEYA 2WELA 3TKHA 4USFA 3C0IA 4GN1A 1XH7A 1PYEA 2C6OA 4F7SA 3E93A 1OPKA 5L2QA 3GFWA 4CTBA 3H9RA 5M09A 3QUPA 1S3SG 3EQPA 4C59A 4FTNA 2VX3A 3QKKA 3ZU7A 4M84A 4L43A 3G2FA 2KDBA 4O82A 5J18A 4TYGA 2WX0A 4PV0A 3ZM4A 2YVCA 4IADA 4KSPA 4OR5A 2NPTB 1E8WA 2GMXA 2BRBA 2P3GX 4WNKA 3GU6A 4FIGA 4PYUA 4OTGA 4BBFA 3EKKA 4IDTA 5AADA 4BDAA 1JQHA 4BVUA 4BCIA 2CPKE 4TN6A 4G3DA 5F94A 4KIKB 2VWUA 4CV8A 4IM2A 3IW5A 4W8EA 3QX1A 2W99B 4TUUA 3QKMA 3RZWC 5FTOA 3JW0X 5KX8A 5CNOA 4ORKA 4CTCA 2I0EA 4EZ5A 1PXMA 2QNJA 5BVDA 3GEQA 4EHEA 3NDMA 4JIKA 3V5QA 5JK3A 4JR7A 2J0JA 4A9RA 4NM0A 4IG7B 3R7EA 3TNWA 4LGHA 2C9WB 4XP0A 3JY9A 4DITA 1Z9XA 1KV1A 5JHAA 2RKUA 2NRUA 2XK3A 5DT4A 4FV3A 2KLGA 5KBRA 4WQOB 3G6HA 2V7AA 5L83A 5DE2A 4AA4A 1M17A 2LGCA 2GTMA 5IQIA 5GIOE 4F6SA 4JRVA 3NNXA 4LCDE 5DGZA 1E90A 3FLSA 4I21A 1JWHA 5HCXA 2L76A 4C35A 1E9HA 2PVHA 3UC4A 4XBRA 3CKXA 3UGCA 3VN9A 4L45A 3KRWA 4G6NA 3LM5A 1PMNA 5LMAA 4YJSA 2WTKC 4MGYE 3APDA 3BHVA 4PS7A 3HMMA 2XK7A 2XNNA 4R3PA 4IE9A 2B53A 2G01A 2VUWA 5IUGA 3C5UA 3FYJX 2WKMA 3ZUVA 1OVEA 4BIEA 3EN9A 3F2RA 3BYVA 4E5AX 1J7IA 4EK8A 4KZ0A 3UO6A 3AC2A 5E8XA 5EM5A 3QQKA 4WWNA 5JFWA 5E4HA 4JDHA 3KULA 5CT0A 4YZCA 1VZOA 4PL5A 3ZFYA 1OKVA 4N4SA 3LXNA 4MXCA 1IR3A 2GQGA 1Q1OA 2AL6A 3ANQA 3L9NA 4QMPA 2WOUA 3MTFA 1Q4LA 2L0TA 3H3CA 4DFUA 5F4NA 3IOPA 4QPAA 2EU9A 5CTRC 4K1RB 1GAGA 2B4SB 1PYXA 3BGQA 2G2FA 4K1BA 4J6IA 2XJ1A 4FEVA 4DTBA 1WBVA 2KK8A 4GIHA 4IVAA 2LAVA 4BZNA 5GNKA 3TACA 4FX3A 4ONAA 4HDQA 5DR6A 2Z7LA 4BDFA 4PF4A 2NBUA 5HG7A 4QMOA 2A19B 1WBOA 3PWYA 3FXZA 3V5PA 2ONLC 3PS6A 3DQXA 4GMYA 4GMVA 3KCKA 2BRHA 5KHWA 5CVFA 2V3SA 4U5JA 3KN6A 5JQ8A 4EI4A 