4IM2A

Structure of tank-binding kinase 1
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
659
structure length
618
Chain Sequence
GSMQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRNIKPGNIMRVIGEDGQSVYKLTDFGTEEYLHPDMYERVLRKDHATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVMGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase TBK1
publication title Structure of Tank-Binding Kinase 1
rcsb
source organism Homo sapiens
total genus 212
structure length 618
sequence length 659
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF18394 TBK1_CCD1 TANK-binding kinase 1 coiled-coil domain 1
A PF18396 TBK1_ULD TANK binding kinase 1 ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4im2A02
1.20.1270.420 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4im2A04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4im2A03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4im2A01
3TWJA 4XG4A 3QTSA 4USDA 1UWHA 1J3HA 2PMOX 5E8ZA 2PMIA 4R7BA 4AZFA 3CIKA 4Q5HA 2GMXA 4URKA 3B0AA 3ZH8A 1KLVA 3C51A 4IWPA 4W9LA 3IDCA 2VO6A 1FINA 5BVDA 2FUMA 3WF8A 5GHVA 1WBPA 3KUCB 4QMPA 3FXZA 2OJGA 4I0TA 5I0BA 2CKQA 2AWTA 2OK1A 1L7YA 2D2QA 2WYQA 3ECIA 4M67A 4OLIA 3E8CA 2JKQA 5GIPE 4TZRA 3KVWA 4CLJA 2QOIA 4JDJA 4EI4A 5HIDA 5EHYA 2XJ2A 4UXLA 5I3RA 3I0OA 3VHEA 4YNEA 4P90A 2V62A 1OKZA 5IA7A 3H7PB 4Q9ZA 2ZJWA 2CR5A 3WIMA 5HG8A 2CCHA 3RD2A 2WMAA 3IVFA 3TUCA 1UH6A 2W17A 1Q8TA 3FPMA 3PRMB 2HXQA 4EKKA 3HMPA 3L08A 5D1JA 4BBFA 5EW8A 4BWPA 4CZTA 4C8BA 5I9VA 1XH5A 3LCKA 3UC3A 2YCSA 5GMVA 2F57A 4WWOA 2YLMA 4R3RA 2PZ5A 4E5AX 3GNIB 2IG7A 1FVRA 4PMMA 5CU3A 4RPVA 1CMXB 3ORMA 5BVNA 1HCLA 3ZDTA 4CHKA 3QQGA 1LPUA 4NJ6A 2O2UA 5A6OA 3VH4B 4HZSA 3FSFA 3R83A 4ZOGA 4W9FA 5AIKA 1LFDA 3MY5A 2X39A 1UA2A 5HTCA 4EZ7A 1W82A 2RG6A 3HRCA 1IEPA 5JEBA 1BUHA 3DJ5A 3I79A 5CAOA 3VUGA 1UBIA 3DVNV 2Y4IB 2XK5B 3MB7A 4O2PA 1R1WA 1XR1A 3SC1A 2WB8A 3A62A 4JI9A 1UD7A 3TG1A 5DWRA 1SNUA 3NY5A 3NAYA 1WJUA 4AJWA 2Z7QA 5DRDA 3C4ZA 3U4UA 4EUTA 2YM6A 4AFEA 1YWRA 3KXNA 4G9CA 3EN9A 1U5RA 4CTBA 4B6WA 3HRFA 4IFCA 3H7PA 5GIOE 5FTGA 3RWPA 3WZUA 3R2YA 1M7NA 1TQPA 2VO3A 4BR3A 2IZTA 3C0HA 3QWKA 2KULA 5HG9A 5IDPA 4JR7A 3FE3A 3Q9WA 3OY3A 4IX4A 3FZ1A 4L44A 5DR6A 5IG1A 1B39A 4P2KA 2VTQA 1PXLA 2C6MA 3QUPA 3HV6A 4OTGA 4IBMA 4FTNA 4IMYA 3F9NA 3LFBA 5LMAA 2W5BA 1J7LA 1M2QA 3RAHA 1Z5SB 3Q4TA 4EQUA 1EUVB 4PDPA 4G2FA 4XV2A 4W4WA 2E9UA 2WMXA 3TBLD 4M0ZA 4FBXA 3N9XA 4EK6A 4RFZA 1KJTA 4A3OA 2J6MA 2CNUA 4XOZA 2RGFA 2CHXA 2WMBA 2AL6A 1Q0WB 3TKIA 3IW7A 2IO1B 2HWOA 4EH6A 4PTGA 3GQIA 4PPAA 1R4NI 4KZ0A 2AEHA 4FSQA 3P23A 2GS6A 5IZFA 3FMEA 4F6SA 4FZDB 4DXAB 2JKKA 3DDQA 2VWXA 3DY7A 4FKJA 5FQDC 4RWIA 3C4FA 1UNGA 2C9WB 2YDIA 3LCTA 3ORKA 5EG3A 4I24A 4O0TA 2FO0A 4D5KA 1Q8YA 4FKRA 5TOZA 3SDLC 5KMJA 1V6EA 1KE9A 4LGDA 3VTWA 3LMHA 3I4BA 3OF0A 3SRVB 3Q5IA 2HD5B 3DXPA 3O8UA 4O7NA 4DFUA 3LFNA 1OPLA 2EUFB 5L95C 4CMUA 2W4KA 3DOWA 3KRRA 4KSQA 5LXHA 4TNDA 4U43A 5LVNA 4JAIA 1ZYDA 1H0WA 3V5PA 3VFKA 1O6KA 5M55A 4AT5A 3HM3A 3G6HA 4CV9A 5L6WL 3LAUA 3PJCA 3BIZA 5C4LA 4QP2A 3F7WA 4ANXA 5FEDA 4ZTHA 2X4ZA 4W4VA 2WXVA 2IO3B 4NFMA 5KBRA 4UMPA 3LW0A 3ROYA 4MX9A 4RQVA 3VUYA 4RA4A 3RYTA 3LXNA 3ULZA 4QMTA 4MGZE 4WOVA 4L01A 4K11A 4O1PA 2HY81 2PHKA 4AGUA 2B3AA 2OXYA 1G8SA 3KK8A 5EHLA 2FSMX 2DENB 3A7GA 5H3QA 1F0QA 4NCTC 3PTGA 4KVGB 3F2NA 5CX9A 1XBCA 3Q2MA 2JIVA 4UX9A 4NCTA 3JVZX 3EQIA 4IB3A 2R3MA 4NM5A 3L8VA 1PXKA 3UIOB 4GFOA 2CMWA 4MM3A 1HCKA 1U59A 4M66A 5AUWA 3JXWA 3WAMA 3V62A 3DOGA 4ZZMA 2JKMA 1E1VA 4FT7A 3KRXA 4UMRA 3DKCA 5EI2A 3QRTA 4H3BA 1OIRA 3E5AA 4GG7A 1OMWA 2I1MA 2JDTA 3SOAA 3UGBB 3Q4UA 2XZSA 3HP2A 1C1YB 1UU7A 3H1UA 3PY3A 2W1ZA 4NKSA 2I6LA 4R3PA 1XH4A 4F70A 4YZNA 4UWYA 4DK5A 4FEVA 4BY9E 4DLIA 4TNBA 1NT2A 4R7IA 1H1PA 4GGQA 3ORIA 4ZTNA 2CGXA 3C1XA 3LJ0A 2Y6MA 3PHWB 3ZNID 3OWLA 4EHGA 1UKHA 2AC3A 2Y4PA 1MRUA 4GK4A 3VS7A 5BNJA 1Q8ZA 3MTFA 4FKTA 3VIDA 4Z9LA 2DAFA 4XC2A 3CTJA 4FV7A 4ZSAA 3VDZA 5IPJA 3HZTA 1JNKA 4KB8A 1OL5A 4GDLB 2XP2A 1SIFA 3QCXA 4DEBA 3ORXA 3PXKA 5TO8A 2BUJA 4IVCA 4QYHA 4CCUA 4BN1A 3QD2B 3KXHA 4BDGA 4ITHA 3KEXA 3M42A 5LCKA 3NGAA 4FK6A 2H34A 2KZRA 2WEVA 5E6PA 3S2PA 1IRKA 4UY9A 4GOCA 3RCZA 3PA4A 5E4HA 1ZYJA 1HE8A 2G4SA 4MNEB 4OT5A 2ZJDA 3RP9A 4XV3A 5FTOA 5A4TA 1DAYA 4XJ0A 1YD8U 4F9BA 3CR0A 3D7ZA 4ASWC 4HGSA 4G1WA 3MB6A 1OVEA 5AEPA 3FHRA 3D7TA 4AZWA 2BPSA 5FUTA 1GY3A 1PXPA 4ANNA 2X8DA 2VGPA 4AUQC 1XKKA 2UW5A 4K81A 2LJ5A 1PJKA 3C5UA 2CLXA 3QLFA 5AEKB 2ITNA 3L0WB 4EOYA 4GYGA 4JNWA 4ONAA 2PPHA 3QHWA 5C1QB 1O9UA 4FV0A 5AX9A 1ATPE 2CGUA 2XK7A 3MPMA 4EZKA 4ZLOA 2GBRA 1UBQA 3QQJA 4I0SA 4X3FB 1OIUA 2M17A 2OF4A 4F6WA 3GFWA 3FLQA 4BVUC 4LG4A 4C57A 3ML9A 1PXJA 5ETAA 4OTDA 4BVUA 2R3LA 1PMNA 2QOLA 5CQWA 2QONA 4FZAB 4FHKA 3WILA 2CHWA 1YI4A 3SD0A 3OBJA 4PWNA 3FQHA 1H8FA 3OLMD 2EB2A 3TZ8A 4XG6A 4AFJA 4IVDA 5HLWA 2JIIA 4O7SA 3ORZA 2RG5A 2V55A 3UVQA 3V3VA 3MHSD 3NYOA 1BL6A 2MLBA 2Y8OA 4TYGA 3RK5A 5IQBA 4E71A 4R1YA 2BIKB 3AMYA 3HK0A 2JD5A 4EC9A 3R0TA 3WALA 4R78A 4MNEA 5HIEA 3DK7A 4FTIA 3N4TA 4FF8A 3DGKA 5AUYA 1G3NA 2VX0A 3MN3A 4HGTA 4EOQA 4PY1A 5BQ0A 5B2MA 4BBMA 2CJMA 4IZ7A 3OJ4B 5TKDA 