4IM2A

Structure of tank-binding kinase 1
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
659
structure length
618
Chain Sequence
GSMQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRNIKPGNIMRVIGEDGQSVYKLTDFGTEEYLHPDMYERVLRKDHATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVMGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Tank-Binding Kinase 1
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase TBK1
total genus 212
structure length 618
sequence length 659
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF18394 TBK1_CCD1 TANK-binding kinase 1 coiled-coil domain 1
A PF18396 TBK1_ULD TANK binding kinase 1 ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4im2A02
1.20.1270.420 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4im2A04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4im2A03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4im2A01
3TCAA 4D1ZA 4RZWA 3DK7A 2XBAA 4YJRA 3RPSA 1UZXB 2ACXA 3FLQA 3HRBA 3HNGA 2W4KA 2WMWA 2HELA 5H2UA 3FHRA 4CV9A 3NOBA 3ORXA 1OPJA 5DGZA 3RAHA 4FKRA 3UGCA 4WHZA 1Q5WB 1WZ0A 1XT9B 4MEMA 5HNGA 5AA9A 4DTAA 4FTTA 4YP8A 5I9ZA 2JFMA 5HICA 3KXXA 3ZTCA 3LCOA 4C4JA 3LFNA 3R8LA 3ZM4A 4HYSA 4AF3A 4FHKA 2JRIB 4RBLA 3PPJA 4WQOB 1XBBA 3NLBA 3UVQA 3R2YA 4BHZA 3I0QA 3A8XA 3R7OA 2XIRA 4J53A 1WGRA 3EN5A 3KYCD 1YRPA 1WM3A 2O2VB 1GNGA 1U54A 4CKJA 3MA3A 4LRKA 1W83A 3DK3A 3IG7A 3SX9A 4EOQA 2L76A 3FY0A 1X8BA 4O91A 3F3UA 5HCXA 3UTOA 3BKBA 3V5PA 5JEBA 5FEEA 3FQHA 4BWPA 3WZEA 4EOSA 2C5OA 4OW8A 4FYNA 3VHEA 3QWZB 4L6QA 4DT8A 2J5EA 4IAYA 4YZNA 5BVKA 5DNRA 4CMTA 4LJOB 3I5NA 4TQ1A 5I3OA 4WJOA 1JOWB 2OJ9A 2GOWA 4IIRA 4XC2A 1GJZA 2QHMA 3H0ZA 4CG9A 1YKRA 4Q9SA 4ZLYA 4RIOA 3I7BA 3NW6A 4ZTQA 3A4OX 4FV9A 1YD8U 2LVOA 5K5XA 3ZU7A 5E9EA 4A4LA 4O0SA 5AZFA 2X6EA 3DBFA 1FBNA 4ZTNA 2LRWA 2B55A 2WQNA 1H4RA 2WYQA 4D1XA 5AEKB 3FXXA 4LQMA 4E5WA 3UO5A 3CGFA 4L46A 4D55A 2N1WA 4TXCA 3ATSA 3LCKA 4W9GA 2JKMA 4I93A 3C7QA 2UW6A 4EK5A 2GBJA 3M1SA 5D41A 2V4LA 3PRZA 2PPQA 3U9CA 2IN6A 1OKWA 3RCJA 1OGWA 2LVQA 1B38A 3I6WA 2XK5A 5LLIA 3DXQA 2B9FA 1JSVA 3HAMA 4DG2E 4YL8A 3BBWA 5HCYA 2ZDTA 4EKKA 3WIGA 3A7IA 3RAKA 4FKTA 3SDLC 2BRNA 1OBGA 3IDBA 3L1SA 4OTHA 2IBIB 5D7GA 3B8QA 2V55A 5FXSA 2WMBA 2CGXA 3QQKA 1RE8A 2PUUA 3TIYA 1KUTA 4JIKA 5C4KA 1OL5A 4B6LA 3ZDUA 3RK5A 4ZDVA 4I4EA 3AD6A 3TNWA 3V5QA 5A9UA 2FNJB 3ANQA 3IW5A 4XG4A 4ZMEA 3VS7A 2WD1A 4IBMA 2KD0A 2VTPA 4LMUA 2OF4A 2ZM4A 4IVDA 4DCEA 2VWIA 3B2TA 3G5DA 3NPCA 3TI1A 3B2WA 3RHKA 4AQCA 2B3AA 2G3QB 3PS6A 3E87A 1TQIA 3KN6A 1ZW7A 3HV3A 5CQWA 4RLLA 2GQRA 3QX4A 4EYJA 1AD5A 3BHHA 1Q0WB 2AC5A 4NPNA 4BGHA 4W9DA 4EYMA 3H30A 3EECA 5GNKA 3A7FA 3Q9YA 3KU2A 1DI8A 5BVFA 2W17A 4MXAA 5A4EA 3U6JA 5TKDA 2CDZA 2G2HA 2WMAA 4QMPA 3MPMA 4NIFA 2KN5A 4YTCA 1H00A 4XYFA 2BKZA 4U45A 2I6LA 2FGIA 5AV1A 4I23A 4EEVA 2P33A 3C4EA 4GT5A 5D1JA 4ZSAA 1WF9A 1H27A 3GU8A 3QTQA 3ZZEA 4D2WA 5M08A 4ACMA 2BROA 2QO2A 5GINE 3IONA 1ZZ2A 1OKVA 3FMJA 3KREA 4LMNA 4W4XA 4ZSGA 5LMAA 2EXEA 5EHLA 4BYIA 3A4RA 1W98A 2UUEA 4YSMA 5IA3A 3LIJA 5B2MA 3PP0A 4CTCA 4X6QC 1H08A 4CXAA 2FSOX 4O7LA 2HWOA 4PRJA 3EQDA 3FZTA 4FVQA 4FZAB 3PXZA 1KJTA 4W4VA 5K0XA 4NAWA 2OGVA 3VHKA 3GC0A 4GVAA 5JGDA 3DVNU 4GJ3A 4JQWC 5G1XA 3BV3A 3ZUUA 4ACCA 4EK3A 3OUNB 4GL9A 2ZB1A 5AP4A 4NM0A 3P79A 4GVJA 4IX3A 3R00A 4QQCA 5HGIA 2QOQA 3U6HA 4RA5A 2VWXA 2BRBA 3COIA 2WTVA 3FZRA 4IAIA 5C26A 1XH5A 5BPYA 2CNVA 1Q3DA 1YDTE 1YWVA 3R8PA 5EKNA 4RQVA 3FC1X 4ZJJA 3CGOA 4TWNA 3VUKA 2IZTA 4QMYA 3R7IA 4EH4A 3WF7A 1GC6A 4NQKE 1WVWA 2FSMX 3MA6A 4L68A 4AZWA 5E4HA 2XNPA 2KC1A 4G3GA 3MW1A 5HVYA 1ZOHA 5ANJA 4ACHA 4XG9A 3P08A 4ZTMA 3NHEB 1CMKE 1CSNA 2DAFA 1QPCA 4N9F4 2QNJA 4N57A 5E6PA 5AADA 3BY4B 4KNBA 2ETMA 3BV2A 4QT1A 3BX5A 3NUPA 3VXWA 2VX0A 2BHEA 5HVKA 3MS9A 4EWHA 4GN1A 3M11A 4F9WA 4C33A 4S32A 4YTFA 1EF5A 2NRUA 3OY3A 5F1ZA 2LGDA 4TWCA 4E4XA 4O82A 3T9LA 2IO0B 3R2BA 4RZVA 4ZAUA 1UNLA 2YITA 5I5ZA 5M4FA 3QF9A 2VU3A 1H07A 4XMOA 1L7YA 3F5PA 4K18A 2G45B 3WARA 2FSLX 5KMLA 3QYWA 4II2B 4MNEA 4EK8A 1ZY4A 1UA2A 5AUYA 2XM8A 3UZTA 1IG1A 4EH6A 4P7IA 3F9NA 3MJWA 4MEDA 3Q6UA 4YGAA 5EOLA 1KOTA 4CZUA 3SXFA 3F7ZA 2OU7A 4FA6A 2IVUA 3PUPA 3CCNA 4QQJA 3TZ8A 3JSVB 4LDTD 4RM9A 2JPHA 4AP7A 1WJUA 3FMEA 3FMLA 4G3FA 2KO3A 2LRUA 4RMZA 5AUVA 4AOJA 4XBRA 3R66C 2QQ7A 3DBRI 2IJMA 3HV7A 3UNJA 2PYWA 4LGHA 3U87A 4HXDA 4ANMA 2XIKA 4IMYA 3HA8A 4WSQA 4X0MA 2N9PC 3IHPC 3V5LA 2VN9A 3NW5A 4FKWA 4G16A 5AJQA 1A06A 5E8XA 4P4CA 4O2ZA 5HX8A 1OITA 2PWLA 3FSFA 2GNJA 2QO7A 3ULIA 4FV7A 4KRDA 3N32A 4FIEA 1PHKA 2GCDA 4KA3A 4XG8A 5DVRA 3WF6A 3ID6C 4TZRA 3NYNA 1GIHA 4YHFA 5AX3A 4EZKA 3TNHA 3QAME 4KBKA 4HPLB 1UKHA 1Y8GA 3O8TA 2R2OA 5DBXA 3OJ4B 3WAMA 2PSQA 3AGLA 1R0EA 4KAOA 5T68A 4KSQA 3IKAA 5ACBC 5FM3A 2GDOA 3WZJA 2ZNVB 3FEGA 4IAKA 5HD4A 3PSEB 4HDQA 4FTUA 4LGGA 1W0XC 5E6OA 5J18A 2IW8A 4D9UA 1P98A 1SNXA 2BF8B 2QOFA 4W8EA 1LR4A 4U79A 4RX7A 2ZV7A 4XOZA 5HG7A 3RAWA 2OBJA 3RK7A 3TJDA 2CNQA 2DWBA 2R3IA 5DLSA 3OOGA 3ZXTA 4QP3A 4PNKA 3LJ3A 4EQMA 2BAJA 1H24A 4ASZA 5IG1A 3W1YA 3QC8B 2JFLA 4ZSEA 3TV4A 4A9YA 5FGKA 4W9IA 4E73A 1RAXA 3L08A 3FUPA 4RQKA 5M4UA 1WGHA 3CXWA 2QR8A 4GS6A 