4IM0A

Structure of tank-binding kinase 1
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
659
structure length
619
Chain Sequence
GSMQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRNIKPGNIMRVIGEDGQSVYKLTDFGTEEYLHPDMYERVLRKDHATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVMEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Tank-Binding Kinase 1
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase TBK1
total genus 208
structure length 619
sequence length 659
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF18394 TBK1_CCD1 TANK-binding kinase 1 coiled-coil domain 1
A PF18396 TBK1_ULD TANK binding kinase 1 ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4im0A02
1.20.1270.420 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4im0A04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4im0A03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4im0A01
3V51A 4MGKE 3EFWA 3EN4A 4GYIA 5CEQA 1Q1OA 4LM5A 3KCFA 2BZKB 2BRBA 2ITZA 5AIKA 2FO0A 3ACJA 4BDFA 4CSVA 4PL4A 2KLCA 2KWCA 4HK2A 3NYXA 4WQOB 5AX9A 3POOA 3MYGA 4L9IA 2YEXA 5JZEB 3A7GA 4MD9E 3FSKA 2OKRA 2PVYA 3JY9A 3TV4A 4ZY4A 1R4NI 2NS5A 3GU6A 4JIAA 2YLMA 5CHFA 5DCNA 3U55A 1IASA 2Y7JA 5HCYA 1GJZA 3CJFA 3KUCB 3LIJA 5HORA 2XNMA 4CFWA 2C3KA 2JDSA 3R3MA 2QODA 3VS3A 1WAKA 1YWVA 3E93A 1W7HA 3QRTA 4JRNA 2YM3A 2I0EA 3BU6A 3ENEA 4YHFA 4XLIA 3PY3A 3CXWA 3GP0A 3Q6WA 4FEUA 5AEKB 4FI1A 5HESA 2J5FA 5FM2A 3BGQA 3WF6A 4QP7A 2VNWA 5ACKA 4FEWA 3C7QA 3F5PA 2FUMA 3H10A 2C68A 3HA8A 4I6BA 4AP7A 4C33A 3UINB 5D11A 3RJCA 2PUIA 2GMXA 3K5VA 3GBZA 3IO7A 3O2MA 2OFUA 5M51A 4FTTA 5CX3A 4C3FA 1OI9A 1YJ1A 3FWQA 3ATSA 5E1SA 2P2IA 3R22A 3FQHA 4P4CA 4F9WA 2O2VB 2OJGA 2QNJA 2C7HA 3N4VA 4JNWA 3DDQA 3FZOA 3TV6A 3E8EA 2G45B 3EECA 5D7VA 4BFRA 3VQIA 1TQIA 2IW6A 1Q3DA 4KKHA 4O0YA 2C6TA 2VX0A 1MP8A 3D5XA 3F82A 4GMYA 3MDYA 3MJ1A 4MWHA 5L83A 5HLWA 4C34A 3LCOA 4EH5A 3FBVA 3KRLA 5IEYA 4KIKB 5J79A 3EIDA 4BBNF 3PRIA 2GS6A 3V5LA 4DH3A 1TBEA 1DAWA 3R30A 3IW6A 4H36A 4XCUA 4EHGA 4BCJA 1S3SG 1KJTA 4CFNA 2WMVA 3GOKA 1IRKA 4LFIA 4O0RA 2DHZA 4XX5A 2OJJA 2ITQA 2J5EA 4E4MA 3RINA 1OL6A 4LGGA 3IS5A 2RG5A 2W1HA 4KD1A 2JIIA 2X8EA 4FG8A 5EM7A 4FKJA 3O71A 1H1RA 4L00A 4BC6A 1Q5KA 4IAFA 3BGZA 2KWUB 2WX0A 2E9VA 3CR0A 4UMRA 2BFXA 2CDZA 5ANIA 3BBTB 3ZNID 1ZY5A 4KDLB 4QMWA 3RT3B 2IVTA 2LAVA 3WALA 3HP2A 4CRSA 3KL8A 4ASWC 1APME 3LMHA 5JGDA 3LW0A 4XG8A 5B2MA 2EMSA 5IA7A 5DMZA 5JHBA 1OPJA 4WRGA 4ZTMA 3NSZA 5CEPA 5LMBA 3ZO2A 5E8TA 4JDHA 4R1YA 3NUAA 3OROA 4FK6A 1ZZ2A 2PYWA 2P33A 2QOHA 4AA4A 4H3PA 2H9VA 3GENA 4YBKA 2BWES 2KHWB 1KOAA 5DGZA 5DI1A 3SHQA 1WFCA 2FSLX 1E8WA 3TCAA 1XH8A 5D12A 4ASEA 1GNUA 5AP3A 4IJPA 2F2CB 5M4CA 3FMMA 2BGFA 4RZWA 3SXSA 3ZW3A 2O5KA 1UA2A 3OT8A 2YCRA 2BDJA 2CGXA 4BDEA 3FE3A 4DINA 2GBKA 4R6VA 1WY8A 3BYUA 4RX8A 4E5WA 3R1YA 4II2B 2GQSA 5CU3A 3CGOA 4WG3A 4B0GA 3L10B 3W32A 5G6VA 4J71A 2VTAA 4BCMA 2UVYA 1XH6A 2YDIA 3JVRA 2R4BA 3O51A 3ORTA 4JDKA 4AX8A 1YXVA 1ZYDA 4JXFA 5K9IA 5J1WA 2DYOA 1QL6A 3IHPC 4O7VA 4YJUA 4CFMA 2JGZA 4L42A 3RCDA 4D4VA 4AE6A 5C8NA 5KMOA 1WVYA 2RIOA 4TV3A 5CF6A 3R63A 4RPVA 2R3QA 4AU8A 1FQ1B 4OTIA 4CV9A 5C8KA 4DGGA 3TUDA 2WTWA 3KK8A 3FXXA 3OY1A 1PMNA 1Q5WB 2BKRB 5JRQA 2IO2B 3IW8A 4MEMA 4W9EA 2XH5A 3OEZA 5A9UA 2XYNA 4GU2A 1V81A 4FK3A 4L7FA 4IX6A 3CQWA 3VQHA 4IFCA 1LEZA 4WUAA 4EBWA 4RWKA 4KNBA 3FI4A 1PXPA 1S9IA 4Z7HA 4DFBA 3NS9A 1OIUA 2PMOX 4BGGA 2WX1A 3APFA 3ORNA 2NPTA 2WQMA 1H26A 3QZHA 1EF5A 2OIBA 4FG9A 4HNIA 4TQ0A 3D2IA 2HE7A 1MRVA 2H6DA 5FDPA 5FLFA 5TF9A 2CKOA 1OUKA 1NDDA 3ITZA 2W1CA 1JSVA 1OL7A 1M14A 1GAGA 4K33A 4AWIA 3K2LA 5C23A 3SRVA 4L44A 3ZVVA 5EG3A 3CPBA 3UYTA 3PVBA 4IVBA 3DJ7A 3IK3A 3IONA 4I4EA 3LCKA 1UU9A 4FNXA 1WX9A 2M4NA 2YM6A 1WBVA 3A4OX 4QYEA 5DBXA 1NBFC 3D5WA 3DS6A 3QAQA 2OFVA 3D15A 3OWLA 2G9XA 2A2AA 1UNHA 1JKKA 4GDKA 4RM9A 4DHJD 4HGEA 4YTHA 3E8NA 2ZB1A 2XB7A 2YIXA 3OWJA 1G6JA 5T6KA 3NGAA 4WJQA 3VXWA 4OTHA 3CMMB 3SKCA 2XBBC 5GHVA 1FMOE 2E9UA 4X2NA 3G33A 3U4WA 4FSRA 4E6AA 5EYDA 2VWZA 2VTTA 2YISA 3EC8A 2CNQA 2NPQA 2R3FA 2Z60A 3NAYA 3REPA 3ZC5A 2G01A 2XK7A 5D94A 4E71A 1YVJA 2OSCA 4DTAA 2BZIB 4FTKA 2FCNA 5CEOA 1WCCA 3UQGA 5A4TA 3KXMA 2KZRA 2NP8A 3HUCA 3OP5A 2L76A 3QD3A 5KHXA 3U6JA 5CSVA 2BUJA 4MCVA 4IX4A 5EM6A 1RAXA 3Q4UA 2RFSA 3BCEA 4M69A 1KWPA 4LUDA 4F7NA 5AADA 2KO3A 3RP9A 4BOSC 4RC3A 2C6LA 2X2LA 4NKSA 4B95A 1J7LA 3TACA 2IZRA 2VN9A 3KRWA 5HX6A 4ANXA 1G8AA 4IVDA 2CGVA 1ISNA 1HOWA 4GJ2A 3PRFA 4PUZA 4M0WB 4HCVA 4K77A 1KV2A 5IZFA 3H9FA 4EKKA 3M2WA 3R1NA 4OTQA 2C6OA 4TZRA 3I6WA 3UIOB 4IB1A 1IEPA 3FLZA 4USFA 2KDFB 2KFKB 4HPLB 4FGBA 2W0JA 2QU5A 2UZBA 4F08A 4BDAA 4G9CA 2UW7A 4NUSA 3PTFC 5IH6A 4P2KA 4XNEA 2X7GA 5IA1A 4NH1A 1ZW7A 2WTJA 2OXXA 3F3VA 4D2TA 4ZDVA 2WEVA 2B9HA 3RNYA 4BI1A 5HG5A 2I40A 3WIKA 5M44A 5JFXA 3PA5A 3UOKA 1ZMUA 4W4VA 4G31A 4AZFA 5AA9A 4LJPB 4DFYA 1GY3A 2PE1A 4GVJA 2CS4A 4U43A 2XIXA 2NO3A 3B2WA 3BHUA 4YLLA 3T9TA 4AG8A 2NR2A 3V62A 3ZLZA 4IWOA 5D9HA 1P2AA 1KE7A 4H39A 1VZOA 2VTIA 2YABA 3ACKA 4UMUA 3DBSA 3QQHA 4K7WA 4NWMA 5I9UA 1O6LA 5D10A 3QTWA 2MA9B 3N3KB 2PMLX 1YI4A 1YQBA 3WI6A 1YX5B 4FV0A 4ZYNA 3BIZA 5AUZA 