4QOXA 2GNLA 3FLSA 2Y0AA 5K5XA 4J52A 2ITQA 3IW5A 4IJ9A 4QMXA 3A7HA 4U79A 3P7AA 4GK2A 2RFEA 5AP1A 4XRLA 4W9CA 4BFRA 2MW5A 2PVLA 2OZAB 4G6LA 2JZZA 5BYYA 3ZNGC 3BWFA 2KXJA 2PE0A 4X3FC 3DJ7A 1OL6A 3FMDA 1YDTE 4X3FA 5CSVA 4IG7B 2FH9A 3OXZA 2G45B 1CKPA 3GXLA 3Q53A 3LFDA 3D94A 1NXKA 3GOPA 1H01A 3ZRMA 3DBSA 4YZDA 5E9EA 1OITA 2PULA 3FAAA 3ZLWA 4X0MA 2X6DA 3P2BA 3QL8A 3HV3A 2UZWE 3BLRA 3W18A 3EIDA 2FCMA 4AOTA 4IB1A 5HG7A 1QZEA 2D07B 5HBJA 2JEDA 5AAEA 2PE1A 1I09A 2KVRA 3I60A 3SX9A 1DI9A 2BHHA 5AR2A 3Q4CA 2YABA 3WE4A 4YPSA 4DGNA 5ANJA 3MSSA 4FSWA 5BUIA 5DYJA 2BZHB 2WWZA 3W8QA 3CJGA 3EWHA 3UOLA 3T9LA 2X7GA 1WGDA 4U97A 3BQCA 3JVRA 5CVFA 4O0XA 5JZNA 3T3VA 4K7WA 2NO3A 3NUAA 1NBFC 3DQWA 4AZVA 4GXBA 3T8OA 4RFYA 3VN9A 3P79A 2G4DB 2E2BA 4OGRA 2DWBA 2UV2A 5EKNA 4ANLA 2NPQA 2L05A 2C0TA 3ZDMC 4L45A 3GCUA 2PYWA 4MKCA 4J99A 1W0XC 4PPCA 2VNWA 5CTRC 2J5FA 3W1YA 3F2RA 2X2KA 4EK4A 4E73A 4BZDA 2AYOB 4GS6A 3M3JA 4L00A 5D94A 4F0FA 4XNEA 5HESA 3ITZA 3RZBA 3ELJA 3ALBA 2IVTA 2AL3A 5J8IA 1JPAA 3A4RA 4WRGA 1KOBA 3G15A 4M7IA 3CEKA 5C8KA 2H6DA 3HA8A 3I3TB 2CSNA 3VVHA 5HLPA 3MI9A 2B9HA 3SLSA 3ZLXA 3N32A 4XOYA 3VHTC 3KN5A 3A4OX 4DGOA 1ZWSA 1X1MA 2ZNVB 3ET7A 5JFXA 4FSTA 4YJRA 3MJ2A 1KM7A 4G3GA 4BTJA 3RAKA 1MUOA 3FMLA 3VW6A 4O7RA 1WBNA 4IACA 3QTUA 4FA2A 3ZDIA 1BKXA 2UVXA 4W9WA 2WTCA 3PJ2A 3UINB 3M62B 2QG5A 3TNQB 5FM3A 2JY6A 2BKFA 5E8SA 4PMSA 4WBBB 4AOJA 3R9OA 3F88A 4MJSB 4XG8A 4B4LA 5HBHA 2VRXA 4ZRKA 3FKLA 3PLAE 5EOBA 3GOEA 3QAQA 3PSEB 4NW6A 1PW2A 2KLCA 4E8AA 5B7VA 4I22A 4H3QA 3KREA 5CAVA 1XO2B 5EDQA 4D9TA 2WIPA 4QP9A 5K0KA 1WI0A 4N9F4 3DAJA 4MCVA 2GQGA 2KHWB 5BVKA 5CT7A 2R3NA 3HX4A 3TI1A 2J7QB 1E1XA 2WPAA 4YURA 2GBMA 2BIYA 1OQYA 4TYJA 3R28A 3R8VA 1OUKA 4I4EA 4C36A 3DCGA 3BGZA 1NY3A 3PRPB 3ZZEA 2PE9A 4G0NB 3DBQA 2YIRA 5CEIA 4EH8A 3C5IA 4J97A 3ZXZA 2LAVA 2L3ZA 3A99A 5EYKA 1B6CB 4BTMA 4G17A 2OIQA 2LUEA 2ZNVC 3PJ1A 2VO7A 4Y83A 1FGIA 2JGZA 3PZEA 3UO6A 3PE2A 3ZBXA 3AG9A 4I6PA 2PUPA 2N7EA 5AA8A 4B99A 3IK3A 3UIBA 2HTHA 2MCNB 1XH6A 2REIA 2KTYA 4IZYA 4YJVA 4KBAA 3FHIA 2VTTA 4RX7A 2QOBA 4M12A 1TGZB 4UEUA 1E9HA 4DEEA 3UVRA 3EL7A 4YO6A 2PUUA 4QMOA 1ND4A 1WXAA 4BYJA 5AP2A 2F2UA 5G6VA 3H6NA 4MAOA 1Y8YA 1M94A 5LLIA 2R2PA 2VTOA 4NYEA 3RINA 1H4RA 4DGGA 4B6LA 4F7JA 2HXLA 4IXPA 2RFSA 4NEUA 3R73A 4I6HA 1AARA 3KMUA 2W1HA 5L83A 4EH9A 4EWHA 2YZLA 2HOGA 1QPEA 4F0GA 4ALWA 2H96A 5J18A 4YJUA 4WIHA 4IIRA 4F99A 4GT3A 2D10A 3T9IA 1VJYA 2RSUA 5BPYA 3GC8A 4YJSA 3UNJA 3T3UA 5BVEA 3VBXA 2OJFE 2VWZA 3PVBA 2GMIC 1V1KA 5I9XA 4V05A 1EF1A 3F69A 2IWIA 2OFUA 4D28A 4AU8A 3Q60A 4G6NA 3NUPA 3ACJA 3H0ZA 3HDNA 2PK9A 3C50A 4WT6A 4G50A 2PTKA 5GJGA 2R3GA 3VNTA 4KWPA 4O27B 4QMVA 2DZJA 3DFAA 3QUDA 4ALVA 3CTHA 4UMQA 3QCAA 1UZXB 3QC4A 3DT1A 2BDWA 4KIOA 3VUMA 3I5ZA 2BMCA 1UU9A 1ZGUB 2IN6A 3O2MA 3PSDA 2KFJA 3QKMA 3OZ6A 4MVFA 4BBEA 4DDGD 2QU6A 2BTSA 3UVPA 2K6QA 3WOWA 1F3MC 2N7DA 4FTRA 3EQRA 4S30A 4MBIA 3D14A 4WAAA 3OROA 3O0GA 4AW0A 3G33A 4EKUA 4N0SA 4FKQA 1SVEA 4ZJJA 3W1SC 1DI8A 1FOTA 3W1SA 5C9CA 3OD6X 1PQSA 4JIOU 3NIEA 4IADA 5M09A 3B8QA 2YEXA 3QTQA 3E8DA 3P1AA 4FTAA 2YJRA 3UZTA 4K7SA 4I5CA 4AP4C 1PKGA 2IJMA 2WDTB 3PLSA 4U44A 3R6XA 2QQ7A 4D1SA 1ZYLA 3QWJA 4HJKA 4E3CA 4RVMA 2G2FA 2YCQA 2DZMA 2B54A 3I6WA 1Y6BA 2MQJA 4AG8A 2UZNA 4GU2A 2M0XA 5J79A 1QL6A 4HGEA 2C1BA 3ULIA 3OT8A 4MQ1A 1RJBA 3ZTCA 3K3IA 4DF3A 4E4MA 3UNKA 4YHTA 1Z9XA 1YXXA 1J19A 2HZ4A 2VTIA 3V5LA 3JYUA 1VYWA 4O38A 4O0WA 2C6TA 4QQ5A 1W8CA 2YHVA 2XK6A 5HNBA 3JW0X 1H1RA 3HNGA 2GOWA 4FE2A 3F3TA 3L8SA 3EFKA 4AGCA 2BCJA 1SVHA 4BCKA 1UV5A 5FDPA 5HO7A 5EDPA 4YU2A 2BFXA 3WYXA 1SMHA 4BFMA 2Q0NA 4ASEA 4A4XA 2NRUA 5A9UA 1RW8A 4BHZA 2EVAA 3DBFA 5CWZA 4BZNA 3DV3A 3EFJA 4D9UA 1GZ8A 1H8CA 3MVJA 2BALA 1BI8A 1W84A 2YN8A 2XKCA 3EJ1A 2LI5A 4EZLA 1ZKHA 4BZOA 4ASXA 3BU6A 2VV9A 3QX2A 3L1SA 3W32A 2VZ6A 3CSTA 3PSCA 2O6VB 5IA4A 4AW2A 2OFVA 1LR4A 2G15A 4DLJA 4BCMA 4NUSA 5IQIA 2QHOA 4N6ZA 3COMA 5L8KA 4V0GA 1XBBA 2OIBA 4A9SA 4BKYA 4ZY6A 2YLEA 3QQUA 4FSYA 3VS6A 4A20A 3U8WA 3OOGA 4C3RA 5KHOA 4BCGA 2BKKA 3VBYA 2IZSA 4PS7A 3GP0A 3V6CB 3ALNA 3KCFA 4EBWA 5BO4B 3L9MA 4UZDA 4G3FA 4A4LA 3DKGA 3MA6A 2DX5B 4D2TA 1S1QB 1PXMA 4DHJD 5LCJA 1E8WA 4N4SA 4KSLC 1V0PA 3R01A 4OR5A 1JQHA 5HE2A 1ZY4A 4AT3A 2FVDA 2XNOA 4ACDA 4C2WA 5D6JB 4FV8A 2XB7A 3PT2B 3QTRA 5KKRC 4XV1A 5KMMA 4ZSEA 3ZLZA 4CMTA 4QYYA 5EM5A 3FDNA 4IQ6A 2KMCA 1UVRA 1DAWA 4FKIA 5TF9A 3MDYA 4BYIA 4Z16A 5FXRA 4NIFB 4AZEA 3VUKA 5CS6A 2XA4A 3D32A 2KJ6A 2I7QA 4KSKC 3EN4A 4O22A 4CT1A 2GDOA 4L3LA 3P78A 4AN2A 3KMMA 3ZM4A 2W99B 5C8NA 3FKNA 5AR5A 2KLGA 2XUUA 3ORNA 2QO2A 5HKMA 4ZTRA 3ZFMA 2F4JA 3TT0A 2O6VA 1OL2A 1A5RA 4OTRA 4RG0A 3QK0A 4NK9A 3BV2A 5LXMA 1XH8A 4YGAA 2CU1A 2C7MB 5J2RA 4DFNA 4MHAA 2G01A 1APME 4NQLB 3DS6A 1WE6A 4JG6A 3PE1A 5AM6A 4YLLA 2E9NA 4D0WA 4JBQA 4BHNA 1WXVA 2R7BA 2R7IA 2K8CA 2OZOA 4CYEA 1Q99A 2W1CA 3DB6A 3U87A 3O51A 4IAYA 4RIWA 4FTCA 4G5JA 1YWNA 2LASA 2IO6A 4EK5A 1UELA 3U9CA 3QTIA 5DR2A 4ZZOA 5A54A 4J6IA 2CGVA 3CJFA 3NOBA 1Q3WA 2LVPA 3SQQA 3Q9ZA 3VS4A 4FKUA 2CPKE 1WX7A 2BZKB 3NS9A 5C26A 1ZAOA 3QZIA 4QPMA 3GZNI 4RBLA 3VRYA 3BX5A 1W7HA 4HYIA 2A27A 3HHMA 5CY3A 3K5VA 1YHSA 4EJ7A 1SZMA 