5FXRA 5KCVA 4X2NA 1ATPE 4MXZA 2VD5A 2WAJA 4XG7A 5EHOA 4DH8A 5K4JA 4PS7A 3VAWA 3LFCA 1FMKA 4QMWA 4DWFA 3DJ7A 3DBQA 3A9KB 1EF1A 2XEYA 1Y6BA 1ZWSA 4L42A 3R28A 4QOXA 1F5QA 3BINA 2EB3A 3BHVA 4JAIA 1XH7A 2FUMA 4FJZA 4NNJB 4B95A 2UZNA 4MF1A 4RX8A 3C0RB 3FMHA 4BBFA 3K9OB 3II5A 1WXVA 3AC5A 3CR0A 3PIZA 4U97A 5IQCA 5GJGA 3PFQA 3OUKA 3EB0A 4FV4A 2CNUA 3UOKA 5CANA 3TDVA 5EI6A 3M63B 5K4IA 2K25A 4OT6A 3TV6A 4RG0A 5HLPA 5GMVA 3F5XA 3L8SA 4JBOA 4NQLB 4IFGA 2NVUI 4O7WA 2W1HA 5K3YA 1SVEA 5ANIA 4BGGA 2QOIA 2NRYA 2UZLA 4X2GA 5HG8A 3DNDA 3Q52A 3OZ6A 5L8LA 1MRVA 4Z9LA 4KSPA 2FIFA 2WO6A 3LW0A 3LXPA 1WGDA 5KHWA 2WQOA 3HMNA 3SRVA 5M56A 2PPHA 3PPZA 3BIZA 4HLEA 1LXDA 3EHVA 2C7MB 3ZO4A 3UIUA 3EN9A 1BLXA 4ERWA 4UMQA 2XK8A 2ONLC 3DS6A 4NWMA 3EQHA 3PXFA 4ZZMA 1OIYA 4M12A 4KINA 4AX8A 3BHYA 4YZMA 4IVCA 5LVPA 2MLBA 2EKEC 2KHWB 2HD5B 3VH3B 3NW7A 3MY5A 2R3JA 4NFMA 4AW2A 4EH7A 4FKGA 3Q2MA 4IDTA 5HD7A 2HE7A 2KFKB 4GSWA 4OTIA 5CU6A 2C6DA 2WMXA 4IQ6A 1UH6A 1WFCA 1FPUA 3I1AA 3FAAA 3ZXZA 1GG3A 4GK3A 1OBDA 4DHZB 1TVOA 5TR6A 2XBBC 2UVYA 2XIXA 3HMPA 3TBLD 4DFUA 4YJTA 4JX3A 4BCGA 4TYJA 2Q0BA 4RC3A 4MHAA 3PY0A 4JQ7A 2JGZA 4L53A 5T3QA 4FNXA 1UNGA 2IO2B 4URKA 3GT8A 4CEGA 4CZTA 4MH7A 3PY1A 3KVXA 4QO9A 2ITUA 4RSSA 5A6OA 2JDSA 4MNEB 4QMOA 4X3JA 3MVMA 2NCNA 5FUTA 2HJ8A 5L8KA 2GMIC 3I7CA 5I0BA 2BAKA 2XCHA 4HYIA 4DEHA 3QJZA 3NNXA 3E5AA 3QZIA 3DVGY 1CM8A 1BMKA 1OGUA 2MWSB 3ORIA 4JDIA 4FV3A 4X3FA 2KTRA 2XIZA 3DQWA 4I3ZA 4M66A 4YZDA 3RI1A 1O9UA 4PPBA 4PP9A 4KS7A 2E9UA 2XMYA 3QWJA 4DEEA 3ZDTA 5DPSA 4AJYB 4WG4A 2GMXA 1XO2B 3VBXA 4AOTA 5BVDA 4R77A 1O6YA 3LOKA 3OS3A 1FOTA 1H8CA 4CG8A 3HHMA 4O2PA 3VN9A 4OUCA 5L2QA 4FTCA 4F7NA 2J0KA 4UYNA 1WZ3A 2JKOA 4U6RA 5HNBA 3HEGA 3UQGA 3IO7A 5AR8A 4BDBA 2RGFA 4YTHA 4C37A 2R4BA 2P3GX 2XRWA 4NZWB 5F20A 3FPQA 4ZRKA 4WWPA 3UOLA 3UNZA 4PTEA 1Q41A 1TBEA 2BRGA 3JR1A 3M3JA 2QO9A 3OCSA 4YJNA 2P0CA 4RIWA 5AUXA 4NW6A 3E63A 4BTFA 4E1ZA 3H9OA 4X3FB 2A19B 4MBJA 3TWJA 5AM6A 3ZNZB 3HGKA 1H28A 4WNMA 3GU7A 5JGAA 1PXIA 1QMZA 4CLJA 3QYZA 1VR2A 3FLZA 3ZLYA 4Z3VA 1YXUA 1F3MC 4FSZA 4G5JA 3R8ZA 1RLFA 4KIPA 1PXKA 3CIKA 3KXGA 4D2SA 1YI3A 4E6AA 1Q97A 2ZPYA 4IFCA 4B7TA 4BCFA 3ENEA 5AP6A 1UGMA 4MQ2A 5AP3A 4EOOA 2HXLA 4FGBA 5CI6A 2PVLA 1NVQA 1ZAOA 2FCMA 3G9LX 4J6IA 2VV9A 2WTKB 4LI5A 5A4QA 1V5TA 3CP9A 3DNEA 2XEZA 4KIQA 4H58A 3R1YA 3V01A 2QOLA 4YUQA 3R9OA 2PE1A 3PZDA 5JN2A 4TV3A 1NY3A 4QP8A 3VS0A 1SVHA 3PWDA 2GQSA 3OCBA 2JIUA 4C34A 2WQBA 5DFPA 1E7UA 3HLLA 3WIKA 3R8MA 4CSVA 4XOYA 3HUBA 2W4OA 3MJ1A 4O7RA 3L17A 5AM7A 1TZ1A 3N3KB 2XBJA 3U54A 5JFVA 1PXNA 3D7TA 4BOSC 1Q4LA 5TOZA 2KMAA 4ZS4A 3TNIA 4FI1A 3I81A 2YWPA 4HGEA 1UD7A 2N1VA 2ITYA 3MVLA 4IX5A 2KFJA 3F82A 3NSZA 4GSBA 1V2YA 2D10A 1JKKA 2VTMA 3Q2JA 1OVEA 3EFWA 3FWQA 2YCFA 3KF7A 4YMJA 3BWFA 2MX2A 3PXRA 4RWKA 4D4VA 3RAIA 4JS8A 3ZRKA 2HZNA 4K7WA 1FVVA 3ANRA 3CQEA 4N0SA 5LARA 5KHQA 2G4DB 1M17A 5IKWA 2VTOA 4XP0A 3VUIA 4O0YA 5CF6A 3RZBA 2UW9A 2YHVA 4DINA 4E20A 3LKMA 4I5PA 2C6IA 3R6XA 3VULA 1G3NA 1ZZLA 3OBJA 2RR9A 3A1QB 5GIOE 5BYLA 3PJ8A 2XP2A 3DOGA 2GBKA 1FMOE 2QI8A 3BE9A 5ANEA 1JQHA 4ZYNA 5CTRC 3L8XA 3PVGA 3NZSA 1U5QA 2NNWB 2UW0A 3O2MA 1WFYA 1PMUA 3R7UA 5I3RA 5E8YA 3W32A 2A0CX 5L8JA 1SMHA 1G8SA 3JYUA 4BKSD 4HGLA 2PTKA 4YTIA 3D5VA 1SVGA 3M2WA 4XX9A 4I5CA 3VC4A 3VWAA 3W2RA 4CNHA 2B4SB 2IZSA 3PA4A 2J9MA 2G1TA 4BWXA 4D4YA 2LD9A 4M8MA 3SU8X 3LLAA 1WBWA 1YQJA 2HZ4A 2XB7A 3PXYA 4CQEA 4OAVB 3M95A 3NUSA 2A2AA 4WBBB 5CEMA 3GNIB 2X0GA 3HVCA 5HE1A 2R3LA 5J8IA 5L2IA 1ZKHA 4YHJA 5T6KA 2I0EA 3MH3A 4HGSA 4ZY4A 4BKSA 2OZAA 4X2FA 4OTWA 1OMWA 3OC1A 4AW1A 4OBQA 4EBWA 2AYPA 3BLHA 2C9WB 2C6EA 3LFFA 2LAVA 2C69A 4F1OA 2C5VA 1RRBA 4LOOA 1WR1A 4RIYA 1IASA 3EC8A 2OIQA 2Z2WA 3H9RA 1J1CA 5A4CA 4GG7A 5LVNA 2LXAA 3DQXA 4BOZB 4TYIA 2JVCA 4EHGA 1W84A 4FTQA 2WTKC 4CFVA 1H26A 3S95A 3V3VA 1YIWA 3COMA 1U4DA 4MXOA 5CT0A 4BI1A 5AMNA 4HNIA 4BKZA 1XKKA 2PJHA 2JT4B 2LXCA 2JF5A 5HKMA 1Y8RC 2R3KA 1YHWA 4FSUA 3BWJA 1WVXA 1U54B 3O71A 3OWKA 3DDCB 2W4JA 2PY3A 3QZGA 3DBSA 4EFOA 3RBWA 2FB8A 4Y72A 1YW2A 1JWHA 2J7TA 3ZO3A 4AP4C 4C59A 2ZJDA 5IUHA 2WMVA 5CNNA 5AP7A 4BIDA 3Q4TA 4HOKA 2NPTA 2C0OA 4AZTA 1WH3A 3TKUA 3C4ZA 2N7DA 3DA6A 3QQLA 3OD6X 2NO3A 1T46A 3C4CA 2CLXA 2AL6A 3APDA 2DS1A 1UNHA 3DTWA 3T3VA 5HORA 2KX0A 2WELA 5G2NA 5EDQA 4FG8A 1KE5A 4JLCA 5EHYA 3JVZX 4HYHA 4ZSJA 2MP2A 5JHBA 2XNEA 2PUNA 3LCTA 4JRNA 5CT7A 5CU3A 5DPWA 1ZYDA 1H1PA 2JEDA 2CGUA 4IZAA 5IQFA 4M97A 3GQLA 3OF0A 2WMSA 3VS6A 4CCUA 5F9EA 5ICPA 1JAMA 4J97A 3ALOA 3NIZA 5EI8A 1OKYA 3ORPA 3TL8A 3GCQA 4FNZA 4O7SA 1FXTB 3TEIA 2XA4A 2UZWE 3OWPA 4UN0C 1SGHA 2RD0A 4QRCA 4C2WA 3QUEA 2WOUA 3OP5A 3ELJA 4HYUA 2JDOA 3D94A 4FV5A 4YHTA 3T9TA 4UMUA 2J90A 4Q9ZA 4HCNB 1H8FA 3VUDA 4DEGA 2R3QA 4I6PA 1ZYSA 4OVVA 2R3MA 3BGZA 4CZYB 4ANXA 1OUKA 4WWOA 1V49A 4FUYA 2QG7A 2MP2B 2WMQA 4KKGA 4AUQC 4AE9A 3VUXA 2YM5A 5B2KA 3PTFC 2J0IA 4RRVA 4EZ3A 4E5AX 1CMXB 3PRPB 2JLDA 2ITPA 3ZBFA 5J5TA 4UXLA 4KZCA 2BPMA 5FR6A 3S2PA 3W2OA 4ASXA 1CKIA 3SHEA 4LFIA 4XHKB 5CY3A 2ITXA 4BGQA 3WALA 4RMAA 1KOAA 1FGIA 4MK0A 4CT2A 4FIIA 4PPAA 4G1WA 1VZOA 5CAUA 3WF9A 3V5JA 2QOOA 3ZO2A 4BY9E 1Q5KA 3H7PA 3NS9A 2WKMA 4FTLA 1YXXA 