4IM2A

Structure of tank-binding kinase 1
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
659
structure length
618
Chain Sequence
GSMQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRNIKPGNIMRVIGEDGQSVYKLTDFGTEEYLHPDMYERVLRKDHATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVMGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase TBK1
publication title Structure of Tank-Binding Kinase 1
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 212
structure length 618
sequence length 659
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF18394 TBK1_CCD1 TANK-binding kinase 1 coiled-coil domain 1
A PF18396 TBK1_ULD TANK binding kinase 1 ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4im2A02
1.20.1270.420 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4im2A04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4im2A03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4im2A01
4KZ0A 1L8TA 4GKHA 1F9JA 2I1KA 4ACCA 1BT0A 3MB6A 2ZVOA 4ZTNA 3H7PA 3UNZA 3CEKA 4HGTA 4G6LA 3KW5B 2BFXA 1GZNA 4RZVA 5JRQA 4XG2A 3VBQA 1XD3B 1ZLTA 3HP2A 1UNLA 3FQSA 3W2PA 2VTQA 1YVJA 2AYPA 2XEYA 4WBBB 2WMWA 4CFNA 3M11A 4IHPA 1NVRA 4RIXB 3AG9A 2WX1A 3S3IA 3WIKA 3BE2A 4G6OA 1RQQA 5GZ8A 2CN5A 2NRYA 4OW8A 4HK2A 1RE8A 4KIPA 3AT4A 4UYAA 3E3PA 4XP2A 3CMMB 5EHLA 2HWOA 3EFKA 4FSMA 4TNBA 4O22A 4O0XA 3IVFA 4L3JA 5LQFA 5C23A 4YP8A 5KCVA 3JSVA 1W0XC 1QPCA 5JFSA 1U54B 3WAOA 1ZW7A 3ACJA 3G0FA 4MHAA 1J1CA 1M52A 5CENA 3RK9A 3UJGA 3KYCD 3VBTA 3W18A 3UP7A 4O7RA 1G6JA 4RJ8A 3IS5A 3H1UA 3CBLA 2AWTA 3NVMB 4R1VA 3KRJA 3Q32A 2YLMA 5C4LA 2Z7QA 1V2YA 4FI1A 2G4SA 2O63A 2VX0A 3M95A 2XH5A 1OEYJ 2X7FA 4TYHB 2CGUA 4MKCA 5HO7A 1OPJA 1WZ3A 3F5UA 1L2NA 2MBBB 3DBFA 1OEYA 5AEKB 2HTHA 3VW6A 2KDBA 3P23A 3DFCB 1YHSA 1H25A 4TT7A 4JQWC 4M12A 4B95A 3BBTB 5FM2A 1CKPA 5K4JA 3AC4A 3C9WA 2VTPA 2BRGA 1UNHA 