4IX5A 3W2PA 4ITIA 2NBWB 3L8XA 4FVQA 3OXIA 3AULA 3FJQE 4L46A 3R7RA 3U8ZA 5LVOA 3VBWA 4NIFA 2K1FA 2DUVA 4LQMA 3VULA 3O50A 4CFFA 3FWQA 4AXAA 3DZQA 3PXFA 4QMYA 3X0WA 3OTUA 4NAWA 4MSMB 5E6NA 1H1WA 5KHWA 2J0KA 5L8JA 5EDRA 3I7CA 5J87A 1OIQA 2KC2A 2JPHA 2B53A 5DHJA 4I6LB 4KS7A 4FODA 1U54A 4FOBA 2I0YA 5JT2A 2ZV2A 5AV4A 3MYGA 3F5GA 2R5TA 3IECA 4I6BA 3EOCA 5EM6A 3FLYA 5DI1A 3V6RA 4RZVA 4R77A 3WZEA 4G5PA 2GU8A 3V5JA 2CS4A 3A2CA 3HYHA 5DE2A 4DN5A 4QP1A 3C4XA 4U80A 3OCSA 3L8PA 2NR2A 5B0XA 1YHVA 2W1EA 2XBJA 2BHEA 4DINA 4MD7E 4XCUA 3SA0A 3FLZA 2Z8CA 2KWVB 2VWIA 3FUPA 5CHVC 4PTCA 4IC8A 3ZSHA 4R1VA 5IMEA 4C4GA 1CMKE 2W5AA 3I1AA 3KXGA 1GOLA 4E6CA 4RJ8A 3NUSA 4M13A 5FG8A 2W9NA 4FTUA 2JDSA 2XNEA 4DH5A 3ZUTA 3FYKX 4TRLA 1IP9A 3BLHA 4MH7A 4YO4A 3MWUA 5CHWA 2O63A 4JDHA 4L52A 2O8YA 2PVYA 1UWJA 1Z57A 2XIYA 5E8WA 3ZBFA 3LQ8A 3UIPB 4YNOA 2FGIA 5AR4A 3AC2A 5CEPA 3D5XA 2XIRA 2BZJA 4L68A 3EQHA 3SAYA 3IW4A 4MBJA 4E5BA 2L0FA 3MVHA 5CVHA 4NJ7A 4CGAA 3W2OA 3POZA 3PXRA 2XBBC 4L9IA 5CF8A 4O84A 4RC2A 4ACHA 3PG3A 2W1GA 2R0UA 3DA6A 2F7EE 3N51A 3G90X 2YDJA 4F7ZA 2ETMA 4RC3A 3U54A 5AR8A 4FV2A 2F9GA 1J8CA 2B1PA 4LV8A 1OBGA 3SXRA 2RR9A 5B2LA 3Q96A 4AJYB 1J1BA 4QNYA 5TR5A 4BDJA 1IAHA 2LVOA 2OJJA 4N70A 4FNZA 3KF7A 5ANIA 3ZEWA 2MBQA 3KXXA 2WTWA 2LD9A 2W4JA 4YBKA 5TR6A 3QUEA 3EFUA 2ITOA 1YXSA 1WZYA 3TCAA 4FTMA 3K2LA 3QKKA 3O23A 1REKA 3BE2A 5IQEA 4EH2A 3DDPA 2SRCA 2ZDUA 3G51A 3G2FA 2KKCA 2VTJA 1YJ1A 2EKEC 3FI3A 2JZ3B 2XEWA 3H9OA 4BF2A 4IVBA 1Q3DA 2QOFA 2YIQA 1PYXA 3LIJA 4FEQA 2GBNA 2X2MA 4IDTA 3GEQA 2J4ZA 4XG9A 4GUEA 4FT5A 1WBSA 3R2BA 2XIXA 1ERKA 3REPA 3M95A 4O91A 3HECA 4S34A 3KB7A 3W33A 4KIPA 5J95A 4O82A 3PA3A 5LJJA 4B95A 3LFCA 4MF0A 4F9CA 3NRMA 4QP8A 3UPXA 4Y72A 5EI8A 2CKEA 5JHAA 1YI6A 5JSMA 4QP6A 1H28A 4FTOA 3QHRA 3KYCD 4UMUA 4BKSD 4DE4A 4CZYB 3W2SA 1P3QU 3TIYA 5AWMA 3FV8A 3BWJA 3COIA 4JDKA 3RPOA 4ZMEA 3WZDA 2R4BA 1YKRA 3GC7A 4IEBA 3FQSA 5DBXA 2BWFA 4F1SA 2YACA 3RTPA 1WBTA 4LJPB 1V0BA 2C5XA 3UJGA 1GC6A 2DZIA 4PL3A 4EK3A 4NW5A 2X9FA 5T6KA 4TV3A 2W06A 4AAAA 4QMZA 4P4CA 5KUPA 3SD5A 3ZFYA 4YBJA 4EORA 1WX8A 1Y8GA 4BKGA 5IEYA 3ZOSA 4HYHA 2OGVA 4DFXE 3N30A 3QC8B 2B52A 3ETAA 2D3GA 4EYJA 4DYMA 4JAJA 3TZ9A 2V0DA 5LVLA 2V5QA 2WQNA 2ASQA 3MBLA 2BDJA 4WJPA 2GHGA 4LGGA 2BTRA 5AA9A 4YHFA 1H1SA 3FC1X 3ZLYA 4X6QC 5L2QA 2KD0A 3ZONA 3WIKA 2G2HA 1PMVA 3BHVA 4KAOA 4LRJA 2J0IA 3FLWA 1RQQA 3BE9A 5JFVA 2JC6A 1Z5MA 5A4EA 1W83A 1TTNA 5KMIA 4DITA 1WMHB 4I3ZA 2O2VB 1SNXA 3UYTA 2QNJA 3U51A 1GG3A 4EH4A 3QQLA 2C5NA 4XEYA 4DT8A 5FBOA 4K1RB 1QPCA 4RJ6A 1W98A 4TKSA 2HELA 4U41A 5ACKA 3OW4A 3SU8X 4FVRA 1IAJA 2HZIA 3PJ8A 3FMNA 4W9JA 4JQWC 3SG8A 3IG7A 3WF9A 1FQ1B 3PP0A 3W2CA 4U3ZA 3UO5A 3PXYA 3MIYA 3MH1A 5HVKA 4GV1A 3IPHA 4EHVA 2R3OA 4F64A 4X3JA 1E8YA 5DT0A 2R3QA 1WBOA 3ZS5A 1WMKA 4C37A 2JUOA 3FPQA 2IY0B 1OTRB 3DLSA 2OKRA 4BDAA 3DVGY 3L9PA 2JFLA 2K6DB 2GTMA 3LDZE 3ONSA 2CKHB 3Q3FA 1H27A 3ROCA 3V6EB 3TNWA 5AP5A 4JS8A 4EJNA 4GRBA 5J1VA 2DYLA 3D5WA 2FUHB 3EB0A 4AP7A 2BPMA 5L2IA 3HL7A 1RRBA 1H08A 4TL0A 4TT7A 5E8VA 3DDCB 4BKJA 3EN5A 5IH5A 2QG7A 3H7SA 4QMSA 2PE6B 2WU6A 3MH3A 2BILB 3W8LA 2GNHA 1PMEA 3GGFA 1WMHA 3GU4A 2O2VA 4MXCA 3M11A 3ZUUA 3AXCA 4OTIA 4GW8A 1VR2A 3TDWA 5F1ZA 4IE9A 3TJCA 4U3YA 2YM3A 2UW4A 1YQJA 3JY9A 5CANA 1IASA 2X9EA 4DG2E 4LFIA 4EZJA 2XK4A 4E4XA 2QI8A 3LHJA 5E7RA 3S3IA 3EQPA 4XLIA 3OOMA 3QCYA 3D2IA 3KA0A 3I0QA 5FXQA 1URWA 4JJRA 3QXPA 3TNPC 4M3QA 4FKLA 2GNIA 2YLFA 3LJ3A 4D2VA 4PUZA 2XVDA 3CD8A 1R0PA 4L6QA 3HMIA 3VJOA 4C38A 2E9VA 3FLNC 4Y85A 1JSTA 5M56A 4DT9A 4BB4A 1GZKA 4B9DA 3TNHA 5KMKA 3P7CA 1NVSA 1VD2A 3WE8A 4CFWA 3H3CA 4K6ZA 5DLSA 3MJ1A 1E5WA 3JSVA 5AR3A 4BL1A 1PXOA 4DFZE 5IUGA 4AGWA 3ANRA 3QRIA 2XKDA 5A46A 3PPAA 1XD3B 4RIXA 2UW3A 2M4NA 3MFSA 3QXOA 5DPVA 3PVLA 3KK9A 1V5TA 3L10B 4X2JA 4LM5A 1YX6B 3VBTA 4GJ2A 3VAPA 4GT4A 3U4WA 4YHJA 3ZTDA 2NS5A 4H39A 3FMJA 3LFAA 3BU5A 2UYZB 1WH3A 3VAWA 4FOCA 2YISA 3QX1A 3N3KB 1XH9A 3QAME 4OW8A 2KTRB 3W1FA 1RAXA 2RKUA 2QU5A 4RIOA 2FSLX 3R71A 3GI3A 2VTNA 3KVXA 3LJ1A 4QYGA 3QBNA 3FL5A 2O65A 5JFSA 4F9YA 4CQEA 4YSMA 4Q5EA 4ERKA 3PIYA 4LI5A 1Y8RC 3GU6A 1YXTA 4UWBA 3A4PA 5D41A 1PHKA 4BWKA 3RPSA 1P5EA 4FKOA 3BYSA 3AOXA 3LVPA 2J2IB 4HZRA 3D4QA 4HCTA 4UBAA 4L3JA 3THBA 2XMYA 3FEGA 2B55A 4AA5A 4E4LA 4JBOA 1E7UA 2GQRA 3TTIA 4EKLA 3NHEB 3Q52A 2FCNA 4PL4A 1HOWA 3V5WA 3A60A 3NNWA 5IF1A 5HX8A 2CN5A 5M4UA 1TQIA 4J8NA 4YJTA 1A06A 2W1IA 3WIGA 2CNQA 2QOKA 4M15A 2X0GA 3P5KA 3N4UA 5FP5A 4WBOA 4EEVA 2WMVA 5KMOA 4MNFA 2Z2WA 2GFSA 4FN2A 4ACCA 4M97A 3JS2A 4FYOA 4AQCA 3RHXA 4AW1A 3H4JA 3WF5A 2C6EA 4LUDA 3VRZA 2OJ9A 5IQCA 3PJ3A 4MBLA 1V49A 1ZY5A 3WZKA 3ZO2A 1XJDA 1L8TA 4JRNA 4U7ZA 4J53A 1JSUA 4RWKA 4B8LA 1O6LA 4P5QA 2VGOA 3R66C 4PDYA 4HPLB 3OWKA 4ITJA 4DGLC 4D4VA 2G1TA 4PP9A 4Z7HA 2KTRA 2UVYA 2K39A 3SG9A 2C6IA 3VUTA 5IA2A 3HGKA 3JR1A 4JGHB 3H9DA 5TE0A 4R5SA 3PVUA 3BEAA 3QWZB 3ZM9A 2KFKB 4U9AA 2FIDA 1R3CA 1WJNA 3MPTA 3IQ7A 3LFQA 2KQSA 4BBNC 3DB8A 5ETIA 4DG0E 3DBLI 4FIJA 2VTAA 5HVJA 3PY1A 4GSBA 4J96A 1P4FA 3C0IA 4X2FA 3GCSA 1JKTA 4LRKA 4WA9A 4QMMA 4AWJA 5J17A 4TN6A 2BKZA 5E90A 3NYXA 5IA1A 3B8RA 2OIDA 4IWQA 2OJIA 4OBPA 3BKBA 5CSPA 