4IM2A

Structure of tank-binding kinase 1
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
659
structure length
618
Chain Sequence
GSMQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRNIKPGNIMRVIGEDGQSVYKLTDFGTEEYLHPDMYERVLRKDHATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVMGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Tank-Binding Kinase 1
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase TBK1
total genus 212
structure length 618
sequence length 659
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF18394 TBK1_CCD1 TANK-binding kinase 1 coiled-coil domain 1
A PF18396 TBK1_ULD TANK binding kinase 1 ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4im2A02
1.20.1270.420 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4im2A04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4im2A03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4im2A01
4YJNA 4YUQA 4UMTA 4UEUA 2GBKA 2ZM4A 3BBWA 3HRBA 3TUDA 3U8ZA 4IFGA 4YJUA 2WWZA 3QKMA 4QQJA 4GH2A 3R83A 2H8HA 1BL7A 3RPRA 3AU4A 4KDLB 3KFAA 4EC9A 4CYEA 2CHXA 5AAEA 2K8HA 2KDBA 2BRGA 2YM3A 5I3RA 5DPRA 4ZYNA 1ISNA 2E9OA 2OI4X 3HP5A 4ZSLA 1TQMA 4PL5A 2E9PA 1WZ3A 4FTRA 4FV1A 4ZTRA 4NJ7A 4EOSA 2GOWA 4IXPA 5A4TA 5M09A 5GJFA 4I5HA 5CI7A 3V5JA 3ZDIA 2J0JA 1IAHA 3UPXA 1JKKA 3PG1A 4ASXA 3KRWA 3E62A 3F5PA 2G4DB 1J1BA 5ETIA 3W1SA 4HCTA 4AUQC 2HELA 4F7JA 3MVLA 3P7AA 2P33A 3BYUA 4I94A 3Q9ZA 4H58A 3DJ5A 2QHNA 5IH5A 1E7VA 2GBJA 4TT7A 4D2TA 1T45A 2ZAZA 4BVUC 5K0KA 4YZBA 4N4SA 3ZVVA 2W0JA 3NW7A 4ORKA 4TPTA 2RFDA 5IEXA 2WMUA 3NYNA 2KMAA 3QXOA 3ORLA 4MTAA 2OJRA 3UZRA 3WF6A 4G5PA 5J1VA 3DBQA 2LXCA 1WXAA 3NNWA 4LRJA 1B6CB 2C0TA 4WOVA 5CYIA 3D7TA 2FAZA 2W4KA 4XJ0A 1M7QA 3JVRA 5DRBA 5H8BA 3VS7A 4GDLB 4BBNC 4QYEA 4EC8A 4W9JA 4KNBA 5DBXA 4HWIB 3VTWA 2GCDA 1WX8A 3RCDA 1S3SG 3RPOA 3VTVA 1H08A 4W9DA 3NAYA 5HLNA 2X4ZA 4J1RA 3MTNB 3PVLA 5ETAA 5AA9A 2B7AA 2XNNA 3HMPA 4L7SA 2LRUA 2MLBA 4PTCA 3EJ1A 4IB3A 2XRUA 3HZTA 1A48A 4R5SA 5D7GA 1OMWA 1WBVA 4KA3A 3R8MA 4BIBA 5ICPA 4OVVA 3HAVA 2OIBA 2CHLA 2VV9A 2JY6A 3EQDA 3D2KA 1WZYA 2C6DA 4YR8A 4J52A 3ZRLA 3R21A 3W8LA 4ZAUA 2YZLA 4MH7A 3SGCA 2YIRA 1IEPA 2XEZA 2ZJWA 4BDIA 4MXYA 3V60A 2BRHA 4R8QA 5E1SA 4CMUA 4RWKA 2O8YA 5BVNA 5JFSA 5ANIA 3IHPC 2PTKA 3NOBA 1XH4A 3QUPA 5GIPE 4U41A 2B53A 5M44A 4MXXA 4IM0A 4U40A 3BYOA 2JITA 3ZDMC 2FCNA 1Z9XA 1Q8WA 2OIQA 3KCFA 3MBLA 4XHKB 3Q5ZA 4FBJB 4O7TA 4QYGA 2N7DA 3ORNA 3D5VA 3FI2A 2IZTA 4FKWA 4G3FA 4GUEA 1XKKA 2VU3A 3LFDA 2EUFB 1JQHA 2Y9QA 4ASEA 4GSBA 1V86A 3ZRMA 3R7QA 2KDIA 3OWLA 4U3ZA 5IQIA 4C36A 2C5LC 3DFCB 2BF8B 1Q5KA 2PU8A 2QOLA 1QPDA 4O6LA 2QHMA 4WG5A 5HHWA 4EOPA 3EN9A 3AD6A 1NVRA 2KWUB 2KX3A 3PRPB 4FIEA 4DG2E 3PV1A 1YQBA 4JQWC 3ZDTA 4OTWA 3F9NA 1SNUA 1YI3A 3K3IA 3VS3A 1EH4A 3DY7A 3HEGA 4IAAA 3GU6A 3MGYA 2XK8A 3NAXA 4RLLA 1YXVA 3W2OA 1XBAA 3OFMA 4C34A 2Z02A 5ETCA 3W16A 1YOLA 5KNJA 4UWCA 3KMUA 2K6DB 5AADA 3C5UA 1YX5B 3CBLA 1ZMVA 3V5PA 4XP3A 3BWFA 4QTCA 4FVQA 3R00A 1REJA 1WX9A 2L05A 4FKTA 3PSDA 4FTIA 1WRDB 3FEGA 5CXHA 1FPUA 3ZRFA 3MH0A 3BQRA 3VC4A 4AN9A 4QTEA 3R6XA 3TCAA 4K6ZA 3QC9A 3QQFA 3CQUA 3WZJA 4B99A 4Z7HA 3ZTDA 2VRXA 3Q96A 2QG7A 4EOLA 4FKJA 2R3LA 4C2WA 4ZJVA 4TUUA 3QYWA 4NM3A 4URKA 3TNIA 2DZKA 1XT9B 3ZM4A 5CXZA 4XNEA 4EK5A 3IVFA 1QMZA 3L8PA 4ZDVA 2GFCA 1A5RA 5HKMA 3X23A 2C7MB 1SGHA 4IDVA 4BB4A 4YC3A 1FINA 2LD9A 4M8NA 3U87A 2C1AA 3RCJA 4Z55A 1PMEA 4L45A 3O96A 4NEUA 4D2VA 5KKRB 3NNVA 4S32A 4BCJA 5A4CA 3CPCA 2JF5A 2W9NA 4G6NA 1Y6BA 1IPGA 4FYNA 5CY3A 2WDTB 3DT1A 2QVSE 3OCSA 4FUXA 4L6QA 5JZNA 3PHWB 5IEVA 1KOTA 3EZRA 2GSFA 4EL9A 4KSKC 4KRCA 4V04A 3QUDA 2LAVA 3D0EA 4JQEA 5HI2A 4AN3A 1RLFA 3TJDA 3VBWA 4E6QA 3H7PA 3VS4A 3U6HA 2CCIA 5H9BA 2PE1A 3QRJA 4QP6A 4X21A 4J8MA 4MHAA 4C4GA 4WQOB 2QLQA 2D07B 3QHRA 3LXKA 2AWTA 4K77A 4WWOA 4GIHA 4OTPA 3QIJA 3QU0A 5AUTA 1DI9A 2WO6A 4QP3A 5BPYA 4BKGA 3PWYA 5EDRA 2OWBA 1R39A 4WT6A 3R9HA 3NVKI 5CS6A 4ICVA 3MJ2A 3QWKA 3ERKA 5H2UA 2BYFA 1Y8RC 4W9FA 1PXMA 3F6XA 4TW9A 4W8DA 5AUXA 1OEYA 2BGFA 4OTHA 5EDQA 3RINA 4FEUA 2J0MA 1YXSA 4O0WA 3ML8A 1E8ZA 4G17A 4GB9A 3DKGA 3P9JA 4FX3A 5AJQA 1WR6E 1WY8A 2ZPYA 3QAQA 1UBIA 4YBJA 4MSQB 1H0WA 5IA5A 4CQEA 5HNBA 1L8TA 3QTZA 2LVOA 4GKIA 2MW5A 4FL1A 1S9JA 5JN2A 2KMCA 2YM7A 5EM7A 2C4GA 3OBJA 3TM0A 5JKGA 3R7VA 5J5SA 4AW0A 5EHLA 4DFZE 2J5FA 3IDBA 4ZJIA 3R22A 4F6WA 4FSRA 5AR4A 3HNGA 4AW2A 1RDQE 2VD5A 2PK9A 2W1HA 4I5MA 4CXAA 3CPBA 4RWJA 3FJQE 3QHTA 2MBOA 4R7IA 2YIWA 1GZ8A 2GBMA 2AL3A 3QRIA 3OW3A 4TYGA 4E4NA 1AQ1A 3NY5A 3ZNID 2R64A 4F8CB 3OXTA 4D1ZA 1GZOA 4C4FA 4NQKE 3ET7A 3PUPA 4W4WA 1KV2A 2X0GA 4S30A 4EEVA 4EQUA 4ZSAA 4FT0A 3L16A 1O6LA 2M4NA 3A4RA 3NUPA 3AT2A 5BVEA 1UD7A 4MEMA 4CFNA 1Q8UA 2WAJA 4RMZA 4WJOA 4C61A 3QX1A 4DWFA 1R0EA 3R0TA 4DCAA 5JHAA 2HZ4A 3W10A 3JYAA 1K9AA 2JBOA 4ZIMA 1L7YA 4A3OA 4NJ6A 2YCQA 3UOHA 1UU7A 3EQHA 2CHWA 2KC1A 4PRJA 1DS5A 4QMPA 1JSUA 5TE0A 4JBPA 2IN6A 2X39A 4XP2A 4L00A 4FV6A 5HG8A 4UX9A 3PXZA 4JI9A 3M63B 3DAJA 2W9ZB 2ZMCA 1APME 2X81A 4QMQA 3CE3A 3L17A 5I9UA 1U54A 3IONA 1CTPE 5AWMA 2RR9A 1GAGA 3RGFA 3D7TB 4J7BA 4KUJA 5CLPA 3X0WA 3UIBA 3RVGA 3ZO4A 4IZ5A 4J96A 4NUSA 