4J95A 4GU9A 4ZTHA 4HPUE 4IWDA 4OTFA 4RJ5A 1WX9A 5E8VA 4OAUC 4MWIA 2UVXA 1EH4A 2K6DB 1WY8A 4QYFA 4OBOA 4JAJA 3NGAA 5ANDA 5AFVA 2PMOX 3F3TA 2I0HA 4L67A 4R78A 3V62A 3BGPA 3QGWA 4HWIB 4NYEA 2OZAB 4MCVA 3PRFA 2RSVA 4NM3A 3KMWA 3LVPA 2PVKA 2YIWA 3QC9A 4YLLA 5CU4A 1BI7A 5E1SA 4DEAA 4ANQA 1YOJA 3PJ3A 4KABA 1Y57A 3OXIA 3KVFB 2XF0A 3NNVA 4I24A 1E8WA 5KMNA 1WMHB 2DZKA 3KUDB 4XRJA 3W1SA 4QPMA 2B9JA 3ZFYA 1R4MI 2JY6A 2ITTA 4FSQA 4W4YA 3OEZA 4KRCA 3VQHA 1WXMA 3SOCA 4O84A 3UF8A 5C8NA 2JWZA 4GGQA 3SG9A 3OCGA 3UPXA 4DF3A 3N4UA 4DBXA 4XH6A 2YM7A 4DK5A 3TTIA 2R3PA 2F2CB 4YJVA 2C6MA 4FZFB 2W5BA 3ATTA 4GDKA 1K8RB 2CHZA 1YXVA 3CBLA 3V61A 5BUIA 2CKQA 2B53A 3KA0A 4IDVA 3TUDA 2BYFA 4I0SA 3K5UA 5DA3A 3ETAA 2X2MA 2YIYA 4FKJA 2KXJA 2V22A 2BCJA 2CKPA 4E26A 1U59A 2J0MA 4GKHA 4CO7A 2OW3A 2PVNA 2RSUA 3L0WB 2CGWA 4FTJA 4GIIA 4EK6A 3QLGA 4G3XB 3CTHA 4O38A 5CASA 4A4XA 5KO1A 3IW4A 5E90A 2W9NA 2UZTA 2VWUA 1UU7A 3LCSA 3KCFA 4JRVA 4LRJA 1OL2A 4X7QA 2NBWB 4CHKA 4GV1A 5GHVA 5BVEA 4D58A 4M0ZA 2UZOA 3A8WA 4FTMA 4EBVA 5BMSA 2GBRA 2JC6A 1PYXA 4M3QA 3EZRA 3NDMA 5HNIX 2J6MA 3ZLSA 5AAFA 1PMVA 5ANKA 1H1QA 3NIEA 3C51A 4EOIA 4CV8A 4FKVA 3RVGA 3QD0A 1MRUA 2DYLA 3HECA 3KF4A 3KVWA 3MH2A 2C3IB 1E8ZA 3TM0A 3PLVA 2LVPA 3PP1A 4UMTA 4USEA 2YM3A 3LCDA 2Z02A 3KFAA 3RUIB 4R1YA 1B39A 3VW8A 3KMMA 4L44A 4Y85A 2ITWA 5JZEB 2GS6A 5KE0A 5LVLA 2SRCA 4V0GA 3Q53A 4PV0A 2CSNA 2UW5A 4QMMA 4ASEA 4BDDA 4E4MA 2E9PA 2MBBB 5J1VA 1GJOA 2PVFA 5IEYA 2R2PA 3HDMA 3OY1A 4QMLA 3RPOA 3V5WA 3ZLWA 5IUGA 5KMJA 5EM5A 4BCKA 4FIGA 4BBEA 5EQPA 2QLQA 3GCUA 3QALE 5LMKC 3EYGA 2KKCA 3KRWA 4ACGA 3SD5A 4RJ6A 4E6QA 1L2NA 1YWRA 2RFDA 5HO6A 3KK9A 4Z7GA 3DVNV 4OVUA 3VUWA 2KLCA 4FSTA 4FT3A 2E9OA 3QKLA 3Q5ZA 3R1QA 1XR1A 4G31A 4PPCA 2L00B 4I20A 1ZOGA 3EHAA 3D5UA 5HBEA 1YJ1A 2XK5B 5TR5A 5E92A 2AC3A 1URCA 3KCKA 4IM0A 3L9NA 4A9RA 3B8RA 1WVYA 3Q9XA 3E62A 4J7BA 2O6VD 4V0GB 4GIVA 4FOBA 3RULA 4EJNA 3X23A 4F6SA 1P2AA 3PZHA 4NH1A 3UP2A 4XEYA 3UMWA 3VS2A 3R9HA 3OT8A 3AXCA 5KZIA 5L6PA 3WIMA 2KJHB 1Q1OA 4R1VA 3DAJA 2X9EA 2IO3B 3SGCA 3ODZX 4FV6A 2JRHA 3TDWA 2KTYA 4FEUA 4M69A 1CTPE 4K77A 3BHUA 4QP2A 4D9TA 4X3FC 4GT4A 3ORTA 4IB3A 2YWVA 4G6NA 1K2PA 3VIDA 3VS1A 4I0RA 1GZ8A 1LM8B 2MBEA 4IANA 5HBHA 5I9UA 4ALUA 4E5BA 5IH4A 5D9HA 1J3HA 5DPVA 2MRPA 1YHVA 2R7BA 3A4PA 3NUYA 2IVTA 4PL5A 5JRSA 1WX8A 3BELA 3MFSA 5M4CA 4FIFA 4DDGD 1OQYA 5E8ZA 4U42A 4NIFB 5HLNA 2KMCA 4GFGA 3G2FA 4CFXA 3Q3FA 5CSVA 1ISNA 1Z2MA 2IY0B 3ALBA 3DT1A 3E64A 3R73A 4TPTA 4ZOGA 3FMMA 2C47A 5BX0A 3GCVA 5JRQA 2GSFA 3O7LB 3AGMA 4A9TA 4D5HA 2DZMA 3CS9A 5M57A 4PYUA 4HZRA 4G0NB 4M69B 3GENA 2VTJA 4O1OA 3GOKA 3HIZA 1I42A 4U43A 3P7AA 4G3EA 4MAOA 2LI5A 4JDJA 3EFLA 2XM9A 4U8ZA 5C1QB 3Q3BA 4HPTE 1OEYJ 2C0IA 4IWPA 1Q99A 2E9NA 3LHJA 2D07B 2B0QA 4F63A 5KHOA 2JIIA 4BFMA 1KE6A 4NU1A 3FE3A 3WZKA 2B9HA 4GOCA 3S4QA 3QU0A 3TKIA 4Z16A 2O2VA 4K7UA 4CFWA 3SVVA 3NAXA 3O65B 4FZDB 3N9XA 3PJ1A 4GJ2A 1JVPP 2B9IA 2HY0A 4IC8A 4R3CA 4CYJA 4ZXTA 3R7RA 2DZIA 4BBNF 4ITIA 2O65A 3JY0A 5I9YA 3QIJA 4KB8A 4QD6A 1JSTA 5C03A 4HW7A 4FX3A 5EOBA 5E6NA 1U46A 3Q4UA 2FA2A 1PF8A 4TQ0A 1IRKA 1R3CA 2WZJA 3G0EA 4IJ9A 4TY1A 5EQEA 2ZYBA 3R83A 3FL5A 4R3PA 4UY9A 5C9CA 4YLKA 3VF8A 1QPDA 3L54A 1PKGA 4ZSLA 2ASQA 4MNFA 4EQCA 5C4LA 2JDVA 4RA4A 2CJMA 2RPQA 3P9JA 5HCZA 2LZ6A 1KV2A 4KUJA 3QTUA 4IHPA 3ZRLA 3MHSD 4O7ZA 4CLIA 4RFZA 4MF0A 1YDRE 3GVUA 3ZLXA 2VNWA 1WIAA 2QLUA 3TN8A 3FZSA 4L52A 4M7IA 4BDIA 4KWPA 3PHWB 2MA9B 4L3LA 3NEWA 4PMSA 3U9NA 4MGIE 4YLJA 3FI3A 5CEOA 4FJYA 4WJPA 2KK8A 1IP9A 2BFXA 2ZMCA 4NKSA 2Y4IB 3LJ0A 4AA4A 3UOHA 2F7XE 3Q9ZA 3KC3A 4AT5A 4EOJA 5C8MA 2C4GA 3OFMA 3OWLA 5DRBA 4LJPB 2HYYA 3BZ3A 3RJCA 3AD5A 3NVKI 2JKQA 3G90X 1UU3A 1HCKA 3DLSA 4UBAA 1MG8A 4BCNA 4BTKA 2XIYA 2VO3A 3PLSA 2Q83A 2G4SA 3K9PB 4ZRJA 4IVBA 5CQUA 1MP8A 1PXPA 3QRIA 2CCIA 3K3IA 5DWRA 3UG2A 5AR2A 3PWYA 2XJ1A 4S33A 2BTRA 5TE0A 3QRJA 4ZEGA 3E3PA 4FKUA 2RF9A 3P1AA 3TXOA 1OEYA 5DPTA 3V04A 4O1PA 2GHGA 5HO8A 4ORKA 3QQGA 2XNMA 4YC8A 2G01A 4U41A 3ZRCA 1L3RE 4IAZA 3WF8A 1JKLA 5JGBA 5H9BA 2QONA 5IEVA 5J7HA 4RFMA 2J0JA 1PY5A 4GRBA 1JRUA 3EFUA 3D5XA 3OOMA 4JL9A 5AP5A 3NYXA 4O0VA 4DH5A 2IG7A 4EHEA 4YU2A 3KULA 3QWKA 1FGKA 4MGZE 5E1EA 3A7HA 2RG6A 4CYEA 4IX4A 3BE2A 3PG3A 4HJOA 4RIWB 5DEYA 2YEXA 5CVHA 2VTQA 3VFKA 3WILA 2WU7A 1YI4A 5HKHA 3DGKA 4FV0A 2BALA 1DM2A 2XJ0A 3R71A 5H8EA 2WMTA 5HTIA 3MTNB 4MXYA 3HYHA 4ANUA 2GPHA 2O5KA 1M7NA 4HCUA 1PW2A 2W5AA 5CEQA 3HA6A 2I0VA 5CZHA 5E8SA 3SC1A 3TG1A 4BF2A 4KVGB 3A60A 4PWNA 1GNUA 4PL3A 4EH5A 3CD3A 2KX3A 3R7YA 4HDOA 3RTPA 3L9MA 3UQCA 2KVRA 1WBOA 1C1YB 4GK4A 5L6OA 3P0MA 4U5JA 5G6VA 2R0IA 2BDFA 4QPAA 4H1JA 2ZV8A 5BVWA 3ZSIA 2QODA 5ETCA 4M68A 5DG5A 5LWNA 3EQFA 3RMFA 3WANA 3FL4A 1Z57A 1QPJA 1MQ4A 4FK3A 2YERA 4RC4A 4LL5A 1IEPA 3MVHA 3MWUA 5DT4A 1PQSA 1E1VA 4XJ0A 5FLFA 4C4HA 2MW5A 4I22A 4YJPA 4XS2A 5LCKA 3ZC5A 4BCJA 4O7TA 4HCPB 4TWOA 4KSKC 1Q62A 2EU9A 4FSWA 5J1WA 2X2LA 4CTBA 3QTWA 4I6HA 3DK6A 3MH0A 3G6GA 4FMQA 2JKKA 2Z7LA 4U44A 4ZS0A 2H34A 3EKNA 4NEUA 1Q24A 4PL4A 4U40A 3K54A 4N70A 3AC2A 4UZDA 3RM7A 4EONA 4F1MA 3Q32A 2AWTA 2YCRA 2YDKA 5CF5A 3OW4A 5CX3A 4AZVA 4MQ1A 2G15A 3TT0A 1FVRA 3VNTA 