2YJRA 2Z2WA 3SHQA 2EWAA 5HESA 1IASA 3D0EA 1WBPA 3HAVA 2K8CA 3VS7A 3EQDA 3MVJA 4NYEA 5H3QA 4L00A 1V0PA 2YM8A 1ZYLA 4RIXA 2JD5A 3WF5A 2YITA 2X9FA 5LVNA 4IH8A 4UMUA 3QTQA 1QPEA 2C9WB 3A4SC 4GJ2A 1YJ1A 3ZRFA 5D41A 5DR2A 1E90A 3VS1A 3MH0A 2QU6A 1WVXA 5J9LA 4RX9A 3O2MA 4CFXA 4WWNA 4G3DA 4D2PA 2KWUB 5LXIB 5K3YA 2DZKA 3AXWA 3BEAA 4JBPA 3DPKA 3IG7A 4C8BA 5TO8A 1WXMA 3QA0A 4EK4A 5D2MB 3TN8A 1O6YA 3OOGA 3PYYA 3TNPC 4EK3A 4FZDB 4GDLB 1U54A 5A14A 2BRHA 4CFUA 3UIXA 4E93A 1WJNA 3EL8A 3H0YA 4HNFA 3R00A 3LFSA 3U55A 3UVQA 3OWLA 2BGFA 2B54A 4IB1A 3P9JA 4A3PA 5HO6A 2WU6A 4C02A 5L2TA 3BYUA 3ZIMA 1FINA 1QPDA 2R3RA 5EYDA 2MLBA 4TYHA 3PRFA 4L45A 2HW6A 4PYZA 4E73A 5EDRA 3QX2A 3RUIB 3OXTA 3IECA 2ZB1A 4U3ZA 3IFWB 2I40A 2J7QB 2GHLA 5IZFA 1WBWA 3EIDA 5HNGA 3JR1A 3BELA 2B55A 4EK8A 4QYFA 4DBXA 1H1QA 1LPUA 4LJPB 4NWMA 2NR2A 2RFNA 3TNQB 4YC8A 2PVKA 4YJUA 2PTKA 3PRZA 4M0ZA 2C6LA 4HPLB 4GSWA 1S9JA 4J8MA 3T9TA 1V9JA 5EK7A 1G5SA 2XNMA 4L6QA 4AZSA 3G9NA 3KXGA 4GRBA 4YLJA 5JSMA 4AT3A 3R66C 2E9NA 4O2PA 2YDIA 5CTRC 4HCNB 3KMWA 2RD0A 1ZMWA 3QQGA 3KULB 4BDCA 2JBPA 4FJVB 2GSFA 2X81A 2BWFA 3OEFX 2FO0A 2XK7A 5M4CA 1WMKA 3SRVA 2ZM4A 5IEYA 4QPMA 3PVLA 4UYNA 2IO0B 2N9XA 2XK6A 4XG7A 5D7GA 4JBOA 1WGHA 2VWYA 4ID7A 4HOKA 4FSTA 3NPCA 2N7EA 2DAFA 3ENMA 3FEGA 3EQFA 1PY5A 2W1GA 5DPWA 4GDLA 3LJ0A 4XNEA 2K1FA 3NYXA 4N0SA 4RC3A 3VHEA 3CP9A 2QG7A 2W9NA 4ZSAA 3K54A 4RFYA 3W8QA 4ANUA 2QO2A 3QU0A 1OPKA 4Y85A 2E9UA 3PXRA 4CYJA 2JDVA 3R7IA 3ZFMA 4LV5A 4BBEA 2C68A 2X8DA 4O7SA 2CPKE 2Z59B 4C33A 2W4JA 3PRMB 2EVAA 4BGHA 1WBSA 3W2RA 5AIRA 3CSFA 2WOTA 4BGGA 4JR3A 3FYJX 4PTCA 4YHFA 4EZKA 3MS9A 3LFNA 3MFSA 3C4WA 3R9HA 4DEGA 2OU7A 3R7UA 1QL6A 4NKSA 2UW4A 3GP0A 3G90X 3EFWA 1OUYA 4ORKA 4BCIA 4EUUA 2R3QA 2F57A 2C5LC 3ALNA 5IQBA 3D5VA 1ZGUB 3F2RA 3SVVA 1OECA 5J17A 3LE6A 5BVNA 4QQCA 3P4KA 3K9OB 4FIGA 3FWQA 4I24A 4A9TA 1P2AA 5E9EA 3U6JA 