4OTIA 2CGWA 5HG7A 2X8IA 3H9RA 5JZJA 3CSTA 4M84A 5FDXA 2BUJA 1E1VA 2GS7A 3M11A 4MYGA 5GZ9A 4A3PA 1XO2B 1IG1A 3H3CA 3HMOA 4IWDA 1JPAA 3ZU7A 3ZONA 2GDOA 3JVZX 2YJRA 5ANOA 1Q62A 1V0OA 2XBBC 5IQDA 3OWPA 5C1ZA 2JIIA 3FI4A 5L2TA 2R2PA 1XH6A 1YD8U 2NNWB 4QT1A 4I23A 3OLMD 4BCQA 1M14A 3LZBA 3NNXA 2VAGA 4YPDA 3D15A 3D83A 3IW8A 4C2VA 4F9WA 5AX9A 5BMSA 5BX0A 1BT0A 2BKKA 4O2PA 3PZDA 4DDID 4U3YA 2X6EA 2X9FA 2NS5A 5B0XA 3RNYA 2WQEA 1OBGA 3HUBA 2K8CA 4FOBA 3UOKA 4MAOA 5E4HA 3PJ1A 3TDVA 2JBPA 2BR1A 2JPHA 2CMWA 2PSQA 5HBEA 2PVNA 4YO4A 2MRPA 2PZIA 3GXLA 4HGSA 2C3IB 3P78A 4AZEA 4D2RA 2Y6MA 5AAGA 2XBAA 5LCJA 1WXMA 4PYZA 2EB2A 4CYIA 3DVNV 5A6NA 1PW2A 2I1KA 5IQGA 3IGGA 4LRKA 2XNPA 1OZ1A 4DH8A 5B2MA 2BZIB 4AQCA 4O81A 5CVFA 1TQPA 2PY3A 2VTTA 2W1FA 4FK3A 5FBNC 4FT9A 5HNIX 3F5UA 3TL5A 2LGXA 4BDBA 1RRBA 4QMUA 2ZJDA 1BLXA 4PMMA 2GNIA 3HX4A 1LP4A 2GHGA 4W9CA 2JZZA 1Q3WA 2Z7LA 4RBLA 5HO6A 4BGHA 2RG5A 2JLDA 4O96A 1XBCA 2H6DA 2H96A 3UIUA 3BIZA 1AARA 2WMTA 5IU2A 3ZIMA 4LJPB 2X7GA 4CVAA 3SA0A 2FIFA 1PXOA 5D7VA 3VUGA 2XIXA 4BKZA 4EK8A 2CCHA 1WGYA 4B9KA 4FYOA 3CGFA 3CKWA 4TYIA 4I92A 2I6LA 5AV3A 5LXHA 3UBDA 4WAAA 4CKIA 2R3RA 4ITHA 4XS2A 1LEWA 3G6HA 3E8NA 4ID7A 4GG7A 4C7TA 2WGJA 4E4XA 2RKUA 2JIVA 3PVUA 4M0ZA 4RQVA 4BFMA 2NBVB 3EKNA 4O7SA 3DKCA 3R9NA 5FTGA 4J99A 4UXQA 4GFMA 1XH7A 2WOTA 2Z2WA 3LVPA 3MFSA 4CTCA 4PPCA 4DEIA 2XCKA 4QP7A 2C6IA 4BCPA 3DVNU 1PXLA 2Z7SA 1WX7A 3GU7A 2C6KA 2GNLA 3QXPA 2Z59B 2QC6A 3FY0A 5KKRC 5E6OA 5BYLA 3AD4A 3KGAA 2WXVA 3ODZX 4ANBA 1F9JA 3P2BA 2UZEA 1OKYA 1WGDA 2I0YA 2CKQA 4DH1A 1CM8A 5HU9A 4EZLA 1JKLA 2OJGA 4A4LA 4LFIA 4EQCA 5ETFA 2VWYA 3EB0A 4Q9SA 3DLZA 2KFKA 3B1LX 3Q9YA 5CU4A 2O64A 4D9TA 4NJDA 4NAWB 2F57A 2FSLX 4TL0A 2UW0A 1LFDA 5HIBA 3PJ2A 2Z0DB 5IQHA 5DPVA 3RM6A 2J9MA 4F7LA 3QGWA 3KVFB 4PQNA 3TTIA 4CO7A 3R9RA 4FKGA 4WWNA 3C50A 3U9NA 4EH8A 1KOBA 3U4UA 1OIYA 2MBHA 4IX3A 3R2YA 3LJ2A 5HICA 3V3VA 4HCVA 4MQ1A 3LW0A 5KE0A 5BQ0A 5CU6A 3LMGA 4Q2AA 4A9SA 3PXYA 2JKOA 1LEZA 1CDKA 4C02A 4EYMA 3MI9A 4RQKA 3CGOA 3KF7A 2YDKA 3T9TA 4DLJA 4FKIA 5A54A 2RF9A 3KUCB 4DT9A 3SRVB 4BCKA 4QPMA 4EKLA 2Z8CA 5L6PA 2UZVA 3GENA 4FV9A 4DEGA 4G3XB 4A9UA 1HE8A 2VTHA 5HLWA 2N1VA 5HOAA 4HVBA 2BZHB 3Q32A 4LGGA 2EVAA 3AC4A 1YW2A 3CXWA 4DTKA 4L01A 4YBKA 3TZMA 2V55A 4GV1A 5C4KA 4ZEGA 2HOGA 3EWHA 4BWPA 4AW5A 1XHAA 4ENXA 4YJOA 5M4CA 3PSEB 4FBXA 4I6QA 4RFZA 3A4OX 4FHKA 2JFMA 3CTHA 4FMQA 3SQQA 3TWJA 2UZDA 3ZFYA 3GFEA 2M1MA 4QQCA 1JWHA 3BU3A 4O2ZA 5I9YA 4QD6A 4U42A 4HVIA 1RJBA 3I81A 4GL9A 4G11A 1J7UA 2OLCA 4MK0A 1CMKE 2XKEA 4BI1A 1P1AA 2C7HA 3Q9XA 4FOCA 2XK9A 2CNQA 2B1PA 4ERKA 1R4MI 4M66A 3B8RA 3PG3A 3QC4A 4L42A 1PKGA 1R0PA 4YTFA 3TUCA 5IG1A 2VTMA 2IW8A 5KMJA 2KKCA 3N32A 2UUEA 3BHUA 2XK4A 3LHJA 1XH8A 3ZO2A 4CZTA 2AL6A 5CEMA 4EH5A 4XH6A 5EH0A 2QR8A 4J6IA 2HZIA 3EQRA 4F9YA 1RAXA 4B6LA 5D6JB 1PKDA 1YWVA 2XNGA 4FV2A 3LFEA 3LIJA 3R63A 4FTKA 2BFXA 4OBQA 3V5TA 3W55A 5A4EA 1WJ4A 1ZRZA 5H8EA 5HZNA 2XM9A 1P9DU 4TWCA 5HESA 1TGZB 3L13A 3R01A 3RWQA 2QOQA 5HG9A 3A7GA 4RVLA 4U79A 3C4CA 4AT3A 3CTQA 3MFRA 3FSFA 5DR9A 1JNKA 3LXPA 3WOWA 4DLIA 4OVUA 4U7ZA 5DT0A 3DV3A 5DPTA 2CPKE 2W1IA 3BYVA 5D11A 4FEWA 4CNHA 4KS7A 2DX5B 4GGQA 2XNOA 4C59A 5L83A 3VO3A 3QX2A 5HCXA 4G16A 1KJTA 1R1WA 3UG1A 1T0YA 4EKUA 4WUAA 2PWLA 4M97A 5HGIA 5DI1A 3DDPA 2P55A 2JDVA 2AC3A 1OVEA 3EFJA 3PVGA 2BDFA 4PDOA 4Q5HA 4JQ8A 5C8KA 4MSMB 2HENA 1U54B 5DGZA 4YL8A 4AFJA 2PMIA 3O8PA 3H0ZA 3OOMA 2C6EA 5L2SA 2O5KA 3VF9A 1I35A 1OKZA 3KXHA 3S95A 2DAJA 4YZ9A 3BEGA 3RPSA 3TBLD 3KYCD 3ALBA 1FBNA 3DKFA 2IW9A 3CS9A 2K25A 3CMMB 2PPQA 4JG7A 4DFLA 4GRBA 1FQ1B 3R1NA 4PL3A 2HW6A 4PL4A 3CKXA 3ZLWA 4BHNA 3HUCA 3ULIA 2YERA 4HCNB 4EZ3A 3ENMA 3DBFA 5D94A 2FSMX 4IHPA 5DMZA 3VQIA 3TZ8A 3KXGA 3POOA 4N57A 4RX5A 3ZBXA 3GU5A 3TXOA 5J9YA 5D41A 4RM9A 4DFUA 3C0HA 5GHVA 4UZDA 2I7QA 4C37A 4ONAA 1ZARA 2RFEA 3HK0A 3PLVA 4ACHA 1QPCA 2N9PC 3U4WA 1NW1A 3HGKA 1QZEA 4FTQA 1ZWSA 4FZAB 2W1ZA 3VS5A 4UZHA 5C26A 5CQUA 3PS6A 1GZNA 4YZNA 2MBBB 4FT3A 2GTNA 5D10A 4LRMA 5DR2A 3NIEA 5LVOA 2OIDA 5AV2A 4ZK5A 1SM2A 3R9OA 1L2NA 2BAKA 3HYHA 1SVEA 2BMCA 4G5JA 3L9LA 3R9DA 4FIJA 1J91A 3Q04A 3RBWA 4KVGB 4GMYA 3UZPA 2M17A 1MRUA 4CZYB 3FKOA 3G90X 2WIHA 4K0YA 3WF9A 2JDTA 1VZOA 2IY0B 5FD2A 4ANNA 2YISA 3B0AA 5CHFA 4FTTA 3DKOA 2Q0NA 1U59A 3ORZA 4UMUA 4MJSA 4R3RA 4FI1A 1G6JA 3K9PB 5T68A 3SKCA 4JRVA 3KN5A 4JLCA 3W2CA 1NDDA 2GBRA 3NCZA 3KRXA 2W5AA 2ITQA 2ZDUA 2ZVAA 2CU1A 4X6RA 2IPXA 2OXDA 3V04A 1O9UA 3OHTA 3SHQA 2D3GA 2C7NB 2V0DA 3SDLC 2VZ6A 3KU2A 4ANMA 2OZAB 1WVXA 2K8BA 3LJ0A 4QMOA 2YWVA 4YTHA 5EI6A 5AP2A 4TYHB 2XIZA 3EH9A 3QQJA 5AUZA 1ZOHA 5IUIA 3AGLA 3O51A 4BYIA 1K8RB 4FSQA 3WE8A 4FA6A 3OT3A 4PPBA 2YHVA 1OPLA 1YQJA 3QTXA 5LCKA 3LLAA 4EUUA 3DQXA 2GNHA 2IVUA 2XJ2A 2ZOQA 3OTVA 2F7EE 3PVWA 4HGEA 2F2CB 3C4ZA 3FE3A 4FIIA 4KSQA 2FNJB 2YIYA 2M0XA 3QQ8B 4O91A 3NVMB 2WKMA 3R7EA 1VR2A 3PLSA 4DA5A 1JKSA 3KRLA 1U4DA 2CJMA 1YOMA 3WILA 3GC8A 4GK3A 4C0TA 5AZGA 4EWHA 3NPCA 4TWOA 1H4LA 3FHIA 2VN9A 2R3GA 3L8SA 3QQKA 5I3OA 4FSZA 3Q4UA 4AS0A 4YSJA 1QL6A 3BU5A 3NYOA 4FZ6A 4HPTE 1PY5A 4EUTA 2WYQA 4RJ6A 4O1OA 4EZ7A 4UMQA 4HNFA 3PTFC 2H9VA 3BHVA 5HORA 3NUYA 1OPKA 