4W9HA 3UODA 4JQ8A 3ZC5A 5J5SA 5CSWA 1WR1A 4EBVA 3KCKA 5D7GA 1E8XA 5IUIA 4LOPA 2C7NB 3QTWA 3HV5A 3ZUNA 3OCTA 5FP6A 3L54A 3ZXTA 2JITA 4MQ2A 4BDBA 3LCSA 2R2QA 3UP7A 4CZUA 2VTSA 5AP3A 3ZSGA 3AC3A 2QOQA 3NW5A 2FSTX 4ZZNA 2WHBA 2IO2B 4CRSA 1UU3A 5J9YA 3BY4B 1Q1OA 3D5UA 5GZAA 3R9RA 3H9RA 3ENHA 5CX3A 4O7VA 5B2KA 1GJZA 4QMLA 3R7YA 4DH3A 2UZDA 1U4AA 4HPMB 4CMOA 4BRXA 1KUTA 2GHMA 3ZZWA 3DCVA 3B1LX 4CTCA 3DBEA 5EM7A 1JKKA 3TUBA 2JXXA 4APCA 4CKJA 3NW7A 3BHHA 2KFKA 3I81A 4D0XA 2GNGA 5EQPA 2OICA 2Y4IC 2VTRA 2G9XA 5CENA 3HV7A 4YTIA 4MTAA 3TZ7A 4RFMA 3BPRA 1WXSA 4IB0A 2XK5A 5EQYA 2HAKA 4RMZA 5E91A 3QGYA 4XUFA 2MP2B 1G6JA 5DEYA 4TWOA 5AIRA 4KS8A 3PWYA 2WZJA 3R22A 5FRIA 1ZXEA 2XRWA 2C5VA 3VUHA 4OBQA 5EK7A 5A4LA 2EWAA 5EKOA 3UOHA 3UZPA 5AAGA 4RA5A 4YJQA 3QZGA 4RVKA 3RCDA 3IONA 1JAMA 4K0YA 3R8PA 3DKOA 2YM5A 2XNNA 2WX0A 4FSNA 5EH0A 1ZOGA 3P4KA 3VF9A 3WANA 4FADA 1P9DU 4LDTB 3R8MA 3MPAA 4BDFA 5L2TA 4XRJA 3FY2A 4BOSC 2XM8A 3GC9A 3RM6A 4FA6A 3HUBA 3W10A 1YDSE 3ODYX 4E1ZA 4FIGA 2C3JA 4Y95A 4BCOA 3V61A 3V8WA 5K0XA 2Z7LA 2C0OA 4WD5A 3DBRI 5IEXA 1IYFA 4F7LA 4ZMFA 3RUIB 2C3IB 3MH2A 3NWWA 3ANQA 4I93A 3NYVA 4FZFB 2LRUA 5FLFA 4YP8A 4W9EA 3E93A 2C6LA 4BI2A 3PRZA 2FCSA 5AFVA 2JF5A 3UG1A 3BYUA 1IG1A 4NNJB 3ZMMA 3DVGX 4BDHA 2FAZA 2A1AB 1R4MI 4I4FA 3ZTXA 4I6QA 4ENXA 1YOLA 2XKFA 3D0EA 5L6OA 1CTPE 3CSFA 4DCEA 3FMHA 5DPWA 3PA5A 3EQGA 3SRVA 3BZ3A 3QQ8B 3O65B 5DG5A 4G3CA 4K9YA 4MEMA 3AU5A 4BKTA 2ZM3A 5BVOA 3V5TA 4HPTE 2H8HA 3W55A 2KO3A 4EOJA 5M4FA 3IS5A 4RIYB 4LDTD 4X57B 4IAKA 5HLNA 1OEYJ 4U45A 5ANGA 4CG8A 2A5UA 4D55A 4AE9A 1JOWB 4II5A 5D9HA 4I92A 3BEGA 2PZRA 3AD5A 1ZYSA 2MSED 4PYUA 3I7BA 1A9UA 5LWMA 1X8BA 4E20A 3VS3A 5BMSA 2KC1A 4S33A 2HW7A 4F63A 3Q9YA 5IQHA 2ITVA 3BHYA 3SVVA 2UVZA 3JUHA 3MESA 5IUHA 2QOCA 4FIFA 4U6RA 3OG7A 5AV0A 4IX6A 3JPVA 5LOHA 4HCNB 4FV5A 4M0WB 3GOKA 4BCPA 4A3PA 3RJCA 1IPGA 3TZMA 3NSZA 3LOKA 4E6AA 3HIZA 4R5YA 4E26A 3Q4ZA 1K2PA 4JX3A 4RT7A 2R64A 2VO0A 4RRVA 3IHPC 2QO7A 3EECA 2ZDTA 4FT9A 4ERWA 3OVVA 4ZIMA 3DNEA 1NW1A 2QLUA 3UZRA 2G2IA 3DTWA 4XP2A 3PP1A 3F3WA 4EYMA 3KVFB 2PZIA 3BBWA 3WBLA 2XK3A 4NT4A 3QCSA 4F7NA 3DXNA 3O17A 3EN6A 4EH7A 4ZSGA 2BRMA 4WJQA 3OY1A 2XCKA 3G9NA 3RPYA 3L17A 4JQEA 4MGKE 2ZV8A 2OXXA 4BBNF 2Y5BB 4S32A 2AUHA 3U55A 3L16A 4Y5HA 3FMKA 3D15A 3A9JB 4FG7A 4GDLA 1SE9A 3LFFA 1CKJA 4CD0A 2LGYA 2UZVA 3TTJA 2BAJA 5LQFA 2P55A 3LFSA 3UQCA 4EQMA 5GZ8A 3NVKI 3F5XA 1JLUE 2RIOA 4KRCA 1AQ1A 4OUCA 2GNFA 4JR3A 4HWIB 4EK8A 5DIAA 4FR4A 4O7WA 3R63A 3ZW3A 3FKOA 4C02A 3QRJA 2P0CA 4G3DA 5LWNA 5HQ0A 1MRVA 4UN0C 2QOHA 2ETRA 4QTCA 4CSVA 3AT2A 1NVQA 3U6IA 4BDDA 4P7EA 2XF0A 4R6VA 2EXCX 3OAWA 5JFWA 3AC1A 4RSSA 3EL8A 2DQ7X 1Y91A 4B9KA 5DCNA 4WWNA 4AS0A 2IBIB 2NCNA 4IW0A 3PYYA 2WELA 3EQDA 5T3QA 2X8EA 2HIWA 2CNVA 4C4FA 5A4CA 2Z0EB 3APDA 3RULA 3TJDA 4YZMA 3II5A 5DN3A 5DH3A 3UDBA 5H9BA 4OVUA 3O7LB 3RZWC 3A7IA 3ENMA 2GFCA 1YOMA 3MVMA 4QP4A 4FEWA 4PF4A 3TEIA 3UC4A 2WQEA 3OEFX 5CALA 1MP8A 1M7QA 2C6KA 2L8JA 4HNFA 2PVNA 3MY0A 2E9OA 1TBEA 1E7VA 1WGRA 3S00A 4ZRJA 1PF8A 4OTPA 3UO4A 3ZC6A 1WVYA 4GVAA 4Q9SA 3ZDUA 3MA3A 4CKIA 3UBDA 1URCA 2WMRA 3ZHPC 5CNNA 1MQ4A 3VTUA 5AAFA 3A1QB 2F2CB 4IDVA 3UMXA 3QD4A 5JN2A 2C3LA 4I0RA 4JXFA 3RBWA 3RHKA 4D2RA 2QR8A 4O21A 4O2ZA 4DA5A 3KW5B 2PL0A 1ZLTA 4CXAA 5EI6A 2PVJA 4HDQA 3TV6A 4NSTA 3RM7A 4GKIA 3MW1A 5HTBA 3ACKA 2XK8A 3NYNA 1L2NA 4CG9A 2VNYA 4DDID 4C59A 4EOIA 4L3PA 3NR9A 2UW6A 4AWIA 2ZM1A 5I3OA 3Q2JA 3BV3A 1OGUA 3LM0A 3AU4A 4U8ZA 3CQUA 3HMMA 2ZVAA 4ID7A 3VQHA 5FBNC 5G1XA 3U6HA 4GVJA 1JSVA 3QQKA 5CAPA 4BKZA 3QALE 3SKCA 3O7LD 2BFYA 3LQ5A 3BI6A 5LVMA 3DPKA 3NDMA 2YAAA 2IW6A 3UIMA 3CC6A 5CVGA 2OZAA 4AE6A 3OCBA 3KMWA 2HE7A 4BC6A 3L9NA 4FL2A 3KQ7A 4IM3A 2HYYA 4MEDA 4X2NA 2LWPA 1WBVA 1P0RA 3DJ6A 4BCQA 2VD5A 3PS6A 3VQUA 1JWHA 4O7YA 2FB8A 4XZ4A 4M84A 3CTQA 3FMMA 2Z59B 5HD7A 4FV6A 2A0CX 3TUDA 3U9NA 3NMUF 4O96A 4NM7A 4E74A 2OLCA 3CSVA 2RSVA 3CQEA 1FXTB 3TIXA 3DNDA 1Y6AA 4PP7A 4R3CA 4FTKA 5E8YA 5BUJA 3A4SC 4AOFA 2IVSA 4O0UA 2K25A 5AX3A 2JFMA 4O7ZA 1YOJA 5IISA 3AMBA 4WG3A 2LXCA 1H00A 2J50A 2YIYA 3FBVA 4FUXA 3GU7A 2QURA 2QO9A 3PREA 3MTLA 2BRGA 4YC3A 4M69B 2RPQA 2WMSA 4PDSA 3W2RA 4CFNA 3IW8A 3OCGA 4MSQB 3F3VA 1C3TA 3PSBA 3R00A 3G0EA 2VU3A 4JT3A 4W9XA 1BX6A 3DZOA 4X21A 1WRDB 3GCQA 1OZ1A 2UW7A 3P0MA 1WCCA 4DEHA 2YM4A 5IH6A 4BCJA 1I35A 3NVMB 4NM3A 2WD1A 4OTFA 4F1TA 5LXIB 1RFAA 2VTHA 1V0OA 2GNJA 2QCSA 5CSHA 3AC8A 4IM2A 4EWQA 2XCHA 5HGIA 4RM8A 5E8TA 1RE8A 3BYOA 4I94A 5DNRA 3R9NA 4F1MA 2KTFA 5CU0A 1Q97A 3ZYAA 2IZRA 3R1SA 2L7RA 2V7OA 2HW6A 3CP9A 1H25A 4LV5A 4ZTLA 4QO9A 3E88A 2UZLA 1YDRE 5FEQA 1M52A 5EDSA 5IA5A 2Z02A 2XNGA 3B2TA 2PY3A 1WE7A 5L2WA 4LMNA 4QRCA 1L3RE 1TKIA 3QYZA 2UWQA 4ENYA 1XHAA 4PS8A 4E4NA 4O7LA 4CYJA 2Z7RA 3CD3A 4DFBA 4FK3A 3K3JA 5DT3A 4NM0A 2Y9QA 1KOTA 4DFLA 4TWNA 2WAJA 3V8SA 2JRIB 3FI2A 5KZIA 3PWDA 4CV8A 4WQOB 2ZAZA 4IWDA 4EH5A 3AGLA 2MBHA 4EH3A 2XH5A 4YC6A 1U5QA 4XG7A 5E8UA 5CF6A 4M69A 2LGDA 4QD6A 2KJHB 5HHWA 3E64A 3NUUA 3IO7A 4FVPA 4QNAA 4ZRIA 5D10A 4ZJIA 4C61A 3WAPA 1WFYA 4FYNA 4BIDA 5KCVA 4NY0A 3HKOA 4UYNA 3BYMA 3OWJA 3BINA 4GFGA 4A9UA 4X2KA 4AACA 4MJSA 4WO5A 5CEKA 3LMIA 1KE5A 