3KMUA 3CKXA 1J3HA 2V22A 1H4RA 4X2KA 4QP1A 4N70A 3TZ9A 2ETKA 3WILA 5GJDA 4E7WA 4DH3A 1DAYA 5DGZA 5AWMA 3F3ZA 3N9XA 4BOSC 4ANWA 2QR7A 1AARA 2KDEB 4X57B 1W84A 3PRIA 4IC7B 3GFWA 4W9FA 5CSVA 4IAYA 4TUUA 1WR6E 2ZVAA 5IU2A 4L01A 2F9GA 2WTDA 1BI7A 3A7GA 2UW7A 2XIYA 4P2KA 2GMXA 3NNUA 4RVMA 5I9YA 4P7IA 2YIQA 3U51A 2LWPA 4LUEA 4MSQB 4U97A 3UNKA 4WJNA 3ZBXA 1LR4A 3ZXTA 1P0RA 1YRPA 3QLGA 3QCYA 4FV4A 4D28A 5LLIA 1MQBA 2QO7A 2QOQA 5AR2A 3RGFA 4DH8A 3BYMA 3MI9A 4JQ8A 2OIDA 2N1VA 3FXXA 4PV0A 3KEXA 2DHZA 4V04A 4MBIA 4XV1A 4MX9A 1BI8A 1M2RA 2ZJDA 3LM0A 4BHZA 1IYFA 4FHJA 5CTPA 3C4XA 1Q3WA 3PY3A 4CV9A 2GQGA 2PVFA 3JY0A 2BYFA 5HEZA 1C3TA 2VUWA 3UIMA 4EKUA 4TYEA 3Q96A 2KLCA 2KFKB 5BUIA 4FVQA 5IEXA 3GVUA 3R2BA 3K3JA 1YOLA 1E1VA 4S33A 2OJFE 2AL6A 3EOCA 5LMBA 2WMTA 4RM9A 3RPYA 3ZXZA 4DEDA 4M8MA 4FKUA 3W2SA 4FTNA 4J53A 3QZFA 4ZTQA 3F3UA 4IUMB 3MESA 2VTLA 4QTEA 3DBHI 4GEOA 2Y4IC 2WTCA 2QVSE 4KD1A 2LJ5A 3HDNA 2H8HA 3Q6WA 1R1WA 4E8AA 5BUEA 4YL8A 5BYLA 4PX6A 2FA2A 4IC7A 5CT0A 1BL7A 2B9HA 3MB7A 2JFLA 4TYGA 4I6QA 3TACA 3K2LA 2PE6B 4MNEB 4FSQA 3ODZX 3APCA 2UVZA 3L8XA 5D7AA 4J96A 4K0YA 3FL4A 3NX8A 4HVIA 3UZPA 2R3FA 5FRIA 4NFMA 3KFAA 4C36A 2CU1A 5GNKA 4CYEA 5TOZA 4GFOA 4FKJA 3QA8A 4C4FA 3PIZA 4IANA 3MDYA 3MGYA 5KZ0A 3RMFA 3PP0A 5EKNA 4I0SA 4FTAA 4ZSGA 4I6LB 5I9VA 5IH6A 4IDTA 3TBLD 5IA7A 2C5NA 1WBTA 2C3IB 4EOMA 3MBLA 4CQEA 2CS4A 4LOOA 4FTUA 4ZY5A 4FIEA 4F6SA 5LCJA 4RJ4A 3VDZA 1U46A 2WMAA 5A4TA 3PZEA 2D2QA 2J0IA 3FMJA 4EZ7A 2KFKA 4EOLA 3AC5A 1TQPA 3HMIA 1FGKA 3C51A 3SKCA 4QRCA 4RX8A 4MXXA 2X7GA 4DK5A 5J5SA 2FSOX 2XBBC 2G15A 4IM2A 1SNUA 4XP0A 3VAWA 1KE9A 4FVRA 1YWRA 5HHWA 2PE1A 1H26A 3IQ7A 4OGRA 1PXMA 4AZEA 4JLCA 4TY1A 4QNYA 2JDRA 3FZSA 5E8SA 5EDSA 4FN2A 4C4HA 3QKLA 1S3SG 5CSXA 4WT6A 3KXZA 4M84A 5DG5A 3LJ2A 5KNJA 4R5YA 3VULA 5CHVC 3DB6A 3TZ7A 1H01A 2BRNA 3RALA 4WBOA 2OF2A 4MNEA 3LFEA 3VUYA 4BBNC 