4I5CA 2I0VA 3TEIA 3H9DA 3FZRA 3ROCA 3HV7A 5LVPA 3ENHA 4C3RA 3UMXA 5E6NA 2R4BA 4YHJA 3G6GA 1SVHA 2JWZA 3OUKA 4ZRKA 5ANDA 3V5QA 4HVHA 4WD5A 4DC2A 3ONSA 1OKVA 1VYZA 3GCQA 1I42A 5BVFA 4A4XA 5AUUA 1JKTA 1V1KA 4AXAA 4M69A 4F0GA 5M51A 3ZUNA 2GMIC 4HDOA 3K5UA 4ZZOA 1E90A 3FYKX 4I1ZA 5EM5A 4B0GA 1GC6A 1OKWA 3UG2A 2X9EA 4P7EA 4MH0E 4B6WA 2HZ0A 3QWJA 5D2MB 4BTMA 1BMKA 4CGAA 1PMNA 2WELA 4D5KA 1F0QA 3VF8A 4QQTA 2KJRA 1H00A 3PSBA 3F61A 4XG8A 1XQQA 2YIQA 2ZVOA 3IG7A 5L95C 3QTRA 4GYGA 4O27B 4L3JA 5CVHA 4FSNA 1SMHA 2EXMA 3ZO3A 2L8JA 4P7IA 4EFOA 4FSYA 4QMZA 3IDCA 4YJRA 5IDNA 4MWHA 4HK2A 5A3XA 4N6ZA 1NI2A 1WBPA 3OT8A 1X1MA 4HCPB 3HRCA 2RG6A 4CSVA 5L2WA 5EFQA 1WXSA 3CJGA 5AV0A 4M7IA 4MXZA 4ZLZA 3TUBA 3TIYA 2KHWB 3BHTA 3NZ0A 2QURA 3O7LD 1MQ4A 4ZY5A 2JZ3B 4E93A 4AJWA 3TKIA 4CKRA 3RKBA 4I3ZA 2XKDA 3E7VA 3TACA 4FV4A 2G4SA 4K81A 3ZM9A 4UYNA 3MTLA 2O2VB 2X2KA 3I5ZA 4GK4A 4IJPA 1UWJA 3VNTA 4C4JA 3F66A 3GT8A 4FR4A 5JT2A 4O0YA 4W4XA 3ULZA 5DRDA 3POZA 5AMNA 4BCGA 4CFXA 5I5ZA 4DHJD 2IG7A 4LGHA 4K1BA 4BDAA 3N3KB 3NW6A 3E3BX 3HKOA 2PVRA 4RIXA 4WHZA 5JRQA 3I3TB 3DXQA 3K2LA 3LFQA 4HNIA 4FL3A 1VCBA 4BHZA 2RD0A 2G01A 3N4TA 5IQAA 3WAMA 5FP5A 4DGNA 1YHVA 1LR4A 3BGQA 1KOAA 2B52A 2FCSA 3MS9A 4RIWA 3ZO5B 1PF8A 2PL0A 4EK3A 2ZYBA 3KMWA 4RLKA 2ZVNA 4FF8A 5CENA 3UVPA 1JBPE 3QTIA 1W0XC 2C3JA 3QCYA 1E5WA 3TNPC 2JIUA 3WARA 2WQOA 4BIDA 2QQ7A 2Y4IB 3KA0A 2IW6A 4JAJA 3WZKA 4B8LA 4M0YA 1WGHA 3UOJA 3COIA 3DB8A 4DGGA 3ECIA 4MDKE 3AU5A 2FUMA 3RJCA 5HE0A 2K6QA 4OTGA 3BU6A 3FL5A 2Y0AA 3MWUA 4OTQA 3PY1A 4R3CA 4ZS0A 1YHWA 5FBOA 3QZIA 2CLQA 3ZEWA 3L9PA 1SYKA 1VEBA 3QQUA 4HZSA 4BDDA 4CEGA 5JMSA 4OUCA 4WSQA 4UN0C 2N9EB 4I6PA 1ZYCA 4BKTA 3QJZA 1W98A 3L8XA 1RW8A 2YA9A 3EKKA 5BVWA 2BKFA 4DK5A 5CF5A 4UV0A 2Z0EB 4CFWA 3FHRA 3UNKA 3BRBA 2KDFB 2Y5BB 3RT3B 2BCJA 3GU4A 4FNYA 3FMHA 4I24A 4WNMA 4DAWA 3I79A 3DDQA 5F95A 4DE4A 2QO2A 4G9RA 4OAVB 5EDSA 4S33A 4RJ8A 4Y5QA 2WD1A 3LQ8A 3QGYA 2NPTA 3BE2A 3MH3A 3OXZA 4O0XA 4CYJA 1J7IA 2OJ9A 1ZYSA 4O7NA 1OUKA 2I1MA 2XKCA 3G9LX 3LOKA 2IVTA 3NLBA 4LG4A 4YHTA 5K0XA 5DPWA 2G2FA 2XRWA 4JNWA 4F9BA 2DYMA 1UU9A 4BI0A 4RSSA 1JRUA 1AGWA 5F9EA 3LQ5A 5FQDC 3N4UA 2UV2A 4ZY6A 1B38A 4BGQA 4O7VA 4GDKB 1ZYJA 5D12A 2V5QA 1GJZA 5G6VA 3ALNA 5DN3A 5IUGA 4MEDA 3OD6X 2YJSA 4JDKA 1OL1A 2UWQA 5EW3A 3ZRCA 4FC0A 5M07A 4IC7B 5JEBA 2IZRA 1PXPA 3TKHA 3DVGY 5EQYA 3U55A 4HCUA 2PE9A 3DCGA 4GEOA 3ZBFA 1H1RA 3KMMA 1IP9A 5M4IA 4WA9A 2UW6A 1FXTB 4PF4A 1W83A 3MVJA 2W05A 1TKIA 4NZWB 3SG9A 4FV8A 3R8PA 2MP2B 4IX5A 5EHYA 2UZWE 3H30A 5LQFA 4FN2A 3NDMA 2WEVA 4WSYA 4PX6A 4RRVA 3QK0A 3P0MA 1UGMA 5AA8A 4RT7A 2FO0A 2YCFA 1OTRB 4J8NA 2V4LA 3BBTB 3BV3A 5I9VA 4FKUA 2WMSA 4WJNA 4W9IA 3SV0A 5L8LA 3REPA 5K4IA 3M95A 3GOEA 1XWSA 4R7BA 3O0GA 5HQ0A 3UO6A 3RAKA 3VH4B 2ONLC 4IW0A 3T8OA 4BCOA 4NW5A 1F3MC 4YGAA 4ZMEA 3JVSA 3GQLA 5HTIA 3FDNA 2D11A 3KW5B 3UIOB 3HECA 5CTRC 4BF2A 1WMKA 3L0WB 1FVRA 1P5EA 4HGLA 4IVCA 4HPLB 1BUHA 5T6KA 2WEIA 3LCTA 4Y5HA 3MPMA 3LFSA 3AGMA 4DN5A 4DGOA 3LFBA 5L8KA 4XG6A 2VWWA 4J95A 3KF4A 3BGPA 5DHJA 4B7TA 4D5HA 3E8DA 1Q3DA 2WIPA 5IA4A 4DTAA 2OICA 4EOYA 4Z3VA 3E3PA 2BVAA 4IDTA 4MWIA 3PJCA 3R1SA 4X6QC 2XIRA 5FGKA 5HLPA 4AOTA 4XX5A 4IANA 3FZOA 3ORKA 3OP5A 3AI5A 2HW7A 3T8MA 1YI6A 3GP0A 4EZ5A 2BWES 3D4QA 4RIYA 4KKEA 3IECA 3A60A 4DEBA 1GNUA 4DF3A 2YM8A 3KXXA 2E9NA 2QONA 4CQGA 5J5TA 4GIIA 3CY3A 3KXNA 3TL8A 5BVDA 5EKNA 3ZFMA 2YM4A 4QQ5A 1OB3A 4FEVA 3VQUA 2NBUA 4IVAA 2WTCA 2L7RA 3NUSA 2E2BA 5TT7A 3VVWB 4CRLA 3AMAA 3IKAA 1OL7A 2IZUA 2W5BA 3DK7A 3R8VA 4AE9A 5I9ZA 5AIRA 5LWMA 3A9JB 4NQLB 2PZPA 5CX9A 5E90A 4MGZE 2BZKB 2QOOA 1WGRA 2E9UA 2VTAA 5DT4A 3IK3A 3PFQA 1LUFA 3DTWA 3HDMA 3II5A 4ZTSA 3RCZA 4TXCA 3TJCA 3SD0A 3OAWA 3VWAA 4L3LA 2J0LA 2OOBB 3TMPB 4DBGA 1Q99A 4R3PA 4G6OA 4OT6A 4B9DA 4TKNA 3Q60A 5AZHA 1ZYDA 3GGFA 1WBTA 4CHKA 2KANA 4QP8A 4I6FA 4RJ3A 2G9XA 4AGDA 1WBOA 1Q1OA 3OTUA 1BYGA 4IUMB 1WMHA 4PMSA 3ENEA 4MGKE 4D2SA 4XG3A 4ZTMA 2M8SA 3O65B 2AUHA 2RFNA 5HU3A 4F0FA 4GG5A 2R5TA 1FOTA 4N0SA 2XYNA 3VHEA 3RI1A 4TYHA 2YM6A 4L43A 4FEQA 4ALWA 3D32A 3QALE 4RFMA 4OT5A 5FG8A 1J7LA 3UVQA 5L6OA 4FNWA 1G5SA 3MW1A 4OGRA 2NRYA 4O0SA 3EN7A 4UALA 5EYMA 3PPJA 3ZYAA 4EHVA 1GJOA 3HV3A 3NYXA 4D2PA 4D55A 3DBDA 3F5XA 4EOOA 4MVFA 3ZC5A 4M67A 4CG9A 3W32A 5LLIA 3FBVA 1Z57A 4QYYA 4RC2A 5G1XA 4ACGA 1DAYA 4L3PA 5ANKA 1Q97A 2IWIA 2CDZA 5L2QA 4YLLA 5AM7A 5E7RA 5HD7A 3ZUTA 2DZMA 5JQ5A 4YZDA 4XZ4A 4MKCA 5DPSA 5JH5C 3FSKA 4E73A 1KSWA 2KTFA 2A5UA 2JT4B 5BYZA 4JL9A 4II3B 4N6YA 4GSWA 4B95A 3MH1A 4BBEA 2GBNA 1H26A 2QO7A 2R3NA 3LLTA 3OROA 3QRTA 4FL2A 4MM3A 1OIUA 2B9IA 1AD5A 3PP0A 3PZEA 4XYFA 2I0HA 4XRLA 4WJQA 5AM6A 3QYZA 3VAWA 2C5OA 5IA0A 4U80A 4EOKA 2HAKA 4DH5A 5I4NA 4ENYA 4FADA 2ITZA 2R3HA 3QTWA 3DPDA 2ZNVB 4DHFA 5CF6A 2IVSA 1KE6A 2YDJA 5HVKA 5CHWA 3P4KA 3CD8A 1YXXA 5J18A 3U8WA 3RMFA 1J3HA 4BDEA 5FRIA 2YABA 3C0GA 4X3FA 3ORXA 5B2KA 3TTJA 5CAVA 4IAYA 2IJMA 1QPEA 2R0IA 3DNEA 4MNEB 3ML9A 3IW4A 1MRYA 3N30A 3I7BA 4IQ6A 3QLFA 2DQ7X 3ZTXA 3DS6A 2W17A 4NSTA 3ZRKA 3V6EB 3VHTC 4O0UA 1URWA 5D9HA 3W1FA 3UO4A 3K9OB 2PMOX 2HWOA 3P7CA 5CI6A 2H34A 3RAHA 3ATSA 1YI4A 2JC6A 3A7HA 4PDSA 5GJDA 4AP7A 