4E71A 3SV0A 3GC8A 3L8VA 5M4IA 3K2LA 4HGTA 2C6LA 4AE6A 4W9XA 4BDGA 5J79A 2J0LA 5JSMA 3ML8A 2PK9A 3QFVA 2W9ZB 3CD8A 3BHTA 3HUCA 5DHJA 3EQBA 1BUHA 1MQBA 3U4WA 2EMSA 4G2FA 3T8OA 3ZO1A 4BL1A 5CVGA 5JZJA 3GQIA 2QU6A 3GI3A 2YA9A 3N51A 3H3CA 4WD5A 3RPYA 3QCXA 3NZUA 4II3B 4YO6A 4GEOA 2CKHB 4C4IA 2GQGA 4H05A 5ANGA 3MGYA 4HPMB 5EQYA 1NI2A 4D0XA 4H3BA 5HHWA 1P9DU 3UIXA 1NDDA 2J7QB 2M4NA 2WEVA 3H7SA 2PMLX 2R3HA 2VX1A 2A4ZA 3UO6A 4NAWB 4Z55A 1OL6A 4F9CA 4HNFA 4XV3A 3IQ7A 4GCJA 2GNFA 1UV5A 2PZYA 3A7JA 3ROYA 2OJRA 4F9AA 3RYTA 4XG2A 2ITQA 3QKKA 3PXQA 4BDEA 3KXZA 3RWPA 4QQ5A 4PS3A 1YXSA 4ZLOA 2KULA 3FMKA 1OIUA 3QZHA 2FIDA 4ITJA 3NNWA 1NT2A 5EW8A 5HE2A 2C1BA 4MELA 3KH0A 2C68A 2PE0A 1V6EA 3ZTXA 1J0GA 3PLAE 2VTAA 4BWKA 4AFJA 4MWHA 4FSMA 4O6EA 5A4TA 4QTAA 5LXHA 2WTCA 4F08A 3GOEA 3N4TA 3GCSA 4NK9A 4F65A 1P1AA 2R7IA 4ANWA 3V51A 4BTMA 2OZOA 1PYEA 2O63A 2RIOA 2WMRA 4OTQA 3WAPA 4RVTA 4FBJB 3ZFXA 3ML9A 4AT3A 3QQ8B 3NR9A 4I6FA 3P2BA 3AC1A 3ODYX 3ACJA 3G51A 3VHTC 4C2VA 1H0WA 2Y5BB 5D6JB 3ZLZA 5CSXA 4UYAA 4NM7A 1J1BA 4ANOA 4K11A 3HX4A 2I7QA 3KXHA 1UU9A 3RNYA 1PKDA 3TACA 3PV1A 1DAWA 5DIAA 4O27B 4D5KA 4QP6A 3OTUA 4WNKA 2BILB 3DDQA 3ZUNA 1EO6A 3BEAA 4O0UA 5EYMA 3W10A 1WJ4A 3ZKJC 2XNBA 2YISA 5HU9A 4WJNA 4IADA 2AUHA 2XNNA 2Y8OA 3D9VA 3BYVA 4AGCA 1XWSA 3HL7A 3JY9A 3MFTA 3GFWA 3MN3A 5DN3A 3ZRMA 2F7EE 4I92A 3E8NA 4X21A 2X1NA 5AR5A 5FBNC 4E93A 5IMXA 4S31A 1GC7A 2FAZA 2CCHA 4X2JA 2VTNA 1YI6A 3FYJX 4Q2AA 5BYYA 1URWA 3QZFA 4K8AA 2P55A 2Z0DB 4CGAA 4FUXA 4L3JA 5IH6A 2MCNB 3OXTA 4IEBA 4C3PA 4FT5A 3QBNA 3R0TA 4PDOA 5AEPA 4F09A 3ZVVA 3UJGA 4AA0A 1HE8A 3AG9A 3MI9A 3LFBA 4AZEA 2ZZPB 1I35A 3N4VA 4EH9A 3C0GA 4IB1A 5C27A 3F5GA 2QOHA 4YSJA 4FT9A 5H3QA 4A3PA 3ZM9A 4I6NB 2F49A 5DR6A 2JDRA 2KJ6A 2ZMDA 4H3PA 4JI9A 1SE9A 2OO8X 4JBPA 3UYSA 3DBDA 3DTCA 3OW3A 2CN5A 4RJ7A 4RWIA 4B4LA 3QAQA 4NCTA 4EC9A 2HXQA 3EJ1A 4ONAA 4BHNA 3KW5B 2ZCCA 4UALA 1QCFA 2WIHA 3PG1A 4CFMA 4Y83A 4CFUA 3ZS5A 4F70A 5J9LA 1X1MA 3W33A 3IW7A 4RGJA 3RKBA 2CN8A 2V62A 3G9NA 1M94A 4FN2A 1YWNA 2GS2A 3W2SA 4L01A 3HV6A 4LUEA 4NFNA 2OICA 3L9PA 4GYIA 5J7BA 1H1SA 3BYMA 1H4LA 4BI2A 3CKXA 4RIXA 3TTJA 4DITA 1E8XA 2K8HA 2MBOA 2YLEA 5FEQA 3QQJA 1YX6B 1G6JA 3CTJA 4RWLA 2JIVA 3IW8A 3LQ8A 3ACKA 2ERKA 5M07A 4RJ3A 2PZRA 4AOIA 2B52A 2UZDA 1V81A 4DGGA 2X4ZA 2YACA 4FJVB 3VVWB 4FTRA 3QTSA 4AWJA 4XUFA 5AP1A 2YM6A 1NXKA 5TT7A 1ZYLA 4PX6A 5E8UA 5FD2A 4WWNA 4K7SA 4FSRA 2O3PA 2HIWA 3FKNA 2DENB 4R7BA 3A9KA 4NJ3A 2YAKA 3E92A 5ACKA 1GIJA 3Q60A 4C58A 3V8TA 2PULA 3WE8A 4ANBA 2O6VA 3LXNA 1D3ZA 2OJGA 2QOCA 2WPAA 4DBGA 3EIDA 4JDHA 5HLWA 3L10B 3M42A 4MJSA 3ZW3A 4EKLA 3DJ6A 2VTSA 4BDKA 1JBPE 2X9FA 1WRDB 2PEAA 3MYGA 2WU6A 5D2MB 2XK4A 3REPA 1XQZA 5TO8A 3PVWA 1LEZA 2IZRA 4DEIA 2PUPA 4F4PA 5EI2A 2ZEQA 5CI7A 2PVJA 2VWWA 3WAOA 3TL5A 2XRUA 2J50A 2KDIA 1TGZB 3BRBA 3L8PA 4D2RA 1WYWB 5IQGA 2WOTA 1E1XA 3PZEA 3VJOA 3IGGA 3IS5A 4HVGA 2B7AA 2HZ0A 1UVRA 3UNKA 4FTAA 4BRXA 5LMKA 1B6CB 5D12A 1WI0A 3NY5A 3VBVA 4AN3A 5CHVC 4XG6A 5L95C 2BRMA 1J7UA 4O0RA 4PMTA 4ERKA 5GZAA 5AP2A 4AGDA 2HW7A 1WBTA 3ORLA 3ENHA 3QTXA 3E8DA 1WE7A 4D28A 4GU2A 3F88A 4F6UA 3EYHA 3VVHA 4EOMA 2R2QA 4FADA 1REJA 2BVAA 4FG9A 5DR2A 5F4NA 2EWAA 5D7AA 2XVDA 3F2AA 4LCDE 3E3BX 5ETIA 2WQMA 3WI6A 3MTFA 1GZNA 4FTNA 2WDTB 4AUAA 3PJCA 4F0GA 3EL7A 3KRLA 4R8QA 3RWQA 3QCAA 4D4SA 4FKQA 5C8KA 3ZCLA 4EJ7A 2JZ3B 4M8NA 4M15A 3HMIA 3K5VA 4KS8A 3NS8A 1OM1A 2XNOA 2GTNA 4CCBA 5IPJA 1E9HA 3RHXA 4UMRA 2WTIA 4QMXA 2W9FB 2F4JA 1PXOA 5HVJA 4YJOA 3FPMA 3QKMA 2ZDUA 3ZUTA 4F8CB 1DAYA 4FEQA 4MXXA 2YN8A 4I5MA 4DGLC 1IPGA 4GFMA 3I3TB 1S1QB 3BU5A 4MVFA 4BCHA 3B0AA 3PT2B 2QD9A 1WZYA 3UIOB 4FKOA 3WE4A 4FEVA 4PDSA 2M1MA 1TQPA 2YZAA 1E7VA 2CR5A 4BVUA 3GGFA 2KLGA 4MH0E 3T8MA 4HVBA 4H1MA 4DFYA 3HP5A 5JHAA 1IYFA 3NZ0A 4GFOA 4QYEA 2WIPA 3KB7A 3FY2A 3B1LX 1OPKA 3AD4A 3R22A 2ITVA 3O8PA 4FTIA 3FJQE 3DZOA 3GU5A 3OVVA 1TKIA 4PTGA 2W0JA 2GNLA 5HIBA 2QHNA 3EN6A 4O96A 4BDHA 4QMNA 4I6LB 1WBSA 2H6DA 2F9GA 5CZIA 1OL1A 4UXQA 4DXAB 1UWHA 3O96A 4KBAA 2W1GA 3BYOA 3QRUA 4MD7E 4PMMA 3MTLA 5HIDA 1ZY5A 3IPHA 3PXKA 4QMVA 3FMDA 3UZRA 3LXLA 4ARKA 3O0GA 4C62A 1S3SG 1T0YA 3AT4A 5HG9A 4UV0A 1UKIA 4UWYA 3GP0A 1RDQE 3C13A 2YVCA 2UW8A 3GUBA 4G6LA 3A7GA 4OTDA 4L9IA 5EW9A 1IA8A 4FODA 4EK4A 2OJFE 4IXPA 4EOYA 3UIBA 3CSFA 2O6VB 4GUBA 4K2RA 1H0VA 4MXCA 1APME 1SNUA 4RX9A 3LAUA 4IZ7A 4EUUA 3MFRA 4WOVA 3F3ZA 2X39A 3VRYA 3QQUA 2O0UA 2JD5A 5CENA 4ZTRA 1M14A 2GNIA 4ACDA 1IAJA 3AT2A 4NW5A 4TYEA 5JFWA 3TUBA 5GIPE 4LGDA 2V7AA 1XH4A 4ENYA 1KSWA 3NWWA 1J7IA 4YC6A 5DPRA 4FL1A 3MESA 4TKNA 2FCSA 3JS2A 4G17A 4LM5A 2ZV2A 4M67A 4NCTC 1NA7A 4UX9A 2VTIA 4KIOA 4NSTA 2XK7A 3KKVA 2W1IA 4ANSA 3R7VA 4F1SA 3X0WA 3H9FA 2OIDA 2DZJA 3QLFA 2C1AA 2VRXA 5IQIA 3ZC6A 3TNPC 4TYHA 5L83A 3EQIA 1BL6A 3DLZA 3FZOA 3QX2A 3WBLA 3AOXA 4KSLC 1CKJA 4BB4A 2K1FA 2OH4A 3ZDIA 4ZTLA 4IB5A 2PE6B 3A9JA 3JPVA 3FBVA 3PPKA 5EDRA 1J91A 2XCKA 4NJ7A 2XEWA 3P86A 5IUIA 3AULA 2WX0A 5FXQA 1OECA 4QP7A 3D7TB 1IAHA 3DY7A 1NVSA 4F7ZA 3VRZA 3O23A 4O22A 3COHA 3HM6X 3JYAA 4K1BA 4I1ZA 4OTRA 3DBLI 4W9JA 2KNBA 3PIYA 4MD9E 2WB8A 3G33A 3OT3A 2VRRB 3QARA 2RFSA 2WHBA 2YCQA 5JFSA 3OTVA 4OTGA 