2CNVA 3QQUA 2ONLC 1OIUA 4MH7A 1YI3A 4J98A 3FAAA 3ALOA 4FKPA 4BCHA 3R21A 4BCGA 3BU5A 2K8HA 2D11A 2JBOA 1WY8A 4EHEA 2RKUA 5H2UA 3WF7A 3V6RA 1K8RB 4NW5A 3JW0X 3ORTA 4Z7HA 4HDQA 3SG8A 4W9XA 4M8TA 5J7BA 5BVKA 3Q53A 5KO1A 1LP4A 3Q2JA 2CKOA 2PMIA 3LCOA 2BTSA 3ZRMA 3QZIA 5M08A 3UZTA 1IG1A 4F4PA 1XH4A 4CMTA 3UDBA 2OLCA 1C1YB 2CHWA 4RA4A 4EOQA 2XMYA 3COMA 3V51A 4U42A 4ANSA 3OMVA 5D9HA 4D2TA 4WOVA 4UMQA 3VH4B 4NM7A 4MJSA 4GW8A 4EORA 4QMMA 5I5ZA 4J71A 5DHJA 3E8EA 4DITA 3O7LD 2XCKA 4W8EA 3WI6A 5A3XA 4X6RA 1YDSE 3VJNA 4KDLB 4MQ2A 3GNIB 5AP0A 3QTSA 3QBNA 3RHXA 1RLFA 4ANLA 2QOLA 3RVGA 3PG3A 4JXFA 3EYHA 4PY1A 3WF9A 3LM5A 4FE2A 4BWKA 1X8BA 2F7EE 4EOIA 4KV2A 2H96A 4MF1A 3VO3A 4BDAA 4ACDA 3CJGA 2R9SA 4F9CA 3CD3A 4XUFA 3ULZA 1GAGA 5C1QB 4I6HA 1OKYA 5J87A 5I9WA 4HJOA 4BB4A 3QQLA 2VX1A 3KH0A 5CU3A 3UOKA 2C0TA 5KMKA 4S30A 4GUEA 2ZZPB 2KLGA 1V1KA 2NNWB 3OEZA 4JBQA 1CM8A 4KSQA 2IVTA 3I5NA 3NUXA 4ZTLA 4IG7B 4BFMA 2Z7SA 3FSFA 1DM2A 4UY9A 2ZM1A 3NNWA 3BLHA 4F09A 3EQPA 2B9JA 4RVKA 5CAPA 4O84A 4CFVA 4PS7A 4M0WB 3MA3A 4BY9E 2XEZA 4GK4A 1U5RA 5CI7A 4PMSA 4LDTB 2WTKB 4LRKA 4FR4A 5GZ9A 4KKHA 3PGEA 3KVXA 2JKKA 3ZYAA 3WOWA 1M17A 3PXFA 4JI9A 3UOLA 1KOTA 3RZBA 5C03A 2VV9A 4CFWA 3FMMA 4BI0A 3VQHA 4NAWB 2KDIA 4QMXA 4QP7A 4PQNA 5JH5C 3R9RA 1UKHA 3ZDIA 1KM7A 1BX6A 3FMKA 4BDGA 2YM6A 3MH3A 3S1HA 4PP9A 2FUHB 2GMIC 4YGAA 2ACXA 2I0YA 4TYIA 4B6WA 2CR5A 2YCQA 4QMOA 3DVNV 2OO8X 2HY81 5AA9A 3NNVA 4LRJA 5AV0A 3ZRLA 2KTYA 3FUPA 4Y8DA 2LUEA 3M42A 3KXXA 4IAFA 3ACKA 1DAWA 3JYUA 4DEEA 3T8MA 2UZLA 2YM3A 3SD5A 3VS0A 4DFUA 4BDEA 4J1RA 4IVBA 5LWNA 4B7TA 4BTKA 4DBNA 4DGOA 2AEHA 4E4MA 3PLAE 2JLDA 3DCVA 3APFA 3HEGA 3F5PA 2W06A 4CGAA 3UYSA 2WNTA 3PVUA 4F9BA 3UE4A 4ZY6A 4K1BA 2DYLA 4NUSA 2ZB0A 2DZIA 3ENEA 3KRRA 3DBRI 3NCZA 2PUPA 4B9KA 3MVHA 4M66A 4YZ9A 2CMWA 5CY3A 5AR8A 3Q9ZA 4TQ1A 4PPAA 2C3LA 1K3AA 5IG1A 1I42A 3NLBA 1JQHA 