4ACDA 5KHXA 4FTMA 3D5UA 2PE2A 2FCQA 2V62A 2BIYA 4M12A 4XOZA 2PPHA 4EH9A 3BELA 1YVJA 3TG1A 5HTCA 4LM5A 2ONLA 2XF0A 3W1YA 3MSSA 4K33A 3QA8A 4ANUA 1M7NA 4JVGA 4YJPA 2WX1A 3KEXA 2E9VA 4FJZA 5TKDA 2LJ5A 3U7DA 4GCJA 2QOFA 4PWNA 2B0QA 2X2LA 2F7ZE 2VO3A 5DWRA 5J7HA 1V2YA 1H1WA 4OBOA 2UZBA 2VWIA 2W7XA 2XK6A 3NS9A 3OCBA 3BLQA 3VUMA 2OFVA 1TQIA 4C62A 4FKPA 2VWVA 3FMNA 3PDTA 2ZZPB 5LJJA 4L7FA 2KX0A 3UQCA 3RD2A 5AFVA 2AC5A 3V61A 2BTRA 4DG3E 5CF4A 4JXFA 4RG0A 4TZRA 4E26A 2QR7A 2GNFA 2VGPA 4EHZA 1O6KA 4JR3A 4I6NB 4JIOU 3PA3A 5A6OA 4UMRA 5K5XA 3DA6A 3M42A 4MBJA 1OL6A 2IY1B 2WMXA 4IC7A 3R7OA 4A7CA 4FODA 1U4AA 3DBRI 4BOSC 4JRNA 3Q53A 4K8AA 1W82A 3ACJA 3KVWA 4RIWB 5EI8A 4E4MA 5CEOA 1E8WA 4K7UA 3VUXA 2BRBA 1ZY5A 2R3OA 3MA6A 2ITYA 4IIRA 5A14A 5IQEA 3EQGA 1XBBA 2I0EA 1XJDA 4M68A 4BI2A 5CALA 3UP7A 1Q61A 3EQIA 4PUZA 4EZKA 3EL8A 1CKIA 3FZPA 3V51A 5CX3A 1IA8A 2YDIA 5EKOA 5HX8A 2JVCA 3NCGA 4WG4A 3VQHA 2MQJA 2FSTX 2WTIA 5KMMA 5IF1A 5HCZA 4EYJA 3A1QB 4IE9A 2JRIB 3IO7A 3UQGA 4DBNA 5CSVA 2CLXA 4ZRJA 1HCKA 3DXNA 4FTCA 3NGAA 5ACBC 4EBVA 4MX9A 1TVOA 2BKZA 1E9HA 2QOCA 3F2AA 1PYXA 3FZTA 4QOXA 4RWLA 4XV2A 3ODYX 3ORIA 4ASDA 5M57A 1GC7A 4YP8A 5AP3A 3IFWB 3ZW3A 3CIKA 4B4LA 3QHWA 3V6CB 3DB6A 2HY0A 4CT2A 4DFYA 4DDGD 2VGOA 5H8GA 2OXYA 3C13A 2WOUA 2YACA 3SLSA 2V7AA 1OITA 2ASQA 3LCKA 2DYOA 2ERKA 4ZTNA 2HYYA 5HE3A 2GU8A 3R7IA 4C4HA 1K3AA 3LM5A 2EKEC 4OAUC 3TDWA 2JKMA 2GS6A 4HYSA 3FYJX 2UW9A 5HVYA 1WXVA 5EOLA 3C0RB 1JSVA 1Y91A 1OL2A 5AIKA 2DWBA 2VNYA 2F7XE 2HXLA 5EHOA 4AA4A 4K7SA 3V8SA 4JGHB 1BX6A 3BHHA 1WE6A 2JAMA 3F3ZA 4W9GA 5CEKA 2PUNA 3R7GA 5LVLA 4F70A 1V81A 5DVRA 4Y73A 1J0GA 5DCNA 3CSVA 2BFYA 4O86A 5CSHA 1P4OA 4UB7A 4IADA 3LE6A 3VW6A 3GCSA 5EYKA 3DXPA 3VJOA 4BZDA 3TKUA 4IB1A 3OBGA 4RA5A 2CHZA 5H3QA 4K7WA 5IMXA 3R2BA 3FQSA 4GDKA 5AV4A 3DBSA 5FM3A 3FQHA 4C33A 5EW8A 5J2RA 4G3DA 5GZ8A 5AP7A 3T9LA 1G8SA 3THBA 5FUTA 5CT7A 3MIAA 5EYDA 3SW7A 3MH2A 1UKHA 4TV3A 3OMVA 4AZFA 4RVKA 2WQBA 3ZFXA 2QD9A 3C4EA 3OUNB 4IH8A 4QRCA 4EONA 5IQCA 4QMNA 3JXWA 4O1PA 2R3QA 1UA2A 1KE7A 4RPVA 3GI3A 4W4YA 4ASWC 4QMMA 4I4FA 2ETRA 3PT2B 4ZJJA 3QC8B 2B9HA 4RVTA 3MVHA 3RAIA 1UNGA 3CY2A 4ZS4A 4GT4A 5DT3A 1WZ0A 4LMUA 1J1CA 3FMDA 2NPQA 3BYSA 3UF8A 1TTNA 3VJNA 3Q2JA 3C4XA 3NUUA 2J7TA 3FV8A 4LUEA 4FVPA 4JOAA 3BLHA 4O0RA 3BV2A 4AZSA 2YITA 4YNOA 2KWCA 4FVRA 3VW8A 3PP1A 1V80A 2MSED 1IASA 2QO9A 2RFSA 3TZ7A 4GK2A 4NKSA 2O6VB 5HNGA 4EHEA 4YZMA 1WMHB 4NCTC 4KV2A 3GCUA 2R3FA 3I60A 3VS0A 5EM6A 3U51A 4FT5A 3U6IA 4C38A 4DH7A 5DIAA 3E87A 4GS6A 5LMKC 5J1WA 2Y4PA 4ANXA 1ND4A 4QYHA 4EK4A 1K2PA 3WBLA 2JDSA 3NRMA 4BZOA 3UE4A 4C3PA 3OCTA 3F3WA 5F1ZA 3HIZA 4DHZE 3QUEA 1H24A 2VNWA 3EYHA 4BL1A 4TYEA 3PTGA 2DENB 2LZ6A 3F88A 3VS6A 3RULA 3DJ7A 2CGXA 4Q5EA 5GINE 1KE9A 1NBFC 3AT3A 3ZCLA 1ZOGA 2A0CX 3JUHA 2P3GX 4O0VA 4APPA 2VRRB 4AX8A 2R7IA 3RTPA 3WF8A 4U5JA 2CGUA 1WBNA 4O7LA 4G3GA 3PLAE 2IBIB 2F2UA 4WNOA 5CZIA 3QD0A 5AP0A 5IAAC 2QLUA 4P90A 3KB7A 2BILB 3E63A 1UZXB 4H1MA 1L3RE 4MD8E 3QA0A 4Y8DA 4I93A 3RPVA 3WZUA 5C8NA 3WANA 5TR6A 1U46A 1UVRA 4GXBA 4R7HA 3MTFA 2YN8A 2X4FA 4PTEA 3Q6UA 2UZOA 3DDCB 3LMIA 4ZRIA 3VTUA 4ALUA 2OF2A 3KREA 2XK7A 1URCA 3CD3A 2WU6A 4FZ7A 1BI7A 4W8EA 3PHXB 4GFGA 4HJOA 4FTLA 1WVYA 4LUDA 3AC2A 3MY1A 2KOXA 4I6LB 4O7WA 4QMVA 3ZLZA 4ANVA 4PDPA 4UWYA 4PP7A 4DEEA 2EMSA 4M3QA 5IQFA 4HOKA 4MNEA 4KIOA 2QNJA 4GUBA 2XP2A 4K18A 4DITA 4ALVA 3UC3A 3F3TA 4RX8A 3RAWA 3PE1A 5CVGA 3ZEPA 2WX0A 4IBMA 3DQWA 4RMAA 5JZEB 2BROA 4GDLA 3I6UA 2KC2A 2JDRA 1KLVA 4OBPA 2C60A 3IW6A 4V01A 4ANWA 4LL5A 3UINB 3DOWA 1MP8A 5HE1A 3OW4A 1OGWA 4A9TA 4M0WB 3U30A 3OJ4B 2BDJA 1JOWB 3LCDA 2Z60A 3NS8A 2ITVA 1CSNA 2AYPA 3P1AA 4Y72A 3MY5A 2EXEA 3BCEA 3UTOA 1IR3A 4BZNA 1VD2A 5HTBA 1NA7A 1P4FA 3AC3A 3KULB 4OTRA 3UVRA 3VUIA 4QP4A 1E7UA 1M94A 2KWVB 4UYAA 5K5NA 4E4LA 2J0MB 4PPAA 4QTDA 5IMEA 1OIRA 2Q0BA 4YSMA 3WAOA 1BI8A 5HKHA 3PIYA 4AWIA 3TJPA 2PUUA 2WQNA 4JBVA 3H7SA 4BKSD 4ZP5A 2PZRA 4PNKA 3GB2A 1WF9A 2JUOA 4FSWA 4G31A 3A8XA 3Q4CA 3IG3A 5E8VA 3C1XA 3D5WA 4RIOA 4AT4A 4E6DA 5JGAA 1TZ1A 3S2AA 2KTYA 3D7ZA 1CKPA 3L8VA 4JIKA 3MJWA 3RNIA 3V5LA 1OPJA 1KUTA 4AG8A 5EG3A 3WA0A 3Q4TA 1XQZA 2NRUA 2QI8A 3I7CA 3A7JA 5CWZA 2L0TA 4D28A 5I9WA 2HXQA 5D1JA 4FICA 4M69B 5IKWA 2XEWA 3FLQA 4GW8A 4W4VA 4LV5A 4XP0A 3EECA 2C6LA 3VFKA 4PY1A 4FUYA 2KTRB 1ZYLA 2B4SB 2PVFA 4PS7A 1GUAB 3W2PA 4HJKA 5JQ8A 4JX7A 4RVMA 3GC9A 2B54A 4IWQA 4FTUA 1CMXB 4YHFA 3C0IA 2ZM3A 3O23A 3P23A 4KAOA 4X2JA 5AR3A 3PE2A 2ITUA 4AU8A 4QMLA 2XCHA 1G3NA 3LFNA 4LI5A 1STCE 4X7QA 4CG8A 3P7BA 4GU9A 3Q2MA 3IW7A 4PMTA 4TQ1A 1H8FA 1Y6AA 1YXUA 5GNKA 4ZLOA 3F82A 4TYJA 4BCFA 3RALA 2HZNA 1UU8A 4BTKA 4HDQA 4EOMA 2R3IA 2PUIA 5CHVC 1B39A 3KY2A 4BKYA 2RPQA 4KSPA 3A33B 4TY1A 4DHZB 2OGVA 5J95A 2BPMA 2XNBA 4D0WA 4FHJA 2O2VA 4DH3A 5TR5A 2IZVB 2FYSA 1H1QA 2W4OA 5EM8A 3VBXA 1F5QA 5EQPA 1JLUE 4NIFB 4JBQA 2QCSA 3ZUVA 2VO6A 5CU2A 3W2SA 4DCEA 2LASA 2PMLX 4PV0A 5M55A 3FLZA 3LFFA 3EFKA 4J97A 1PMVA 4MXOA 4BGGA 3QKLA 2YWPA 4C3FA 1R78A 3EHAA 3EHVA 3VUDA 5J17A 5HO8A 4EH7A 2B55A 3P08A 5HE2A 5C9CA 1H4RA 1V5OA 5CAUA 4JR7A 1M17A 2J5EA 3HMIA 3PY3A 2W1CA 4RA4A 3EN5A 4G9CA 3V6RA 3Q3BA 4MXAA 2C3LA 