4TW9A 4JG8A 3F61A 2C5NA 5AP0A 2YIQA 3FKOA 3WYYA 3UIMA 4TRLA 5CAVA 1F9JA 2BAQA 2VWYA 4G3DA 3DFAA 1VYWA 4WNPA 2C3LA 1BI8A 4OR5A 4KD1A 4F7JA 2J4ZA 3A9JB 1KOBA 2BKKA 4R7IA 4A3OA 5GZ9A 5CAPA 1P5EA 2X7FA 4XBUA 2YCSA 2K6QA 4G9RA 4A4OA 2UW3A 3ZH8A 2IO1B 2OJJA 3WYXA 2NPTB 3QD2B 3BYSA 2W5HA 5CLPA 5IA5A 4C3FA 1GUAB 3HM3A 5L4QA 3Q5IA 4F7SA 3DB6A 2BYEA 3UZPA 4IWQA 4TTHB 4DTKA 4F1TA 4C4GA 4P5ZA 4YNOA 3AC3A 3KEXA 3ORZA 3R9DA 3VBTA 4Y5QA 5CXHA 3W2PA 2UZEA 4DLIA 3OBGA 1H1WA 2M17A 5TF9A 1GZKA 1PXJA 3A62A 4Q5HA 3VBYA 1M2RA 4HZSA 4WA9A 3DCGA 3AI5A 2XKCA 4U3YA 4FTKA 3ZDMC 2CKOA 5IQBA 3QCQA 5HTCA 4XNEA 4EUTA 2VAGA 5CF4A 2QCSA 1ZRZA 2X7GA 3GXLA 4WKQA 4BYJA 2KDBA 5CNOA 2VTTA 4V01A 4TN6A 4MGYE 3QRKA 1KLVA 3GZNI 4BICA 1YOLA 2HOGA 4BCMA 3DCVA 3UOJA 3VTVA 4DBNA 3IECA 4RVLA 3UP7A 4FNYA 1JNKA 2ETKA 3PLUA 2UZVA 1RQQA 3NRMA 3U51A 2BUJA 1QL6A 5KX8A 5IISA 3I60A 1A9UA 4YJQA 2KWUB 4UWCA 5EG3A 4FKIA 3TIZA 1E8YA 1MUOA 4GG5A 1RW8A 1U5RA 2CHXA 3Q9WA 3QL8A 4WIHA 3LFAA 4AAAA 4PP7A 4I6BA 3NX8A 2BKRB 5JH6A 3DBCA 4NL0A 1Y91A 2ITNA 2W7XA 3LPBA 5D7VA 2KZRA 4AW0A 2JAVA 4A07A 5BVOA 3Q96A 1BX6A 5I9WA 2Y4IC 4TNDA 4FL2A 2CMWA 3CQUA 4DE4A 2PU8A 2UZUE 2JITA 5AUTA 4UWBA 2Z7QA 3EZVA 4XRLA 3Q4CA 3ZSHA 4EQUA 4XV1A 1S9JA 1XHAA 2RG5A 3LQ5A 3QQFA 3ZSGA 1BKXA 4L7FA 5FP6A 5BVNA 2WTJA 5FM2A 5KKRC 4X57B 4BKYA 3UINB 3CSTA 1BT0A 4L43A 5EW3A 3MIAA 5JK3A 1JPAA 4FKPA 4KIKB 4N6YA 2HK5A 3F6XA 3U4UA 5HO7A 3SA0A 4I94A 3RALA 5M53A 4FE2A 1GIIA 2BFYA 2YLFA 5IEXA 2BDWA 3G6HA 3P4KA 3O8UA 4IZ5A 4BTJA 2DYBA 3D5WA 3VQIA 1IR3A 4BCIA 1ZXEA 2GU8A 3QCSA 5EYCA 5HBJA 5FQDC 3ZNHB 4USDA 4C36A 3V6CB 4Y46A 4L8MA 2ONLA 4E4NA 5A4LA 2DYOA 1NVRA 4Y95A 4KKEA 4BZNA 4CKRA 5AR3A 5BYZA 4FK6A 1UBIA 4GH2A 3R3MA 4EH8A 2PVMA 3HMOA 2YDJA 4F7LA 3MIYA 3FI2A 4FKLA 4IG7B 3ZTDA 4QMSA 5GJDA 3UQAA 3BQRA 4LV5A 4APCA 3UIPB 3VUTA 3VBQA 5B2LA 3LFDA 4J96A 4ICVA 3F69A 3GBZA 3JVSA 4GYGA 5AWMA 1U4AA 1F0QA 3GU4A 4BI0A 4O0TA 1WGGA 3N30A 2ZVOA 2IWIA 3MV5A 3QA8A 3QXPA 4PUZA 3HP2A 2ZAZA 3LZBA 5HQ0A 1P3QU 1GOLA 4MBLA 2HCKA 2XKFA 4BCPA 3OLMD 1OB3A 1PXLA 1YDSE 3I79A 3DKFA 4CD0A 2L05A 5DCNA 4IZYA 4O6LA 2OLCA 2O2UA 2PMNX 3CY2A 4APPA 2YFXA 2JXXA 4DGMA 4E3CA 1VYZA 2OG8A 3FLWA 3L9LA 3P7BA 4JQEA 1TTNA 5JH5C 5AIKA 4JIAA 2X8IA 2CHWA 3CE3A 3KL8A 2Y9QA 3IOKA 2XKDA 3THBA 4EOLA 4HVSA 2A5UA 2C6KA 3U6IA 3DQVA 4D2VA 3QHRA 2HAKA 4S2ZA 2UWQA 5CS6A 2CPKE 1OIQA 2UZBA 4RVKA 3U30A 2AEHA 1OKZA 5A54A 1NW1A 2R3RA 3MPTA 3ECIA 3F2RA 4CYIA 2QU5A 5EDSA 3SHQA 4FT7A 1T45A 3OHTA 4M8TA 3BYUA 5E91A 4NT4A 2P2HA 2ZPNA 4FEXA 3DAEA 4ZZNA 4ZY5A 1PXMA 4IACA 3ITZA 5HG5A 5DR9A 3WOWA 4KV2A 3FXWA 5IDPA 1KV1A 4G5PA 4F0FA 3TZ9A 4K0YA 4ZMFA 3S1HA 3F5UA 1W7HA 1WR6E 4XP2A 3NCZA 4OBPA 3LFEA 4I6QA 2K8CA 4FT0A 2C6TA 2R0UA 3VH4B 1XD3B 3CC6A 3TUCA 3IGOA 2KWCA 3BU3A 4RPVA 2OWBA 1Q8WA 3A33B 4AU8A 2CS4A 2R3FA 2PVHA 3UQFA 2IVSA 1PMEA 2MQJA 2AYOB 2QOKA 4W9LA 1UU8A 3MB6A 3PSBA 4LL0A 5JQ5A 1GAGA 2W99B 3VQUA 4FYOA 4DEDA 2BGFA 3KRRA 4FVPA 3KRXA 3NYVA 4EKUA 3BI6A 3UVPA 5BO4B 3TMPB 4YJSA 5AZGA 5IQHA 4I0TA 4FLHA 2X8EA 4MYGA 2OJIA 3Q6WA 1Q8TA 4G9CA 1RFAA 2OI4X 3TZ7A 3PHXB 3RCDA 4EZJA 2YZLA 2VUWA 2ZM1A 3OMVA 1WAKA 2CLQA 3LJ1A 2X4FA 4U81A 4ALVA 2O64A 4LYNA 4W9EA 4NJ6A 2BMCA 4JG7A 3SKCA 4EORA 1V5OA 4MGKE 3NUAA 4DFBA 4AW5A 4C8BA 3U8ZA 3FHIA 3KUZA 4IWOA 3NMUF 4KZ0A 2V1YA 4M13A 4E6CA 2DYMA 1M2QA 1YHSA 2A27A 3UC4A 2QVSE 2C0TA 4ZZOA 4GB9A 4CFFA 4J52A 1NBFC 4IAFA 3ET7A 4ANVA 3BGQA 4NTTA 2W1DA 4GKIA 2OSCA 4QTBA 4C61A 2ZCBA 3TJPA 2FSTX 4YBKA 2O8YA 5C01A 3FYKX 1LQBA 4JQ8A 1Y8YA 4FTOA 3HV5A 4ZLZA 3VS5A 1YQBA 3QTRA 3ZEWA 2JBOA 3ZYAA 2WTDA 3PY3A 3CEKA 2YIRA 3UVRA 3MPAA 4DFNA 1R39A 4V04A 3DXNA 3APFA 5FDXA 2K39A 5FTGA 5JFXA 4J98A 3O7LD 3H6NA 1DI9A 5BQ0A 3PDTA 4DEBA 2LGXA 3KYDD 3I0OA 4S30A 5AUWA 4C57A 4CVAA 4O83A 3W18A 5HE3A 3H0YA 5JMSA 4W9CA 4AA5A 3R9RA 3GB2A 4QYHA 5DI1A 2CU1A 1HCLA 4DFXE 2RFNA 1K9AA 2F7ZE 2W06A 4AGUA 1OL7A 2V3SA 4EZ5A 4I5HA 3W1SC 2HZIA 2NR2A 4I21A 3SXRA 4G11A 1ZMWA 5KUPA 5JQ8A 5FTQA 2DAJA 3C5IA 3RT3B 3PTGA 1QPEA 2OFVA 5AR4A 5D94A 2W1FA 5LVOA 3QXOA 3QCYA 5KHXA 4JBQA 1TQMA 1K3AA 2VNYA 3SW4A 4YO4A 3EWHA 4J8MA 4XV2A 3ZO5B 3LXKA 1LP4A 4GW8A 3SDJA 3FXZA 3UO4A 2N9XA 4CKIA 1Q61A 2FYSA 2V5QA 4IC7A 3TNQB 1H1RA 3KULB 4MTAA 3RCZA 5AV4A 4KKHA 3EN7A 3PREA 2VO6A 3Q4ZA 5KMMA 4C35A 4L00A 1UELA 4RX5A 3KY2A 4ZP5A 4WSYA 3IDCA 4CMUA 1Q3WA 1PRYA 3PE1A 4ID7A 3MBLA 3P5KA 3GFEA 4HVDA 1Q8UA 3JXWA 2Y7JA 1V86A 3FLYA 3P23A 3VTUA 1KE8A 2QKRA 4UZHA 2VZ6A 3UC3A 1P4OA 3RK9A 3POZA 1LFDA 5E7RA 3AC8A 4V05A 4QTCA 4QYYA 3V8WA 4Z7HA 4RIXB 1LEWA 4L7SA 3FQEA 4IH8A 4FV8A 3DKOA 4FR4A 2Z59B 1KE9A 4KDLB 4EZLA 4L3PA 3VJNA 4O21A 4PNIA 4ZJIA 3ZMMA 1OPLA 3QUPA 4WUAA 4BDJA 2HTHA 1ZARA 3EFJA 4BDCA 3IFWB 3A61A 2R3NA 1E5WA 4II5A 3A2CA 3PSDA 1J8CA 3VUYA 3I4BA 5L2SA 5IH5A 4LDTB 4BDFA 5EK7A 4Y73A 2W96B 1AGWA 3FMNA 4W4WA 2ITZA 3SW7A 4QNYA 5FDPA 3S2AA 3K3JA 5IQAA 4DTBA 4XLIA 3IW6A 3R02A 3IBEA 4YPDA 2R3OA 2ESMA 4XP3A 1MRYA 3PIXA 4O0XA 3BLQA 3FZPA 5BUJA 3EQGA 5CX9A 5KKRB 2QG5A 2L3ZA 3D14A 3O50A 4NUSA 4GMVA 5A3XA 4J1RA 4S34A 1FINA 1M2PA 2P4IA 3DU8A 3VS3A 5CALA 4MKCA 2YJSA 4WG3A 2C3JA 2QHOA 1ND4A 2FO0A 4X6RA 2XK3A 