2HY81 5LARA 3ZU7A 1QZEA 1KE9A 3JSVB 1P9DU 1WJ4A 2RL5A 2HY0A 4PQNA 4EH4A 4BCQA 3UG1A 4FZDB 4EHVA 4CGAA 2C1BA 3QD2B 3H30A 3QTZA 3IBEA 5IKWA 4QT1A 3E7OA 3Q60A 2GPHA 3TM0A 4A07A 4L68A 2BILB 5AUVA 3UGBB 5H8EA 2O2VA 1K2PA 2YN8A 4LGDA 4DN5A 1A06A 3FUPA 3HV7A 5E9EA 3OOGA 4NJDA 3QC9A 2XKCA 4APPA 4FX3A 4RX5A 4M14A 4QMXA 5AAGA 1DAYA 3WAMA 5AMNA 4W9HA 3DOGA 5K5XA 4CKJA 3MIAA 2WTKC 5I9ZA 2AL3A 4C59A 4EHZA 5AUUA 2VWIA 1O9UA 1Y8GA 1PF8A 4BIDA 3IGGA 4TRLA 2YJRA 5JMSA 1D3ZA 3ID6C 3VUIA 4D9UA 5M09A 2HZIA 3KQ7A 3RK9A 3SXFA 4EOMA 3OS3A 1C3TA 2VTNA 4WOVA 4A9SA 3DPDA 5IU2A 5FR6A 3TBLD 5E8SA 4AN2A 5BVNA 4HCUA 4OBPA 3ULZA 4ZY6A 2X4FA 3RZWC 2R3JA 5CQUA 5KCVA 4J53A 1WVWA 4BDIA 2OW3A 3OBJA 2XNBA 3QQGA 4EEVA 4ZXTA 5CT7A 3K54A 2LUEA 3PG1A 4HDQA 3CS9A 5C4KA 3R7YA 4QMQA 1RLFA 3MFSA 3ZUTA 4FKWA 1YX6B 1J7IA 4JAJA 1WRDB 3QIJA 4O1OA 2W1EA 4KINA 3KCKA 2V22A 1UWHA 4GU9A 4Q5EA 2PUNA 3R7VA 1Q4LA 2VTSA 2UYZB 4RT7A 3GXLA 3NX8A 1YOMA 4RVLA 1OEYJ 3TL8A 3VS1A 1XQQA 4M84A 3MVLA 2DAJA 4GSBA 3X23A 4R78A 3A9KA 1Q3WA 3L13A 2IO0B 2V7OA 2A27A 5AUYA 3R9OA 4X3FA 1SE9A 2PE2A 2EB3A 1ZYSA 4QYGA 4AZTA 2DZMA 2L05A 3EHVA 2UW9A 3D5VA 5CVGA 1WBPA 4I5MA 4EJNA 3FKOA 1L7YA 1J1BA 5H2UA 4H1MA 3OVVA 4KSQA 4FL1A 4ZZOA 3E3BX 5DG5A 4JBOA 1OBDA 1CM8A 3R7GA 4L01A 2XYUA 4C61A 5IAAC 2VTRA 4P5ZA 2GTNA 3I0OA 2J7TA 3GVUA 3QZFA 4XX9A 4BCHA 3CSFA 3JYUA 3AT4A 3IW5A 4ZTHA 3QRKA 4YTCA 5HEZA 4JDJA 5L8JA 3UDBA 4YJVA 5CASA 4I92A 4BBNC 1IPGA 1OB3A 3RBWA 1KE5A 2HXLA 3OY3A 5E8XA 3DQVA 1WGGA 3UF8A 2LGYA 4TKSA 4S30A 3RWPA 1PMVA 4W9FA 2QVSE 4NFNA 3COHA 4AF3A 2ZOQA 4DEDA 2PVLA 4PTEA 3RNIA 3NUUA 3R1SA 4C7TA 2JFMA 4X0MA 2W9NA 3PSEB 4DEEA 4DXAB 5AUXA 3TN8A 2YM5A 4MH7A 4RX7A 4F1TA 3UPZA 3RPRA 3QC8B 3PSBA 5DVRA 4O0WA 3UIMA 3H7SA 1Q8TA 3MB6A 4RFZA 3FL5A 4O38A 3N4UA 4CKRA 4LRKA 2KFJA 3C4XA 2IO3B 5L6WL 4QP1A 3NUPA 3NIZA 3PP1A 3C5UA 5AJQA 4E4NA 1CMXB 2QG7A 5CAOA 3BHHA 3H3CA 4RWJA 2WU6A 3RPSA 2ITVA 4M8NA 5DA3A 4IM0A 3O96A 2Z7RA 3DFCB 4IE9A 2BHHA 3WZKA 4FOBA 3V8WA 1G5SA 2GQRA 2H34A 4D0XA 5E6OA 4KSKC 4NCTA 1PW2A 2Y6OA 4UV0A 4RWLA 4P90A 4HVGA 4Z55A 4KIOA 3C5IA 4ZMEA 1J91A 3UO5A 2WTCA 4JOAA 1TQPA 4LRMA 5HCZA 3QTQA 4BCPA 5GNKA 5A14A 2AYPA 4LRJA 4D5KA 5M55A 1WXSA 2EUFB 4GUEA 3MJWA 4DBNA 4YO4A 3CJGA 3VH3B 5C26A 2WZJA 2K8BA 3MWUA 4KBCA 4UALA 3CY3A 2ERZE 4I6NB 5G1XA 4IW0A 4EOJA 2BDFA 4O96A 2B9JA 5E8VA 1FVRA 2OZAB 4HYIA 2WMUA 1M7NA 2WXVA 5CHWA 3TDWA 3CPCA 3LMGA 4CFXA 1HCKA 3QUEA 2REIA 4B9DA 4FIIA 4C36A 5GZAA 2BMCA 4GEOA 4U41A 3UOHA 2KVRA 2LZ6A 5B2KA 1OITA 2WHBA 5L2TA 2DQ7X 1S9JA 3TZMA 1P3QU 5TE0A 3MVMA 5EHOA 3R2BA 2C3LA 4QMTA 3NUXA 1V0OA 5ANGA 3WBLA 3AC3A 4EK5A 2HYYA 3O8UA 5DPSA 4YJTA 2VWBA 4WWNA 3EQIA 4F65A 4QP2A 1UKHA 3W1YA 5CYIA 4YLKA 3ECIA 5L8KA 4EOOA 3GNIB 3NNVA 5J7HA 3BU5A 3UQBA 4R77A 4P5QA 3FHIA 3OCSA 5J9YA 4IB3A 5DR2A 3VO3A 2FVDA 4AOJA 3R9DA 2J0MB 3NY5A 2VTOA 4E4LA 4JGHB 4FE2A 4L8MA 5IMXA 4C57A 2D07B 3SHEA 4MYGA 2FYSA 3MFUA 4IACA 3K3IA 2BCJA 2R2PA 3HMOA 4RIOA 3KU2A 2JITA 2QOBA 1H28A 1VYZA 4G3CA 4OT6A 3P86A 5JFVA 1WR6E 2LGDA 2C6DA 1WE7A 1WH3A 3OXIA 3LQ5A 4F7LA 3ZNHB 5A4EA 1KUTA 3RHKA 3DPKA 4FNZA 4C02A 5AP0A 2JRIB 2RD0A 1OZ1A 3G9NA 1V49A 3GGFA 2KFKA 3E64A 1U5QA 2XA4A 4F7JA 2W4JA 1E8ZA 4WA9A 3LKMA 4AJYB 4OTFA 3NUSA 1H24A 4HZSA 4XV9A 5IQAA 3KF4A 3ODYX 3Q4ZA 4KS8A 3LFNA 4QTEA 4NW6A 2FSOX 5JN2A 3L54A 3PDTA 3LLAA 3BLQA 2B3AA 3WF8A 1PKDA 1QPDA 2UZNA 4AFJA 3RCJA 2IYDB 3UODA 4BRXA 2MRPA 4HDOA 1KLVA 3CSTA 4QMOA 3KREA 1W98A 4FSMA 3F3UA 2XK8A 3QTSA 5E8UA 2ITUA 4M0YA 5M4UA 1H1WA 2KX0A 5A6OA 3FC2A 5IG1A 1BX6A 1M2PA 3L9MA 3JY0A 4MM3A 1F9JA 4ZRJA 2JC6A 3UQAA 2N7EA 4YC3A 3CBLA 4HVHA 2MP2A 3LE6A 5B7VA 3HMPA 1DM2A 3QTIA 1WBSA 3FQEA 4RZVA 4GIHA 4ANMA 1LEWA 3A2CA 4OR5A 4TYJA 4HVDA 1WZ3A 3JSVA 1GOLA 2V4LA 3PVUA 4I6FA 2RR9A 1A5RA 2R64A 3DVGY 4F7ZA 5KMMA 5IUHA 4MBJA 3MA3A 1WMHB 2L7RA 3GU7A 5HZNA 4ACGA 5JT2A 1VD2A 5AV3A 1H1SA 2JVCA 2KANA 1Q24A 4GGQA 3WANA 1XD3B 4A3OA 3LXKA 2NPTB 3H9DA 5HE1A 4WNMA 4YJOA 2ASQA 4HZRA 3BV3A 3DXPA 2P3GX 4O0XA 2ZEQA 2C9WB 3AGLA 2GBJA 5KKRC 3TIYA 3JXWA 3ATTA 4DA5A 1UKIA 4ANSA 3HK0A 1RQQA 3C1XA 3EYGA 4ZTRA 2IY0B 2YM7A 3ZM9A 2KTRA 2AEHA 3GEQA 2HWOA 4NJ3A 4ZJVA 4CQGA 2MP2B 1E90A 4BKSA 3UZRA 4R3PA 2G4SA 4ZSGA 2WNTA 3LOKA 5HGIA 4K0YA 4HNFA 4BB4A 3ALNA 4E3CA 4MDKE 1RE8A 5FQDC 2Q0NA 4W8EA 3QUPA 3DKFA 3EFUA 4AQCA 2DENB 2YM4A 1NI2A 2YM8A 1R0PA 3QXPA 3QQKA 3L16A 4CEGA 4LDTB 3QHTA 2ETKA 4IBMA 3DLSA 2HAKA 3G6GA 4LG4A 4AGUA 4FV8A 3VBXA 2ACXA 4J6IA 2K39A 4C2WA 3NS8A 3DQWA 5AUWA 4YPDA 3S2AA 5D7AA 3GQIA 3DBEA 4JBQA 1Y6BA 5LCKA 1CKIA 3W10A 2RPQA 1H0WA 4LJOB 1YKRA 3D83A 4Y95A 4ICUA 2LVOA 4I0SA 5CQWA 4ENXA 3V61A 4NIFB 3W2OA 3MY0A 1YXTA 5GJGA 4CNHA 4KB8A 2R3KA 4IZAA 2BYEA 1J3HA 5CF5A 3LLTA 4OTGA 1B6CB 4Q9SA 3R7EA 3B8QA 4IC8A 3BELA 3H4JA 4DGOA 4B4LA 3M95A 4FSQA 5KO1A 4ANLA 2J6MA 2W5HA 4G3XB 4HCNB 3W1SC 2PPQA 3OG7A 4RFMA 4IJ9A 4AOTA 5HX8A 3KULA 2KTYA 4NEUA 2IVVA 4LDTD 5HLPA 1J7UA 4FV9A 3OTUA 4FR4A 5E90A 3WE8A 2BWFA 3P7AA 3PGEA 5J87A 1WI0A 2JDOA 4JX3A 3LVPA 5FWKK 3Q9XA 4DHJB 2X6EA 2R2QA 2UVZA 3RZBA 3FMLA 3NDMA 2BYFA 2RG6A 2ZVAA 3L8SA 2XZSA 2XEZA 3PXKA 4JI9A 2JLDA 3A60A 3R00A 4FTQA 2M0XA 