2DQ7X 3FZOA 4FSRA 3OXIA 2IZUA 4B9DA 4O91A 3VC4A 3R9NA 3WA0A 3M63B 5IMEA 2B3AA 1ZOHA 1WXSA 4HCUA 1FVRA 3V5JA 4UV0A 4AW5A 3IDPA 5KMJA 4NAWA 2LZ6A 3PJ2A 3IK3A 4UEUA 3AC8A 1WVWA 3NW5A 3CGOA 3UVRA 3ONSA 1S9IA 4BZDA 3UMXA 2W5BA 2BZIB 5HX6A 3EFJA 3BLQA 3QL8A 4M0YA 4BDBA 1UBQA 1E8WA 3A9KB 2AL3A 1W82A 3O8TA 3E64A 4IC8A 1XO2B 4OTWA 4RVLA 3NUUA 1WFCA 5ANGA 4A9YA 5BX0A 2K6DB 4Z16A 3TL8A 4NJ7A 3W16A 2XJ2A 3DKOA 1TQMA 4L8MA 4IVDA 1SIFA 2IY1B 4URKA 3F7ZA 2XKDA 3FXWA 3BX5A 4BWPA 2J4ZA 4N6YA 3MFUA 2R4BA 3NYNA 5JKGA 1KJTA 3DDCB 2WEVA 1E7UA 1ZZLA 1K9AA 5HTIA 2QHOA 3WYXA 4FV9A 4DEIA 3LFAA 5HBHA 4BKYA 4EH9A 4L52A 3OY1A 3HIZA 2MCNB 4EK5A 2L8JA 2W5HA 4C61A 4U44A 4ZTSA 4B8LA 1JPAA 3T9LA 4Y46A 5A46A 2WQNA 4F7JA 4FZAB 4KZCA 3TCAA 5GJGA 2C6TA 4KBKA 2R3IA 4M97A 3E62A 4DFZE 1M2PA 3HX4A 2VO7A 4FG8A 3DK7A 4W4WA 2O2VB 2GTNA 5JZEB 2L76A 2LVOA 4ZRJA 3E8NA 1UU7A 5LARA 5BYYA 3OC1A 2IW9A 2IZTA 4DWFA 1JOWB 4UMPA 2LRUA 2HYYA 3SXSA 3ZZWA 1NXKA 2H9VA 1Y8GA 1SGHA 4HYIA 3R9OA 4D0XA 5HCYA 2JAMA 4K77A 4AW2A 4LL0A 5HVJA 5BMMA 4KIQA 1JKTA 3DOGA 3A9KA 5HKHA 2XK9A 4QP8A 3F69A 4CKRA 4IB0A 5AM7A 4F63A 5DNRA 5AX9A 5HO8A 2OXYA 2PVHA 4FV3A 3FPQA 4MBJA 3ZLWA 3L17A 1HOWA 4DHJB 3DY7A 5L8KA 2Y8OA 2FGIA 2ZNVC 1UBIA 3QUEA 2YCFA 1YXUA 4WSYA 4HPUE 2RF9A 2PWLA 5HE2A 2XK5B 4G6NA 3QCXA 4II3B 2QURA 3O71A 2VTSA 4ZXTA 4FL2A 1YXTA 4PP7A 3FMLA 1O6KA 3VTUA 1JWHA 2UW0A 3VHKA 5IA5A 2YAAA 2MBEA 4NQLB 4EC8A 2CKPA 5HTCA 1Z2MA 3U6IA 1EF1A 4NK9A 3QHRA 2HOGA 1MQ4A 4IFGA 3R22A 4G31A 4HJKA 5IQHA 3LMGA 2R3GA 1H8FA 4OBPA 5IKWA 3E87A 3B2TA 3SW7A 5CLPA 3Q2MA 5JZJA 3DPDA 4I22A 2CHLA 2PVLA 4LGHA 4O38A 5CEIA 2BILB 5M53A 4O7TA 1Q8YA 3LJ1A 4EHZA 2EMSA 4B8MA 3RBWA 3HGKA 2BDFA 3DS6A 5F94A 2G2IA 4W9WA 3EECA 1STCE 3CLYA 5L2WA 3QAME 5HNIX 5M09A 4HLEA 4C0TA 4ZK5A 4XRJA 4FV8A 4K7WA 4BWXA 3OCSA 3FC2A 5J1WA 2Y6OA 2PU8A 5EM5A 4MSMB 5LJJA 2ITUA 3FZPA 2BALA 