3SOCA 2W4OA 1ZOHA 3KYDD 4PMPA 2FSOX 1WYWB 1OGWA 4NWMA 1ZMWA 5L6PA 4DTAA 2NBVB 2C4GA 2NBUA 3VS2A 5C03A 2IW8A 3QRUA 4BDKA 3A7JA 3P86A 2LZ6A 2XBAA 3O96A 3VS5A 3HEGA 3PPKA 4GEOA 3ZRLA 3O8PA 2QLQA 3GVUA 3PIZA 2NRYA 4JLCA 1IR3A 2I40A 4EOKA 4MXYA 3ORTA 4QMQA 3ZSIA 3GQLA 5AM7A 1UNHA 3EC8A 3E8EA 4H36A 1WJ6A 1BMKA 3BBTB 4JG8A 3PDTA 3H0YA 4I41A 3OEZA 4TYIA 2CHLA 3D2KA 4ZK5A 3TM0A 3AI5A 3LXPA 1WX9A 3UYSA 3FI4A 2F7ZE 5A14A 2P4IA 3KXZA 4FJVB 2KK8A 2ZVOA 4PX6A 4EL9A 2I1KA 2KWUB 3FXWA 1Q62A 4NZWB 4CYIA 2W1FA 4BCHA 4DG3E 2Z60A 4DAWA 2REXA 2P2IA 2LGCA 2WQOA 4KA3A 4KKEA 2LGXA 2J7TA 2IVUA 2DAJA 2VWBA 1ZYCA 4C0TA 1CM8A 5HNIX 4FHJA 3COHA 1ISNA 1AD5A 5FD2A 3ZO3A 4WWPA 5CZIA 1LXDA 4EC8A 3R8ZA 4HGLA 4YSJA 3GFEA 2OJRA 2V3SA 2NP8A 4XLVA 5G55A 5JH6A 3L9LA 1M14A 1GNUA 4FL3A 3BRBA 1YX5B 4CKRA 4FSMA 3CMMB 5H8GA 2ITXA 4BDEA 4KUJA 4KZCA 2ZMDA 3ZCLA 3DK3A 3PVGA 4PYZA 3OP5A 4IANA 3TMPB 2C6OA 4YZ9A 1LM8B 4H05A 2UZOA 1V80A 3RNYA 3APCA 4LUEA 4DH1A 4AGDA 2ZV7A 5AJQA 4QQJA 3CGOA 1OPKA 5I9YA 4QTEA 2WNTA 5AP4A 5KBQA 2X7FA 2XNPA 4C3PA 4USEA 4FV3A 3ZIMA 4YLKA 1H24A 3HAVA 1P98A 2W96B 3H10A 4G6OA 1RLFA 4NFNA 5ETCA 1WGGA 3ALOA 4U81A 3V04A 3A9KB 4CRLA 3C4WA 3VBQA 3TJPA 1LUFA 1D3ZA 3LZBA 5AADA 5HZNA 2YAKA 3R1YA 4BDIA 2ZVNA 3S95A 3KL8A 5JGAA 3FL4A 5M08A 2WEIA 3SW7A 4FTJA 5J7HA 5EHOA 4DHJB 5L8LA 1FMKA 4NTTA 3JY0A 4QPAA 3VUDA 4Y73A 1XH7A 2QD9A 3FZTA 5DVRA 3SV0A 3OMVA 4FL1A 4W9KA 1Q5WB 4C3FA 5CNOA 2ITWA 4HYSA 3D7TB 1XQQA 4G3EA 4PDOA 4PPBA 3ENEA 4DGMA 5AUVA 5EQEA 3ATSA 3QYWA 2PVKA 3IOKA 3LM5A 4MWIA 4FTQA 4B7TA 3UPZA 1UGMA 1ZW7A 2PU8A 1QPJA 3E8NA 3C9WA 5K3YA 4ZY5A 2PE2A 4G11A 4HXDA 5CAUA 2OH0E 4EFOA 5JMSA 3P9JA 5KHQA 3MGYA 2CHZA 2W0JA 4FSRA 3TXOA 5HVYA 2YM7A 3KXMA 3NPCA 5ETFA 3S1HA 3BELA 4FKPA 4NTSA 3EQFA 1JBPE 2R3RA 3NIZA 4HNIA 5DMZA 1DS5A 2BAQA 5IQGA 2ITZA 4N57A 1FPUA 5HKHA 2XK9A 3QKLA 1WBWA 4ZTSA 4E5WA 4MDKE 5DA3A 4KIQA 3LE6A 2B9IA 4EOSA 2V1YA 4E6QA 5EM8A 3OT3A 2WOUA 2OH4A 1CDKA 3POOA 4FULA 4DHFA 3KRJA 3A9KA 3F6XA 3VUWA 5C8MA 5K9IA 2JDRA 3ZUVA 5CI7A 4JRVA 5EW3A 2C0IA 2ZPYA 3JYAA 2V22A 3R9HA 4Y8DA 3OHTA 5AUUA 5AP6A 3KKVA 4A9YA 3QZHA 4V01A 2EB3A 4A9TA 4A4OA 3UTOA 4UYAA 2YCFA 3TV7A 2JBOA 3QGWA 4RJ5A 4ICVA 4JDIA 4NQKE 2XRUA 3E3PA 4GCJA 2BYEA 2ZPNA 2WMWA 3RT3B 1ZZLA 2MBOA 2KDBA 2I0EA 3EN7A 4RMAA 3LFEA 3R8UA 1FGKA 5A3XA 4ANOA 3MIAA 3UE4A 1UKIA 4AUAA 2W7XA 2XYUA 5DFPA 3VBVA 4FGBA 3LMGA 4ZSLA 4ICUA 2H9VA 1REJA 4BCFA 4C4EA 1PRYA 3NZUA 1H0VA 3F61A 3LLTA 4MK0A 2OU7A 1UU8A 5GJDA 4FNXA 4K77A 5DRBA 4GYIA 3EQCA 3RNIA 1R39A 1E8ZA 3RKBA 4QMWA 2OI4X 4O6EA 3UGCA 5AUTA 3BU3A 1H26A 3DK6A 4I23A 3HRBA 3QFVA 4IZ5A 4FKGA 2CDZA 3LXLA 3NW6A 1I44A 3CPBA 2HZ0A 2YCRA 4FSZA 4BTKA 3VC4A 4F7SA 4M0YA 3ZVVA 5E1SA 3RK9A 2C5OA 4F65A 2VX1A 3VHKA 3G6GA 3PZHA 3HMNA 1WVXA 3SXFA 4P7IA 3P08A 3LJ2A 5GJFA 3OUKA 4JVGA 3ODZX 4IJPA 4RZWA 2CKPA 1IA8A 2VWWA 3TKUA 3EFWA 3LCOA 5C1ZA 3U6JA 3VW8A 5I4NA 4IAZA 2OO8X 3E63A 1JKSA 4XH6A 4XHKB 2O64A 3I6UA 2W9ZB 4TWPA 2VAGA 5JZJA 3PLVA 4HVHA 1KWPA 2YJSA 4ASZA 2N9XA 2Z7SA 4L42A 2GS2A 3PPZA 4JBPA 4EHZA 3E62A 4I20A 3I5NA 4ANVA 1WIAA 1F9JA 1WVWA 3HAMA 1T46A 1OEYA 5CEMA 2VUWA 4AOIA 3ZRKA 3VXWA 2PUIA 5IQDA 4RJ4A 3TL8A 3X23A 3PHXB 2UZTA 5I9ZA 1U4DA 1VCBA 2XJ0A 3MH0A 4XV9A 5FTQA 3HMOA 1P14A 3C0GA 2BZIB 3UQGA 4QP3A 2KDIA 1YI3A 3GB2A 4G31A 4PS3A 4LOQA 3QA8A 2KOXA 4TQ0A 1KSWA 2BAKA 4ASDA 3BHTA 3EHAA 4WUAA 4FG9A 2R2OA 3QJZA 4BGHA 3VS0A 1GUAB 3CS9A 4ANQA 1F5QA 4C4IA 2BR1A 4E6DA 4FIIA 1OKVA 4C7TA 2XKEA 4E93A 2YFXA 4RJ3A 4D1XA 3Q04A 5HO8A 2BRHA 3UG2A 1SGHA 1WJ4A 1YRPA 5KNJA 4G16A 1G5SA 2ZZPB 4WNOA 4F9AA 3QF9A 4ZJVA 1JRUA 1E90A 4W9IA 2OF2A 2EMTA 3WI6A 2VWUA 5IMXA 2C6DA 4IH8A 5C23A 3A8XA 3VUXA 3PVWA 2E9PA 4GKHA 2ERZE 2VN9A 4GIIA 3AXWA 3UIXA 2WKMA 2EU9A 1EH4A 4YUQA 3L13A 4Y46A 3LPBA 4LJOB 4MYGA 3BYVA 3DU8A 2BKRB 3IBEA 5C27A 1ZMUA 3DVNU 2C30A 2C5LC 2XM9A 2N1WA 4QMUA 5FR6A 2ITTA 4QMNA 3PLUA 3UQAA 2VTPA 4QQTA 4ACMA 4DHZE 3C4EA 3EHVA 2V7AA 1ZMVA 3OC1A 1QCFA 4PV0A 5DPRA 3NZ0A 4GT5A 3GCVA 4FEUA 2P33A 4QTBA 3IGGA 3RMFA 1PY5A 1ZOEA 3IDBA 5HCZA 2O3PA 4IX3A 4WJOA 2PMLX 5HOAA 5HNGA 3ZO4A 3TV4A 1YIWA 3RGFA 5EYCA 4XBUA 5CQUA 2XS0A 4WG5A 4DCAA 5ICPA 2WTJA 2JRHA 2V4LA 3RZFA 5GINE 3DLZA 4MXOA 2KQ7A 2LVQA 2ONLC 3QU0A 3G0FA 4FKVA 4YJNA 2WFYA 1SYKA 2ONLA 4OTQA 5HIBA 4O1OA 3GU5A 1OL1A 5H8BA 2N4FA 1SM2A 5M53A 3SHEA 3W2QA 5E92A 4D2PA 3EYGA 1J1CA 3E87A 5K5NA 5HU9A 3UOJA 4F9WA 5T68A 3DQXA 5AR7A 3WAOA 3F7ZA 5M4IA 5AMNA 3BLQA 2PZYA 5BUEA 3HM6X 2XNMA 2YA9A 4TWCA 3R8LA 4I5PA 4G3XB 3LQ3A 5KX8A 4J8MA 4UB7A 4X7QA 1TQMA 4XX5A 4QT1A 5C4KA 3H9FA 3R7VA 5CTPA 5EYMA 4K33A 5DPSA 2LRWA 4DEAA 3KFAA 5HBEA 3S4QA 2WGJA 1KV1A 4GG5A 4ALUA 4QTDA 4ZDVA 2GHLA 3CY2A 1Q41A 4FZ7A 2R0IA 2GTNA 5JKGA 2C3KA 5F94A 3GC0A 4ZXTA 4AA0A 2WTIA 4UXQA 1Q5KA 3FSKA 3VJNA 5JZEB 1STCE 3VF8A 3AT4A 4FNYA 5CEOA 2W9FB 4KDLB 3V6SA 3PRIA 2KX3A 2RL5A 5M07A 4DWFA 2R3PA 2PVRA 3AC4A 2J5EA 3HDMA 2Y7JA 3R21A 4IWOA 2X1NA 2QC6A 4ACGA 2UZBA 2ZV9A 4GU6A 4M8NA 2YIXA 4ARKA 4W8EA 2C1AA 1TZ1A 4RC4A 2ZOQA 3QARA 2YVCA 3ZO5B 4MXXA 4OVVA 4GL9A 3R7QA 4BKSA 2I1JA 2D11A 1KE8A 4KBCA 4EOPA 4F08A 3Q5ZA 4L7FA 1LEZA 1PYEA 4M68A 2WIHA 4IVAA 