1R78A 5EDPA 1XH8A 5DMZA 5KMKA 1LPUA 4YJUA 4B9KA 3E88A 4C4EA 4PTCA 3HDNA 3UMXA 3APCA 2R64A 4FEWA 3QD3A 3WZDA 4PYZA 2QR7A 4R7HA 5DEWA 4EL9A 3AT3A 2A1AB 5HEZA 5AV3A 2GHMA 4ZY6A 2PZ5A 1AARA 3V8SA 2YM8A 1XJDA 4R5YA 4BCOA 4HVIA 5IA0A 5M55A 4EH3A 3Q3JA 4EHVA 4CFNA 5IQDA 2Y0AA 4AN9A 3PPAA 3E7OA 1G5SA 2GS7A 2MBQA 3ZNID 2YDIA 4AACA 3U8WA 5LQFA 5IAAC 3I5ZA 1O6KA 3F66A 4JNWA 5ANOA 4W9KA 4AJWA 4BVUC 5BNJA 4MD8E 4DA5A 3OROA 3TIXA 3ZBXA 4JOAA 3CKWA 2W1EA 3HV4A 4XV9A 3DFCB 5J9YA 2V0DA 4A9UA 4D4RA 5M44A 1OTRB 3LM0A 1VCBA 5HIEA 3IG3A 3FQSA 4CMOA 5JKGA 5D11A 1EUVB 4IAAA 2PE2A 4WG5A 3M62B 2OK1A 2ZM3A 4BIEA 3AC4A 5FP5A 4DC2A 1V0BA 3LMIA 4N6ZA 2PZIA 2XYUA 2Z8CA 3PA5A 4RFYA 2C3KA 5C23A 2BIYA 2GFCA 3FLNC 5HOAA 4ENXA 5CEKA 4EWQA 2WX1A 3AQVA 4IC7B 2W1CA 4G34A 2JAMA 2NP8A 3D15A 3FV8A 4QPSA 3R8VA 2RFEA 2ITOA 3TCPA 4IB0A 1Y6AA 1SM2A 2VWBA 3DV3A 1ERKA 2VWZA 4R5SA 4C3RA 4U80A 3VW6A 3KK8A 4DH3A 3MB7A 5EM6A 4F99A 4KDIC 2IPXA 4YURA 2PUIA 1ZYCA 4WBOA 3AU5A 1I44A 2REXA 4JR7A 1ZMUA 1BL7A 4AGWA 5LXIB 1DS5A 4FHJA 1PMNA 3JVRA 4M0YA 4U3ZA 3AMYA 4LOPA 4FIJA 2LASA 4YZBA 4LOQA 5L2TA 2MBHA 5HTBA 4FNWA 4RM8A 4ZRIA 3DZQA 5L6WL 2G2IA 3RPVA 3NYOA 4PQNA 5JZNA 3GCPA 4BC6A 2IYDB 5J87A 2DQ7X 2FCQA 3EMGA 5I9VA 1A48A 3ZHPC 3MDYA 1YXTA 2EMTA 3DBEA 2YJRA 2X81A 3FSKA 3D0EA 4F64A 2XS0A 3NVMB 4TUUA 2R9SA 2BDJA 2ZNVC 2KJRA 4EOKA 3COKA 4TNBA 2HENA 4BN1A 3E93A 2C5LC 4DHZE 2ZOQA 2PVRA 4XCUA 3EN4A 2C30A 1OUYA 4CT1A 3FC2A 3AMAA 3G0FA 4R3RA 1H01A 2OXYA 4DYMA 2IZVB 2HY81 3DAKA 1M7QA 4MBIA 3D83A 5HE0A 3S3IA 3CF6E 3V60A 2NS5A 3JSVA 4OLIA 2W1ZA 4BR3A 3W2CA 4IM2A 3EOCA 4QTEA 1REKA 4L45A 4FICA 4BCQA 2RGPA 3V6RA 4BIBA 3DBHI 3ZNGC 2H96A 5EH0A 3F2NA 4LUDA 5CF8A 4FOCA 4TT7A 4FBXA 4MM3A 1WMKA 3LQ3A 4O7VA 4J8NA 4H36A 1V0PA 4Y5HA 3JUHA 4UMPA 4PS8A 3UODA 2IZUA 4DLJA 4HK2A 3F7WA 4XX5A 1WE6A 1W8CA 3KRJA 5AR7A 3H1UA 4FV1A 3NNUA 2EVAA 4QYGA 2G2FA 3GU6A 5CAOA 3UYTA 1WGYA 2Z0EB 4B8MA 5DT3A 4TYHB 4AS0A 4M84A 5FWKK 1WXAA 2B1PA 4PY1A 3QHTA 3W55A 3RINA 5FTOA 2CKEA 1S9IA 1OZ1A 4YZCA 2CGVA 1V1KA 1Q8ZA 5BMMA 5KMOA 3JW0X 4IX6A 5DE2A 4W9HA 4ASWC 3UE4A 4ITHA 3UDBA 1XQQA 3EKKA 3H4JA 3D2KA 3R63A 3DXPA 3MH1A 4AOFA 2GFSA 3EQCA 3R7QA 4P7EA 3A4SC 3EH9A 4MSQB 3PVUA 3V6EB 3RGFA 2UVZA 1H25A 2VTHA 5D10A 4A7CA 2XH5A 5BUEA 1XBAA 2CHLA 2FH9A 4H39A 2Z7SA 2V7OA 2I40A 1SZMA 2RKUA 3MFUA 5CVFA 5CEIA 1C3TA 2PZPA 2WTWA 2FVDA 3WZUA 2LGCA 4IUMB 2GNHA 3H10A 2E9VA 1GZOA 2WQEA 5F95A 1IA9A 2Z60A 2BZIB 4RT7A 4PF4A 2UYZB 2VWVA 4JBVA 1WXSA 3L16A 3UPZA 3NUXA 4GDLA 1SIFA 3MJ2A 5HI2A 4U0IA 2AL3A 2BWES 1OIRA 4KBCA 4ASDA 4E6DA 5KMIA 2M8SA 4B99A 3R04A 4ANNA 4AFEA 3OAWA 4QNAA 2KQSA 2DUVA 3QGYA 5ETAA 4H3QA 2PE9A 3UQBA 5J2RA 3ROCA 5GZ8A 3SD0A 4FA2A 3UGBB 2YM4A 3SAYA 2ZV9A 2GTMA 4TWPA 3S0OA 4MJSB 5LOHA 5M06A 1HOWA 4O7NA 3KXMA 5IA7A 3QHWA 1G8AA 4QP4A 5ETFA 4RIYB 2X8DA 4WJQA 2E2BA 2L0TA 5ITAA 4G6OA 2N7EA 2KFKA 4GU6A 2BRHA 4DFLA 4UB7A 5LCJA 4BKTA 2WGJA 2XYNA 3CJGA 3LFQA 3P7CA 5B0XA 2X2KA 3T9IA 4EC8A 4P5QA 5AA8A 2UW4A 1CKPA 2KTFA 1P4FA 1STCE 3ZONA 3DOWA 2OH0E 3QK0A 4K81A 3VUGA 4AWIA 1YVJA 2BPSA 4MSMB 2VGOA 4JGHB 5EM8A 3ERKA 1QZEA 2L7RA 4TYGA 5HX6A 4FSNA 4DG0E 5CU0A 4RLKA 3A1QA 2X7OA 3CPBA 5EFQA 5LWMA 2QURA 3TZMA 1WBPA 3ONSA 3LFSA 3KGAA 4NM5A 4P90A 3O17A 4HCVA 4JX7A 2FCNA 4BFRA 2I1JA 4DG3E 3LLTA 1KE7A 4EI4A 3DVGX 1V9JA 2VX3A 3D4QA 4J71A 4QP1A 2QOBA 3R01A 4GT3A 2EXMA 3RNIA 3NCGA 4RWJA 3MSSA 4PDPA 3R7GA 3QRTA 1ZMVA 2QC6A 4CRLA 1WM2A 1WX7A 4OTPA 2BHHA 4WAAA 4JIOU 2Q0NA 2NBUA 2C5YA 3WF5A 2C5XA 3AXWA 3CY3A 2C7NB 3BBTB 2XKEA 3C50A 3OWJA 2Z7RA 1V80A 3C5UA 5F94A 1FQ1B 3QD4A 1R0PA 4FSYA 4RC2A 3VS4A 4YC3A 5EYDA 4WNOA 3EQRA 5IA4A 4QTDA 3HRFA 5CSHA 5JT2A 4PDYA 2KQ7A 5CHFA 3E8EA 4J99A 2BIKB 3HAVA 3DKGA 5CXZA 4K33A 4ALWA 4C4FA 5DH3A 3R1NA 4YNEA 5LJJA 1J7LA 2I0YA 5AAEA 2BZJA 2XJ2A 4A20A 2IVVA 4BZDA 2M0XA 3U7DA 2VO0A 3ZUVA 2XK6A 3OEFX 3LE6A 1CDKA 5I9XA 1WJNA 3VDZA 4I41A 5LVMA 5AUZA 4AT4A 4DHFA 4O0WA 2C60A 4D0WA 3R9NA 2PL0A 4A9SA 3CQWA 3KXNA 3E7VA 2MSED 3KN5A 3SLSA 4TKSA 4ZIMA 4QQTA 5AV0A 3R1SA 2GNGA 4NJDA 5M51A 4F9YA 2HW6A 5DT0A 2J2IB 2H8HA 2IY1B 4ICUA 2H9VA 2YLMA 4GIHA 2L0FA 4GUEA 3NUNA 4BZOA 3PGEA 3IOPA 4IJPA 4U9AA 4LG4A 5E8TA 4WUNA 4FIHA 5CU2A 4W9WA 5G55A 4RVMA 3R7EA 4ZTSA 3UBDA 5CEPA 3FZ1A 4BDAA 2KC2A 3VF9A 5J95A 2EXCX 2IW9A 2W05A 2XNGA 3BLRA 4C02A 5LXMA 4EH2A 4M0WB 4DGOA 4A06A 1GY3A 2Y6MA 4IE9A 2WFYA 3CSVA 1XBCA 4ANLA 3IK3A 5J17A 4PMPA 3GOPA 3W8QA 4ZJVA 3VTWA 3BEGA 3V5TA 2LGYA 4CQGA 1P0RA 4HCTA 4RJ8A 3DPKA 1BYGA 1WJ6A 4AN2A 2QKWB 2ZJWA 2PVYA 4LRMA 3LDZE 2VTRA 3CPCA 4YZ9A 3TKHA 2OXDA 3PVLA 3VO3A 3POOA 3FI4A 3BPRA 3VAPA 2OKRA 3RD2A 4JVGA 4IM3A 3KMUA 3OG7A 2X6DA 2OOBB 3H9DA 3LMGA 4EHZA 2I1KA 2OXXA 1P14A 2BYVE 2Y4PA 2C6OA 4XG3A 5KBQA 5C1ZA 3QX1A 3C0HA 3C0IA 1AQ1A 4K9YA 2K8BA 3CTQA 1O6LA 1Q8YA 3EL8A 4GXBA 3L13A 2GHLA 1LUFA 1JKTA 4O81A 3R21A 4QMQA 3QTIA 3SRVB 4EEWA 2GBNA 1KWPA 3D2IA 1PJKA 3T3UA 3OCTA 3FLSA 3S00A 5M09A 5EM7A 5HU3A 1WBNA 4QP9A 1YX5B 5A46A 5CAQA 5A14A 1ZGUB 4B0GA 3D32A 2KANA 3GEQA 3F3WA 1JLUE 3MY0A 4JR3A 4MX9A 4N4SA 5KZ0A 4BBMA 4BKGA 3QQHA 3NAYA 1L8TA 4YPSA 3LJ2A 4P2KA 3H7PB 2BZHB 4LV8A 4QMZA 3QC4A 2BWFA 