2WU7A 4M8TA 3KXZA 3ZXTA 4DEHA 4F1MA 3NX8A 4X2FA 2J7QB 4IM2A 1YHSA 2PUPA 2ITTA 2Q83A 2HK5A 2OK1A 4D4SA 2ZB0A 3LM0A 2XA4A 3FZ1A 4DGMA 5L8JA 4X3JA 5KBRA 2DS1A 4ZMFA 2QG5A 2QOIA 3MJ1A 4O7YA 4GVJA 4FSTA 3GC7A 4DFBA 3DZOA 3FY2A 3H7PB 4JG8A 5BNJA 2C9WB 2OXXA 4UMPA 5CSXA 3NSZA 4L9IA 4YJSA 3VS1A 4CFMA 2KLCA 2BTSA 1YDRE 1YX6B 2XK5A 4WBOA 4BWXA 1WGGA 3T9IA 4S31A 2A4LA 2WFYA 2WPAA 2UW7A 3LJ1A 3C51A 4BCHA 2ZV9A 3A1QA 4KSLC 5FTOA 4QPAA 3G51A 2A2AA 3ZDUA 4X0MA 3L08A 3UQAA 4F63A 1PYEA 3R02A 2O6VA 4XX9A 3NHEB 4ZTQA 4IACA 4FJYA 4I0SA 4KS8A 3FWQA 3MB6A 5D7AA 4APCA 3OEFX 5DA3A 2W1DA 3L9NA 3B2TA 1KE5A 2QODA 5CNNA 4AA0A 4BTJA 3OY1A 1OM1A 3DBEA 4YJTA 5EK7A 4E6CA 3GC0A 2UW3A 3PJ8A 3UO5A 2OW3A 3SG8A 4EBWA 1W7HA 2A19B 2C3KA 3PXKA 2VTIA 4CV9A 5DR6A 4AAAA 2I40A 3FZSA 4J71A 4YC8A 3A61A 4IWOA 2ZDTA 3SVVA 2G15A 3ACKA 1BL6A 3MFUA 2C69A 3ZMMA 3UQBA 4FNZA 4AT5A 3FXXA 1GIHA 3BYMA 4JS8A 3RHKA 4H05A 2IO3B 3NYVA 3UIMA 5CQWA 3MPTA 4MF1A 4EH4A 3KYDD 1RE8A 5CAQA 2D2QA 4RC3A 2G3QB 1W8CA 3QZFA 1WYWB 4I6BA 2CN5A 4BBFA 1E8YA 4WNKA 4Y83A 3W18A 4AOJA 4E7WA 5KBQA 2YFXA 4K11A 5I9XA 3V01A 3ZSIA 2CS4A 3DJ6A 5CZHA 3GEQA 3CC6A 3PJ3A 4ITJA 2OFUA 1M2RA 2YZAA 4EOQA 2XJ1A 4XBRA 1UELA 4X2GA 3R66C 1D3ZA 3DAKA 2CNUA 4BWKA 3V8WA 2V22A 2J0KA 2C1BA 2VWBA 1LQBA 2MX2A 4NAWA 1ZAOA 4GYIA 5B7VA 5BUIA 2MWSB 4AW1A 4FG9A 3NEWA 3U54A 3RPYA 3ZH8A 3EMGA 4IAIA 4KD1A 1FVVA 4BCIA 2LWPA 2PJHA 3ZLSA 2VTJA 3HAMA 1OGUA 4PTGA 5IISA 3RZFA 2BKRB 3QD4A 3ANRA 3QZGA 2CKEA 4GVAA 4PP9A 2NO3A 2SRCA 5JFXA 1Q0WB 2DYBA 2FVDA 3JY0A 2PYWA 3HMMA 4IFCA 4XC2A 4IB0A 4JDHA 4AACA 2VX1A 4QNYA 2ZCCA 2PULA 3BX5A 3R7YA 3TNWA 4FGRA 3KK9A 3CEKA 3VRZA 2GQGA 1G8AA 5J79A 1I09A 1Y57A 3BHYA 5EW9A 2K1FA 5E8XA 1H07A 3NMUF 3JY9A 4YLKA 3AMBA 1X8BA 4H39A 5TF9A 5IH4A 2BPSA 4NM5A 2JDOA 5F4NA 2OF4A 3H9FA 2IO6A 3KVXA 4EOIA 1M2QA 2PZYA 5LMBA 2KK8A 3GZNI 2XNMA 2VTPA 2C6TA 3OS3A 4M14A 4BC6A 2N7EA 3NWWA 3AQVA 3TIZA 4JX3A 5J7BA 1GOLA 2WTKB 4E6AA 3W2RA 5IA2A 3FQEA 3RM7A 3VXWA 4IC8A 5HD4A 3WALA 1SZMA 4TTHB 4OR5A 4NU1A 1FGIA 1Y8YA 4K9YA 2N9XA 1ZMWA 4E1ZA 2UZTA 4QMSA 3U6JA 4MGIE 4L68A 3PRMB 3FPMA 5KUPA 3EN4A 3QFVA 4F64A 4WWPA 3SC1A 1HOWA 3S4QA 4GT3A 4QP1A 4A9RA 3A7IA 3E8EA 3RUIB 1E1XA 4FLHA 4A20A 4G6LA 3TV7A 2OH0E 3H4JA 4G3EA 4EORA 3KUZA 2LGYA 3KQ7A 4YZCA 4W9WA 3VH3B 2CSNA 3M2WA 2IO1B 4ZY4A 4XLVA 3TI1A 2WTVA 5CEIA 4HPUE 2YAAA 3E92A 3G0EA 3ZHPC 2KQSA 3AXWA 3OCGA 2ETKA 2GTMA 2UVZA 5LMAA 3UP2A 2XEYA 3BY4B 3TNHA 2WTKC 3EZVA 3UNZA 4PS3A 4DFXE 3VDZA 4D9UA 4FSMA 4OTDA 4WKQA 1GY3A 5IQBA 1NT2A 1V49A 5EYCA 4KABA 2X2MA 3IS5A 5J9LA 3SU8X 4I4EA 2VO0A 4JAIA 4FKQA 3FPQA 5AP1A 3ZS5A 4I0RA 4L46A 4CFFA 5GMVA 3P5KA 2CNVA 4BBMA 3COKA 4KBCA 4NTTA 5EI2A 3UC4A 4IVDA 3FAAA 2PMNX 2VTNA 4O6EA 5M53A 5FR6A 3UYSA 3HHMA 3K3JA 5EOBA 5AZFA 3IPHA 4MF0A 3QQHA 1BKXA 2VTOA 2DYLA 3OY3A 3RZBA 2YLEA 4E5BA 4IX4A 2A27A 5IUHA 3PVBA 4YC6A 2UW4A 3V8TA 5HBJA 2AYOB 3GBZA 3RK9A 3MY0A 3ZLYA 2IO2B 3AULA 4HYIA 2CKOA 1OBDA 1XR1A 3E64A 1KV1A 2LRWA 3GCPA 5FM2A 3FKLA 2WMAA 1H28A 1PMUA 4TN6A 3I4BA 3C9WA 5GJGA 3NZSA 5ANEA 2HY81 2J6MA 2R3MA 4YPSA 5AR2A 4DYMA 5KX8A 3QL8A 3O2MA 3OG7A 2FIDA 4R5YA 1V0PA 3EQCA 3E5AA 3NW5A 3A4SC 1IYFA 3PPZA 5FXSA 5FDPA 1O6YA 4EKKA 1WJUA 2ZEQA 2WHBA 3UIPB 2OZOA 2J51A 3LXLA 3FXZA 4Y46A 4E3CA 1M52A 4YNEA 4MELA 3WIMA 3IGOA 3SAYA 2EMTA 4BDGA 5E8YA 5I0BA 2HD5B 5E6PA 2EU9A 3OVVA 3ALOA 4KIKB 3KKVA 5L3AA 4PYUA 4G34A 4RC4A 1IAJA 4L44A 3SDJA 1MUOA 2V3SA 4HYUA 2WB8A 4I41A 2C6MA 4UXLA 3FC2A 3TT0A 3VN9A 3VRYA 5IZFA 1KWPA 5KMOA 4EEWA 3FMKA 2OJJA 4ACMA 5FEQA 2OJIA 4IZ7A 2XK5B 3DTCA 3EQPA 4KB8A 3E88A 1Q41A 2X8DA 3K54A 4X3FB 5AP6A 2R3KA 5KMLA 3O8TA 5FLFA 5KHWA 5LOHA 5M56A 3QCSA 3KN6A 3LPBA 5JFVA 2R2OA 4YTCA 2GS2A 5BUEA 2KTRA 2NCNA 3NZUA 4ANLA 1OQYA 3LKMA 2XH5A 4EHGA 4E5WA 1UBQA 2HCKA 2GNJA 5DYJA 3UPZA 2WNTA 4MBIA 1V5TA 4BVUA 5JFWA 3ZOSA 1WFYA 3TCPA 1OEYJ 2J90A 1P3QU 4C4IA 2VX0A 4NNJB 4E5AX 4O7RA 4DT8A 4C58A 4P5QA 4GKHA 3RHXA 4W9KA 4CV8A 3HLLA 2BZJA 3A8WA 4FKSA 4FTAA 5LARA 2Y6OA 4S34A 3PXRA 1H1SA 2VTRA 3CJFA 5FEEA 3PLUA 4FJVB 2ESMA 1JAMA 3MN3A 4F1TA 1V6EA 3RZWC 1WIAA 2YLMA 2JKQA 2UZUE 4R6VA 4U45A 3GOPA 2RSUA 4XG2A 3I6WA 2B3AA 4I21A 2X7FA 2OZAA 3CTJA 1H01A 2PVYA 2RL5A 1H25A 3VAPA 5HVJA 3TZ9A 4ZSGA 3D14A 4YU2A 5JK3A 2VO7A 5L2IA 4KZCA 1ZXEA 3S2PA 4E8AA 4PMPA 2GFSA 5CU3A 4QO9A 3VHKA 3VS2A 2C5VA 1YWNA 1R4NI 4R78A 5GZAA 4CMOA 3OZ6A 4R77A 3T3UA 1MRVA 4XG4A 5IA3A 2QKWB 5JH6A 1NY3A 4EQMA 4FKOA 5G55A 4D4RA 2XM8A 5E1EA 4AGWA 1WFCA 1YJ1A 2ZPNA 4JIAA 3FKNA 4NFMA 4DEAA 4IX6A 4NH1A 4IAFA 2XIKA 4LJOB 2GHMA 4TQ0A 3PIZA 3F3UA 1JSTA 4NTSA 4RZWA 4ZZNA 4PS8A 4F1SA 3PXFA 1IA9A 2O63A 4TNDA 4CTBA 4NJ3A 4KBAA 4FKLA 5F20A 4DBXA 3PRFA 4P2KA 5AEPA 5E92A 2WTWA 4DGLC 1I44A 2YEXA 3VBTA 3DAEA 3Q4ZA 3QAME 4X57B 4JG6A 3D5XA 3DK3A 5KMNA 5J9ZA 2BAJA 2FA2A 4BCMA 1ZW7A 3HM6X 3ZNZB 1YRPA 4IMYA 2WQMA 4IG7B 3SXRA 4BDJA 4YMJA 3ZC6A 3L1SA 5E8TA 3BE9A 4X2KA 5BYYA 1ERKA 3JW0X 1A9UA 2ACXA 2PVMA 2UW8A 3R71A 4L53A 5KZIA 3S3IA 5KMKA 2JGZA 2G1TA 3FMMA 3VBYA 2OKRA 4BIEA 2F9GA 5J8IA 4U8ZA 3CP9A 4HXDA 3QCXA 5E91A 5KCVA 2UW5A 3WIKA 1ZKHA 2KXJA 3W1SC 1Q24A 3DBLI 2WMWA 2OO8X 4KKGA 1A06A 4AZTA 