1V86A 3RPVA 1OBDA 4F0IA 2IPXA 3CCNA 4G9RA 2WX1A 1PXIA 4DBNA 2LXAA 1M2PA 5BYLA 3DAEA 4K7UA 4W4XA 5BVFA 1BI7A 2ZB1A 4FV4A 3R1NA 5K4JA 4TPTA 2PEAA 2XJ1A 3SGCA 4YR8A 4NJ3A 3K54A 2UW8A 1QMZA 3DKFA 4EOLA 3N4VA 4AF3A 1TVOA 3AD4A 4CNHA 2GS7A 4D5HA 3RI1A 5A6NA 4JG7A 2PVHA 3S0OA 4J1RA 3H30A 2ESMA 3NUXA 2FNJB 1J7IA 5M06A 3PG1A 5F20A 1SVGA 2QODA 5F95A 3EKKA 4L53A 3KRLA 3QD3A 2A4ZA 2I0HA 3GU8A 4Y5QA 2NVUI 1K9AA 5J7BA 3DQVA 4LL5A 3IFWB 4W4YA 5JHBA 4R7HA 3V5QA 2O0UA 5C01A 3NAXA 3VS1A 5ITAA 3NUYA 2CLQA 3D83A 3WARA 4ZAUA 2IO0B 4KINA 5ANEA 2N1VA 4V04A 5CF5A 3CKWA 3B08A 3M63B 5D2MB 2HY0A 4TYEA 2WTKB 2JAMA 4AN9A 5M57A 5KZ0A 1P1AA 1AGWA 2HZNA 4MXAA 2KDFB 3LCDA 3OXTA 3CE3A 3M1SA 1OUYA 4L7SA 4RLLA 4FICA 4KBKA 3ID6C 2YERA 2C5YA 5IDNA 4O83A 5AUZA 3COKA 1WM2A 3VTVA 2EMSA 3E7OA 4DEDA 3CXWA 3GBZA 3QA0A 4D4RA 2JDOA 1V9JA 3G5DA 4U42A 2QVSE 2R3KA 2OWBA 4FTLA 2GQSA 4ZLZA 5DR9A 3R3MA 3EFLA 4H1MA 4KRDA 3BGQA 5HE3A 4O81A 5HD4A 4EONA 2DHZA 4RX8A 4M8TA 2ITYA 1OECA 4IZAA 4OAUC 4UMTA 4TKNA 3PXQA 4WRSA 3TNIA 3EMGA 4BGGA 2PSQA 1Q4LA 2MWSB 2K8BA 4D2SA 3V8TA 3O71A 3APFA 1BYGA 3QC9A 3OJ3A 3RALA 3M2WA 2CGWA 3U30A 2KN5A 2ETKA 5F4NA 3TCPA 4ZYNA 2JLDA 2ZYBA 2OG8A 3BCEA 4WUNA 4KKGA 1WM3A 3G9LX 4LOOA 4F09A 1P4OA 4EZ3A 4ZTQA 2B9FA 4EHEA 4BIBA 4FG8A 3SDJA 3VUIA 2QKWB 3D9VA 3FYJX 4HDOA 4RM9A 4FT3A 5IA0A 2VTLA 4LCDE 3PIXA 4II2B 4K2RA 1FVVA 2WTKC 1Q8WA 4I6FA 3VH3B 1H07A 5FXSA 4D1ZA 4V0GB 4AA4A 3NLBA 1ZARA 3RVGA 2KWCA 4LYNA 3FZPA 4FJYA 3MS9A 4YC8A 4CT2A 1ZRZA 3Q6WA 2VWYA 1OB3A 5HG5A 4ZS4A 3RPRA 4TXCA 1WY8A 1BLXA 3NNVA 4BIEA 4KV2A 5AV3A 5DEWA 3IW6A 2JDVA 1V81A 4DBXA 4YLJA 4HVIA 2B9JA 3R04A 3A8WA 4FV9A 4PQNA 4DEGA 4FEXA 2WO6A 2VTMA 4GN1A 4S31A 4QYEA 3IKAA 1YHWA 5D11A 4NL0A 2C69A 3AMAA 2N9EB 1M2RA 5KKRB 4L43A 3F5UA 4ANBA 5HE0A 4ANMA 4F6UA 1GNGA 3O8TA 4CO7A 4PRJA 4KD1A 4HLEA 2YWVA 4DC2A 4ANSA 2NPTB 3GUBA 2FCQA 4IHPA 4OTHA 4C34A 2M1MA 5TT7A 3C0RB 2IW9A 5JGDA 1OL7A 4L8MA 3UP2A 3GENA 1IA9A 4OT6A 4USFA 1V2YA 2BGFA 4X2GA 5LMBA 3PY0A 2A2AA 1FBNA 3BHUA 3DPDA 3ML8A 2J0LA 3FZOA 3TKHA 4TYHB 4R8QA 4S2ZA 4M8MA 2K8HA 3ZRFA 1S9IA 2WTVA 3FZRA 3OTVA 4Z3VA 5IU2A 5L4QA 2ACXA 5JH5C 4MGIE 1O6YA 4C62A 5CXZA 1QPDA 5JK3A 4DEIA 3ZNHB 4RIWB 1KV2A 4C58A 4BDCA 4UZHA 1H4LA 3DBDA 4ZSJA 2DYOA 5CZHA 4JOAA 3FY0A 2QHMA 4QQCA 5A4QA 4GDKB 2DYMA 3QQHA 3VQIA 3PRFA 4O0YA 4FJZA 3QQFA 3QD0A 3WF6A 2XNBA 2PVFA 4I6NB 2VX3A 1BT0A 3QHTA 3BGPA 5HU3A 5IAAC 5BX0A 4W9GA 4F4PA 3WYYA 4YZCA 2X8IA 3ERKA 5LARA 1WF9A 2CN8A 3R7GA 3DTCA 4WJNA 4XBRA 1G8AA 4IB5A 1OKYA 1GC7A 1R0EA 2ZCBA 5JRQA 5IKWA 2PZPA 3SW4A 2UZEA 4FMQA 3C4CA 4IC7B 4GIHA 2X81A 2PUNA 4O0SA 2QKRA 4XG2A 4MH0E 4LL0A 4CVAA 4KSPA 4NAWB 4H1JA 2NPTA 2Q83A 2ZEQA 4J7BA 4JBVA 4U40A 3NX8A 1KOAA 2O6VD 2YZAA 1OI9A 4AZTA 1U54B 1YVJA 4OTWA 2HWPA 2PWLA 2WMUA 3PV1A 3EKNA 5JQ5A 3MTNB 1GZNA 4AZSA 3MJWA 2R3HA 5CU2A 2GCDA 2PJHA 4TYHA 4TTHB 3CQWA 2XEYA 3UF8A 4AT4A 4F1OA 5IQFA 4MGYE 2JAVA 1JKLA 4RX5A 3RK7A 2WOTA 2JKOA 3VWAA 4CCBA 2FIFA 3MV5A 3EYHA 3KH0A 3MY1A 4B8MA 5FGKA 5BVWA 2XYNA 4GB9A 3NNUA 5AV2A 4P5ZA 2ITUA 1WAKA 1YXUA 5JRSA 5DPTA 3RCJA 4OAVB 4LMUA 1XWSA 4D2WA 2XEZA 4GDKA 2GPHA 3R7IA 4HK2A 4FC0A 1OM1A 1CSNA 2I0VA 5K4IA 1LQBA 4NU1A 5EYDA 2BDFA 5CU6A 3UQFA 3CKXA 1LP4A 4I5MA 4ZTMA 4FKSA 4UALA 5CAQA 4FIEA 3CF6E 3KULB 4RLKA 4KIKB 3C13A 4JQ7A 2YIWA 4RGJA 3F3UA 3CLYA 1YW2A 4HYUA 4XP3A 4IC7A 2M8SA 5HORA 3ORLA 5HTIA 3R7UA 3QZFA 5KMNA 1UNLA 3B2WA 3CPCA 3CY3A 3F2AA 1Z2MA 3SXSA 4O6LA 2C68A 4NH1A 2RFNA 3EH9A 5KE0A 3QTZA 4Z7GA 2WMTA 3IGOA 3SHQA 1WXMA 3UQBA 4HPUE 4QTAA 5CI6A 4NKAA 2BVAA 2RF9A 1NVRA 2W5HA 1WFCA 2MRPA 3IOPA 3K9OB 4AW5A 5D7AA 5ANOA 3FZSA 4NPNA 4K1BA 5CASA 2UUEA 3ZNZB 3A33B 4BGQA 4GU9A 5HE1A 4KDIC 1YQBA 4J71A 4DHZB 1V5OA 5CSXA 3PZDA 5HCXA 3WZJA 2JIUA 1J91A 5I5ZA 4FLHA 5BMMA 1T45A 5HO6A 4A7CA 5FM2A 3FQEA 2L00B 4ZS0A 4BOZB 2GBKA 4CFMA 3ZFXA 4HVBA 4HW7A 4C33A 2DYBA 3Q6UA 1RDQE 5IA3A 3DFCB 3HA6A 1OIYA 5HI2A 4YZBA 5JQ8A 4MWHA 3BQRA 3DBCA 1J0GA 5M44A 2R3IA 3NCGA 3DAKA 2BROA 3KULA 4FX3A 3P7BA 4KIKA 5F9EA 2Z0DB 2CKOA 1MG8A 4MD8E 1YXVA 4WSYA 4PNIA 2YM8A 3KN6A 4DH8A 5FEEA 4B0GA 2HCKA 3NNXA 5H2UA 2KMAA 3ZKJC 2OBJA 2C7HA 1K8RB 2Q0BA 4E7WA 5AP7A 4O86A 1S9JA 5IEVA 2OXDA 3D5VA 1WGHA 4II3B 4HOKA 4HCPB 3NS8A 2UW9A 4I1ZA 4FV1A 3TDVA 3AQVA 5M4CA 3HLLA 5J1WA 4U5JA 2KANA 2HJ8A 5J9LA 5JGBA 2N9PC 2X2LA 1NDDA 5DGZA 4CEGA 4WNPA 4BI1A 2RFDA 2P3GX 4MD9E 5L2SA 4YPDA 4YMJA 2R9SA 5H8EA 3FC2A 2WMQA 4RVLA 4XG3A 3DXQA 3VO3A 4IAFA 2J0JA 3EZRA 1EF5A 1R78A 5HX6A 4O7TA 5IQAA 5AUXA 4C4HA 5CHFA 2QHNA 4QYFA 4FUYA 4EUUA 2G3QB 4WKQA 2JVCA 1YWVA 5LMKC 2MP2A 2BYFA 5BYZA 5CLPA 3TACA 4FI1A 4RX9A 5LMKA 4XYFA 3UOKA 3R1QA 2OOBB 3HP5A 4QPSA 4CFXA 1GZOA 5I9UA 2AYPA 3PPJA 4K8AA 4BCIA 5ANDA 3KC3A 3RAIA 5GNKA 4DTBA 3R9DA 5E1EA 1BL7A 2WU7A 5CXHA 4DTKA 2PPQA 4GFMA 1S3SG 2EXEA 4H3PA 2A4LA 5FWKK 4HVSA 3AT3A 2HK5A 4D4YA 3FI8A 3NEWA 3V01A 4FBJB 3F82A 3DBHI 5ACBC 3U7DA 3K9PB 4D4SA 3ZO1A 1XQZA 4EOMA 3QRKA 1WZ0A 4NJDA 3ZEPA 5EFQA 4FKWA 4FSUA 1I42A 3VVWB 2BRNA 2FYSA 1DM2A 5HEZA 4ORKA 4D58A 5KO1A 4WNKA 3PTFC 3UNZA 4PNKA 2J51A 4RWLA 5ANKA 3GCPA 1MQBA 4HVDA 3HV4A 4IFGA 5M51A 1A48A 5CF4A 4GK3A 1Q8UA 