2VTLA 2R3GA 2XUUA 4RJ4A 4G50A 5AZHA 1XH6A 5IZFA 2UV2A 3F3VA 4AG8A 1VD2A 1W82A 1RJBA 4DH7A 3W8LA 2HWPA 2KOXA 5AUUA 3CMMB 5CWZA 2BR1A 2YIXA 4B6WA 2NBVB 5CYIA 2A4LA 3QA0A 3ZOSA 1R4NI 2L8JA 3U55A 3W16A 4OT5A 3V6SA 1JSUA 3P78A 2IW6A 3SQQA 5AAGA 3UG1A 3PRMB 3ZIMA 3ENMA 4I4FA 5K9IA 2KDFB 1WBVA 3ZEPA 2PHKA 4WRSA 3B08A 1ZOEA 3A99A 1Z5SB 3BQCA 2ZVNA 3RZFA 3FDNA 3GC7A 5A6NA 2GBMA 2KTRB 4E8AA 4YR8A 4GDLB 3RZWC 2DX5B 2G9XA 2WMUA 5J9ZA 3ORNA 5L3AA 3HZTA 3W2QA 1SYKA 4DHJB 4JT3A 3PA3A 3PVBA 4JJRA 5J5SA 3PSCA 4GDKB 4NKAA 4CRSA 1UBQA 3D7ZA 4DH1A 3SG8A 4GMYA 4FVRA 5FBOA 4M14A 4D2TA 4XZ4A 4DT9A 5DRDA 3G15A 5CSPA 4WRGA 2JUOA 2F57A 4F9BA 2YABA 2FUHB 1FVTA 4C38A 2OFUA 2D11A 2I1MA 2UW7A 2XZSA 4JG6A 4OGRA 4JXFA 3DJ5A 5IA2A 3NUUA 3DPDA 3GC9A 4C7TA 4FV2A 4E4LA 2VGPA 4GK2A 4DN5A 4EOPA 2VO7A 5E8WA 3ZZWA 2B54A 1E90A 2NPQA 4KIKA 3I6UA 5CSWA 5LMBA 4DDID 2REIA 1ZYJA 2R5TA 3DKCA 4FZ7A 4F6WA 3VUMA 4B9DA 5FEDA 2OF2A 3EFKA 3C4XA 3IDPA 4W9FA 5CHWA 2ETRA 4DGNA 2JZZA 4WT6A 5KBRA 3C1XA 2J5FA 3FKLA 3MY1A 2KWVB 4HJKA 4BBNC 3KQ7A 1Z9XA 3AU4A 3CJFA 2BZKB 2N9EB 4WO5A 1I09A 2EB2A 5CTPA 2P2IA 5GJFA 3ZFMA 3QTZA 5IF1A 2LUEA 3FI8A 4YBJA 3ORKA 2IO6A 5K5NA 1XH9A 5AX9A 3HMMA 2YAAA 5DOSA 2WXVA 3HK0A 3SXSA 4FL3A 4F0IA 5IMEA 3OJ3A 3KUCB 3TV7A 2ERZE 3C4WA 4B8LA 3Q04A 5AIRA 4C0TA 1YOMA 4MDKE 5KNJA 4X2KA 5L2WA 4FKSA 3IVFA 3R30A 4E7WA 3HRCA 4AZFA 2J51A 3ORMA 3PYYA 2OIBA 2WNTA 2KDEB 1J19A 3BU6A 3PE2A 3ULZA 2F2UA 3CLYA 3QUDA 4QMUA 2JBPA 2WEIA 3RM6A 2DHZA 4W8DA 5H8GA 2Y6OA 2ZVAA 3W1FA 2N4FA 4FULA 1R1WA 1WCCA 5H8BA 4DFZE 4K1RB 5IU2A 4O7YA 4QMTA 1ZLTA 3RP9A 3SOAA 3ZRFA 5FRIA 3R8UA 2LWPA 4FGRA 5IA1A 2JDTA 5I4NA 2PMIA 5B7VA 3O51A 5IDNA 4JDKA 5HESA 2D2QA 2D3GA 4E74A 3LMHA 2BTSA 3ALNA 1VJYA 4U7ZA 2BKFA 4K6ZA 4ZK5A 1UWJA 3AMBA 3BCEA 3MVJA 5EKOA 4FF8A 2J0MB 4EZ7A 4NY0A 5EYKA 4IVAA 5AV2A 4USFA 4FC0A 1JKSA 5K0KA 1M52A 4R6VA 5FG8A 4Y8DA 4AZSA 4Q5EA 1V0OA 4NTSA 1KM7A 3DB8A 3EQPA 4G3CA 4BKJA 3PJ2A 3RPRA 2EUFB 4FZ6A 4TL0A 2ZB0A 3DDPA 4FG7A 1WMHA 4DHJD 4UEUA 3OXZA 3WA0A 4O86A 3TJCA 4XLVA 4HVHA 2WWZA 4DCAA 1VEBA 3LM5A 4D2PA 4AXAA 3C4FA 5HZNA 2C7HA 4IW0A 4D1SA 3HKOA 3E8CA 1A5RA 1OI9A 4DAWA 2LJ5A 2RL5A 1Z5MA 3VBWA 3C9WA 5IQEA 3VUHA 2XK9A 3PRIA 5DYJA
chains in the Genus database with same CATH superfamily
4C4VA 4D1ZA 4RZWA 3DK7A 3RPSA 2ACXA 3Q8AA 5H2UA 3UGCA 3RAHA 3LCOA 4FHKA 3A8XA 4J53A 3EN5A 1YN5A 3KYCD 3IG7A 4O91A 5HCXA 3V5PA 3FQHA 4L6QA 2J5EA 4IAYA 5DNRA 4CMTA 5I3OA 3H0ZA 3I7BA 5K5XA 3NVVA 2BS3B 1FBNA 2B55A 4D1XA 4LQMA 4E5WA 3CGFA 4D55A 2H89B 3M1SA 1DOYA 1OKWA 1OGWA 3DXQA 1B38A 3BBWA 2ZDTA 4FKTA 3SDLC 2BRNA 1OBGA 2IBIB 3B8QA 2V55A 3QQKA 4JIKA 2Z8YA 3ZDUA 4ZDVA 3V5QA 3ANQA 4JWEA 4LMUA 2ZM4A 3B2TA 3RHKA 2B3AA 3E87A 3HV3A 2GQRA 4EYJA 1Q0WB 4BGHA 4EYMA 3HAIA 3U6JA 2WMAA 4NIFA 2I6LA 4I23A 4EEVA 1L6UA 1WF9A 5D1JA 3P5JC 3IONA 1OKVA 4ZSGA 5EHLA 1L0YB 3A4RA 4FXCA 4YSMA 5IA3A 3LIJA 4X6QC 4PRJA 3EQDA 3FZTA 1KJTA 4JQWC 5G1XA 4GL9A 4NM0A 3P79A 4GVJA 4RA5A 2VWXA 1O7DC 4IAIA 3DYTA 5BPYA 1Q3DA 3R8PA 4ZJJA 3VUKA 3CGOA 2IZTA 4QMYA 3R7IA 4NQKE 3WF7A 2TSSA 2FSMX 4L68A 3MA6A 2J53A 5E4HA 2KC1A 5HVYA 3NHEB 2J52A 1CSNA 4N57A 5E6PA 4KNBA 2ETMA 4QT1A 3BX5A 2BHEA 3MS9A 4GN1A 4S32A 4YTFA 1EF5A 5F1ZA 2LGDA 4TWCA 4E4XA 3T9LA 1L7YA 2WXOA 2VU3A 4AXCA 4MNEA 1ZY4A 2YL8A 5AUYA 2XM8A 4EH6A 3MJWA 3SXFA 2IVUA 3PUPA 4QQJA 4LDTD 4HKZE 1WJUA 3FMLA 4G3FA 4QDVA 3ACOA 4RMZA 4XBRA 2IJMA 3UNJA 4WSQA 2XANA 3V5LA 1P7FA 4G16A 1A06A 5HX8A 4P4CA 2PWLA 3ULIA 1OAOA 4FIEA 1PHKA 3WF6A 4XG8A 2ELBA 2RAKA 4TZRA 3TNHA 4KBKA 4HPLB 5DBXA 2PSQA 3RV1A 4KAOA 5FM3A 3N20C 1TKYA 4D9UA 2BF8B 1LR4A 2ZV7A 3RK7A 3TJDA 1N62A 4QP3A 4W9IA 5FGKA 4E73A 3CXWA 4DWFA 3DJ7A 1WSPA 4L42A 3R28A 1F5QA 1XH7A 3C0RB 3PFQA 3OUKA 1Y2OA 1VLRA 1VLBA 3UOKA 4OZCA 2CNUA 4RG0A 3F5XA 2W1HA 5K3YA 4BGGA 2QOIA 5L8LA 4KSPA 4EZOA 2NTTA 5KHWA 2PPHA 1LXDA 3EHVA 3UIUA 4FE2A 2XK8A 2ONLC 4ZZMA 4NWMA 3EQHA 4CQGA 1XMLA 4DHIB 3NW7A 2HE7A 4GSWA 1UH6A 1FPUA 3FAAA 1WWTA 5TR6A 2XIXA 4YJTA 4URKA 4FNXA 2NTSA 1QOFA 4CEGA 3PY1A 2K9XA 3KVXA 4RSSA 3DPQA 2NCNA 5FUTA 3MVMA 2YL5A 2BAKA 2XCHA 1CM8A 1AN8A 2MWSB 4M66A 4YZDA 1O9UA 3ZDTA 5DPSA 3OS3A 3HHMA 4F7NA 4UYNA 2NMQA 2JKOA 5AR8A 2RGFA 4C37A 3RD2A 2P3GX 4NZWB 3UNZA 3D4YA 2QO9A 3KQ4A 4E1ZA 4X3FB 2WU5B 3R2IA 1PXIA 4UDYX 4G5JA 4E6AA 2MH7A 3KXGA 3ENEA 3BVTA 4LI5A 1V5TA 3DNEA 3V01A 4OZBA 3PZDA 4KX6B 3OCBA 3HLLA 2YIAA 4O7RA 2W4OA 3U54A 4BOSC 4ZS4A 4IX5A 1V2YA 3Q2JA 2MX2A 3RAIA 4N0SA 1WRIA 3RZBA 2UW9A 3LKMA 4DINA 2RR9A 2C6IA 5ANEA 2QI8A 3ZM9A 4H6HA 1TJEA 1QQRA 3O2MA 5I3RA 3W32A 5L8JA 4JN4A 3VC4A 1SVGA 4I5CA 3VWAA 3PA4A 4JWUC 3SU8X 4RFBA 3LLAA 1YQJA 2HZ4A 3PXYA 4WBBB 5CEMA 3HVCA 1ZKHA 2AYPA 3EGRA 3LFFA 2C69A 4F1OA 1RRBA 1WR1A 2OO2A 4EHGA 1W84A 4FTQA 1YIWA 3COMA 4MXOA 5AMNA 2JT4B 2LXCA 2JF5A 5HKMA 4C56C 3BWJA 1WVXA 3DDCB 1JWHA 2J7TA 3ZO3A 2N7DA 3OD6X 1T46A 2AL6A 2DS1A 3DTWA 3UDSA 1H1PA 3GQLA 3VS6A 5F9EA 5EI8A 1OKYA 3GCQA 3TEIA 2UZWE 3Q0KA 4FV5A 4Q9ZA 4Q2JA 3P4RB 4OVVA 5FR3A 3GZNB 2MP2B 4KKGA 1TQSA 2JYEA 2YM5A 4EZ3A 4KZCA 3S2PA 3W2OA 3SHEA 4LFIA 5CY3A 2ITXA 1FGIA 3WF9A 4FTLA 4IWDA 1WX9A 5BMHA 4OAUC 2UVXA 4OBOA 3QGWA 