3CEKA 4EH9A 4QPMA 1GNGA 4JBPA 2YZLA 4MK0A 3ULIA 3VUGA 1UELA 2UWQA 5LCJA 3HDMA 2B7AA 4M0ZA 2MCNB 3PVLA 3MH1A 1VR2A 4B99A 2PMNX 3PXRA 4GFMA 2WWZA 3MHSD 4GIVA 3TV7A 3G0EA 1E8XA 1YDTE 4MJSA 3F2NA 3OBGA 4JRVA 1YHSA 4K2RA 4E4XA 3FDNA 4NM3A 4PL5A 4JIOU 1E1XA 2LRWA 5AUTA 5JH5C 2Q83A 3BGPA 3UE4A 3QWKA 3BZ3A 3HKOA 1SNUA 2EVAA 2OIDA 4BWPA 2WDTB 4FICA 4UMQA 1NY3A 5F94A 4E73A 4FKQA 2X8DA 2QLQA 4C4GA 4JG7A 1EF1A 4WAAA 4IHPA 4IM3A 2WMBA 1A9UA 4PDPA 5AP5A 3ZFXA 3V5QA 5M08A 5A4CA 4W4XA 3HHMA 4N6ZA 4DHFA 2I0HA 1PXIA 4YZCA 3FPMA 2WD1A 3UYSA 5F1ZA 2QHNA 4RVKA 2VU3A 3ZYAA 4O7LA 3QQJA 4I20A 2RSVA 4LMUA 3T8MA 2XBAA 3BEGA 3OCTA 3QKMA 5KMLA 1URCA 3UNKA 1M94A 4BCIA 3PJ2A 5KHWA 1WGHA 3PLSA 2JIVA 5FEEA 4M68A 1IAHA 3HLLA 2C3JA 1WJ6A 4OLIA 3WARA 4CCBA 4LOPA 4GV1A 5BX0A 3IW4A 1ZWSA 4IWQA 4RM8A 5HO8A 4MSQB 3V6EB 5CNOA 3LCSA 2YDKA 1UH6A 2GQGA 2ZMDA 2KN5A 3Q4TA 4MJSB 4UEUA 5DT3A 2EMTA 4NAWB 2CNVA 4R7BA 2XM9A 1YOLA 4AFEA 3BBWA 2HD5B 5GIOE 4TTHB 4QTAA 4FBXA 1FMKA 4ONAA 3UMWA 4F1OA 4MXOA 4CLJA 4QMMA 4QP3A 4PS8A 4GW8A 2UZTA 2ETRA 4H3BA 2ZV8A 1W84A 1O6YA 2XNGA 4C8BA 1WZ0A 2C1AA 4FV6A 2WTIA 4O7TA 5BVFA 2PZRA 3MFTA 2PUPA 2B1PA 2EKEC 3DVNU 4RG0A 2XS0A 5G55A 2I6LA 3U30A 2PTKA 2YWPA 4DH5A 4EH8A 4DGMA 3OJ4B 3U9CA 5EKNA 1PYXA 4WO5A 3ZNZB 5LVPA 3I7CA 3K9OB 1Q8YA 2OG8A 5IEXA 2VWVA 1Y57A 4FT3A 5KZ0A 1ZY4A 4IAIA 2IG7A 4X21A 4L45A 4EH7A 3UVRA 4TY1A 4X2KA 4BBMA 5J9LA 2J90A 4MH0E 1SVEA 3LXPA 3MA6A 2MBQA 4AE9A 3S3IA 3SW4A 2LASA 4HCPB 4BHNA 3DBFA 4MNEA 4APCA 4BL1A 4YURA 3TI1A 4KABA 4DITA 3C50A 4FTLA 4CTBA 1UZXB 3ZZEA 2MLBA 5AWMA 4GFGA 2W06A 1GIHA 3KMMA 5AV1A 2RFDA 4FG7A 3BX5A 1Y6AA 1Q97A 4TYHB 5E7RA 2G1TA 3RI1A 4GN1A 4QTDA 3P9JA 5DOSA 4FADA 2YERA 3A62A 4ZS0A 2MBEA 2UW6A 3BYVA 3W55A 4MGZE 3UIPB 2W9ZB 3GUBA 1PXJA 4JT3A 4S32A 3RGFA 4U80A 2QQ7A 3R01A 4B7TA 4IB0A 4MXAA 3SLSA 1RFAA 1PYEA 1SIFA 4J95A 4JLCA 2ZNVC 5I9YA 3B1LX 5IH5A 4MEDA 3DB6A 4ANUA 4HXDA 2GNIA 4F9AA 2PVFA 4U40A 1OIRA 3QUDA 4RJ5A 3ORMA 3UQCA 4BGHA 1PXMA 4RQKA 5AR2A 3VJNA 1KM7A 4XHKB 2Y4IC 3F66A 4WNPA 2RF9A 4WT6A 5BVKA 3UNJA 4LV8A 2QOIA 3QKKA 4ZRKA 4CYEA 2UW0A 2XKEA 3X0WA 1GJOA 4L3LA 1XT9B 1H8FA 3PLAE 4D2RA 3OD6X 1TKIA 3V5TA 4A9YA 4AA5A 2G3QB 4Y72A 1KE6A 4LV5A 3UMXA 3SV0A 1R78A 4MTAA 3LDZE 1CKPA 4O7NA 5A6NA 2CHWA 2KDEB 1SZMA 4CD0A 1G8SA 2XJ2A 2OIQA 3GC8A 2J0KA 3AC1A 3FMKA 4G3GA 4ZTLA 3ZZWA 4ALWA 4QP8A 4BWXA 4CXAA 1MRUA 3KRJA 5IMEA 4GK2A 4EOSA 1Q8ZA 3W33A 1PJKA 4DDGD 3RVGA 3ZRMA 4E26A 2OJFE 2BAKA 4QMYA 1PY5A 1V5TA 1OBGA 3PPAA 4V01A 1IR3A 1H0VA 2QOQA 5HG9A 1R0EA 1XH9A 4GUBA 4Y5QA 4YO6A 1MQBA 4OAVB 1PQSA 2CR5A 4ICVA 4F0FA 5FDXA 4X2GA 3SVVA 4DFZE 4WJNA 2ZVNA 3DVGX 4FKSA 2JKKA 3QWJA 4HPTE 3HUBA 4XLVA 3ML9A 3KXZA 3WZEA 4DEHA 3ERKA 5EI6A 2LI5A 4D28A 2ZCBA 2CKQA 4AS0A 3DXNA 3R2YA 5AP7A 3JS2A 4X7QA 1OIQA 3PUPA 3P79A 3VBVA 1WBOA 1CSNA 3FLQA 2EXEA 3GT8A 3HRBA 2GS2A 4OW8A 3R8MA 3NW7A 1Q0WB 1WJNA 1I44A 5GZ8A 3HM3A 3KY2A 4KBAA 3S2PA 3W2PA 5HI2A 4FVRA 2R7IA 2GCDA 5LVMA 3NRMA 5DEYA 2D2QA 3TG1A 2PK9A 4FKOA 5LXIB 4CZYB 4D5HA 2UV2A 4GVAA 2E9PA 4LYNA 2UW4A 4EONA 3FMJA 2JXXA 2BKKA 3UP2A 2FIDA 5K0KA 5I5ZA 2ZV9A 5L2SA 3V5WA 3EN5A 4AP4C 3N4TA 3NYVA 3PXFA 3NYOA 4HJOA 5A4QA 1ZARA 4V0GA 4CO7A 4TN6A 2EXCX 4A4XA 4EUUA 1OMWA 2HK5A 4EOPA 2W4KA 2P55A 2WMQA 5F4NA 3TZ8A 3ZLSA 2IY1B 4FT0A 1IP9A 2QOLA 5L2QA 4TWCA 1UU7A 3Q96A 2K25A 3SOCA 3ET7A 2NRYA 5EDQA 3VW6A 5HLNA 1FOTA 5HVJA 1M2QA 2WPAA 2JAVA 4FUXA 4D4SA 3H7PA 3P0MA 2BYVE 4IVCA 4EOYA 3WAPA 4O7WA 4C0TA 2NBWB 3KW5B 4EEWA 5HU3A 5ANEA 2Z2WA 3SA0A 3K5UA 2UUEA 3DU8A 3E87A 5FP6A 4WUNA 3I5NA 4GYGA 2YZAA 3FYKX 3MPAA 3I3TB 5EQYA 4CQEA 3LCTA 1ZKHA 2NCNA 3HM6X 2JKOA 4BVUA 4C2VA 1FBNA 2X9EA 4O91A 4E5BA 4JAIA 4CMUA 3KN5A 5AR4A 4TQ1A 5DIAA 4U8ZA 5I9WA 4LL0A 5KBRA 5HTCA 1REJA 2V55A 5CVHA 5TOZA 1UVRA 3T8OA 2OGVA 3D7TB 3W1FA 2BVAA 4FL3A 3TKHA 4EQCA 1ZMVA 3MB7A 5CTPA 4DG3E 1ND4A 2VRRB 1CTPE 3DBDA 4ITHA 5B0XA 3Q53A 3PWDA 4EZJA 3RAWA 2O0UA 4A3PA 3KRXA 4WWOA 2EXMA 2ZAZA 3DBCA 2IVUA 3DV3A 3CQUA 3A99A 4ITIA 4MXZA 1GUAB 4M8MA 2Z0EB 4WG5A 4YHJA 3FI2A 1U54A 4R3RA 4AJWA 2PUUA 3QA0A 4XUFA 4KKEA 4BKYA 3GCVA 4RQVA 1YHWA 3AT2A 4XG2A 4XP0A 1L2NA 1H00A 5BVWA 3VBYA 3HAVA 3UO4A 2YJSA 5DH3A 3P78A 3BWFA 2VGOA 4FZ6A 3V60A 1IAJA 3PE1A 5DFPA 3MIYA 2M1MA 5CSHA 1EUVB 2ZCCA 2BZHB 3V6SA 4FJZA 4EL9A 5CEKA 5E6PA 3R7OA 1OL2A 4YU2A 5M4IA 4CRLA 3AQVA 3SX9A 4P7IA 5D2MB 4WSQA 4DBXA 4O0TA 2X4ZA 1LFDA 2DZKA 3FI8A 3ZSHA 4R7IA 4TNBA 2NRUA 3R02A 4FA6A 1XWSA 3DNDA 3RCZA 3PT2B 3BV2A 4I5PA 5HIBA 4IZ5A 4JJRA 1YXXA 4OAUC 4XC2A 3DFAA 3U6IA 2IJMA 2OI4X 1ZOEA 4G6NA 3H9OA 4JDIA 2ITWA 2J0JA 4DGNA 3N32A 3QWZB 3QARA 2J2IB 4M69B 2UZVA 3EQGA 3Q6UA 1NVRA 4X57B 3BHVA 2KTRB 1LR4A 2PU8A 2Y5BB 3FZRA 3KYCD 2J50A 2CJMA 4YJPA 3MPMA 5CS6A 3R8LA 2CNUA 4F99A 3LQ3A 2YAKA 3NEWA 4CFVA 4KBKA 4L53A 2CN8A 4XJ0A 5EM8A 2ITYA 3G9LX 5CENA 1WZYA 4GL9A 4E5AX 1K8RB 2CKPA 1ZRZA 3EL8A 4W9WA 3TZ7A 4E7WA 3R28A 3QAME 4X3FC 3VTUA 2R3LA 4EYJA 4XG3A 4YZDA 1OKWA 4C4HA 2JFLA 3MH2A 3KA0A 3ZO1A 3BI6A 3EH9A 4FIJA 4LGHA 5BYYA 2QKRA 1Q62A 4KZCA 2ZPYA 4V05A 5GMVA 3EHAA 5ETIA 4QMUA 3PY1A 3TNPC 3UC3A 2IW9A 3HMMA 3R8PA 3O23A 5CAPA 3E63A 3KK9A 3ZO3A 