1GIIA 1CKIA 4CFUA 4FTTA 3Q32A 2IVVA 4ZEGA 5DOSA 3KUDB 4HJOA 2ZCCA 1J7UA 2OSCA 3EQBA 3S2AA 3NUNA 3JVSA 3TL5A 4ZP5A 4AX8A 4LRMA 5I9WA 3AD6A 4KNBA 4XS2A 2W05A 2AC5A 4WHZA 4IAAA 4ANWA 5EW9A 4X6RA 4IAIA 2IY1B 2X6EA 2C47A 4HCVA 1B38A 3ZLSA 2HENA 3A7FA 2J9MA 4IUMB 2OW3A 3E3BX 2QR7A 4MF1A 3T9TA 1U46A 2KNBA 2P2HA 4TQ1A 3K5UA 5D7VA 4TW9A 4YL8A 4C35A 5CEQA 5AV1A 3HUCA 1FMOE 4PTEA 4FNWA 1WZ3A 3PXZA 4CQGA 3Q9XA 2VRRB 1GIJA 2F49A 4O0VA 2B4SB 4I5HA 2CCIA 4U0IA 2YITA 4A07A 4W9DA 1XBAA 4J95A 2BWES 4RIYA 4A06A 1MRYA 2EXMA 5HCYA 1FVTA 1K3AA 2JT4B 4RJ7A 1GIHA 4YJOA 1Q61A 5CYIA 2PMNX 1PXNA 2XIZA 4WNMA 1OKWA 2WQMA 4G34A 2L76A 2UW0A 3CGFA 5EOLA 3E92A 3WA0A 5L3AA 2WQBA 4GUBA 4RWJA 2R3FA 5J5TA 2ZB0A 3C7QA 3OBGA 2B0QA 4FZ6A 3E7VA 3RAWA 3Q3BA 2L0TA 4L67A 4TUUA 3QLGA 2BRBA 3EZVA 4UV0A 2MA9B 1JVPP 3F5PA 4FIHA 2A19B 3NCZA 5D12A 3OWPA 1KE6A 4GIVA 3PGEA 2O5KA 2WTDA 3WF7A 4F8CB 3OW3A 2NNWB 5AP0A 1WR6E 2ERKA 2C60A 5LVPA 4OBOA 5IH4A 4XX9A 5HICA 3OFMA 3R7OA 2IZVB 4BWXA 4ZLYA 2YDKA 5KMLA 1GAGA 3QCQA 2BYVE 4J98A 4N6YA 2VWVA 4APPA 5KHXA 4FT0A 4JIKA 3ZRCA 3GT8A 3OUNB 2JWZA 4KKHA 2KJRA 4LGHA 4ZY4A 3MVLA 5AZFA 3IG3A 4GH2A 4DH7A 3QTXA 3QIJA 3A61A 2RD0A 2J90A 1XT9B 2KDEB 3JSVB 4WSQA 4ANUA 2X7OA 3UMWA 3MFRA 2GBJA 4W8DA 4PMTA 5E8XA 3V51A 2FA2A 4RIXB 4XP0A 3ZU7A 4CLIA 4Q2AA 3NZSA 1NI2A 5AZGA 3KU2A 3AGMA 5J9ZA 3IDPA 2IZUA 4BI0A 3PFQA 2QOOA 2PVMA 3A9JA 3W16A 1ZZ2A 4DBGA 4K18A 3KUZA 3V60A 2JBPA 5E6OA 4GMYA 4JL9A 3HVCA 4PL5A 2J0MB 3QX4A 3ATTA 3UIUA 1WGYA 2R3JA 2MBBB 2Y6OA 4MELA 4QP7A 4EOOA 3AC5A 2MBEA 5CU4A 4I21A 5GZ9A 3TN8A 4XMOA 3TIZA 1KE7A 1PKDA 4HVGA 1M17A 1H1QA 2YWPA 4C2VA 4C4JA 2DZKA 2GSFA 3KGAA 4JIAA 3Q3JA 3LXKA 2BF8B 4A9RA 3RWQA 1VYZA 3CBLA 4EEWA 3LLAA 3R02A 1EO6A 1GJOA 3T8MA 2KX0A 3KY2A 3FXXA 1VZOA 2ZMCA 2ZM4A 4FGRA 1VEBA 4M14A 3F3ZA 2DS1A 5CT0A 4DFYA 4BICA 2B7AA 3KRWA 1OPJA 2IYDB 2F7XE 5FDXA 1NA7A 4GMVA 4EZ5A 5G2NA 2RGPA 2MX2A 4GJ3A 2XIKA 4RQKA 3MFTA 2UZUE 2ITPA 3R30A 2X4FA 1LEWA 3PUPA 4BCNA 4EQCA 4JX7A 1Y57A 3F66A 3OS3A 3KF4A 4YTHA 4YTCA 4O0RA 4WG4A 5AZHA 4Z55A 1T0YA 4GSWA 4CFVA 3LKMA 4YJPA 4TY1A 4YTFA 4UWCA 4AN3A 4BTFA 3A1QA 3R7EA 4HCUA 1P2AA 5DT4A 2J0MA 3MFUA 4RVTA 2W1DA 4MXZA 1Q24A 4IM0A 4KABA 3ORPA 4H58A 1PMUA
chains in the Genus database with same CATH superfamily
3TWJA 1LGRA 4XG4A 3KIOC 3QTSA 4D2KA 4USDA 1UWHA 1J3HA 2PMOX 5E8ZA 2PMIA 4R7BA 3T49A 4AZFA 3CIKA 4Q5HA 2GMXA 4URKA 3B0AA 4EE2A 3ZH8A 1KLVA 3C51A 4IWPA 4W9LA 3IDCA 2VO6A 1FINA 5BVDA 2FUMA 3WF8A 5GHVA 1WBPA 3KUCB 4QMPA 1HXYD 3FXZA 2OJGA 4I0TA 5I0BA 2CKQA 2AWTA 2OK1A 1L7YA 2D2QA 2WYQA 3ECIA 4M67A 4OLIA 3E8CA 1E9MA 2JKQA 5GIPE 4TZRA 3KVWA 4CLJA 2QOIA 4JDJA 1I4DA 4EI4A 5HIDA 5EHYA 2XJ2A 4UXLA 5I3RA 3T47A 3DX4A 3OWEB 3I0OA 3VHEA 3MHZA 4YNEA 1QKZA 4P90A 2V62A 1OKZA 3W9CB 5IA7A 3H7PB 4Q9ZA 2ZJWA 2CR5A 3WIMA 2Z8LA 5HG8A 2CCHA 2YIAA 3RD2A 2WMAA 3IVFA 3TUCA 4EZRA 1UH6A 2W17A 1Q8TA 3FPMA 3PRMB 2J42A 4AZ6A 2HXQA 4EKKA 3HMPA 3L08A 5D1JA 4BBFA 5EW8A 4BWPA 4CZTA 4C8BA 3HRDD 5I9VA 2OW6A 1XH5A 3LCKA 2X0QA 3UC3A 4EZSA 2YCSA 2ZXQA 4R5LA 5GMVA 2F57A 4WWOA 2YLMA 4R3RA 2PZ5A 2BBCA 4E5AX 2QILA 3GNIB 2IG7A 5BYRA 1FVRA 4PMMA 5CU3A 4RPVA 1CMXB 3ORMA 5BVNA 1HCLA 3ZDTA 4CHKA 2WDRB 3QQGA 1LPUA 4NJ6A 5I4DA 2O2UA 5A6OA 3VH4B 4HZSA 3AB5A 3FSFA 3R83A 4ZOGA 4W9FA 5AIKA 1LFDA 3MY5A 2X39A 1UA2A 5HTCA 4EZ7A 1W82A 2RG6A 4XWWA 3HRCA 1FO4A 1IEPA 5JEBA 1BUHA 3DJ5A 3I79A 5CAOA 3VUGA 1UBIA 3DVNV 2Y4IB 3W0RA 4JX1C 3Q8BA 4YSXB 2XK5B 3MB7A 2WP9B 4O2PA 1R1WA 1XR1A 3SC1A 2WB8A 3N20C 3A62A 4JI9A 1UD7A 3TG1A 5DWRA 1SNUA 3NY5A 3NAYA 1WJUA 4AJWA 2Z7QA 5DRDA 2Z8YA 3C4ZA 3U4UA 4EUTA 2YM6A 4AFEA 1YWRA 3KXNA 4G9CA 3EN9A 3C8YA 1U5RA 4CTBA 4B6WA 3HRFA 1XMMA 4IFCA 3H7PA 5GIOE 5FTGA 3RWPA 3WZUA 1TIFA 3R2YA 1M7NA 1TQPA 1AYFA 4AXEA 2VO3A 4BR3A 2IZTA 3C0HA 3KWLA 3QWKA 2KULA 5HG9A 5IDPA 4JR7A 2F18A 3FE3A 3Q9WA 3OY3A 4IX4A 3FZ1A 4L44A 2M19A 5DR6A 5IG1A 2F7PA 2WQYB 1B39A 4P2KA 2VTQA 1PXLA 2C6MA 2C08A 3QUPA 3HV6A 4OTGA 3RNCC 1DOXA 4IBMA 4M02A 4FTNA 4IMYA 3F9NA 3LFBA 5LMAA 2W5BA 1J7LA 1M2QA 3RAHA 3AEGB 1Z5SB 3Q4TA 4EQUA 1EUVB 4PDPA 4G2FA 4XV2A 4W4WA 2E9UA 2WMXA 3TBLD 4M0ZA 4A8XC 4G6QA 4FBXA 4J3OD 4C00A 3N9XA 1HTQA 4EK6A 4RFZA 1KJTA 4A3OA 5TKYA 3Q0KA 2J6MA 3G9GA 2CNUA 4XOZA 1R33A 2RGFA 2CHXA 2WMBA 2AL6A 1Q0WB 3TKIA 3IW7A 2IO1B 2HWOA 4ZHOA 4EH6A 4PTGA 3GQIA 4PPAA 3GE8C 1R4NI 4KZ0A 2AEHA 4FSQA 3D2FA 3P23A 4B9QA 2GS6A 5IZFA 3FMEA 4F6SA 1FCCC 4FZDB 4MM3B 4DXAB 2JKKA 3DDQA 2VWXA 3DY7A 4FKJA 3CVRA 5FQDC 4RWIA 3C4FA 5FIGA 1UNGA 2C9WB 2ND1A 4XGAB 2YDIA 1F1HA 2WDVB 3LCTA 3ORKA 5EG3A 3RNGC 4I24A 4O0TA 2FO0A 4D5KA 1Q8YA 4FKRA 5TOZA 3SDLC 3DX0A 5KMJA 1V6EA 4XDCA 1KE9A 4LGDA 3VTWA 3LMHA 3O5AA 3I4BA 3OF0A 3SRVB 3Q5IA 2HD5B 3DXPA 3O8UA 1OQRA 4O7NA 4DFUA 3LFNA 1OPLA 2EUFB 5L95C 4CMUA 2W4KA 3DOWA 3KRRA 4KSQA 5LXHA 3MC0B 4NAMA 4TNDA 4U43A 5LVNA 4JAIA 1ZYDA 1H0WA 3V5PA 3VFKA 1O6KA 5M55A 4AT5A 3HM3A 5BYSA 3G6HA 4CV9A 4AAYA 5L6WL 1XO3A 3LAUA 3PJCA 2WYIA 3BIZA 5C4LA 3I2WA 4QP2A 3F7WA 4ANXA 5FEDA 4ZTHA 2X4ZA 1T3QA 4LNOA 4W4VA 2WXVA 2IO3B 4NFMA 5KBRA 1X04A 4UMPA 4C56C 3LW0A 3ROYA 4MX9A 4RQVA 3VUYA 4RA4A 3RYTA 3LXNA 3ULZA 4QMTA 4MGZE 