3H9RA 4E6AA 5EM7A 4ACHA 1YOMA 4CMOA 3F2NA 3HYHA 5HBEA 5HG9A 1O9UA 4FADA 4F1TA 3E3BX 2XM9A 4RQVA 4MQ1A 5CU6A 4ONAA 3L13A 4CG9A 5E92A 2J6MA 3W32A 2J0JA 4PL4A 5EDQA 3HM6X 3OVVA 3O65B 3O50A 2KJHB 4OTGA 5L83A 2WGJA 4TYJA 4NNJB 3MPMA 4EH7A 5KHXA 1WBNA 4UWYA 2EB2A 2FSTX 3PV1A 2YEXA 5CEOA 1RDQE 3APDA 3LFFA 3EZRA 1A9UA 3LFCA 3NOBA 2PVMA 2XK5A 4B0GA 2IY0B 3KL8A 2CKEA 2KULA 1OIYA 4YPDA 3FI3A 3MYGA 1U4DA 2OGVA 4F6WA 3MH2A 4E4LA 1XT9B 1Q4LA 4CFMA 5FTOA 2BPSA 3C1XA 4D1XA 1KE8A 3IW8A 4W9EA 3FLQA 3U9CA 4WRSA 3ZFYA 3LXPA 3L8PA 4PUZA 3SD0A 4R5SA 3GFEA 3A8XA 5DIAA 2BTRA 3VN9A 3HV5A 3ZLSA 3R9DA 5DA3A 1G3NA 2VGOA 2UZEA 2H34A 2M0XA 3KXNA 5I3OA 3QGYA 3F3VA 3R8LA 3EQCA 3AT2A 3TNWA 4Y73A 2IO1B 3M2WA 4MXYA 4PNKA 4PF4A 4FKWA 4FV7A 4OBOA 2LD9A 4RRVA 3DBLI 1KE7A 4PDPA 3R3MA 2VAGA 4YTFA 5KMLA 3OFMA 4FSUA 3ML8A 1O6LA 1OPLA 2C0OA 5L3AA 1KWPA 5CXZA 4EJ7A 4HVGA 4I0TA 1H1PA 3Q9YA 2HENA 4B99A 4NJ6A 4FMQA 2PZYA 2XNEA 2VD5A 2FIDA 4EOPA 3DNEA 3R8UA 3NUAA 1A06A 1VZOA 3H3CA 1J7IA 4ZSLA 4H1MA 2CGVA 5LMKC 3HA6A 4FT5A 3PG1A 4E74A 3C0HA 1GZKA 5TF9A 3KA0A 4QD6A 3ZSGA 2IN6A 3ZM4A 3EFLA 3QUPA 1WF9A 2F7XE 4RVTA 3VF9A 3BV3A 4IWOA 3QHTA 5I3RA 3ZC5A 4C4JA 5L95C 3WAMA 3Q60A 3NGAA 4R1YA 5DH3A 4GT4A 4DLJA 2QOFA 3A4RA 3L0WB 1OM1A 4OAUC 3DKFA 4BIEA 3CCNA 2GBMA 5CS6A 3ZSIA 3PY0A 4NTTA 5I9XA 2GNIA 1WFYA 2UW3A 2RFSA 3FLWA 2CKHB 3H9FA 4F65A 3RHKA 1Y57A 5AZHA 4IZAA 2W99B 2CNQA 4ACMA 4E20A 1LEZA 3OCTA 4R7IA 1WX9A 4CFFA 2V0DA 3FMDA 3R1YA 4A4XA 4P5QA 2ZOQA 4F0GA 4A06A 5CAOA 3PIXA 3IKAA 3PPZA 4MD9E 4GIIA 3BPRA 2CLXA 3GQLA 3LQ5A 3RINA 4ERWA 1H28A 3S2AA 4GU9A 3UMWA 3D7ZA 1J0GA 1LM8B 3TIZA 3WZJA 1NDDA 2WMSA 2C0IA 3W2QA 3MWUA 3OT3A 4BDHA 1V0BA 2IO3B 3R83A 3EMGA 4ZMEA 4AZFA 3UO6A 1XQZA 1CTPE 4XG4A 5JK3A 4O7ZA 1WRDB 2C30A 2DUVA 3QRTA 2J2IB 4YC3A 3ZBFA 3BBWA 3POZA 4AXAA 4E71A 4W9DA 4C35A 2PMNX 4X0MA 2KZRA 4F9YA 2RPQA 4QMUA 4QTDA 