3U8ZA 4BVUC 3OXZA 2IZSA 4FIEA 2QU6A 5E8WA 4IX3A 5I9VA 4R7HA 4ZTNA 2SRCA 1X1MA 2HWPA 1NT2A 3ZUVA 1HCLA 1XJDA 4JQ7A 4KRCA 1LUFA 2KJ6A 4GKHA 3EWHA 3QCQA 5AAEA 2QOOA 2I7QA 5M07A 3F3TA 4IAKA 2BHEA 3HZTA 3TTIA 2HTHA 2C0TA 2ZB0A 4KKGA 4BDCA 3NZUA 4EWQA 3FXWA 2H8HA 1UNLA 4QOXA 5EDPA 3O7LB 3UIBA 3MSSA 3A8WA 3NLBA 3RWQA 4X6RA 2A5UA 4LI5A 1PXNA 5HBEA 5IA0A 4U44A 3OW4A 5E4HA 3KULB 3C4ZA 3AD5A 3RM6A 4DFLA 5KUPA 4NNJB 2IZVB 3ALOA 4QMLA 5CI6A 3QX2A 3PIXA 2CHXA 4MBLA 3PWYA 2VO7A 3ZFYA 2ITPA 2O3PA 4EK4A 3RYTA 2HW6A 3WIGA 4C35A 5CNNA 3GU8A 4OTRA 5KMNA 4YJSA 3UC4A 4W8DA 4X6QC 4C37A 5AP1A 5J1VA 4OTPA 2CHZA 2BROA 2BDWA 1X8BA 3AXWA 5GJDA 1C1YB 5JH6A 3FPQA 5IA5A 2YCQA 4PPBA 2GFCA 3A8XA 1XBCA 1VJYA 4AGCA 2IO1B 4RMAA 3EFJA 5BNJA 2AC5A 3HP5A 3VUXA 3NVKI 4XBUA 5CF4A 3R8VA 2X0GA 3MESA 4ITJA 5I0BA 3UNZA 4CG9A 3E5AA 2OK1A 3AMAA 3BYOA 4G0NB 5CHVC 3HYHA 2KMCA 1JWHA 5DEWA 4YR8A 4GT4A 5ITAA 1JNKA 2BRMA 4J98A 2HIWA 1LP4A 2A4LA 2HJ8A 2WGJA 4NQLB 3ZLYA 3DTWA 4HYHA 1Z5SB 2N1WA 4OGRA 3BU3A 3QK0A 4HYUA 3W16A 2IVSA 4HGSA 4IMYA 4UZDA 4FSUA 5HE3A 2JT4B 2CKEA 5JQ8A 5DYJA 1JBPE 4U42A 2N9XA 4U5JA 1WXVA 2XBJA 5J5SA 3MTFA 4KSPA 3PREA 1Q8UA 2QG5A 3M42A 4PMPA 4I6PA 2KWVB 4NM5A 3QZGA 3LM0A 4IZ7A 3GOPA 3IDPA 2ZDUA 1YXUA 4KUJA 5J95A 2WMXA 2N7DA 3LMIA 3DLZA 3SRVB 2B54A 4RSSA 2C5LC 4EHEA 2KOXA 4NL0A 4ZMFA 3O7LD 2QHMA 2VV9A 3BHYA 3UP7A 4EK3A 5IA4A 2XKFA 2XRUA 4FT9A 2FCSA 1GC7A 2QHOA 3HA6A 2V3SA 1FGIA 3E62A 3HVCA 4ASDA 2V0DA 1MG8A 3A4RA 4CHKA 3BEAA 2OXDA 3P08A 4IG7B 4BCOA 3V01A 3IFWB 4F7SA 3WF5A 5LVLA 5EW8A 4DHZE 4D55A 3F3WA 3MW1A 4J1RA 3VHKA 4BCGA 4NK9A 2UZDA 3ZXTA 1P98A 2KX3A 3MS9A 2YLFA 4F6SA 4JS8A 2C3IB 4BZNA 4FYNA 3ZBFA 5AR7A 2YIYA 4IB5A 1Z5MA 2CGWA 4XG4A 3UBDA 3ANRA 3VN9A 5M57A 3VVHA 3PJ1A 5AP6A 4ZRIA 4ZZNA 5FXSA 5CSPA 4QQCA 4BDJA 4FTMA 3Q9WA 4NTTA 2VWWA 2WO6A 2X9FA 4G5PA 3CE3A 4FV7A 4BTMA 2WMAA 4ENYA 5DE2A 1V6EA 4KSLC 4ZLZA 4ZSJA 5DPVA 4FL2A 1ZYLA 2J51A 2YHVA 3PPKA 2F2UA 3Q04A 3V5JA 3WOWA 3L0WB 5E1EA 3PRZA 2B0QA 2X7OA 4TW9A 5FEDA 1Y8RC 4F70A 3T3VA 2WQOA 4DLIA 3IOKA 3QD0A 4DEGA 4FC0A 4BZOA 3U4UA 5CXZA 4FHKA 3F2RA 2QONA 1YW2A 2WIHA 3NCZA 5L2WA 3GZNI 3SW7A 1XBBA 4DTKA 3KH0A 3LFSA 5H9BA 2W1DA 2VTHA 5BUIA 3EQPA 3FHRA 2NBUA 5JHAA 4UX9A 5C4LA 5TO8A 3DJ5A 3I81A 5D41A 4WKQA 2C5VA 4X3JA 3SOAA 3M3JA 4GKIA 3SC1A 1W82A 1WGYA 3A7JA 1Y8YA 2RKUA 5CZHA 2VWUA 2V1YA 1BT0A 5EYMA 1WVXA 3ODZX 2W05A 3EQBA 3ZSGA 4QYYA 3QQLA 4EH2A 2PZ5A 1KOBA 5DT4A 4C4EA 2FNJB 4RA5A 3HDNA 1HE8A 5B2LA 3OC1A 1BYGA 4TNDA 2AYOB 3R7QA 3NAXA 1OL1A 3MVJA 5BMMA 4BDDA 5ETAA 2VO3A 1XO2B 3CC6A 3P7BA 5JKGA 1GG3A 3RPYA 3PJ3A 4FIGA 5FGKA 2J0IA 4FN2A 4FV2A 5D7GA 4Y8DA 4A4OA 1V86A 1ZOGA 4ZY5A 5HD4A 2R3GA 3BWJA 3S4QA 4PDSA 2WQEA 4PNIA 2XMYA 4M7IA 3I79A 1I35A 3G15A 4O7SA 4AZVA 2DX5B 2CN5A 2OZOA 5BVEA 4O7ZA 4DLJA 3V04A 2UW8A 3QX1A 4CVAA 4DYMA 5HNGA 4DH1A 5GJFA 1UBIA 5DPTA 3E8CA 3ZBXA 2CGUA 5KZIA 3IOPA 3FMDA 3DA6A 5M06A 1GIJA 4YL8A 3HV4A 3R66C 4WJPA 5HHWA 4YTIA 5E8ZA 4ANQA 2F49A 1P4OA 4QMVA 4DFXE 3KUZA 3FQSA 4G5JA 2RFEA 1P0RA 3R83A 2QC6A 4M97A 2GNFA 1IA9A 3MBLA 2WTDA 4CCUA 3CD3A 5LWNA 5JQ5A 3G5DA 2GBRA 2ITXA 4ANVA 1W83A 4ACCA 3ONSA 4ZJIA 4XG7A 4QNYA 4DBGA 4CZTA 3VUMA 3PYYA 3VRYA 3MTNB 1M52A 3O8TA 5JRSA 4BTKA 5BYZA 3UJGA 3Q4CA 4KVGB 4A9UA 1GZOA 4MSMB 2AL6A 3G51A 4BI2A 2P0CA 4KIQA 4YZBA 4KAOA 4ZIMA 3VF9A 4X3FB 1SNXA 4I93A 2JUOA 2XEYA 3WIMA 3DT1A 2XF0A 2XK4A 4TPTA 1B39A 2N9PC 1MQ4A 2W1FA 1KSWA 2XK3A 4BTJA 2C30A 2LVPA 5LLIA 1UU8A 3E8DA 1WMHA 1TQMA 1OKYA 2RGPA 3RKBA 2JZ3B 4F6UA 3BYMA 3EQHA 4N70A 4CYJA 5CU2A 5AM7A 5IH4A 3FSFA 3D0EA 2X2MA 4UN0C 2PE0A 2YITA 2JIUA 4FSZA 4YPSA 1OUYA 2PE6B 3GC9A 2DWBA 4EOQA 4M12A 4UYAA 2LVQA 4YTFA 1YXSA 4K6ZA 4S31A 4YZNA 3R1QA 5TKDA 2QO7A 2XCKA 3OWKA 1TZ1A 3ZOSA 3MN3A 4N6YA 3AD6A 3RTPA 4D1SA 2KDIA 4WWPA 5D6JB 3DDCB 1F3MC 2ITOA 1OGUA 3A4PA 2R3IA 4TYGA 5ANJA 4M15A 4RA4A 4ANNA 3TT0A 1SYKA 3IG7A 3Q3BA 4NM0A 3DAKA 2G2FA 2ITTA 4HOKA 3VW8A 3PXQA 4EC9A 4F9BA 5IA2A 2CHLA 1P14A 4BKZA 4I3ZA 5L6OA 4YP8A 3FAAA 4X2FA 2HENA 1E5WA 2O6VA 4NU1A 1QCFA 3DK3A 1JKTA 4Z7GA 4W9KA 3VUDA 2M8SA 3R8UA 4MGIE 2PEAA 3OZ6A 4R5YA 1H1QA 3CSVA 3VDZA 4C3PA 3TUBA 1R3CA 3ZSIA 4XRJA 3OUKA 4DDID 3KKVA 3NWWA 3Q3FA 2N9EB 4EKLA 4S34A 3LZBA 3DK6A 2WAJA 3F88A 3LXNA 3QRJA 4IWDA 4ZTSA 5K3YA 2YIWA 3EFKA 3NOBA 3TDVA 3B8RA 4Q2AA 3EQFA 4Z9LA 2PE9A 4ZOGA 5HOAA 2O65A 5GZ9A 5CLPA 3HV3A 4NTSA 4TWOA 2O2UA 4OVUA 3W1SA 1J8CA 4G9RA 2C6KA 2XRWA 5ETFA 4PNKA 4O0SA 4DCAA 4FGRA 1CMKE 2QCSA 4XV3A 2L00B 3HRCA 2R7BA 2XJ1A 3DBQA 2Y4IB 3VBWA 4FTOA 2WFYA 4FSWA 5KKRB 3KVFB 5BVDA 3ZTXA 3ENMA 3KVXA 4EJ7A 3U8WA 3DKOA 3PHXB 2JKQA 4AGDA 3KXGA 5FTGA 4TKNA 1B38A 3I6UA 2ETMA 3WAOA 1WXMA 4G17A 3NZ0A 2BF8B 2LGXA 2REXA 4A06A 3RZFA 2PL0A 2QKWB 4FYOA 4YHTA 4ZJJA 4F64A 4IC7B 1WMKA 1E7VA 4DT9A 1GZKA 2GNHA 3U51A 5E8YA 2NNWB 3HL7A 2P2HA 3A9KB 3R9RA 4FSYA 4U3YA 1DS5A 3SDLC 3D32A 3ZIMA 4FLHA 1OPLA 2XIYA 4O86A 5AIRA 3G0FA 2J0LA 3MVHA 3NNXA 4GK3A 2DYLA 5J7BA 2L8JA 2KK8A 4I22A 2KXJA 5LXHA 3HV5A 3R0TA 2C6MA 4U45A 3V5PA 2C69A 3Q32A 5L2IA 4EFOA 2F7ZE 2AWTA 3IG3A 2Y8OA 1QMZA 1H01A 3BINA 4AXAA 2KDBA 1V0BA 3QALE 1WBNA 1WYWB 1CKJA 4AW5A 2W7XA 2BZJA 