3F5GA 5HEZA 2KFJA 4O21A 4AOIA 2C30A 2C68A 4FZDB 1UU3A 5F94A 2MA9B 3WF7A 1Z2MA 4HPMB 2OG8A 5FTQA 3PA5A 4NFNA 5KZ0A 2O65A 3NR9A 3QKKA 3GNIB 4DG0E 1FMOE 2R7BA 4XV3A 2WZJA 5C03A 3ORPA 4U6RA 4A06A 4A07A 2OU7A 2UVYA 4KIPA 3PXQA 4U9AA 1KE8A 1ZGUB 3DBCA 4BDFA 4JJRA 5IDPA 2YIXA 5JRSA 5J87A 2X1NA 4MXCA 5FXQA 2O2UA 3WYYA 1EF1A 2DZJA 2HTHA 2NBWB 3AXCA 3QARA 1C3TA 4Y85A 2PE0A 4UBAA 4UWBA 3EIDA 5C01A 2P4IA 5CU0A 5E8SA 3R3MA 4HW7A 2GMXA 3O50A 3MDYA 2ITXA 3P86A 4W9LA 3SX9A 3IOKA 4WJPA 2DZIA 4D4VA 3TN8A 1S1QB 3SHEA 2EB3A 3A99A 2XUUA 3HA8A 4USDA 4XOYA 4A9YA 2XBJA 2J4ZA 3F7ZA 1YOJA 2REIA 2WMRA 1PQSA 3L9MA 4FZFB 4GFOA 4TRLA 5HX6A 3FXWA 3UNJA 3C7QA 5JSMA 3PA4A 4DHJB 5FEDA 2NVUI 1YXTA 2PZ5A 5CF8A 1J8CA 1LM8B 3FI8A 4U0IA 3FL4A 4G50A 2BIKB 3CR0A 4K2RA 3HDNA 3S0OA 2N1WA 3HA6A 4BDCA 3AD5A 2V7OA 5EQEA 2KULA 3EFLA 4HVDA 4F7ZA 3ZNGC 3KL8A 3O7LB 2WMQA 1E8XA 4A4OA 3WIGA 4F08A 4GU2A 5AV1A 2ITPA 1VYWA 4LL0A 3PREA 4QPSA 4CLJA 5KO1A 1MQBA 1UNLA 4DINA 2RSVA 2YM5A 3I0QA 4JQ7A 4FEXA 5G2NA 4F09A 4FE2A 4ZOGA 4CZUA 1UNHA 4I6HA 4BKJA 5LWNA 3UIXA 2HE7A 2JRHA 3KH0A 2CN8A 4WBBB 3WI6A 4AA5A 2KVRA 1JVPP 3EL7A 3KC3A 4NK9A 3LFAA 1HCLA 3NUNA 1T46A 4V0GA 2JAVA 3R7UA 3VUKA 3ZLXA 4R1VA 2N4FA 5CT0A 5AX3A 5DH3A 3HM3A 3P79A 3QTSA 3OOGA 3CCNA 4HVSA 3Q52A 2FB8A 3CLYA 5AR8A 1W84A 4LOQA 2JEDA 3Q6WA 4G2FA 1C1YB 3DVGX 1XH5A 2W4JA 3PZHA 5DE2A 3MESA 2UYZB 2DHZA 2W1EA 5AR5A 2O6VD 2EXCX 3E8CA 5K3YA 2NR2A 3DQVA 4P5ZA 4RZVA 5DEYA 2BHEA 3BI6A 3ZO1A 4NYEA 4XEYA 1UV5A 4HZRA 3FUPA 3HV6A 4ANSA 3QD3A 4DXAB 1GZKA 5BUJA 2W9FB 3W8QA 3LMHA 2P2HA 3NNUA 3APCA 3LXNA 1PHKA 3AC1A 1GIJA 4H3BA 3D94A 4K1RB 2J0IA 4QMTA 1UKIA 3MV5A 5HIEA 3EOCA 3OWJA 3H9OA 5L4QA 3BWJA 3EFWA 3H10A 5LVNA 3UGBB 3G2FA 3SD5A 4IZAA 2R0UA 5DNRA 3UODA 3ZZWA 3EFUA 3BGZA 3GUBA 1PRYA 4U81A 4LOPA 4ZTHA 5FXRA 4RJ7A 4V05A 4ZSJA 5ANGA 4RWIA 1H8CA 4MCVA 2KZRA 1OIQA 4E71A 4LDTB 4XBUA 5BVKA 4D0XA 3SXFA 3G15A 3OF0A 4WG3A 2W99B 4NL0A 4H36A 2GQSA 4QMYA 4FIGA 4I22A 4LCDE 1GNGA 2XJ0A 5DOSA 3F7WA 4KKHA 4ZZMA 4F0IA 2CR5A 2ITNA 2R9SA 3A7FA 1QPJA 4J53A 2PVLA 2UZLA 4RGJA 1P98A 2ZMDA 3MYGA 2PHKA 3N4VA 4I20A 4KDIC 2B9JA 3I5NA 1IRKA 2LUEA 4XV1A 4W9EA 4M15A 1EUVB 3O71A 3BKBA 4TWPA 5CTPA 2MP2A 2VX3A 4BR3A 3LFCA 4FTJA 3A2CA 3R8UA 4QMXA 4QYFA 1NVSA 3IOPA 3ORMA 4CFVA 2ZV7A 3JSVB 3AT4A 3SOCA 3C5IA 5A46A 3W2QA 2XIYA 3DLSA 2I1JA 2AEHA 2DAFA 2A1AB 4C8BA 4DEDA 2MBQA 5IH6A 2Y4IC 3KULA 3MHSD 4NPNA 2LI5A 3M3JA 5DG5A 3N9XA 3JYUA 3LJ3A 2BHHA 4YJVA 3VUWA 3PWDA 5IA1A 2LVQA 3QCAA 4BICA 2QU6A 5IPJA 2ITOA 5JGDA 2HWPA 3F2RA 2OH4A 4P4CA 4EH2A 3A4PA 2A4ZA 4Z9LA 3G9NA 3I0OA 4IM3A 4X2NA 3VUTA 4FNXA 4EH6A 4GT5A 3ITZA 4HVGA 2XMYA 1WJNA 1SVGA 2LGCA 3UJGA 4ACCA 3A9KB 3WAPA 4FT7A 1SE9A 2HIWA 3H1UA 4X3FC 3QZHA 3C4FA 4RIXB 2RIOA 4KIQA 2BRNA 2GNGA 3ZZEA 4CD0A 2BALA 3D2IA 2QHOA 5E8WA 1CKJA 3E7OA 4CKJA 1DM2A 4CCUA 4FV3A 4USEA 2ETMA 2KO3A 4AP4C 1PXNA 3DGKA 3FLSA 1Q8TA 4NM0A 2C0IA 3TNQB 3IQ7A 3CF6E 1WBSA 4KIKA 5A9UA 3LCSA 4WUNA 4ZTLA 1GG3A 3PRZA 3M1SA 3AG9A 3QX4A 3UDBA 3ELJA 1WBWA 2DUVA 5L6WL 3VULA 3WZEA 4ANOA 1MG8A 3S00A 2C5YA 4FULA 4S2ZA 4RIYB 4E20A 1ZOEA 3COHA 4YLJA 5AP4A 3R1QA 3FLNC 2R3JA 3FI3A 3ORTA 4FIHA 4EK6A 4KINA 3SXSA 2D10A 2KNBA 3PY0A 4MQ2A 3ZSGA 2RGPA 2CKPA 1Q8YA 1OL5A 3N51A 4TWNA 5K4JA 3QWZB 3ANQA 4BRXA 1S9IA 4O83A 1ZLTA 2IYDB 4IWPA 4QNAA 3QRUA 3QQLA 4GJ3A 3ZSHA 4XV9A 3DPKA 4ANQA 3UZTA 4BY9E 2JFLA 4C57A 3UQFA 3GVUA 2PEAA 5C4LA 1ZZLA 2W5HA 3R28A 3D9VA 3HRFA 3QRKA 3R73A 1YDTE 3O17A 2R3PA 4TNBA 3V6SA 5C1QB 1WR1A 2XZSA 4XG9A 4EH3A 4F7NA 4O84A 4O0TA 3E93A 2PE6B 2W96B 4TKSA 1RFAA 4F9AA 4U97A 2NP8A 3AC5A 3QF9A 1P0RA 1PXKA 4CCBA 3VUHA 3KK8A 5CSWA 2KLGA 1YKRA 1TBEA 2NPTB 4HLEA 4J98A 4KZ0A 5E8UA 4NIFA 3GQIA 1Q5WB 3PPKA 3DK6A 3DNDA 3Q9WA 1OECA 3PYYA 4GU6A 5CEPA 1Z5SB 3APFA 3QD2B 3JR1A 4CFUA 4DFNA 2GHLA 5ITAA 2LVPA 1GIIA 2XB7A 4MD9E 2L76A 2MCNB 5CNOA 3DZQA 3VBVA 4D1XA 3UGCA 3VVHA 4AZWA 2V1YA 5DLSA 2UZNA 2Y8OA 3VUYA 2VTSA 4N70A 3MFTA 5IEYA 3V62A 1XH9A 4BOZB 4F65A 5JHBA 4BCNA 4BTFA 2FH9A 4YJQA 4D1SA 2PVJA 2QOHA 3ROYA 3WYXA 2YAKA 4D2WA 5E9EA 4RFYA 5E8ZA 4O82A 3V5WA 3RP9A 3OWKA 5HBHA 5CANA 5AEKB 4FK6A 4IEBA 3F69A 3R30A 2BYEA 3FMEA 4FV7A 4Z16A 5AUYA 3B08A 4BN1A 5C27A 4O38A 5CAOA 4XG7A 4XRJA 3AC8A 3QTQA 3HP2A 2X7OA 2K39A 1REKA 1UWHA 1FMKA 2YVCA 3ZKJC 2C47A 4G3CA 2OSCA 4BYJA 2P2IA 4EOJA 1WI0A 2BYVE 1WM2A 5HIDA 4NY0A 4CLIA 2KFKB 3LQ3A 4QTBA 2B9FA 3UYTA 4WO5A 4OTFA 4NW6A 1YIWA 2YCSA 1M2PA 3AMYA 2BAQA 2VWXA 4JBOA 2JKKA 4AFEA 3U9CA 1EF5A 4FTNA 3RK7A 5B2LA 2IZSA 2VWUA 3GOKA 4Y95A 5HO7A 4II2B 3OC1A 3G33A 3PIXA 3B2WA 5LMKA 2L0FA 4WNPA 3C4WA 2PVHA 4OLIA 1OUYA 2WTJA 4LGDA 2ZM1A 4FV5A 4NCTA 2G2HA 4ERWA 3HV5A 2KJHB 3DCVA 2C6OA 3DFAA 3HMNA 5AAFA 5LVMA 3CSFA 4NKAA 3G5DA 4FG7A 2L00B 3Q3FA 5AP5A 4GIVA 5FP6A 2O3PA 4ZSEA 4MNFA 5LXMA 2KN5A 3Q3JA 3BZ3A 3GFWA 2J50A 4LOOA 2X6DA 2X8EA 1QCFA 1R3CA 2ZB1A 3MA3A 4H3PA 5DFPA 5ACKA 3SRVA 2YLFA 1WM3A 3EC8A 2YCRA 4AN2A 4C4EA 2KDEB 3F2NA 3NUAA 4FA2A 4L67A 2JXXA 2Y7JA 2KQ7A 4H3QA 5M06A 3UOLA 4RX9A 2Z7RA 2BRMA 2J2IB 4ITIA 4NT4A 5DEWA 1FVTA 2L3ZA 3EN6A 3TV4A 2ZNVC 2LGDA 4U44A 5ANJA 3KRJA 1NVQA 5TO8A 3DOGA 4AZVA 4IAZA 2REXA 