3WZUA 4AFEA 4L67A 4TZRA 4MAOA 3FDNA 3R02A 4U97A 4EEVA 4HNFA 3HMOA 5H8EA 3ZXZA 2X9EA 5CY3A 2FB8A 4A9UA 3EYHA 1BL6A 4H36A 3IOKA 5EKNA 3THBA 4O0WA 4TW9A 1Q97A 2FUMA 3VUHA 4CNHA 4ICUA 5EDPA 2YLMA 5J7BA 4CV9A 3NMUF 4ZY4A 1YQBA 3ZXTA 4O81A 4D58A 4BF2A 4FOBA 4O7LA 1NY3A 4PL4A 4RVTA 1KE7A 2YIXA 3ZM9A 4MH7A 1S9IA 3A4SC 4BBNC 3F66A 5LVOA 4O21A 3FC1X 4FIFA 1J7LA 2RFDA 1WVYA 3FXWA 3N9XA 2JD5A 3QXOA 5AA9A 2YZLA 2QR8A 2IW9A 3K3JA 4RVMA 4DH8A 3NSZA 1YWNA 3CD8A 4JG8A 1ZGUB 5CSXA 3OWKA 3KC3A 5EHOA 5AP2A 4RX5A 2V62A 3PTFC 2IN6A 3EKNA 3E8DA 3REPA 4A9TA 4RA5A 1ZLTA 4CFWA 3RPRA 5HLWA 4BDKA 1TTNA 2A2AA 3TZMA 3CCNA 2YIWA 3X0WA 3UQCA 3FPMA 3OS3A 3DB8A 2C0IA 3UIOB 3E64A 4FV5A 5BYYA 4DWFA 2E9VA 3F5UA 5EW8A 5JFVA 4ICVA 2M1MA 1JKSA 4XLIA 4GV1A 2C69A 3I79A 2ZDUA 3F5PA 3O71A 1B38A 4J99A 3MH2A 5TKDA 3AC5A 5LVMA 4BCQA 4UEUA 2YDKA 1P1AA 3VVWB 5L95C 4ERKA 4Y8DA 3IPHA 3FY2A 4O0UA 3UIBA 5D7AA 2OJJA 3ZFMA 4CRSA 3DAJA 5JH6A 4TQ0A 4U8ZA 4RIXA 1FGIA 4FT3A 3EIDA 3P0MA 5KE0A 5AX9A 4WIHA 5AP0A 5KUPA 3A9JB 2J0LA 4AW1A 4YP8A 5CXZA 3DBLI 2XYUA 4MEDA 5ETAA 4K7WA 5M53A 2IVSA 3BU3A 1GZ8A 2Y4IB 3QUDA 4ANQA 2D10A 2GNHA 5A6NA 5EG3A 3ATTA 4D0WA 4GS6A 3A62A 2VO0A 3GU4A 5EKOA 4M97A 1V81A 3AD6A 4E74A 2Y6OA 2YCFA 3FQHA 3OWJA 1XQQA 4FTQA 3VUDA 4FVPA 4LV5A 4TRLA 2VTSA 3PIYA 4ZTSA 3QCYA 2RIOA 2QOFA 3V60A 5KMMA 1XD3B 5CF4A 2N7EA 3NZUA 1YXVA 2KTYA 2F57A 4BVUC 1MRUA 3LLTA 5IQBA 1PMVA 4GDKB 3H7PA 3MH1A 4JQWC 4AU8A 2UW7A 1NVRA 4O83A 1V0BA 5J1WA 3E63A 2REIA 3RM6A 4E7WA 2KC2A 3QARA 5F1ZA 5AEPA 4CCBA 2VRXA 2Q0NA 3C7QA 2DZMA 3DU8A 4FKVA 4IWQA 5JGDA 4WWOA 4PMMA 3HUCA 5DI1A 4BR3A 1WH3A 5DH3A 2B54A 3OBGA 3P86A 2ZB0A 3LJ2A 5HG8A 1BX6A 4RMAA 2KWCA 1UD7A 1Q0WB 5TT7A 3HHMA 4GJ2A 2C6IA 2R7BA 1WIAA 3LOKA 2NBVB 3A99A 4TKNA 5D10A 4CRLA 5A4QA 4R7IA 3DBHI 3OTUA 4RWIA 4BGQA 1YDTE 1IP9A