3PIZA 3MI9A 3EKNA 2BKFA 4QMSA 2VTQA 2OBJA 4NKAA 5AM6A 5FP5A 2LGCA 2PZIA 5T3QA 4AUQC 4E6QA 1JVPP 2I0VA 5DRBA 3QBNA 4QQ5A 4YC8A 2XNPA 2Z59B 4J96A 1BL7A 3QJZA 3PLVA 4JL9A 3Q9YA 3S95A 4W9JA 3V6CB 1Q8WA 1SVHA 3C4FA 3VTWA 1OKZA 5LMAA 4N57A 5CSWA 4DHZB 5CVFA 3ZDTA 3EYHA 3DDPA 4DH7A 2VTJA 3EQCA 4NQKE 2BAQA 5C01A 4FBJB 2HZ0A 3HX4A 5CSXA 5HG7A 2O6VD 5AR3A 4A4LA 4HW7A 3P4KA 1K3AA 2HW7A 2GFSA 2VTLA 4TWPA 1OEYA 4AT4A 4FT7A 1NW1A 5AZFA 3D7ZA 4Y73A 4FSNA 2G2IA 1LM8B 1OGWA 3D9VA 4PL3A 2ONLC 3RPOA 2VD5A 4G16A 2LRUA 4HPUE 2BFYA 2C4GA 2QR7A 3PA3A 5IPJA 4C3RA 4IWPA 4DE4A 2UW3A 4TUUA 3EQRA 1UD7A 4C4FA 2C5OA 3JVSA 4XBRA 4WBBB 5AP4A 5EHLA 3ORZA 3ZMMA 4CT1A 3AU4A 3SD0A 3APDA 2PY3A 3VS0A 4GB9A 2VO6A 3KVWA 3LHJA 2W9FB 5LVOA 4MNEB 4USEA 5L4QA 3ORIA 2F7EE 3QQFA 4RJ3A 1ZOHA 5FXQA 4JR7A 3L8PA 3RHXA 2LXAA 1KV1A 2VTPA 2W96B 3WF7A 4FKLA 4D58A 4E6DA 3TL5A 3FZTA 3VHEA 1P4FA 2PHKA 1YWNA 2VNYA 4RIYB 3VBTA 3ZO4A 1WF9A 4AAAA 2G2HA 2GNJA 3Q2MA 1Q61A 2GNGA 1SMHA 3DXQA 2ZYBA 2XNEA 2CPKE 3CF6E 3GC0A 2UZEA 1WE6A 3T9LA 2XK5B 4U7ZA 4YNOA 4ANWA 2PULA 4UMPA 4AOFA 5KMKA 4NAWA 4O21A 3DAJA 4NJ6A 1IYFA 3PSCA 3BHTA 2OLCA 3EMGA 1T46A 3QHRA 3FJQE 3THBA 4PTGA 4IX5A 3F9NA 3AGMA 2V7AA 4KV2A 3E88A 4L43A 1ZXEA 3CP9A 3ZRCA 3FZPA 4BY9E 4O27B 4I5HA 3ZTCA 4Z3VA 3KRRA 5EDSA 4AZSA 3ALBA 3ZRFA 3CKXA 4YJRA 4QP9A 4FUYA 1YI6A 5J5TA 3V6RA 3W8LA 3AG9A 2KJRA 1YD8U 3U54A 3E92A 2ONLA 5CZIA 5HO6A 5KE0A 4R5SA 3ENHA 3II5A 3E7VA 4W4YA 2YA9A 4A7CA 4QTBA 4FEVA 3PVWA 3QYZA 3NMUF 4NFMA 4ZSAA 2C5XA 2P4IA 3FYJX 1M7QA 4EUTA 3A9JB 4IH8A 2ZZPB 1BKXA 2QR8A 4FEQA 3DZQA 4G1WA 3F69A 3VS2A 4NCTC 5BPYA 4PPCA 1XH4A 3OXTA 2OJRA 3ZLXA 3GU5A 5IUGA 4QP4A 1BI7A 4PWNA 3ZTDA 5HIDA 4IVAA 5FTOA 5DNRA 4Y83A 2WMSA 3BPRA 4R3CA 1DI8A 3EN6A 3VUHA 3ZH8A 4MX9A 3PZEA 1Z9XA 4FV3A 5CAUA 3FV8A 3LCDA 3G2FA 3AC2A 4II3B 2YLEA 3C4WA 4K1BA 5DT0A 2CCHA 2OXYA 3UZPA 5IISA 4CYIA 3LAUA 5FRIA 3WZUA 1VCBA 2I1JA 4BDBA 4D4RA 3PRPB 3DKCA 4I6LB 5L95C 3NPCA 1H08A 1MUOA 3LJ1A 1V5OA 5IDPA 2DYMA 3F5GA 3PZHA 4I94A 3L1SA 2QOKA 2D3GA 2WMRA 4DC2A 4HVBA 3UQFA 3UIUA 4K7SA 1H4RA 1CDKA 4PDYA 3OWPA 5EKOA 1OIYA 4ID7A 4O2PA 2Z7QA 3R21A 3D4QA 1WBWA 3D2KA 4FVPA 4L67A 3JW0X 3QKLA 4XOYA 3SD5A 2PJHA 4LQMA 4EKUA 3PIYA 2FSMX 1W8CA 2BIYA 3LFQA 4S33A 4EZ5A 4QYHA 2ERKA 3C13A 5JSMA 4EH6A 4QP6A 3A1QB 4XZ4A 3PHWB 3DY7A 3DZOA 3KFAA 4KIPA 3AOXA 4RC4A 2JBPA 4DF3A 1FINA 1IA8A 2X8IA 3OCGA 4ARKA 2QO9A 1I09A 3OFMA 4I4FA 2WB8A 2C5NA 4L52A 4QO9A 5J9ZA 5IQBA 3CKWA 4ZK5A 4RFYA 4YZMA 2G15A 3Q5ZA 4ASXA 3G90X 4XH6A 4ANOA 4BGQA 4MWIA 1TVOA 2W1GA 5FTQA 2R2OA 4O82A 3FKNA 4I1ZA 4V04A 2UW5A 3BLRA 3MTLA 3UTOA 2K1FA 3TXOA 3I0QA 4PYUA 3GB2A 4D2WA 3F61A 1Q99A 3LM5A 3P23A 5LOHA 5LMKA 3VRZA 2KC2A 2GTMA 4GDLA 2VRXA 3F6XA 5EW9A 2YACA 4FTRA 5C9CA 1BUHA 2A1AB 3TEIA 4ACHA 2O63A 3PVGA 4FKRA 2B9IA 4L6QA 4EOKA 4F1SA 2PVKA 4QD6A 3ORKA 4IADA 3FZ1A 3ZCLA 3ML8A 3OT3A 4I6HA 4K9YA 1SGHA 2MBBB 5EHYA 5CXHA 3NIEA 5H8BA 2WTKB 3WF9A 4FODA 1OQYA 4AT5A 2XUUA 4RJ4A 2KKCA 4IEBA 3BLHA 3LJ0A 2ZV2A 2UZWE 3QCXA 3ZNGC 4MQ2A 3ZUNA 4A9TA 4XEYA 3QQ8B 2WIPA 4GT5A 3ZS5A 4BKJA 5KNJA 2C60A 3ZEWA 1WM2A 4G3EA 3IKAA 4I0TA 2KTFA 1M2RA 3W18A 3ZHPC 4DT8A 3ZRLA 3EQDA 4BOZB 5HCXA 3TJCA 3F7ZA 3PJ8A 2XIKA 2X1NA 4WIHA 3TNIA 4ZLYA 5BUEA 1U54B 1UGMA 3P5KA 4Z16A 2Z7SA 4BDKA 4GRBA 2GDOA 3VTVA 4FHJA 4F63A 4CTCA 2KQ7A 3A7FA 3FY0A 3LFCA 2FB8A 4AN3A 4DG0E 5L3AA 3DCGA 4XP3A 3Q52A 3HEGA 3AC4A 4G34A 5AR8A 4E8AA 2OF2A 3TNWA 4EBVA 4EK8A 3UOLA 1JKSA 4OBQA 1JSUA 4YGAA 1KE8A 3ETAA 4O6LA 2DZIA 3JVZX 3VH4B 4FTJA 1OVEA 3GCUA 3BE2A 4FZ7A 2XNOA 1PXLA 4IAAA 3FXZA 1YDSE 3EZRA 3LPBA 1BL6A 2C0OA 3NW6A 3QX4A 2BAJA 4F09A 3QFVA 3RM7A 3WILA 4FVQA 2ZM4A 1AGWA 4X2JA 4DFNA 5LQFA 4MHAA 4NZWB 4UB7A 3OLMD 4DAWA 3PPJA 3L17A 1RDQE 2WTVA 4FKGA 4HCTA 4KA3A 4RBLA 4OVVA 4H05A 4ZS4A 3QF9A 4QQTA 3H7PB 3IDCA 3ELJA 3GFEA 4FT5A 3CQEA 5DR9A 3RAHA 4Q5HA 3HRFA 4DEAA 4G2FA 5JZNA 4RRVA 5CT0A 2IW8A 3H0YA 1JRUA 2FIFA 1VYWA 3OW3A 5DHJA 3FMHA 5C27A 5DPWA 3RALA 1OM1A 3V8SA 5HU9A 3IW7A 4KS7A 4MQ1A 4XMOA 5CTRC 3UG2A 2PVRA 3ZFMA 1WIAA 4MF1A 3VWAA 5CWZA 3CTHA 3I5ZA 5HKMA 4JIKA 4EQUA 4FV5A 3NZSA 1BMKA 3EN9A 3DNEA 2RFNA 3QCYA 4FSTA 2GS7A 2PMIA 4GG7A 4NSTA 5H8GA 4HVSA 1XHAA 4L3PA 1Z2MA 3FZSA 5JGAA 3M11A 1UNGA 5ETCA 4LUEA 3S00A 4MELA 3W2QA 5ACBC 3VS7A 3S0OA 2MBOA 3VUWA 1XH7A 2R9SA 4O2ZA 3CLYA 5IQGA 5T68A 4ERKA 2Y6MA 4CKIA 1YOJA 2ZNVB 3SG9A 4PS3A 4DTBA 5I3OA 2EWAA 4W9LA 3C0GA 4BYIA 4RGJA 5AA8A 2Z7LA 4DEIA 4NW5A 4U3ZA 4KZ0A 5HBJA 4W9CA 3IECA 4WNOA 4RMZA 3NUNA 4BHZA 4UWBA 3UOJA 4MVFA 4QMPA 4PV0A 2FGIA 3UVPA 2MQJA 4AT3A 5HG8A 3FMEA 5DR6A 2XK5A 4HGLA 3DK7A 3VS6A 4YLJA 3COIA 1BI8A 2DS1A 1ZZLA 5I9XA 1PHKA 4FNWA 4DK5A 3KGAA 2KULA 4G6OA 4I41A 5DRDA 3HGKA 1ZAOA 3GCSA 5HVKA 4ZP5A 2OICA 3GOEA 4K7UA 5HE2A 3SAYA 1H07A 3KUDB 4UXQA 1V80A 4NYEA 2XK6A 4I23A 1PMEA 2JBOA 4PP9A 4IAYA 4C58A 4F9CA 1K9AA 1VEBA 1STCE 2WMTA 3OUNB 1L8TA 4F0IA 4IQ6A 1J0GA 1YI3A 4FMQA 4YBJA 5HIEA 3KB7A 3EOCA 2H96A 3DGKA 2ZDTA 4C62A 1SVGA 4F6WA 3OTVA 3U7DA 4R8QA 5AR5A 3JR1A 1R4MI 5GIPE 2X81A 2KNBA 2KQSA 4ASZA 5GINE 4I24A 2K6DB 4EOIA 5CF8A 4I21A 3FEGA 2BALA 4Y5HA 4YSJA 1W0XC 1YHVA 2R5TA 2KLGA 2EU9A 