3JPVA 3ZONA 3FLNC 3EL7A 5BYZA 4A7CA 3BGQA 3CPBA 2BRMA 1ND4A 1ZY5A 5EFQA 2Z02A 4E5BA 4CXAA 2KC1A 3RZFA 3Q3FA 4RZWA 4TWPA 2R3HA 2MP2A 1PXPA 3ZC6A 3U87A 1I35A 5G6VA 2YIYA 3VTWA 4L9IA 3KC3A 3DZQA 3DKCA 3ECIA 4LOQA 2XB7A 2KNBA 4FF8A 1H4LA 3G9LX 4AAAA 2WELA 4XLVA 4FKQA 4R7HA 1WGRA 2Y7JA 5E8VA 5IEVA 5CNOA 5HCZA 3NUPA 3DAEA 5E6PA 3OBJA 2WZJA 2WMQA 5M56A 3P7AA 2Y0AA 3Q5ZA 3E7OA 1XQQA 3I3TB 2RG5A 1PYXA 2JIIA 2I1MA 2W7XA 4DFLA 2BKZA 4IMYA 1V5OA 3QD0A 3TKHA 3VNTA 3VS6A 2ZM3A 4XYFA 3D2KA 1XBBA 4IB3A 2KO3A 1I44A 1KV2A 3HUCA 2BZHB 4QPSA 5CNNA 3BZ3A 2JT4B 2QO9A 1GZ8A 4AOJA 3R02A 3UIUA 4S34A 2GNFA 4CNHA 4DF3A 4KVGB 3QQKA 4I3ZA 4EH5A 5AV4A 3DCGA 5E6NA 1IA9A 4FSNA 2G4DB 4QP6A 5BMSA 1YX6B 5D10A 3E8CA 4QMWA 3R0TA 3UO4A 3R73A 3I7CA 3WZDA 4RJ6A 4MVFA 2ITPA 4AQCA 3LDZE 3F7WA 3NY5A 3D4QA 4CZTA 5HG8A 4QQ5A 5LMKA 3AT3A 5JGDA 2X1NA 1CMXB 2X2MA 4BYJA 2VX3A 2E9PA 2X8IA 2W96B 5CEPA 4DEBA 3TJDA 2ITYA 2XEWA 5GIPE 2OIQA 4UMRA 4CCBA 5DEYA 4XP3A 4BVUA 2JXXA 2UYZB 3LLAA 3PXKA 2KJRA 2KKCA 4QTBA 4ASWC 5A4CA 2PJHA 5M44A 2X6DA 4KNBA 4FTTA 3KY2A 4JG8A 3NSZA 2A0CX 2OG8A 2I0EA 5AV3A 3KK9A 4GK2A 2IZVB 5T3QA 2XYNA 2MW5A 1JAMA 1F5QA 4X3JA 5B2KA 2YM4A 1H0WA 3DLSA 4F08A 1G8AA 2LVPA 3OWKA 4FV6A 3ID6C 3GCPA 1KSWA 5IISA 2YACA 3DFAA 3BY4B 2JPHA 4F9WA 2C6DA 1E7VA 3H0ZA 2KXJA 2J51A 3LJ3A 5FGKA 3MPTA 3UVPA 5HLWA 1PHKA 3D14A 4YR8A 4AOTA 3B08A 2C6EA 4ZOGA 1JKSA 5IQCA 1WH3A 4EOJA 3D32A 2CHZA 5L2SA 4FGBA 4GB9A 1U59A 3UINB 4LGGA 4FTQA 2CN8A 5JGAA 3VS3A 3LXLA 3TNIA 3AC2A 3LFDA 4QMSA 5A6NA 1XH5A 5DI1A 1WE7A 4YZCA 3HP5A 3VW8A 4AP7A 3DQVA 5JQ5A 5TT7A 3MVMA 3IBEA 5K5NA 3U54A 2JZZA 4L43A 4X7QA 1OL7A 3PTGA 2CKQA 1R4NI 2C1BA 4AUQC 3LIJA 4K18A 3R7VA 1RRBA 1W7HA 1QPJA 3ZTDA 2J9MA 2J50A 1FQ1B 4WG5A 5AUXA 2N7DA 3D5WA 3QRIA 4HXDA 4EOKA 3U8WA 4JIAA 3I4BA 4R77A 3E92A 5EHOA 4IZYA 4CCUA 2CGXA 4U7ZA 2JIUA 3N32A 3KVWA 4JBVA 3AXCA 4J7BA 