chains in the Genus database with same CATH superfamily
3CD3A 1JVPP 3C50A 4FV4A 3G9NA 3W1YA 2F9GA 5F95A 3EL7A 4X57B 3ZONA 3CEKA 4KGSA 3OMVA 4FTTA 5I9VA 4AZEA 5CU4A 4X21A 3LAUA 3RJCA 3PHWB 1JWBD 1M14A 5JHBA 3O50A 2BR1A 2EB2A 3P79A 3KN5A 4UMQA 4NZWB 4HVSA 4F9WA 4FKOA 4FADA 1GNUA 4JIOU 3LW0A 4D2VA 3EC8A 3HM6X 3ZTCA 3WAOA 3O7LB 2ZXQA 3NVYA 1Y91A 4P5ZA 2J53A 3R2IA 3ZRCA 2BIKB 4X3JA 5IU2A 3MH3A 2YACA 2H6DA 3AEAB 4MUQA 3GU8A 4CVAA 4DGNA 5AR2A 2EXCX 2FO0A 3DK7A 3SOAA 4IDIA 3K3IA 1XHAA 3M2WA 4HZSA 4JNEA 1UU9A 3WZJA 4FYNA 3QZHA 4GDLB 2YL8A 3TZ8A 2LMCA 2X8EA 4U81A 3N4UA 5ACBC 3GI7A 1L5PA 2WNMA 4WKQA 3LZBA 1VD2A 3KVFB 4DXGA 4Z16A 3AH7A 3WZDA 5IH6A 3LFQA 5DCNA 3UVQA 2KQ4X 1NVSA 5HORA 4CFVA 2N7JA 4HR1A 2X7GA 2XAOA 1OGUA 2FUHB 1WF9A 3KVXA 4NAWA 4LG4A 5AAFA 3QHRA 5C1QB 2DS1A 1GZNA 1YJ1A 2ZCCA 1KE9A 2GHMA 4PX6A 1WM3A 2JWUA 5FDPA 4YJRA 3ULZA 3ATSA 3FD9A 4CSVA 4DGGA 2NO3A 4F0FA 2WU5B 2YJRA 4ATMA 1HTQA 3BUIA 5IN7A 1FXTB 4HJOA 3DBDA 3FZ1A 3Q8AA 1YOJA 3M95A 3WE4A 4MQ2A 2IGDA 3T3NA 4FKLA 4ITIA 2XM8A 4XHKB 3GCUA 4MD9E 5DHJA 4FG8A 2ITOA 2LM0A 3JXWA 1OIYA 1MUOA 3FMJA 1JKTA 4Z9LA 4O7NA 3TI1A 3PRFA 4FSRA 2NPTA 3K9OB 5DBXA 3FSKA 4KS7A 1UPXA 3EFLA 3CIKA 1N63A 4MSMB 3RAHA 2BPMA 2YIYA 2WMQA 3IKAA 1V5OA 4XJ0A 1B9RA 1TGZB 3IG7A 2C6TA 3FLQA 5CX3A 2EFLA 3SG8A 3EN4A 4WBBB 4LMNA 3Q0KA 5AP3A 4C00A 5EK7A 2JDRA 2QO9A 2P55A 3CJGA 3L17A 2YAAA 4R77A 2YHVA 4L1BA 3VTWA 4E93A 2YL9A 5BMSA 4YJOA 4DA5A 