2IO6A 3Q9ZA 4PRJA 3ROCA 2FA2A 5HBHA 2VUWA 4BI0A 3VHTC 3H0ZA 3L9LA 3PRMB 3KN6A 4GOCA 4PMMA 2O64A 3A9JA 3DJ6A 2B55A 4NPNA 4D1ZA 5C03A 4PP7A 2KJHB 4S2ZA 3GCQA 3PG3A 4EORA 1U4AA 2CCIA 2RSUA 3PV1A 4GDLB 3PJCA 4LOOA 1YDRE 5AV4A 4RJ6A 4NT4A 2PPHA 4FEXA 3VC4A 2Q0BA 2OH4A 4LL5A 4WBOA 1EO6A 2YFXA 4FOCA 3V3VA 5J8IA 2C7MB 4V0GB 1WM3A 2FAZA 1YWRA 4GFOA 4UMTA 2J7QB 4OT5A 4PTCA 3GCPA 4QYFA 3ZLWA 3B0AA 2JKMA 2EB2A 3ZDIA 1AARA 4CG8A 3K3JA 3N51A 3CD8A 4PF4A 4CFFA 4EZ3A 2KC1A 5IQCA 1AD5A 3P2BA 3FY2A 2PZYA 4FZAB 3A33B 3TNHA 3U87A 3LFEA 4PY1A 4L46A 4Y46A 5EH0A 3AC5A 3O0GA 4KWPA 5AX3A 2L3ZA 4AZEA 2OOBB 4W9GA 4EZKA 3UVQA 4ALVA 5G2NA 3NNWA 5EYCA 3Q3JA 4RJ7A 5AFVA 3ZEPA 2OU7A 2W1IA 4JQEA 5H3QA 4IANA 5L8LA 3M63B 1P1AA 4F0GA 4FZFB 3KXHA 4DWFA 4URKA 3C9WA 1XR1A 2WOUA 4GSWA 1RJBA 3EFLA 2GBMA 4A20A 4AZWA 4K1RB 4E74A 2XP2A 4GJ3A 2ZPNA 1P5EA 5C1QB 5IQFA 3MGYA 1GZ8A 3C51A 2FUHB 3UIXA 2E2BA 3TIXA 4BDHA 3D7TA 2PVNA 2VX3A 3WZJA 4O83A 2IPXA 2VWXA 4G3DA 3ZUUA 1WX7A 1F0QA 3RMFA 3VULA 3CTQA 4XRLA 3SG8A 3B2TA 3RUIB 2GHLA 5K4IA 1XBAA 1AQ1A 2HZNA 3I1AA 4JBVA 2XIZA 5ANDA 2E9NA 4J97A 4K11A 2VAGA 2W17A 3PFQA 2W1ZA 1YRPA 3BYSA 4ZAUA 3HIZA 4IUMB 2BPMA 4MNFA 1EH4A 1RW8A 2J9MA 5F20A 3ZDMC 3L9NA 4D2SA 2YVCA 3C4CA 1ZYCA 3IGOA 5IF1A 4IZYA 3U6HA 2GOWA 2R3HA 4PMTA 3TUCA 3ZKJC 3JUHA 4BKSD 2B53A 4PX6A 5JK3A 2JPHA 2VX1A 4RX9A 1A48A 4RIXA 4UY9A 3NNUA 4O7RA 3KXNA 4FKVA 3C0RB 1JAMA 2F7XE 3LJ2A 4IXPA 2Y4PA 1GIIA 3LFDA 2BKZA 4B6WA 3R7UA 3U9NA 3L8XA 3AT3A 4EK6A 4BCFA 5K4JA 4U0IA 3KF7A 3HNGA 1Q41A 2OZAA 3ZM4A 3DBHI 4GS6A 4FIFA 3APCA 3QA8A 4B9KA 1ZGUB 4RLLA 5CEMA 4I0RA 3KYDD 3EKKA 5EK7A 3UO6A 2X6DA 2MW5A 3EB0A 4MBIA 3FKLA 2Z0DB 3TCPA 4MD8E 4CFUA 1H4LA 4UXLA 1NXKA 5FM3A 3TWJA 4E1ZA 2MSED 3KXXA 2JEDA 4BFMA 2M17A 3PPZA 2C0IA 4JQ8A 4FTNA 2WOTA 4EOLA 2VWYA 4FTAA 3ORLA 4PS7A 2HXQA 3OJ3A 4AWJA 5IQDA 5CY3A 5LJJA 3ROYA 3WA0A 4DH8A 3CIKA 4MXYA 3PS6A 2CLQA 5CEIA 2CKHB 3PY0A 3VAWA 2F9GA 2UZUE 4W4WA 3PLUA 3M1SA 1JPAA 2OF4A 4FJVB 3OEFX 2F4JA 4O0UA 4BCKA 2LWPA 1V0PA 3VS4A 2A19B 2XNNA 3M62B 4FV1A 4IDVA 5IQHA 3OCBA 1E1VA 4QNAA 4AW2A 4YSMA 4TXCA 3FI3A 5A4LA 4BCNA 2WQNA 4O6EA 5TT7A 1U5RA 5KMJA 3VUYA 3MH0A 3BQCA 4IFGA 5TR6A 3I4BA 2C47A 2B9FA 2CMWA 5CANA 1GC6A 2YWVA 2E9OA 1F5QA 5AP2A 2L0FA 3N30A 2B4SB 5KX8A 2GBNA 2ZJWA 4WG4A 4BYJA 3DAEA 2A0CX 4B8MA 1JKLA 4JQWC 3AU5A 4AA0A 4N9F4 2XKDA 3VIDA 5JFSA 1JSTA 2GNLA 2VTMA 3TKUA 2ESMA 3QD4A 5EI2A 4ACDA 3ZXZA 3GFWA 5DPRA 3R9HA 5M53A 1H8CA 5IQIA 2DUVA 4JR3A 5J18A 2YDJA 4AN9A 5IUIA 2OJIA 3PP0A 1G3NA 5CI7A 3TMPB 3SU8X 3D5UA 3D14A 4O1PA 3ZC6A 2R3NA 4U79A 4YJQA 2WQBA 5F95A 3RAKA 4C4JA 4ZSLA 5F9EA 2JF5A 5IEVA 4TT7A 3DBLI 2AC3A 2ZJDA 3HECA 1UU3A 3NHEB 3DOWA 4PYZA 4BICA 5IA3A 1PKGA 5A54A 3WYYA 5EYKA 3UGCA 3CGFA 2X7FA 3MFRA 3VAPA 2WELA 3MH3A 3BE9A 2D10A 3DQXA 1NVSA 5HD7A 5HVYA 3AULA 5J17A 5AV0A 2MBHA 4EC8A 3Q2JA 4M3QA 4CMTA 3RPVA 5HTBA 1U59A 4OBOA 4QTCA 4CLIA 4CT2A 2Y9QA 4M8TA 1E8YA 5A46A 4BIBA 2JZZA 4GIIA 4EZ7A 4NJ7A 2JWZA 3TJPA 2OO8X 2X2KA 4GMVA 3P1AA 4BF2A 1T45A 3VNTA 1WGRA 2NVUI 2WEIA 4IDTA 5EOLA 4GK4A 2GMIC 5D1JA 3O8PA 3OAWA 3TZ9A 1Z57A 5ICPA 3F7WA 2C5YA 3KEXA 2W99B 3QGYA 4GG5A 4L7SA 3RK5A 5CAVA 5LVNA 3VFKA 4XOZA 1XKKA 2UZLA 3VVWB 1UV5A 1YQJA 3MV5A 2BRNA 2I0YA 3KMUA 5CU4A 3W2SA 4DEBA 5FXRA 2HCKA 4UWYA 2N1VA 3PXYA 4XG9A 4W9DA 3O17A 5EI8A 5LXMA 2IBIB 4BKTA 3N9XA 1PXKA 3EL7A 3F5XA 4FTIA 2BTSA 4BN1A 4FTUA 2IWIA 4EI4A 5C1ZA 3ORPA 3DTCA 4D2VA 3R6XA 4YZ9A 3COKA 5EM5A 2WKMA 2XIRA 3D94A 4ZTQA 2G4DB 1RRBA 2HZ4A 3MPTA 4K81A 1H27A 3EN7A 4FKUA 4B8LA 4F1MA 3C0IA 5CAQA 4R1VA 3R73A 1H1PA 2NBVB 2KMAA 3H6NA 3Q5IA 4FULA 4D1XA 3EJ1A 2XJ0A 4ZSEA 4WRSA 4CZUA 2MWSB 3ZO5B 3PXZA 3DBRI 5M4FA 2YCFA 3NYNA 4GDKB 3DB8A 3ZRKA 4F8CB 4W9IA 3RD2A 2BTRA 4U6RA 1L3RE 4M66A 4QRCA 4RLKA 3FLWA 1KOTA 1LPUA 3BRBA 2BR1A 4UZHA 1QPCA 3VUTA 4ANBA 1WGDA 2V62A 5J2RA 4HYSA 2JAMA 4GCJA 4E6CA 1FVVA 5LMKC 4EWHA 5L6PA 3GI3A 1S1QB 5FBNC 3TJDA 4MXXA 3I60A 4XP2A 2BIKB 4XV2A 5M56A 1LXDA 2FCQA 2QOCA 5ANKA 1TTNA 1NVQA 3RK7A 3A4SC 2YIRA 2GHGA 2GU8A 3R9NA 3L08A 4M13A 1U4DA 2B52A 5AZHA 4BDGA 4E93A 2R0UA 2ZV7A 2OJ9A 4J8MA 2O6VB 3HAMA 4OUCA 1U46A 3JPVA 4EH3A 1E7UA 5EQEA 5CX9A 3W2CA 3AXCA 4Y85A 4G11A 4OTWA 2LD9A 4JX7A 4MKCA 1OTRB 3R71A 3LFBA 1M17A 4AUAA 2L0TA 4D0WA 4YJNA 3T3UA 1R39A 3E3PA 3ANQA 3POZA 4AACA 4BZDA 3G6HA 4RJ8A 4U97A 4WJOA 4XG6A 5K0XA 5FUTA 3QTRA 4RVTA 1V1KA 3GC7A 2PVMA 3HMIA 1ZMWA 4MD7E 1REKA 1Y91A 3AMBA 5EFQA 5FG8A 1ATPE 4ALUA 4C38A 5HO7A 4E20A 4HVIA 2JDTA 1OPKA 2FH9A 4N4SA 5AV2A 5BUJA 2K8CA 4HWIB 3H1UA 3TTJA 2Z02A 4J7BA 5AAFA 3QL8A 2DAFA 4GU6A 3VBQA 1WBTA 3QCSA 2ZM3A 3RAIA 3WE4A 5FD2A 2J0MA 1H25A 1XQZA 4A9RA 4WD5A 3A7IA 4AW1A 2A4ZA 2XVDA 1J19A 3AD4A 3R04A 3SDJA 4EYMA 4QQJA 3QZIA 5EOBA 5IDNA 5EW3A 3LXLA 3C0HA 4Q9ZA 5JFWA 3VUKA 2FCMA 1IG1A 4J8NA 4XS2A 3AI5A 2I1MA 4HGTA 3C4EA 4FNYA 2PVJA 4II5A 3O65B 3QYWA 3CCNA 1FGKA 2IN6A 4BKGA 3WYXA 3BY4B 1ZYJA 3A7HA 2WMWA 3QU0A 1UBQA 3DVNV 4HPMB 4IC7A 3CTJA 2PWLA 4O0VA 3OHTA 4KIKA 3QLFA 4QMNA 4D4YA 2V5QA 2VZ6A 4BWKA 4DCEA 5DN3A 5LWMA 2IZTA 4JG6A 3NW5A 4TYHA 2C6IA 3A61A 4JVGA 3AC8A 3FC1X 1O6KA 4U9AA 4UYNA 2KD0A 4ACMA 3SQQA 5HQ0A 