4FGBA 4FG8A 4O22A 4AUAA 3BLRA 2FCMA 3L54A 3FMJA 5M08A 4LMNA 4C35A 3CQWA 4N9F4 4H1JA 4WRSA 4RJ4A 4DTBA 2O0UA 3UMWA 4L8MA 4ARKA 1Q8ZA 3A9JA 1SIFA 3IDPA 2WMBA 4AWJA 3HVCA 4YURA 3ATTA 2R2QA 2W1GA 5HG5A 3WF5A 4F1OA 4BBNF 2GQRA 2IO0B 2C5XA 1FGKA 4MJSB 3F3VA 3ETAA 1H1PA 3TIXA 2PVKA 4I5PA 3CQEA 4UY9A 5BMMA 1U5RA 3HL7A 4G1WA 4MBLA 3ZUUA 3MB7A 4IZYA 1DI8A 2JD5A 4BKSA 1NXKA 4QTAA 1ZMUA 1H27A 1UH6A 1XD3B 4E74A 4ZLYA 1J19A 3KRRA 4FKRA 4B8MA 1PJKA 2BDWA 3A62A 3LAUA 4KRDA 4WIHA 3ID6C 4EJ7A 4W9HA 1WCCA 3BQCA 3QBNA 4IJ9A 4Z7GA 3LDZE 4MGYE 4IVBA 4F4PA 4Q9ZA 4I0TA 1P2AA 2UVXA 3R04A 4FKVA 4F99A 3H6NA 5GIOE 3HV4A 3RWPA 4JDIA 1DAWA 1RQQA 1YDSE 2ITWA 3EYGA 2XKFA 2XYUA 3NUXA 3BEAA 4M13A 5C8MA 3JSVA 3R7RA 3R8LA 4KWPA 4F9CA 4ICUA 4AJYB 3W33A 5BO4B 3QCQA 3KXMA 4F7SA 3ZXZA 1H0VA 4GOCA 4V0GB 1WE7A 3MPAA 2QOBA 4IB5A 2QOKA 4RM8A 5LXIB 4AE6A 2VTLA 4FTOA 4F6UA 2OJFE 2FSOX 1WJ6A 3TV6A 3OJ3A 3Q5IA 3VBQA 5TOZA 3LCOA 2RGFA 4D58A 5A4LA 3MVMA 3A9KA 3PGEA 4LDTD 4PDYA 4XCUA 1PXJA 2QKRA 3BPRA 3R8ZA 5BVOA 3GCVA 2Z7QA 3COMA 3O8UA 3M62B 4LV8A 2WTDA 3MIYA 4FV0A 4ZXTA 4XLIA 2VWZA 5AR7A 4BFRA 3JS2A 4EJNA 1WAKA 3FC1X 3GU8A 3WE4A 2FGIA 2ZV2A 5M4UA 5KHQA 2CGVA 1Y8GA 1PXIA 2ZV8A 5CEQA 2GPHA 3OXIA 4WRGA 2HJ8A 3NIZA 4GJ2A 4U43A 4GMVA 1ATPE 1WVWA 3FLWA 4CT1A 3FMLA 4AF3A 3ZTCA 2G2IA 3R1YA 4RX7A 3DU8A 5KMIA 5K9IA 1V0BA 4CMTA 1KM7A 4LYNA 2ZCBA 3APDA 5CSPA 4EWQA 3QQGA 2C5NA 4AGCA 1V9JA 1LPUA 2EWAA 3PSCA 4FIFA 4L52A 3VIDA 5AUVA 4BDKA 3I1AA 2F4JA 4XMOA 2WMVA 4FSUA 4MD7E 4AGUA 1ZY4A 5T3QA 4CRSA 2QU5A 1SNXA 2IVVA 2KJ6A 5JGBA 1U5QA 1ZZ2A 2VTQA 5IA7A 4USFA 2OBJA 2XNEA 4NM7A 3RYTA 4W9XA 3ZNHB 3QLGA 5CAPA 4M8MA 3KUDB 4II5A 4OW8A 4ASZA 3FLYA 3BINA 2CKHB 5CASA 4KBKA 1LXDA 4EI4A 3PRIA 5HCYA 3SW4A 4LQMA 2KD0A 5EDPA 2XS0A 2LXAA 3IBEA 5FWKK 2ERZE 3KCKA 3OEZA 3AOXA 1Z5MA 4QP9A 4AOFA 5KHOA 4JT3A 4HYHA 1P14A 3WZDA 3H0YA 3JPVA 3S1HA 3EQBA 3SOAA 5C23A 5M4FA 1EO6A 4G0NB 2P0CA 4F6SA 3B8QA 4QMWA 2VUWA 4HGTA 1VJYA 2C0OA 3G0FA 3L10B 1YWRA 3RK5A 2FUHB 4RJ5A 3T3VA 2W06A 4GN1A 4YO6A 3EQFA 3K5VA 1OI9A 3IW5A 4IAKA 5AUWA 2BWFA 2G45B 5A4QA 4O7ZA 1Q4LA 2XK3A 2MBEA 4PNIA 4XUFA 3QTUA 4JDJA 4R1YA 4NWMA 3DBHI 1WH3A 4QP2A 4YTIA 4D4YA 2XVDA 2F49A 4BDHA 3PPAA 4EZJA
chains in the Genus database with same CATH superfamily
4UMTA 2ZM4A 3BBWA 3TUDA 4IFGA 4YJUA 1D6EC 3FKYA 2CHXA 2YM3A 1ISNA 2E9OA 4PL5A 5A4TA 5GJFA 2BVCA 3ZDIA 3UPXA 1JKKA 3E62A 3W1SA 2P33A 3BYUA 1E7VA 4TT7A 4D2TA 1T45A 4YZBA 4N4SA 3NW7A 4ORKA 3UZRA 3WF6A 5J1VA 3NNWA 2C0TA 4WOVA 5CYIA 3JVRA 2PTLA 3VS7A 4QYEA 1J7CA 4W9DA 4M0WA 3MTNB 1GB1A 2LRUA 2MLBA 1A48A 3HZTA 3HAVA 1J7BA 4OVVA 2JY6A 1WZYA 4YR8A 3W8LA 4MH7A 2ZJWA 2LXYA 1G8JA 4R8QA 4ATMA 4RWKA 5JFSA 3O3NB 5ANIA 1XH4A 4U41A 2B53A 3BYOA 2JITA 2FCNA 1Z9XA 1Q8WA 4FBJB 3KCFA 4O7TA 3Q5ZA 1ZP0B 4QYGA 3D5VA 4G3FA 3QNIA 2Y9QA 5IQIA 3OWLA 4U3ZA 2C5LC 3DFCB 2BF8B 2QOLA 1FFVA 4E81A 4O6LA 2QHMA 3Q8EA 3AD6A 4FIEA 3PV1A 1YQBA 4JQWC 3VS3A 3DY7A 5EE0A 1XBAA 3D51A 1MG4A 4UWCA 2K6DB 3C5UA 1YX5B 1ZMVA 3DDFA 3R00A 1WX9A 3CAZA 3FEGA 1FPUA 3TCAA 3QQFA 3ZTDA 2VRXA 4NM3A 4URKA 1XT9B 1A5RA 5BMGA 2C7MB 1L6VA 4BB4A 4YC3A 2C1AA 5KKRB 4Z55A 1PMEA 3O96A 3NNVA 1IPGA 5JZNA 5IEVA 4KRCA 4AN3A 3H7PA 2PE1A 4WQOB 2QLQA 1JALA 5BPYA 3U2SC 2WO6A 5EDRA 1R39A 5CS6A 3DWMA 4FEUA 2J0MA 3I04A 3ML8A 4NZLB 1WR6E 3QAQA 2XAOA 5HNBA 1C4AA 3QTZA 2AQ2B 5J5SA 2J5FA 3IDBA 4ZJIA 3BUPA 3HNGA 1RDQE 3CPBA 2MBOA 2GBMA 2AL3A 4TYGA 3OW3A 4W4WA 4ZSAA 2X0GA 1O6LA 2M4NA 4CFNA 3R0TA 3AKLA 3E9SA 2YCQA 1UU7A 4FZSA 2CHWA 1DS5A 4XP2A 4QMQA 1APME 3CE3A 5I9UA 1U54A 3IONA 2RR9A 1GAGA 4J7BA 3BL9A 4IZ5A 4J96A 5JZJA 2X8IA 1E1VA 2GS7A 3M11A 4MYGA 3H3CA 3HMOA 2N9KA 4IWDA 4QT1A 3OLMD 4BCQA 3D83A 3IW8A 4F9WA 5BMSA 2X6EA 5B0XA 4MAOA 3PJ1A 2WXOA 2BR1A 3MHZA 5HBEA 2PVNA 3GXLA 4AZEA 4D2RA 2EB2A 4CYIA 3DVNV 1PW2A 2I1KA 2KT7A 4LRKA 4M0MA 2BZIB 5CVFA 2PY3A 5C3JB 2IF8A 3F5UA 4QMUA 1BLXA 1LP4A 4RBLA 4BGHA 3O13A 1AARA 5IU2A 1L0YB 2XIXA 3IAS1 1WGYA 2CCHA 4AS1A 4CKIA 2RKUA 2V0GA 4BFMA 2NBVB 5FTGA 4J99A 3MFSA 4CTCA 4DEIA 2XCKA 4QP7A 3DVNU 3QXPA 4KGTA 3I63C 3ODZX 2CKQA 1OKYA 4A4LA 4EQCA 3DLZA 4JWIA 3PJ2A 5IQHA 3RM6A 4F7LA 1ACCA 4CO7A 1OIYA 2MBHA 2QILA 4IX3A 3LJ2A 5HICA 3PXYA 3MI9A 3KF7A 4DLJA 4FKIA 3KUCB 2MI7A 4BCKA 4EKLA 4K3BA 2UZVA 4FV9A 4DEGA 4A9UA 4HVBA 3Q32A 1YW2A 4DTKA 4YBKA 4GV1A 2HOGA 3EWHA 4AW5A 3N1ZC 5M4CA 4FBXA 4I6QA 4FHKA 4FMQA 2M1MA 4DXAB 2UZDA 1JWHA 3L3OM 2C7HA 2XK9A 2B1PA 3PG3A 3QC4A 1PKGA 1QOBA 1VZ6A 2VTMA 2IW8A 2UUEA 2XK4A 3ZO2A 1XH8A 1RAXA 5D6JB 4FV2A 3UQAA 3LIJA 3V5TA 4FTKA 2BFXA 1ZRZA 1P9DU 1FMAD 3L13A 3R01A 3RWQA 2WXNA 3BYVA 5D11A 5IOIA 4GGQA 4OZCA 3PVGA 5C8KA 4YL8A 3OOMA 3H0ZA 2C6EA 2O5KA 3VF9A 1OKZA 4YZ9A 3CS9A 3CMMB 4JG7A 1FQ1B 3ULIA 1YJIA 4EZ3A 3ENMA 2FSMX 3POOA 1FM0D 4RM9A 4ONAA 1ZARA 3PLVA 2N9PC 1NW1A 3HGKA 1QZEA 4FTQA 1ZWSA 4FZAB 3VS5A 2LJIA 5DR2A 4G5JA 1XXGA 1SVEA 4GMYA 3UZPA 3FKOA 4K0YA 4FM3A 2IY0B 2YISA 2Q0NA 4R3RA 3Q84A 3KRXA 2ZVAA 3TSSA 3AKJA 3SDLC 2K8BA 3BUQA 3QQJA 3EH9A 3W9CB 3OT3A 2YHVA 2GNHA 2XJ2A 3OTVA 2ZOQA 3ZGZA 2F7EE 2F2CB 3NVMB 4S17A 2WKMA 4DA5A 1JKSA 3AEGB 4GK3A 4TWOA 4EZYA 1QF6A 4HPTE 2WYQA 4O1OA 