4WOVA 4L01A 4K11A 4O1PA 2HY81 2PHKA 2NCZA 4AGUA 2B3AA 2OXYA 1G8SA 3KK8A 3DX2A 5EHLA 2FSMX 2DENB 3A7GA 5H3QA 1F0QA 4NCTC 3PTGA 4KVGB 3F2NA 5CX9A 1XBCA 3Q2MA 1GB4A 2JIVA 4UX9A 4NCTA 3JVZX 3EQIA 4IB3A 2R3MA 4NM5A 3L8VA 1PXKA 3UIOB 1JW9D 4GFOA 2CMWA 4MM3A 2H89B 1HCKA 1U59A 2L32A 4M66A 5AUWA 3JXWA 3P4PB 3WAMA 3V62A 3DOGA 4ZZMA 2JKMA 1E1VA 4FT7A 1YN5A 3KRXA 4UMRA 3DKCA 5EI2A 3QRTA 4H3BA 1OIRA 2EWFA 3E5AA 4GG7A 1OMWA 2I1MA 2JDTA 3SOAA 3UGBB 3Q4UA 2XZSA 2L1AA 3HP2A 1C1YB 1C4PA 1UU7A 3H1UA 3PY3A 2W1ZA 1HZ6A 4NKSA 2I6LA 4R3PA 1XH4A 4F70A 3P63A 4YZNA 2LGSA 4UWYA 4DK5A 4FEVA 4BY9E 4DLIA 4TNBA 1NT2A 4R7IA 1H1PA 4GGQA 3ORIA 4ZTNA 2CGXA 1SU6A 3C1XA 3LJ0A 2Y6MA 3PHWB 2MHJA 3ZNID 3OWLA 4EHGA 1UKHA 2AC3A 2Y4PA 1MRUA 4GK4A 3VS7A 5BNJA 1Q8ZA 3MTFA 4FKTA 3VIDA 3CWIA 4M0MA 4DXGA 4Z9LA 2DAFA 1D5ZC 1MI0A 4OW0A 4XC2A 3CTJA 4FV7A 4ZSAA 3VDZA 5IPJA 3HZTA 2D3BA 1JNKA 4KB8A 1OL5A 4GDLB 2XP2A 1SIFA 1TS5A 3QCXA 4DEBA 3ORXA 3PXKA 5TO8A 2BUJA 4IVCA 2D5GA 4LTUA 4QYHA 4CCUA 1I4XA 3AV8A 4BN1A 3QD2B 1ENFA 3KXHA 4BDGA 4ITHA 3KEXA 3M42A 5LCKA 3NGAA 4FK6A 2H34A 2KZRA 1R4NB 2WEVA 5E6PA 2Z0NA 3S2PA 1IRKA 4UY9A 4GOCA 3RCZA 3PA4A 5E4HA 1ZYJA 1HE8A 4RFBA 2G4SA 4MNEB 4OT5A 2ZJDA 3RP9A 4XV3A 5FTOA 5A4TA 1DAYA 4XJ0A 4WPEA 1YD8U 4RGMA 3BVMA 4F9BA 3CR0A 3D7ZA 4ASWC 4HGSA 4G1WA 3MB6A 1OVEA 5AEPA 3FHRA 2W55A 3D7TA 4AZWA 2BPSA 5FUTA 1GY3A 2FYVA 1PXPA 4ANNA 2X8DA 2VGPA 4AUQC 1XKKA 2UW5A 3ZXRA 4K81A 2LJ5A 3NJTA 1PJKA 4P6VF 3C5UA 2CLXA 3QLFA 5AEKB 2ITNA 3L0WB 4EOYA 4GYGA 4RF0A 3AH7A 3UDTA 4JNWA 4ONAA 2PPHA 3QHWA 5C1QB 1O9UA 4FV0A 5AX9A 1ATPE 3Q8AA 2CGUA 2XK7A 2Q13A 2LHDA 3MPMA 4EZKA 3L3PA 5FLEX 4ZLOA 2TSSA 1MPEA 2GBRA 1UBQA 3QQJA 4I0SA 4X3FB 1OIUA 2M17A 1ZOYB 3TEYA 2OF4A 4F6WA 3GFWA 3FLQA 4BVUC 4LG4A 4C57A 3ML9A 1PXJA 5ETAA 4OTDA 4BVUA 2R3LA 1PMNA 2QOLA 5CQWA 2QONA 4FZAB 4FHKA 3WILA 2CHWA 1YI4A 4FZOA 3SD0A 3OBJA 4PWNA 3FQHA 1H8FA 5JXVA 3OLMD 2EB2A 3TZ8A 4XG6A 4AFJA 4IVDA 5HLWA 3BUDA 2JIIA 4O7SA 3ORZA 2RG5A 2V55A 1C77A 3UVQA 3V3VA 3MHSD 4EZYA 1L4DB 3NYOA 1BL6A 3BVZA 2MLBA 2Y8OA 4TYGA 3RK5A 5IQBA 4E71A 4R1YA 2BIKB 2N9KA 3BYYB 3AMYA 3HK0A 4JNFA 2JD5A 4EC9A 3R0TA 1SUFA 3WALA 4R78A 4MNEA 5HIEA 2GI9A 3DK7A 4FTIA 3N4TA 4FF8A 4L1BA 3DGKA 5AUYA 1G3NA 2VX0A 3MN3A 4HGTA 4EOQA 4PY1A 2AQ2B 2SEBD 3NVVA 5BQ0A 5B2MA 2WXLA 4BBMA 3BZDB 2CJMA 4IZ7A 3OJ4B 5TKDA 4QOXA 2GNLA 3FLSA 5EE3A 2Y0AA 5K5XA 4J52A 2ITQA 3IW5A 4IJ9A 1PGXA 4QMXA 1TQVA 3A7HA 4U79A 3P7AA 4GK2A 2BS2B 1UGJA 2RFEA 1EU4A 5AP1A 4XRLA 4HJGE 4W9CA 4BFRA 2MW5A 1WRIA 2PVLA 1J7AA 2OZAB 4G6LA 1TQWA 2JZZA 5BYYA 4WIPA 2MJDA 3ZNGC 3BWFA 2ICIA 2PE0A 4X3FC 2KXJA 3DJ7A 1OL6A 3FMDA 4MUQA 1YDTE 4X3FA 5CSVA 4IG7B 2FH9A 3OXZA 3U4EG 1WGKA 2G45B 1CKPA 2W82A 3ACOA 3GXLA 3Q53A 3LFDA 3D94A 1NXKA 3GOPA 1H01A 3KDRA 3ZRMA 3DBSA 4YZDA 5E9EA 1OITA 2PULA 1XXGA 1IUEA 3FAAA 3ZLWA 4JWIA 4X0MA 2X6DA 3P2BA 3QL8A 3HV3A 2UZWE 3BLRA 1D4BA 3W18A 3EIDA 4I1QA 2FCMA 4AOTA 1SU7A 4IB1A 5HG7A 1QZEA 3ABVB 2D07B 5HBJA 2JEDA 1R7SA 4EZPA 5AAEA 2PE1A 1I09A 2KVRA 3I60A 3SX9A 3SOGA 1DI9A 2BHHA 5AR2A 3Q4CA 2YABA 3WE4A 4YPSA 4DGNA 5ANJA 1STEA 3MSSA 4FSWA 5BUIA 5DYJA 2BZHB 2WWZA 3W8QA 3CJGA 3EWHA 3UOLA 1E1DA 2M0AA 3T9LA 2X7GA 2N9LA 1WGDA 2E3TA 2QDFA 4U97A 4O4DA 3BQCA 3KAWA 3JVRA 5CVFA 1UNSA 4O0XA 5JZNA 2IGHA 3T3VA 4K7WA 2NO3A 3NUAA 1NBFC 3DQWA 4AZVA 4GXBA 3T8OA 4RFYA 2V0GA 3VN9A 3P79A 2G4DB 2E2BA 4OGRA 2DWBA 3M3WA 2UV2A 5EKNA 4ANLA 2NPQA 2L05A 2C0TA 3ZDMC 1N63A 4L45A 3GCUA 2PYWA 4MKCA 3O3OB 4J99A 1W0XC 4PPCA 2VNWA 5CTRC 2J5FA 3W1YA 3F2RA 2X2KA 4EK4A 4E73A 4BZDA 2AYOB 4GS6A 3M3JA 4L00A 5D94A 2CU3A 4F0FA 4XNEA 1F0ZA 5EE1A 5HESA 1PYWD 3ITZA 3RZBA 3ELJA 3ALBA 1CJEA 2IVTA 2AL3A 5J8IA 1JPAA 3A4RA 4WRGA 1KOBA 3G15A 5HFYA 4M7IA 2KDMA 3CEKA 5C8KA 2H6DA 1TJEA 3HA8A 3I3TB 2CSNA 3VVHA 5HLPA 4ACFA 3MI9A 2B9HA 3SLSA 3ZLXA 3PZ7A 3N32A 4XOYA 5G5HA 3VHTC 1SBBB 3KN5A 3A4OX 4DGOA 1ZWSA 1X1MA 3BL7A 2ZNVB 3ET7A 5JFXA 4FSTA 4YJRA 3MJ2A 1KM7A 4G3GA 3TEXA 4BTJA 3RAKA 1MUOA 3FMLA 3VW6A 4O7RA 3TEZA 3OG5A 1WBNA 4IACA 3QTUA 3RPMA 4FA2A 3ZDIA 1BKXA 3T3OA 2UVXA 4W9WA 2WTCA 3PJ2A 3UINB 3M62B 2QG5A 1I7HA 3TNQB 5FM3A 1FFVA 2JY6A 2BKFA 5E8SA 4PMSA 4WBBB 4AOJA 1J7CA 3R9OA 2QMTA 3F88A 4MJSB 4XG8A 4B4LA 5HBHA 2VRXA 4ZRKA 3FKLA 3PLAE 5EOBA 3GOEA 3QAQA 3PSEB 4NW6A 1PW2A 3CV5A 2KLCA 4E8AA 5B7VA 4I22A 4NZLB 4H8SA 1VRAB 5D3DA 4H3QA 3KREA 5CAVA 1XO2B 5EDQA 4D9TA 2WIPA 4QP9A 5K0KA 3BVVA 3D4ZA 1WI0A 4N9F4 3DAJA 4MCVA 2GQGA 2KHWB 5BVKA 1R5EA 3AEAB 5CT7A 2R3NA 3HX4A 3TI1A 4H2AA 5EE0A 2J7QB 3I01A 1E1XA 3UDZA 2WPAA 4YURA 2GBMA 2BIYA 1OQYA 4TYJA 3R28A 3QWEA 3R8VA 4US8A 1OUKA 4I4EA 4C36A 2Y5PA 3DCGA 3BGZA 1NY3A 3PRPB 2RMMA 3ZZEA 3BUIA 2PE9A 2EKIA 4G0NB 3DBQA 2YIRA 5CEIA 4EH8A 4HPPA 3C5IA 4J97A 3ZXZA 2LAVA 1VZ8A 2L3ZA 3A99A 3W2DA 5EYKA 1B6CB 3ZQ4A 4BTMA 4G17A 2OIQA 2LUEA 2ZNVC 3PJ1A 2VO7A 4Y83A 3B53X 3I5JC 1FGIA 2JGZA 3PZEA 3UO6A 3PE2A 2BS3B 3ZBXA 3AG9A 4I6PA 2PUPA 2N7EA 5AA8A 2Y5CA 4B99A 3IK3A 3UIBA 2HTHA 3AMZA 2MCNB 1XH6A 2REIA 2KTYA 2PW9A 4IZYA 4YJVA 4KBAA 3FHIA 2VTTA 4RX7A 2QOBA 4M12A 1TGZB 4UEUA 1E9HA 4DEEA 3UVRA 3EL7A 4YO6A 2PUUA 4AXFA 4QMOA 5E84A 1ND4A 1WXAA 4BYJA 5AP2A