2QI8A 2K8HA 4RIYA 2J4ZA 3ZDUA 5A3XA 4IAZA 4ERWA 1LQBA 2CU1A 3KC3A 4UBAA 3I7BA 4FF8A 3RULA 4GXBA 3FMNA 3NUYA 1OL5A 1FPUA 1URWA 2YIQA 3W8QA 5HNIX 2FSTX 3DCVA 3R8ZA 1WFYA 4FTCA 3UZTA 4TYIA 3BQRA 4DFUA 5KMIA 1OKVA 3QGWA 3OMVA 4U81A 3L9PA 3IVFA 3DKGA 2I1KA 3H9RA 2WU7A 2JRHA 1JQHA 5JZJA 4WHZA 3QXOA 5AEPA 2HELA 2JDRA 5TR5A 3EZVA 3QHWA 4HJKA 2XM8A 3FL4A 3SXRA 5HE0A 2QOFA 3GQLA 4HLEA 2UVXA 4EZLA 3NVMB 2PVHA 4J52A 4G50A 3IPHA 2PSQA 3QTUA 5BQ0A 3FLSA 4YC6A 5JGBA 4B6LA 1WJUA 4BIEA 4CV8A 2WYQA 1R1WA 5HTIA 2BPSA 2OH0E 4L3JA 2OWBA 4MXCA 4WNKA 4KDIC 3ORXA 2LJ5A 5FEQA 4TL0A 2MX2A 1I42A 4G6LA 4NIFA 4D9TA 4FV4A 5HNBA 1QPEA 2K6QA 4QMZA 3T9IA 4O22A 4NY0A 3PA4A 1PRYA 5HKHA 2DYBA 2ITNA 3LJ3A 5EDRA 2R3PA 3W2RA 2XCHA 3IQ7A 3QRUA 4O7YA 2YCSA 4K18A 4LMNA 3QCAA 3PTGA 3SGCA 3VQUA 5K5NA 3AMYA 1XH5A 4IM2A 1JLUE 3VS5A 2UZOA 1SM2A 4QPSA 4TYEA 4FKPA 5I4NA 4LCDE 1J1CA 4GH2A 2D11A 2AUHA 4H1JA 2GSFA 3R7IA 4RVMA 1YIWA 3F2AA 2IZUA 2YAAA 5BMSA 2LXCA 4BR3A 2F57A 3ZONA 1WR1A 3QRIA 4JG8A 4DGLC 3FLYA 5E91A 5AZGA 5I3RA 4F4PA 1V9JA 4IIRA 4W9XA 2C7NB 5CU6A 4TWNA 4FKIA 3LFAA 4N0SA 4MF0A 4NM7A 3QTXA 2XK9A 4K8AA 4PDOA 2JD5A 2ZM1A 4P7EA 3TIZA 2Z8CA 4FA2A 4FJYA 4ZZMA 1FXTB 2JY6A 5E6NA 4RIWB 3WZDA 2CLXA 4ORKA 3LQ8A 3OF0A 3UPXA 5IQEA 1OECA 4M67A 4XYFA 1QPJA 3VJOA 4ZLOA 4BBEA 1DI9A 2VO0A 3COMA 5JEBA 3VF8A 5BO4B 4DG2E 2DZJA 3NR9A 4FIHA 3QQUA 3A1QA 1FVTA 4LOQA 1UWJA 5BVOA 2QD9A 3BKBA 3MY5A 4PMSA 2VGPA 3FLNC 4USDA 2QLUA 1V2YA 3OOMA 1PMUA 3HMNA 2Y0AA 3QLGA 3QC4A 2R3MA 2X39A 4D2PA 1T0YA 3PZDA 5CU0A 2GHMA 4UWCA 4AW0A 4GT3A 4YNEA 4YMJA 2CSNA 3O50A 3CY2A 1ZLTA 4PPAA 5DLSA 3V8TA 3F5UA 3IDBA 3L8VA 4KRDA 2W5AA 3KMWA 2BRGA 5FBOA 2XEWA 3MY1A 4O84A 4H58A 1PXOA 1E9HA 5EQPA 3MJ2A 2QURA 5C8MA 2JDVA 4QPAA 3B08A 4RIXB 3R7RA 3P7CA 1WX8A 3K9PB 2N4FA 4RC2A 4BBFA 4H3QA 4RIWA 4MGYE 4O81A 5BYLA 5CALA 3GU4A 2R3OA 1BLXA 1ERKA 3F3ZA 4MAOA 4J99A 5DWRA 3TKIA 4AGWA 2HOGA 4XV1A 1WXAA 1NA7A 4FKTA 5HICA 2QO2A 3TNQB 4C4IA 5KHOA 2PZPA 3NCGA 3PE2A 4BTFA 4AOIA 4ZEGA 4CMOA 4G3FA 1JOWB 2ZMCA 4I5CA 3LFFA 4I6QA 4RWIA 3HV6A 2R3RA 4EQMA 5KBQA 4WSYA 3S1HA 2W5BA 5KHQA 1MRYA 4YUQA 2R0IA 3PSDA 3JYAA 5E92A 2RGFA 2O8YA 2BRHA 4OTDA 4F9YA 2C6EA 2W4OA 1TGZB 1GZNA 2ZVOA 5ANOA
chains in the Genus database with same CATH superfamily
3V51A 4MGKE 3EFWA 3EN4A 4GYIA 1Q0WB 2KLCA 2FO0A 4HK2A 3NYXA 3MYGA 2YEXA 1QF6A 2YLMA 5DCNA 5D3IB 3KUCB 3LIJA 4CFWA 2QODA 1WAKA 4YHFA 4XLIA 3Q6WA 2J5FA 5ACKA 3HA8A 4AP7A 3O2MA 2OFUA 1OI9A 3FWQA 5E1SA 3FQHA 2C7HA 3TV6A 3DDQA 3FZOA 1TZDA 4KKHA 2C6TA 3F82A 5EE9A 3MDYA 3MJ1A 5L83A 4C34A 4BBNF 3B51X 4H36A 4O0RA 2DHZA 1OL6A 3IS5A 2JIIA 1JCKB 4FKJA 4BC6A 1Q5KA 4IAFA 4QMWA 4CRSA 3KL8A 1APME 2RAIA 3LW0A 3OROA 2P33A 2H9VA 3GENA 1T0QC 5DI1A 2FSLX 4D2KA 1XH8A 5D12A 1GNUA 4BDEA 4DINA 2BDJA 3ZEDA 2GQSA 3CGOA 4B0GA 4H6HA 2UVYA 1XH6A 3IHPC 4YJUA 3MFGA 3RCDA 5C8NA 1E6EB 1WVYA 3R63A 4DGGA 3TUDA 3OY1A 2IO2B 5JRQA 4W9EA 2XH5A 1V81A 4L7FA 4EBWA 4JMQA 4KNBA 1D5ZC 1S9IA 4DFBA 1H26A 2OIBA 3KQ4A 1MRVA 5TF9A 3ITZA 1OL7A 4L44A 3CPBA 4IVBA 3IK3A 3IONA 3RI7C 2YM6A 3ABVB 2BQQA 3QAQA 2A2AA 3E8NA 1GPXA 5T6KA 3VXWA 3CMMB 3P4PB 2E9UA 3U4WA 2YEPB 2VTTA 1CJEA 2H89B 2XK7A 3AE3B 4FTKA 1WCCA 3B2FA 3O3OB 3KXMA 2L76A 4MCVA 5EM6A 4M69A 4XWTA 4BOSC 2C6LA 2X2LA 3TACA 2IZRA 3KRWA 5HX6A 4ANXA 4IVDA 1HOWA 1T6BX 4TZRA 4IB1A 4F08A 4BDAA 2WXFA 4P2KA 2X7GA 1ZW7A 4G6QA 2B9HA 5HG5A 5JFXA 4W4VA 4G31A 5AA9A 4LJPB 4GVJA 4U43A 2XIXA 3BHUA 4AG8A 5D9HA 4YTPB 1O6LA 1YX5B 3WI6A 3ZU7A 4CGAA 2HY0A 3LB8C 4FZDB 3QD2B 3IBEA 5IKWA 5AUVA 4DN5A 3HV7A 4NJDA 3CIRB 4QMXA 5AMNA 4W9HA 1QOAA 5K5XA 4C59A 5AUUA 1Y8GA 3KLSX 5JMSA 3KQ7A 3SXFA 2VTNA 3TBLD 4ZY6A 3L3PA 5CQUA 2CJNA 4YWGG 1WVWA 1HTOA 4HDQA 4QMQA 1UWHA 4GU9A 2PUNA 1Q4LA 2VTSA 3VS1A 4M84A 3MVLA 3A9KA 1Q3WA 1SE9A 4AZTA 3D5VA 5CVGA 1WBPA 4EJNA 1L7YA 2M56B 3E3BX 3R7GA 2XYUA 2J7TA 3GVUA 3QZFA 4XX9A 4K3BA 5HEZA 2IEWA 1GAQB 3OY3A 4TKSA 3SFEB 4DQOC 4DEDA 3NUUA 2JFMA 3PSEB 4DEEA 5AUXA 2YM5A 3UPZA 4RX7A 3QC8B 5BMIA 3PSBA 5DVRA 4O0WA 3H7SA 1R4NB 1Q8TA 4O38A 1BUIC 3Q8CA 3C4XA 3NUPA 2QG7A 1CMXB 3BHHA 2WU6A 2ITVA 4M8NA 5DA3A 3DFCB 5TSSA 5E6OA 4NCTA 3DPOA 4Z55A 4KIOA 1I4DA 1Z2MA 3SYVA 5M55A 3MJWA 4DBNA 4I6NB 4UALA 4EOJA 4HYIA 2OZAB 1M7NA 5CHWA 4C36A 1NENB 2KVRA 2LZ6A 5B2KA 1S9JA 3TZMA 2C3LA 3NUXA 1V0OA 3AC3A 3O8UA 4Q2JA 4WWNA 2VWBA 3R8BA 3IT6B 5L8KA 3BU5A 5J9YA 4AOJA 3R9DA 2VTOA 2LHDA 5IMXA 2D07B 3C19A 3K3IA 2BCJA 2R2PA 1WZ3A 4G3CA 2JITA 1H28A 3LQ5A 1RFKA 3ZNHB 3RHKA 4FNZA 4C02A 2JRIB 3G9NA 1U5QA 3O3MB 4AJYB 3NUSA 4XV9A 2LMCA 4KS8A 3ODYX 1KF6B 2FSOX 3RV1A 3BLQA 3RCJA 2JNSA 3KREA 1W98A 4FSMA 3F3UA 4M0YA 1BX6A 3L9MA 4ZRJA 3UQAA 3LE6A 4ANMA 1WBSA 3A2CA 4TYJA 2V4LA 4I6FA 5H8YE 2R64A 5IUHA 2L7RA 1VZ8A 4GGQA 3WANA 5AV3A 3OWGA 1Q24A 2NPTB 3BYTB 2KACA 4HZRA 2ZEQA 2GBJA 5KKRC 3EYGA 3C1XA 1ACCA 2HWOA 4ZJVA 3UZRA 1KRHA 3LOKA 4MDKE 3BK1A 3QXPA 3T49A 2WDVB 4LDTB 4CEGA 2ETKA 3G6GA 4LG4A 4AGUA 1V8CA 4C2WA 4KX6B 2QDFA 4LJOB 4Y95A 3V61A 2R3KA 4Q9SA 3R7EA 4IC8A 4FSQA 5KO1A 4IJ9A 4NEUA 1PS3A 3OTUA 3PGEA 1WI0A 4JX3A 1TQVA 3FMLA 2ZVAA 3VKHA 2XEZA 3A60A 4FTQA 3CVRA 4MK0A 3VUGA 4QAYA 2UWQA 3HDMA 