2JLDA 4FV6A 3BLRA 1EU4A 1KOTA 4XH6A 3FAAA 4ZS0A 5HNIX 4MK0A 1H24A 1RAXA 2RFEA 3LCDA 5J87A 4D5KA 2ERKA 1TS5A 2BTSA 3O8PA 2Y5CA 3DTCA 1KJTA 4F9AA 1PJKA 5HO6A 4J98A 5AZHA 2B3AA 3Q3FA 3FC4A 4DBGA 3VBWA 1ZZ2A 2B7AA 2ETRA 2YM4A 4MNFA 4K33A 1T0SC 2DYLA 4MD7E 2FUG1 1EF5A 3NS9A 2OIQA 5CHFA 3TN8A 2X2MA 4Q9ZA 5I9ZA 3BLQA 4C4HA 3BL7A 3ALOA 4P6VF 3GP0A 5CSVA 4FIHA 3L9MA 4X3FA 2GHLA 2PUIA 3R0TA 3EOCA 4G6LA 2KMAA 4EC8A 4EOSA 4N59A 1FIQA 4YR8A 1EO6A 2JX5A 4MJSA 3CZNA 3RMKC 2Q0BA 4FBJB 3WF7A 3F61A 3VJOA 4YTCA 3KH0A 5HI1A 1UZXB 4ANOA 1R4NI 3DJ6A 3PXFA 4D9TA 4HKZE 4FUYA 1SYKA 3DK6A 5J9YA 3W1SC 4EEWA 4B6WA 4LGGA 4WUAA 4M8NA 3BGPA 1W98A 3PFYA 3R01A 2GQRA 4Y5QA 4FZAB 3OXIA 4O0RA 4NW6A 2O6VB 3DFCB 1TY0A 3P7AA 2DHZA 1YN5A 3O3NB 5L8JA 5I9XA 4IDVA 2G2HA 3PYYA 4EOLA 4XWWA 1WJ4A 1SBBB 1SUFA 2C4GA 1QX1A 1V97A 2MBOA 2MHJA 2ERZE 1U5RA 5FEEA 1YXSA 2O5KA 2HTHA 3RPMA 5KKRB 2VWIA 4YLLA 3D0EA 3ZTDA 4QMTA 3GCPA 1NW1A 3OEZA 2ZNVC 1KLVA 2Q83A 2KX3A 4I0TA 4IM3A 4UY9A 4O7WA 4JDKA 3PRZA 3H0ZA 5AM6A 1TQUA 5CF8A 3MS9A 3D50A 5EI2A 2C30A 4CFXA 4L68A 2C5LC 1DAYA 4DXFA 4YZMA 3LFCA 4UX9A 1OIUA 3EJRA 1FCCC 1R7SA 1VLRA 1WBWA 3SX9A 4PS8A 3MW1A 1BUHA 5DPVA 3E62A 2X4ZA 2W5BA 3ZRLA 4RWLA 3GOEA 4AT5A 3T46A 1JWMD 4ANXA 3KKVA 3DBQA 3WCQA 3UODA 4MXYA 2OIBA 2GB1A 1LP4A 4CLJA 2KQSA 2WMRA 3PVBA 3QX4A 4CMUA 4A90A 3VUWA 2W9NA 2W4OA 1WZ0A 2J90A 3TEWA 3DCGA 2NP8A 4LQMA 2VTRA 3AMAA 4P5QA 3DHHC 5E90A 4L3JA 4U3ZA 4EHVA 3AN1A 4OGRA 1R4MI 1Y56A 5L2IA 2XUUA 2BDFA 3EGRA 4H3QA 4DBXA 3Q4UA 2K5PA 3SXRA 2R3KA 3RWPA 3QCAA 3LQ3A 4AS0A 1KWPA 1G8AA 1TFFA 3PJ8A 3HX4A 1H1SA 4AZFA 4EH5A 4BC6A 2ESMA 5KZ0A 3QQFA 