1Q10A 2PVKA 4YLLA 5CU4A 1BI7A 5E1SA 3PJ3A 1Y57A 2XF0A 4I24A 3KUDB 3W1SA 4XRJA 3ZFYA 3VQHA 1WXMA 3OCGA 4DF3A 4XH6A 4DK5A 2R3PA 2F2CB 4YJVA 2C6MA 1CJEA 4UDXX 1K8RB 1YXVA 3CBLA 3BVXA 3KA0A 1TQVA 4I0SA 1RWSA 2KXJA 3I63C 2CKPA 4CO7A 4EK6A 4O38A 4A4XA 1TKEA 5KO1A 3NZ3A 2UZTA 2VWUA 2NBWB 4EBVA 4B0EA 1X04A 3NIEA 2PTLA 4CV8A 3R8BA 1MRUA 3HECA 3MH2A 3KVWA 3PP1A 4TMAB 2Z02A 3KMMA 4Y85A 2ITWA 2GS6A 2SRCA 4BDDA 3VONA 2KAJA 3ZLWA 3OY1A 3V5WA 5IUGA 5EM5A 4BCKA 2ZW1A 2KKCA 4ACGA 4E6QA 1L2NA 1YWRA 3VUWA 2KLCA 2E9OA 3GS2A 1NYQA 2J4XA 2L00B 2XK5B 3D5UA 5TR5A 3KCKA 2LEKA 4FOBA 3RULA 2DNFA 5L6PA 2KJHB 3ODZX 2JRHA 3TDWA 4M69A 1K2PA 3VIDA 3VS1A 1LM8B 2MBEA 4ALUA 2MRPA 3TMOA 3NUYA 1WX8A 5E8ZA 2D1LA 4WPCA 3Q3FA 4AQKA 3ALBA 3NRZA 2XARA 3R73A 3FMMA 2DZMA 3O7LB 3CS9A 4O1OA 1I42A 4U43A 3P7AA 4JDJA 3Q3BA 3N9YC 1F0ZA 4BFMA 1KE6A 3WZKA 4O4BB 4CFWA 3NAXA 3O65B 3PJ1A 2ZW0A 3FC4A 2QCZA 3JY0A 4KB8A 3Q4UA 4TQ0A 1IRKA 4TY1A 3R83A 4UY9A 5C9CA 4YLKA 1PKGA 2ASQA 4MNFA 5C4LA 1PDXA 5HCZA 3QTUA 4O7ZA 1YDRE 1TS2A 1R4MB 2F7QA 4WJPA 3FI3A 1IP9A 2KK8A 3UOHA 2F7XE 3KC3A 4EOJA 2C4GA 3OFMA 3BZ3A 3AD5A 3NVKI 4UBAA 3DLSA 4BCNA 4BTKA 3PLSA 2Q83A 4REZA 3K9PB 3P4SB 3UG2A 3K3IA 3OHXM 4S33A 1PGAA 4FKUA 2RF9A 3P1AA 4R5KA 1ZXHA 5HO8A 3QQGA 1L3RE 2L83A 5JGBA 2QONA 5IEVA 2J0JA 4GRBA 4O0VA 4DH5A 3WILA 4FV0A 5H8EA 2BALA 5HTIA 4ANUA 4RGNA 1PW2A 2W5AA 2I0VA 4PWNA 1GNUA 2IEWA 3RFZB 3R7YA 4GK4A 3P0MA 4MT5A 2YIBA 2KDMA 5HI1A 3ZSIA 2RDHA 5DG5A 3EQFA 1MQ4A 4RC4A 1YMHE 4LL5A 4IUMB 3TMPB 4XJ0A 4I22A 5LCKA 4XS2A 4I6HA 3MH0A 4FMQA 2Z7LA 4ZS0A 2H34A 3RM7A 5CX3A 3GC8A 2J0LA 3ML8A 3HUCA 5DHJA 3U4WA 2EMSA 4BL1A 5CVGA 2QU6A 3GI3A 2XN9C 1HZ5A 4II3B 3NZUA 2CKHB 4C4IA 1FCCC 4D0XA 2M4NA 3UO6A 4Z55A 4XV3A 3RYTA 2PZYA 3PXQA 1YXSA 2PIAA 3NNWA 1UF0A 1ZXIA 1IBXA 3RNGC 3T49A 1AWDA 4MWHA 1W9MA 3N4TA 3GCSA 1P1AA 3V51A 1PYEA 4FBJB 3ACJA 1H0WA 2Z0VA 4ANOA 4K11A 3HX4A 1GB1A 3RNYA 1PKDA 4O27B 4QP6A 4WNKA 2BILB 3DDQA 1EO6A 3W0QA 5EYMA 3W10A 2XNBA 2BW2A 2AUHA 2XNNA 2X1NA 1GC7A 4S31A 4X2JA 3FYJX 4K8AA 3QZFA 2Z0DB 2P55A 5H8YE 3OXTA 4IEBA 1KF6B 4FT5A 4F09A 3UJGA 3AG9A 1I35A 3C0GA 4IB1A 4FT9A 2F49A 2KJ6A 4H3PA 1SE9A 3PO0A 4B4LA 4NCTA 3M3WA 2ZCCA 4F70A 3W33A 3IW7A 4RGJA 2GS2A 2OICA 3TTJA 3CTJA 1N5WA 2ERKA 5M07A 2B52A 2QILA 4FJVB 2YACA 5E8UA 5FD2A 4H2AA 3A9KA 4C58A 4ANBA 2O6VA 3LXNA 2OJGA 2QOCA 2WPAA 4JDHA 5HLWA 3DJ6A 4BDKA 2X9FA 5D2MB 2XK4A 1XQZA 3PVWA 1LEZA 2IZRA 2ZEQA 3T47A 3TL5A 2KDIA 3DBRB 4D2RA 3IGGA 3IS5A 4HVGA 2OHFA 2HZ0A 3NY5A 5CHVC 3RNAC 3VBVA 1J7UA 4XG6A 2BRMA 2MEKA 1WBTA 4F6UA 5F4NA 5D7AA 3F2AA 3E3BX 1GZNA 4FTNA 3PJCA 3EL7A 1JROA 5IPJA 2W9FB 2F4JA 1PXOA 3ZUTA 4F8CB 4MXXA 1S1QB 3B0AA 3N1XC 3UIOB 2GLSA 4FKOA 5EE3A 1TQPA 4HVBA 4H1MA 2ALWA 1IYFA 4GFOA 2WIPA 3KB7A 2ITVA 2VZKD 4PTGA 2QHNA 4BDHA 1FXIA 1OL1A 2CJOA 2W1GA 3FMDA 3LYYA 3O0GA 4PK1A 5HG9A 4UV0A 1UKIA 2YVCA 5EW9A 4L9IA 4EOYA 4FODA 5L95C 2O6VB 3LAUA 4IZ7A 3MFRA 4WOVA 3VRYA 3QQUA 2O0UA 2JD5A 5CENA 1M14A 1JALA 4NW5A 4TYEA 2V7AA 1YQ3B 4FL1A 4LM5A 4G17A 4YXDB 2VTIA 1E2UA 2XK7A 4ANSA 5IQIA 2VRXA 3ZC6A 4TYHA 3DLZA 3QX2A 3A9JA 2JNKA 4NJ7A 3P86A 2WX0A 5T8IA 1OECA 1IAHA 3DY7A 3O23A 3HM6X 2AQXA 4K1BA 4OTRA 2KNBA 4MD9E 1ZDXA 4EZXA 2RFSA 5JFSA 3F61A 3WYYA 2YIQA 3FKOA 1VYWA 4WNPA 1J7AA 4F7JA 2J4ZA 2YLAA 3QD2B 4XYCA 5IA5A 5CLPA 2D5GA 4IWQA 3ORZA 3R9DA 1KLGD 2UZEA 2M17A 1I4HA 3VBYA 3H8HA 4FTKA 3ZDMC 2CKOA 5HTCA 4XNEA 2Y3AA 2QCSA 1ZRZA 4WKQA 4V01A 4AKVA 3DCVA 4RVLA 4FNYA 2ETKA 2UZVA 2BUJA 1V1PA 4WPEA 5EG3A 4GG5A 1U5RA 1K51A 3QL8A 4WIHA 3LFAA 4NL0A 5JH6A 1Y91A 2W7XA 4AW0A 5BVOA 5I9WA 2Y4IC 2CMWA 4DE4A 2JITA 4UWBA 4XRLA 4QAYA 1S9JA 1BKXA 4L7FA 3UINB 1BT0A 5JK3A 4N6YA 3U4UA 2HK5A 3SA0A 2YLFA 3O8UA 3O13A 1UUPA 5EYCA 5HBJA 4C36A 2WXJA 4E4NA 5A4LA 1D5XC 1TS4A 5AR3A 1UBIA 4EH8A 2PVMA 3MIYA 3ZTDA 3LFDA 3GBZA 1YN3A 1WGGA 2IWIA 5HQ0A 3LZBA 2XKFA 1OB3A 3DKFA 2L05A 5DCNA 5AEKB 4E3CA 1VYZA 3FLWA 3L9LA 2Y9QA 3DQVA 4D2VA 4S2ZA 2UWQA 2CPKE 1OIQA 3U30A 4RVKA 1OKZA 2H88B 3F2RA 1W2DA 2ND0A 5C5BA 5E91A 3ITZA 3WOWA 4P16A 4OBPA 3LFEA 2K8CA 4FT0A 2KWCA 3BU3A 4NAMA 2CS4A 2R3FA 4YTMB 2MQJA 4W9LA 3VQUA 4EKUA 2BGFA 3NYVA 5BO4B 4I0TA 3TEZA 4G9CA 3RCDA 4EZJA 2YZLA 4U81A 4EH5A 3OMVA 2X4FA 4ALVA 4JG7A 3SKCA 4EORA 2ZXQA 4DFBA 3FHIA 4IWOA 5AUIA 2QVSE 3ET7A 3TJPA 2O8YA 4LK0M 3HV5A 5KBPA 3ZYAA 3MPAA 3APFA 5FTGA 5JFXA 3O7LD 3Q3NC 3H6NA 1DI9A 5BQ0A 3I0OA 5AUWA 4W9CA 3GB2A 4QYHA 4DFXE 1K9AA 4KKIA 2V3SA 3AE5B 4EZ5A 4I5HA 3W1SC 3BUBA 5FTQA 2DAJA 3PTGA 2W1FA 3T3NA 4XV2A 1LP4A 4IC7A 2FYSA 3DWGC 3PREA 4C35A 1UELA 4RX5A 3PE1A 4ID7A 3GFEA 3DHGC 4HVDA 3JXWA 1ZWWA 3RK9A 5E7RA 4RIXB 3DKOA 4FR4A 1KE9A 4EZLA 4L3PA 3VJNA 4O21A 4BDCA 2R3NA 1E5WA 3A2CA 3PSDA 3I4BA 3BVMA 4QNYA 4DTBA 3FZPA 5BUJA 3EQGA 4NUSA 3U2SC 2YJSA 2YEPF 2FO0A 4B9KA 1LPUA 4C4EA 4PTCA 3QD3A 4R7HA 1XCTL 3Q3JA 5IA0A 5M55A 4CFNA 3PPAA 3LXFA 1G5SA 3U8WA 1GNTA 3I5ZA 1O6KA 3F66A 4W9KA 4AJWA 3PUFC 3ZGZA 1VZ8A 5J9YA 4A9UA 3IG3A 4D4RA 1OTRB 3LM0A 4C00A 5D11A 1EUVB 3AE4B 4IAAA 4WG5A 1V0BA 2XYUA 2Z8CA 1IBXB 2C3KA 4EWQA 2WX1A 4F78A 4IC7B 2JAMA 2NP8A 1Y6AA 1SM2A 4R5SA 4C3RA 4U80A 4YURA 1ZYCA 4WBOA 3AU5A 1ZMUA 1BL7A