3MH1A 4B99A 3O3NB 3PXRA 4GFMA 3MHSD 4MJSA 1YDTE 3F2NA 2WXGA 2Q83A 3FDNA 4NM3A 1E1XA 3UE4A 3HKOA 4WAAA 4IHPA 4M00A 2WMBA 3ZFXA 4DHFA 3FPMA 2WD1A 5F1ZA 4O7LA 3OCTA 3UNKA 3DBRB 1WGHA 2JIVA 1WJ6A 4LOPA 5BX0A 3IW4A 1ZWSA 4IWQA 2ZMDA 4MJSB 5DT3A 2MI7A 2D3AA 4FBXA 4ONAA 3UMWA 3ZXVA 4CLJA 1MVKA 1WZ0A 2WTIA 2PUPA 3U30A 2YWPA 3ZNZB 5LVPA 3K9OB 2OG8A 4FT3A 5KZ0A 3W2DA 4MH0E 4BBMA 4AE9A 3S3IA 2LASA 4HCPB 4BHNA 3DWMA 3ZZEA 4GFGA 1Y6AA 4TYHB 4LNOA 3NG0A 5DOSA 2YERA 3UIPB 3W55A 2W9ZB 3RGFA 1PXJA 4U80A 2QQ7A 4MXAA 3B1LX 4ANUA 2PVFA 1OIRA 3QUDA 5AR2A 4JWCA 3VJNA 5BVKA 2QOIA 4ZRKA 2UW0A 2XKEA 3X0WA 4L3LA 1H8FA 4A9YA 2K0PA 3DPPA 5A6NA 2CHWA 4CD0A 1G8SA 2XJ2A 3ZZWA 4ALWA 4GK2A 1PJKA 4E26A 4KGTA 1PY5A 1IR3A 1H0VA 2QOQA 1PQSA 1R0EA 5FKAC 4GUBA 3DVGX 3D2EA 4XLVA 3ML9A 2LI5A 4D28A 2CKQA 4AS0A 3JS2A 4X7QA 3P79A 1Y56A 1IBXB 3KY2A 4KBAA 3S2PA 3W2PA 2R7IA 5LXIB 4LYNA 3NYOA 4HJOA 1XLQA 4EUUA 1OMWA 2HK5A 5F4NA 2IY1B 5HLNA 2WXRA 4PO2A 2Z2WA 5EQYA 3I3TB 3I5NA 4GYGA 4CQEA 3HM6X 2JKOA 2X9EA 3KN5A 1PUTA 5DIAA 5KBRA 3T8OA 3DX1A 4FL3A 4EQCA 2J52A 3MB7A 4DG3E 2VRRB 2EWFA 5B0XA 3Q53A 3KRXA 4WWOA 2ZAZA 3DBCA 4M8MA 3DV3A 4MXZA 4WG5A 3FI2A 2INCC 2PUUA 4XUFA 4KKEA 1L2NA 1YHWA 5BVWA 2QSDA 3V60A 3PE1A 5DFPA 3MIYA 2ZCCA 5CSHA 2BZHB 1IGDA 4EL9A 1N5WA 3TEZA 4CRLA 3AQVA 5D2MB 1LFDA 4R7IA 4TNBA 3BV2A 2OI4X 4G6NA 1F1HA 2ITWA 2UZVA 3Q6UA 2PU8A 2F7RA 2J50A 3R8LA 3MPMA 3LQ3A 1WZYA 3TZ7A 3EL8A 4W9WA 2R3LA 4EYJA 4YZDA 1OKWA 2QKRA 3EHAA 5ETIA 2IW9A 3R8PA 3W0SA 3ZO3A 2QU6A 4IX3A 1NT2A 4ZTNA 5M07A 2ZB0A 4BDCA 4QOXA 3BVWA 3UIBA 3RWQA 4X6RA 4LI5A 5E4HA 3KULB 3C4ZA 3AD5A 5CI6A 3PIXA 3ZFYA 2ITPA 4EK4A 5CNNA 5KMNA 4X6QC 5J1VA 2BDWA 5JH6A 2EX3B 4AGCA 4XBUA 3BUPA 4CG9A 3E5AA 5CHVC 4G0NB 1JWHA 3I9V1 5ITAA 2BRMA 4J98A 2BBCA 2HIWA 4LDTA 3DTWA 4EZXA 3QK0A 2JT4B 1JBPE 2N9XA 1SUFA 4PMPA 4I6PA 4NM5A 3LM0A 4KUJA 1MI0A 2VH2A 5J95A 3DLZA 2B54A 2KOXA 4EHEA 4NL0A 3UP7A 2XRUA 4ASDA 4CHKA 2V0DA 3NUHB 3P08A 3GS2A 4D55A 3MW1A 4BCGA 2UZDA 4JS8A 2C3IB 1W2CA 1K51A 4BDJA 4FTMA 3Q9WA 1ZWWA 4FV7A 4ENYA 5FIGA 1V6EA 4ZSJA 5DPVA 3PRZA 3CV5A 4ZRQA 4DLIA 3IOKA 3QD0A 4BZOA 2QONA 1YW2A 3NCZA 3SW7A 1XBBA 5BUIA 5JHAA 5C4LA 3DJ5A 4WKQA 2C5VA 3SC1A 1Y8YA 2JXTA 3ODZX 1KOBA 1Y2OA 3HDNA 4TNDA 1I4PA 5BMMA 5ETAA 4FIGA 4FN2A 2J0IA 3KDRA 3D51A 1ZOGA 3BWJA 4PDSA 4PNIA 2DX5B 2OZOA 4DLJA 3V04A 3A98A 1URUA 5DPTA 3E8CA 2CGUA 3DA6A 3R66C 4ANQA 4DFXE 1P4OA 1P0RA 3MBLA 3L3OM 4CCUA 3EJSA 5LWNA 4ANVA 2GBRA 1W83A 4ACCA 3ONSA 4ZJIA 4XG7A 4QNYA 4DBGA 4CZTA 3VUMA 3VRYA 3O8TA 1E10A 2P0CA 4KIQA 2JUOA 4AZ6A 1B39A 1WMHA 5KBPA 3BYMA 3EQHA 5AM7A 4EOQA 2DWBA 2LGSA 4K6ZA 4S31A 3R1QA 2XCKA 4WWPA 1F3MC 4TYGA 5IH5A 3TT0A 3VW8A 4EC9A 2ITTA 2CHLA 4BKZA 4YP8A 1N62A 1E5WA 3DK3A 1JKTA 4MGIE 3OZ6A 1H1QA 3CSVA 3OUKA 3NWWA 3LXNA 4ZTSA 3TDVA 3NOBA 5HOAA 2O2UA 4G9RA 2C6KA 3DBQA 2XJ1A 3VBWA 5KKRB 2WFYA 3ZTXA 3VR8B 3PHXB 2REXA 3P1MA 2QKWB 4F64A 4DT9A 1GZKA 2NNWB 5E8YA 2DWQA 3R9RA 1DS5A 3SDLC 3ZIMA 5AIRA 2J0LA 5TKYA 2C6MA 5C5BA 2C69A 4OZBA 2KDBA 3QALE 1WYWB 2VTQA 4NKAA 5AM6A 2PZIA 3QBNA 4RGNA 2Z59B 3QJZA 4JL9A 3RNGC 4W9JA 3IAS1 3UITA 5CVFA 2BAQA 4FBJB 2HZ0A 3HX4A 4A4LA 3EJUA 2HW7A 2GFSA 4USAA 4FT7A 2ONLC 2LRUA 4HPUE 2C4GA 3PA3A 3EQRA 4C4FA 2C5OA 3ORZA 3ZMMA 3VS0A 4EZVA 4GB9A 2W9FB 3QQFA 3L8PA 4L23A 2SAKA 4FKLA 3TL5A 4ZYSA 3FZTA 3VHEA 3VBTA 2G2HA 3Q2MA 2GNGA 2ZYBA 2XNEA 1TZOA 4U7ZA 4AOFA 1IYFA 3PSCA 2OLCA 4PTGA 3E88A 3FZPA 4BY9E 3ZTCA 2FE8A 5LNK1 3U54A 3E92A 3NMUF 3PVWA 4IH8A 4O4CA 2QR8A 4NCTC 1XH4A 4FZOA 4PWNA 4IVAA 5DNRA 3ZH8A 1Z9XA 4FV3A 2YLEA 5DT0A 2OXYA 1OQQA 5FRIA 4I6LB 5L95C 1MUOA 2DYMA 4HVBA 3UIUA 4K7SA 3OWPA 5EKOA 4ID7A 4O2PA 4DDGA 4EKUA 4XOYA 3PIYA 4QYHA 2ERKA 3DZOA 4KIPA 3G9GA 2GRIA 4L52A 2WB8A 2C5NA 4QO9A 3CKWA 4YZMA 4ASXA 4ANOA 3N1YC 2UW5A 2K1FA 3UTOA 2EKIA 3I0QA 3LM5A 5LOHA 5LMKA 2GTMA 1F9JA 2VRXA 5EW9A 1BUHA 4ACHA 4FKRA 2KT7A 2PVKA 4IADA 3FZ1A 3HAHA 3Q6BA 1SGHA 4K9YA 3WF9A 4FODA 1YJJA 4RJ4A 1X04A 4IEBA 4MQ2A 2WIPA 1NI3A 4GT5A 4G3EA 2RAJA 3ZHPC 4BOZB 3TNIA 3TJCA 5BUEA 4WIHA 2X1NA 1UGMA 2LEKA 1I4QA 4GRBA 2GDOA 3VTVA 2KQ7A 3A7FA 4EZRA 4HPPA 4DG0E 5AR8A 3HEGA 3TNWA 4YGAA 2DZIA 1KE8A 3VH4B 4FTJA 3GCUA 3LPBA 4F09A 1RWSA 4M01A 1VZ7A 1VLBA 4UB7A 3PPJA 1RDQE 2WTVA 4KA3A 4RBLA 3H7PB 3IDCA 3CQEA 3DX2A 4Q5HA 1SE3A 5JZNA 3DBLB 5DPWA 3RALA 3CTHA 3I5ZA 5HKMA 4GG7A 3DNEA 5JGAA 5ETCA 4LUEA 2R9SA 5T68A 4ERKA 1YOJA 2Z7LA 4KZ0A 4U3ZA 4BHZA 4RMZA 3NUNA 1ZXIA 2VZKD 4MVFA 2FGIA 1IUEA 2XK5A 4HGLA 5I9XA 4DK5A 4G6OA 3GCSA 3GOEA 5HE2A 2EFKA 1V80A 2XK6A 4IAYA 1VEBA 4F0IA 5D3DA 3KB7A 2ZDTA 5AR5A 3JR1A 2KNBA 2PIAA 4I21A 2KLGA 3Q9ZA 3ROCA 3PRMB 3KN6A 4NPNA 2KJHB 4LOOA 1PGBA 2PPHA 2G9HD 2C7MB 1YWRA 1AARA 3CD8A 3FY2A 4FZAB 3LFEA 2GLSA 2L3ZA 1L0VB 5EYCA 4NZLB 3Q3JA 4RJ7A 5AFVA 3DX0A 4JQEA 4IANA 4FZFB 2WOUA 3P63A 5IQFA 1P5EA 3MGYA 4BDHA 2IPXA 2YIBA 1F0QA 3SG8A 3RUIB 1AQ1A 4JBVA 3RNAC 4J97A 4K11A 1YRPA 4ZAUA 4IUMB 4MNFA 1EH4A 3U6HA 3TUCA 3ZKJC 2JPHA 2VX1A 3NNUA 2J42A 3KXNA 1TKEA 2Y4PA 2BKZA 1R4MB 4H8SA 3W9CB 1Q41A 4B9KA 4RLLA 3LLLA 3EKKA 3UO6A 4CFUA 1H4LA 1NXKA 5FM3A 1EWYC 4EOLA 4FTAA 2HXQA 4AWJA 5LJJA 3WA0A 4DH8A 4MXYA 2CLQA