2VV9A 5LXHA 4D5HA 2K22A 2ZV7A 4FZSA 4D2TA 5B2KA 2KFJA 3LFNA 3QE6A 2WU6A 4J1RA 3DZOA 2LD9A 5LWNA 4KD1A 2KNBA 3FE3A 1U00A 3VRZA 4RX7A 4MBLA 4QMQA 3BL9A 4IAAA 3G6GA 1GJZA 3PZDA 3R71A 2ASQA 3VUTA 2CGWA 3NCGA 5BMMA 2CU1A 2WQOA 3C4XA 4Y85A 4EOQA 5EOLA 3UE4A 4D28A 4RC4A 4EH4A 1TZOA 4IKGA 4NJCA 4OTWA 4FSNA 4DH7A 3QHTA 2NYAA 5A46A 3VUYA 3EQFA 3HNGA 5H8BA 4BNEA 4FJZA 2KN5A 2QODA 4M0YA 4BOSC 4ZYNA 2QO7A 5BYSA 2Z7RA 5K0KA 4MH8A 5BVWA 4ZS4A 1PYWD 2YIRA 3F3VA 2I1JA 4JNFA 4TYEA 2QVSE 1HQRD 2RD0A 3DPPA 4MACA 3KY2A 1N60A 1WGGA 2CCIA 5CU6A 3NVVA 5M4IA 2YLLA 5CSHA 4YC3A 3WYXA 3TDVA 3NYNA 3OY3A 4L3LA 3DBFA 4BFMA 3IHPC 1LEZA 3FI4A 3BK2A 3GENA 3V8WA 2M17A 2JY6A 3AG9A 5JEBA 2NCNA 4RJ5A 2W0JA 5TSSA 2WMXA 2PMRA 2OGVA 4D9UA 4C36A 4R3RA 4EBVA 2W4KA 2BT6A 1QF6A 1FPYA 4AGCA 5FP6A 1Q8UA 3ZO2A 3VRAB 4CFFA 4P1BC 4JDIA 1UGMA 4LTUA 2MP2B 2R3OA 1I49A 1WBPA 2CKQA 1CJEA 4JAIA 4FZFB 4JWSC 3Q8FA 2IZUA 3ZW3A 4M0MA 4EUTA 3OFMA 2LZ6A 1JKLA 3PPKA 1FMOE 3U4UA 1KH0A 4FTKA 3B52X 3UG1A 3ZNID 3BQRA 4K0YA 4GOCA 3D32A 5KMKA 4XBUA 1PUTA 4NIFA 4OUCA 1OQRA 5CT7A 3W0QA 3L9LA 3IT4B 3ML9A 3KK9A 4JX1C 3HV7A 2R61A 3SD5A 4UWBA 4O38A 4IAYA 5IPJA 3PY1A 3NR9A 1SJED 3QHWA 1WGYA 3AE3B 1FVVA 3RPFC 2Y9QA 1B6CB 2QHNA 3A4OX 4U45A 4HY9A 2ONQA 1PGAA 1SE4A 4L8MA 3RULA 3RNEC 4NM7A 4EOJA 1D5XC 2WMBA 3MY5A 4FJVA 4P1CC 4G31A 2UYZB 4ANLA 4GSBA 1A9UA 2R2PA 5CF5A 2KN4A 3NVKI 3OWGA 5M57A 1FOTA 4AZCB 5BUJA 3RK9A 2NRYA 2MLBA 5GINE 3VULA 1APME 4BB4A 4GDKA 1A48A 1F52A 1E0ZA 2DYOA 2OW3A 1QCFA 3A9KB 3RALA 4AA5A 2J9MA 5DN3A 2BGFA 2EKEC 4PWNA 4R5IA 3NUSA 4A9YA 3NUPA 4ZTNA 3SEBA 4GT3A 4FVQA 4XNEA 3QTUA 5A6OA 4C4IA 