4EZ7A 3PTFC 2H9VA 5HORA 4I5CA 3FZRA 3HV7A 1HTQA 2R4BA 3G6GA 1SVHA 2JWZA 4ZRKA 4WD5A 4DC2A 1OKVA 1I42A 3N1XC 3Q8BA 1UGJA 4HDOA 4ZZOA 5GXGB 5EM5A 3QWJA 1F0QA 4XG8A 5L95C 4GYGA 3HRCA 2AQ1B 1WXSA 5EFQA 2KHWB 3BHTA 3O7LD 4E93A 4CKRA 3P4QB 1T6BX 3TACA 2XKDA 2X2KA 1CK1A 3AE4B 3GT8A 5JT2A 3ULZA 4BCGA 5DRDA 2IG7A 3I3TB 3DXQA 4FL3A 1VCBA 4BHZA 2RD0A 2G01A 3MP9A 4DGNA 1KOAA 2B52A 4RIWA 4EK3A 2ZYBA 3KMWA 4RLKA 1TKEA 3QCYA 2JIUA 3WARA 4BIDA 3KA0A 1WGHA 3UOJA 3OHXM 4MDKE 3VEAA 5HE0A 2D3BA 2Y0AA 3MWUA 4ZS0A 4R3CA 2CLQA 1VEBA 4OUCA 5MPOA 1RW8A 3EKKA 4H6IA 4CFWA 1YWMA 2Y5BB 4WNMA 4FNYA 3FMHA 4I24A 5F95A 4DE4A 3OK8A 4Y5QA 2W3RA 3BE2A 1J7IA 2XKCA 3G9LX 3LOKA 2IVTA 3W0OA 1UU9A 1AGWA 5F9EA 2JYEA 4GDKB 1GJZA 5IO9A 5IUGA 2EFKA 3OD6X 2UWQA 5M07A 2XANA 2PE9A 1H1RA 1IP9A 5M4IA 4PF4A 3MVJA 1TKIA 4NZWB 2MP2B 4IX5A 3NDMA 4PX6A 3QK0A 1JWMD 4QDVA 4R7BA 5HQ0A 3RAKA 3VH4B 4YTPB 2ONLC 2D11A 3KW5B 3SFEB 4BF2A 1FVRA 4IVCA 4HPLB 3MPMA 2K3UA 4DN5A 5DHJA 5IA4A 4DTAA 2OICA 4EOYA 3KAVA 3T8MA 3A60A 4DF3A 5J5TA 5D3DA 3CY3A 5EKNA 3ZFMA 1OB3A 2JXTA 1R34A 3NUSA 5LWMA 5AIRA 1WGRA 3PFQA 3HDMA 3II5A 3TEWA 2X5CA 3TMPB 4OT6A 4B9DA 4I6FA 4RJ3A 3OTUA 3RV1A 1WMHA 3ENEA 2M8SA 3P4SB 4GG5A 4FEQA 3D32A 3DX1A 1J7LA 5L6OA 4OGRA 3ZYAA 1E1DA 4D2PA 3NYXA 4MVFA 2L1AA 5G1XA 1Q97A 5HD7A 5DPSA 4XZ4A 3VRAB 3FSKA 1H26A 2H88B 3QRTA 4WPCA 2B9IA 1AD5A 3TEXA 4U80A 2HAKA 4ENYA 1J3HA 3TTJA 1ZE3D 3N30A 3I7BA 3ZTXA 1URWA 5D9HA 2JC6A 5GJDA 5KHXA 3D5UA 2PE2A 1HTYA 4XOZA 2W54A 4EH9A 3ERCC 1YVJA 5HTCA 4LM5A 4RFBA 3QA8A 4ANUA 3KEXA 3U7DA 2B0QA 2VO3A 5DWRA 4FJZA 4C62A 4HROA 4FKPA 2ZZPB 5AFVA 3MC8A 2AC5A 4DG3E 4E26A 2QR7A 1YOVB 2GNFA 4EHZA 4JR3A 3NG0A 3DA6A 4MBJA 1OL6A 4ZHPA 1U4AA 2BQQA 1T3QA 3KVWA 3VUXA 2NCZA 2R3OA 3PZ8A 3EQGA 1XBBA 2I0EA 1XJDA 4M68A 4BI2A 3EQIA 4NQIA 3FZPA 3V51A 2JVCA 3VQHA 2MQJA 4DBNA 5CSVA 4FTCA 1DGJA 4EBVA 2BKZA 2ND0A 4B6WA 3RN9C 5M57A 4XV2A 3ATTA 5AP3A 3C8YA 4DDGD 2HY0A 2OXYA 3SLSA 2V7AA 3LCKA 4ZTNA 2HYYA 3TDWA 1GNTA 4OAUC 4DYLA 2J53A 1JSVA 1Y91A 5AIKA 2HXLA 1BX6A 3F3ZA 5CEKA 4Y73A 2BFYA 4O86A 5EYKA 3TKUA 3FQSA 5AV4A 5J2RA 4G3DA 5FUTA 3MIAA 1UKHA 1PYWD 3OUNB 4EONA 2X8XX 3AE1B 4QMNA 2R3QA 1W2FA 1KE7A 4RPVA 2ETRA 3LB8C 3RAIA 4GT4A 3FMDA 3VJNA 3C4XA 2J7TA 4LUEA 4FVPA 3BLHA 4O0RA 3BV2A 2YITA 2KWCA 4FVRA 3VW8A 2MSED 1IASA 1HEZE 1MHXA 4EHEA 4YZMA 3I60A 5EM6A 3U6IA 4C38A 4DH7A 2JDSA 4BZOA 4ZHOA 3OCTA 3HIZA 5F1ZA 1FPYA 3F88A 3RULA 3DJ7A 2VRRB 4AX8A 2R7IA 4DCNC 3AEAB 2F2UA 4P90A 1U46A 3LMIA 2OF2A 3KREA 2XK7A 4GFGA 4FTLA 3MY1A 4O7WA 4QMVA 4ANVA 4UWYA 4A6QA 5IQFA 4HOKA 1T5XD 3T3OA 4IBMA 3DQWA 2BROA 1KLVA 2RAJA 4OBPA 2C60A 4V01A 3OW4A 2BDJA 1JOWB 4E4LA 4QTDA 5HKHA 4JBVA 4ZP5A 3GB2A 3A8XA 5E8VA 4RIOA 2WXFA 4YSZB 4JIKA 2G9HD 3Q4TA 2L0TA 3A7JA 4FICA 2XEWA 4XP0A 2C6LA 2KTRB 2B4SB 4HJKA 3GC9A 2B54A 4IWQA 1ST4A 3C0IA 2ZM3A 4KAOA 5AR3A 2ITUA 4LI5A 3CIRB 4TQ1A 4ZLOA 4TYJA 4HDQA 2R3IA 2PUIA 5CHVC 3KY2A 4DHZB 3O3OB 2FYSA 1F5QA 4NIFB 3ZUVA 2VO6A 3W2SA 4I1QA 2PMLX 4PV0A 4P6VF 3EFKA 3B51X 1VR9A 2YWPA 5HO8A 2B55A 5C9CA 1OQRA 3AE3B 3HMIA 4MXAA 3ZXTA 2PUPA 2ITTA 2HK5A 2Q13A 5KBRA 3MJ1A 4O7YA 4GVJA 3GC7A 3T46A 5BNJA 5CSXA 4L9IA 4YJSA 2BTSA 2WFYA 4X0MA 1STEA 3R02A 3N20C 2O6VA 4XX9A 3NHEB 4I0SA 3FWQA 5DA3A 4AA0A 2W1DA 2IGDA 4BTJA 4AZ5A 5EK7A 3GC0A 4EBWA 2VTIA 4J71A 3A61A 4IWOA 2F7QA 3ZMMA 4AT5A 4JS8A 4EZWA 1RE8A 1W8CA 4I6BA 1E8YA 4AOJA 4E7WA 2CS4A 3PJ3A 2A98A 4ITJA 2CNUA 4XBRA 3V8WA 2J0KA 2VWBA 4NAWA 4AW1A 3NEWA 3EMGA 4BCIA 2PJHA 2WU2B 3QZGA 3ANRA 2CKEA 1Q0WB 2DYBA 3JY0A 2PYWA 3HMMA 2VX1A 2PULA 3HVZA 3TNWA 2GQGA 5EW9A 2K1FA 3BLAA 3JY9A 1SB3C 3AMBA 4H39A 4B9QA 3FILB 5TF9A 5F4NA 2OF4A 4EOIA 2IO6A 1M2QA 2KK8A 3OS3A 2VTPA 4BC6A 3NWWA 2WTKB 4E6AA 3RM7A 4NU1A 1Y8YA 1W9MA 4MGIE 3U6JA 4L68A 2WXLA 1SEBD 4WWPA 3SC1A 3E8EA 4YZCA 4W9WA 4ZY4A 3TI1A 1K52A 3G0EA 3ZHPC 3AXWA 3OCGA 3TNHA 2WTKC 4EZZA 4D9UA 4FSMA 4WKQA 3ZS5A 3FPQA 2CNVA 5AP1A 4CFFA 4L46A 4BBMA 4KBCA 5EI2A 5AZFA 3K3JA 2D4CA 1SU6A 3IPHA 3QQHA 3OY3A 2VTOA 2DYLA 4E5BA 4IX4A 5HBJA 4HYIA 5FM2A 3I4BA 3C9WA 3BK1A 2R3MA 2J6MA 3O2MA 2FIDA 3E5AA 5FDPA 1WJUA 2J51A 3LXLA 1JMLA 3IGOA 4KIKB 3KKVA 5L3AA 4G34A 3FMKA 1Q41A 4X3FB 4GLSC 3QCSA 2NCNA 3NZUA 2XH5A 2HCKA 3UPZA 5JFWA 1P3QU 4GKHA 4CV8A 5LARA 2Y6OA 1H1SA 2VTRA 3PLUA 3RZWC 2V0OA 4R6VA 3CTJA 2PVYA 4ZSGA 4YU2A 5L2IA 3S2PA 4E8AA 4PMPA 4QO9A 5GZAA 3OZ6A 1NY3A 4AGWA 2Z0NA 1YJ1A 3FKNA 4DEAA 2GHMA 4ZZNA 2V3NA 1IA9A 4RZWA 2O63A 3B2FA 4DBXA 5AEPA 5E92A 2WTWA 4DGLC 3DAEA 2J42A 2WU5B 1FNUA 4IDIA 3DK3A 4NSWA 5KMNA 2FA2A 4YMJA 5E8TA 1ERKA 3JW0X 1A9UA 3UZTA 4L53A 3G9GA 3W1SC 1JWAD 4R5JA 1MI0A 4AZTA 1A06A 4O21A 4AOIA 2C30A 4FZDB 1UU3A 1BXTA 3DX3A 2OG8A 5FTQA 3PA5A 4DG0E 3GNIB 2R7BA 2WZJA 3ORPA 4U6RA 3V3XA 2OU7A 3PXQA 3DBCA 5IDPA 2HTHA 3AXCA 4Y85A 4UBAA 4UWBA 2P4IA 5E8SA 1GN9A 3P86A 4O1NA 2ITXA 4D4VA 4USDA 3F7ZA 1YOJA 2WMRA 4TRLA 5HX6A 3FXWA 3C7QA 2BW2A 2KYWA 2PZ5A 5CF8A 4LNKA 4G50A 2H89B 2B76B 4K2RA 4BDCA 3EFLA 4GU2A 2L83A 5AV1A 1VYWA 1YN3A 4JWDA 2RSVA 4FEXA 4F09A 1UNHA 5IN7A 4BKJA 2CN8A 3WI6A 4AA5A 1JVPP 3NUNA 3ZLXA 3MJWA 2N4FA 4M01A 5CT0A 3Q52A 3M62B 5AR8A 2JEDA 2Q12A 2W4JA 2DHZA