4GKHA 4WRGA 2LEKA 4ANMA 4BOZB 3RNGC 4HGSA 3P9JA 4TYIA 3UBDA 1TQMA 3PPZA 5HCZA 3BYOA 2OJIA 3FILA 1JWUD 4U9AA 3V5JA 3DBCA 5BVKA 3FKNA 5HCYA 4KSKC 4JNWA 1U54B 2WXKA 4AOIA 2JYEA 3Q9WA 1IBXB 2YCRA 4L01A 4JMQA 4CT1A 2LUMA 4AF3A 3NYOA 4DC2A 5K9IA 3DX2A 5HG5A 2WXPA 4DTAA 1ZZLA 5IF1A 4X3FC 3PA4A 4G3CA 4AZIA 3OROA 3A7FA 4KBCA 4OLIA 4LNNA 3VS0A 1FMAD 3OWLA 4D8JA 1M2PA 1STCE 1FNVA 4ACCA 4BTJA 5LXMA 4M02A 4RGNA 3I01A 1H08A 5C27A 4N57A 4AG8A 3EQDA 3DTWA 4IFCA 3O0GA 3OUKA 3MA3A 2PMLX 2QLUA 2HWOA 3ZEWA 4WAFA 2RAIA 3U9CA 2MEKA 4A9AA 2WXVA 1DYQA 3AE7B 4BCHA 3U7DA 3ZDTA 1PXOA 4ANBA 3DY7A 4R7HA 5LVPA 3ORPA 5FTQA 4DHZA 5AM7A 3D7TA 2PTKA 2GBRA 1E8YA 1STEA 3OD6X 3ODYX 5JKGA 4O4DA 4ZEGA 2QOIA 2LGXA 4RM8A 4YMJA 2ITPA 4F64A 3TM0A 2BRGA 2VTNA 3COMA 3SR6A 4W9KA 3CKWA 2WXHA 3RHXA 2QOKA 4GIIA 2K6QA 1DGJA 2XBAA 4BJJB 5C3JB 4RSSA 1H28A 1SIFA 2J6MA 4FTJA 4H2AA 1IUEA 1JRPA 1X1MA 1CDKA 4WJQA 4LRMA 3SXFA 4IX5A 1UVRA 4F09A 5CSPA 3SC1A 4KIQA 2WHIA 2FBWB 3L9PA 3PFQA 5D1JA 1YQ4B 4K77A 2HAKA 5DIAA 4C3RA 5KHQA 4L9IA 4FTIA 3P2BA 4JVGA 2WEVA 2YWPA 4PS3A 3E7VA 4AW2A 1E1XA 1WXMA 2IO0B 1RRBA 3KW5B 3ZBXA 2J7QB 3COHA 3GQLA 2O8YA 3ZSIA 2O2VB 2B9FA 2L05A 3GVUA 5E91A 3AC1A 4QO9A 3AT4A 2R64A 5IUHA 4EZVA 5M4CA 5C8NA 4K18A 4H05A 5FBNC 3Q5ZA 3BRBA 3O8UA 4LOOA 4YNEA 3C13A 4I22A 1AGWA 3NW7A 3BVTA 3BWJA 5TOZA 4ACGA 2WXIA 1WCCA 3C0RB 3H9OA 3BYSA 2CS4A 2JSVX 2UV2A 3WI6A 4XMOA 3Q04A 4QD6A 3ZKJC 2WXMA 4XCUA 1T45A 5C03A 3Q9XA 1ENFA 1SGHA 3UIUA 2F7PA 3NUUA 4EQMA 2X2LA 4I4FA 3DLZA 4IW0A 4KSQA 2Q5WD 5K5XA 4ACDA 5BX0A 4WO5A 4BDIA 1XMLA 3QC8B 1Y8YA 2YWVA 1RJBA 3UJGA 3BINA 1WXVA 5KMLA 3BUDA 1URWA 4L6QA 4EK3A 4C2WA 1V1PB 3KCFA 3ID6C 2ZDTA 1WBNA 3MJ2A 4FL1A 4AWJA 3H7SA 3PG1A 2GFSA 2X5CA 4DFNA 3WA0A 3R9OA 2L7RA 3QWKA 1XQZA 1ND4A 3ZRMA 2W3SA 5AFVA 4BAXA 3OLMD 3QBNA 2DUVA 3DV3A 5AP4A 3DKGA 5IEXA 5L6OA 4ENYA 4LJPB 3DVNV 2MI7A 4IB5A 2VH2A 3RAKA 3LJ0A 1LM8B 3I5JC 2QKWB 4GLSC 4WNPA 4GSWA 2CJNA 4BZDA 2QMTA 3JYAA 2Q13A 4II3B 4RVLA 5J1VA 3MTLA 5E6NA 4IJPA 1J7AA 4WSYA 1YXTA 2IG7A 4FEXA 2PVOD 5A14A 2PEAA 2QIEB 3LFDA 5AIKA 3OJ4B 3NUAA 3GUBA 2A5UA 1ZYJA 3UZTA 1E8XA 4DH5A 3MVLA 4GK3A 4D4SA 4Z7HA 3UTOA 2B9IA 1MRVA 3N1ZC 3NUNA 4RX9A 1NT2A 2AQ3B 4X6RA 4BHNA 1HZ5A 2UZVA 2KLCA 4EONA 3I2WA 2MQJA 4N6ZA 3ANRA 3OHTA 1DKXA 4B9DA 5CAPA 1VYZA 3PY3A 5BYLA 4MELA 3NX8A 4FA2A 2X3XA 4EZNA 2JITA 2XRUA 1JNKA 2PWLA 2RDGA 4BZAA 1Y57A 4XDCA 3W10A 2CU3A 3EB0A 3DGKA 3W2QA 3Q3MC 4PMTA 3T3VA 1M2RA 4RLLA 4CD0A 3VR8B 3Q96A 4NPNA 2PE0A 4I6PA 3R2BA 3WAMA 3MPAA 4RJ8A 3LVPA 2R3MA 4J7BA 1AYFA 3DVGY 3O65B 3RN9C 4OVUA 5IH5A 2VO7A 3DX4A 1AARA 2LHDA 1OI9A 4U79A 3G51A 3I04A 2W1CA 5IEVA 2XBJA 3MGYA 4KINA 4EK6A 4CG8A 1Q3WA 2K8BA 4J71A 4AOTA 4DEIA 2OLCA 4KKGA 2VWZA 3R3MA 5DPTA 3LXFA 2HZ0A 2VTLA 2WQNA 5L4QA 4IZ5A 4EYMA 1DI9A 1OKWA 3SHEA 2JU6X 4EJ7A 3C1XA 5EI8A 1N5XA 3BIID 2EXMA 2OJ9A 3HAHA 3PTGA 4FTCA 4FHJA 3KXGA 3DLSA 3BX5A 3ALBA 2J7TA 3NYXA 4B95A 2JKKA 3A2CA 3KMMA 4WG4A 4IMYA 5HIBA 1OL5A 1V8CA 4RFYA 3PVWA 3I5ZA 3VH4B 4FT7A 3FMEA 5CEQA 5HEZA 4HVGA 1XLOA 2ZVNA 4WUNA 4LLGM 5C2TB 1OPLA 2W96B 3HZTA 2XA4A 1YN4A 3KRRA 1PFDA 2Z8LA 4ZTQA 3PLVA 2KDIA 5H3QA 3VBTA 5C8KA 4NFMA 4GEOA 2N9XA 3PJ1A 4KRDA 3Q69A 4MM3A 3KL8A 1XCQL 4U41A 1IRKA 4C80A 5FEQA 5EFQA 3HVZA 4FV8A 3ZJUA 3HA6A 1CMKE 1VZ7A 5ANEA