3RPVA 4AZVA 1PMNA 4JG7A 4XH6A 4O7YA 2BPMA 3TIXA 1P98A 2BYVE 3JXWA 5FDXA 4UXQA 3UOHA 2PVYA 3CQWA 3VBXA 4ZSJA 4G9CA 3MN3A 3ZS5A 2WTVA 4QT1A 1EF5A 1XH8A 4RJ3A 3U30A 3UP2A 3O23A 1WZYA 3QC4A 2R3KA 1OVEA 5AIKA 2XNGA 3UTOA 4GJ3A 3QQJA 1Q0WB 2OJGA 5BNJA 5FLFA 5AR3A 2IO6A 4C38A 3KYDD 4EHGA 1YWVA 1P1AA 3B0AA 1RJBA 3SQQA 4E26A 3ORMA 3DV3A 3BHTA 3QQ8B 2QODA 2X7OA 2WIHA 3FLZA 5H9BA 5M4FA 3N4TA 4O0WA 3QKMA 3BHVA 4FX3A 1YDRE 4FV1A 4RJ7A 5FUTA 4BBNF 4RLLA 2WKMA 4NY0A 5E91A 5ITAA 5HQ0A 4L44A 2ZCCA 4DTKA 4I1ZA 3TZ8A 3BE9A 4RQKA 4CRSA 4FEQA 4ZZOA 3V04A 5B2MA 3C0RB 3LFBA 2YWPA 4ENXA 3PE2A 2L3ZA 2JRIB 4NIFB 2J0MB 2N9EB 4FC0A 3ATTA 1V86A 5LWMA 1UA2A 4FIJA 4NL0A 3FI2A 1R78A 2ESMA 4ANNA 4AX8A 4AE6A 4C4IA 3DJ6A 2KQ7A 3TMPB 4EKLA 4EH2A 5CWZA 2JF5A 3SGCA 3D5XA 2V7AA 4O0TA 3SLSA 3EQGA 3L54A 5DFPA 1P4OA 1NBFC 2C6OA 4J99A 5EW8A 3IDBA 4KS7A 4QNAA 3DVGY 3V3VA 4U79A 5J8IA 2KWCA 5KBQA 3ZO1A 1T46A 3A4OX 3KUDB 4A07A 4EFOA 3I0OA 4IM3A 3OF0A 5EI2A 1WM3A 2AYOB 4CEGA 2VWVA 4CG8A 5E8ZA 1KOAA 5AA8A 1J7LA 2PZ5A 3GBZA 2UZWE 1NVQA 4EEVA 4DH5A 3X0WA 3JVZX 2WD1A 1WE6A 3ZH8A 1Y6BA 3PA3A 4V05A 2RG6A 4DT9A 2P0CA 2W9FB 5LVMA 4GVJA 4TPTA 5AZFA 3U7DA 4KSKC 4O27B 4OVVA 1QZEA 3HV4A 4X3FC 3IO7A 2C5YA 3NS8A 4GOCA 3AD6A 4RWJA 2GS6A 4PMTA 2FCQA 2ASQA 4LI5A 5C8NA 5D11A 4FL3A 3OT8A 3OUKA 3RK7A 3H4JA 5KBRA 3FLYA 5CXHA 1LEWA 3VF8A 2WTJA 3IHPC 4K7UA 2BHEA 4CZUA 3ORNA 2W4KA 2DWBA 4NQKE 4USFA 5IA0A 4NIFA 2YLFA 4LMNA 4C2VA 4DN5A 5L4QA 2J0MA 3MW1A 3QXOA 5BQ0A 5AUTA 1GY3A 3A7IA 2DENB 2BFYA 1WZ0A 4DCAA 5BVDA 4ZP5A 3KF7A 4ZJVA 3HV3A 4YTIA 4F6UA 5EDPA 3P0MA 4OTQA 2K6QA 4WNKA 3L8VA 4LGDA 5HGIA 5IF1A 4OR5A 1TTNA 1FOTA 1WX8A 4R3PA 1JBPE 4Z7GA 2W1ZA 4ENYA 4FG9A 5JHAA 4EOOA 1OL2A 1H1RA 2JKOA 4ZSEA 5JHBA 4QP9A 4BZNA 5KE0A 3AU4A 2YWVA 4K1RB 1PXNA 4FBXA 4FKTA 3EWHA 3UPXA 1Z57A 2VTJA 3WANA 5CASA 3ZCLA 3CXWA 4YNEA 1F0QA 4GL9A 5ACBC 5HCXA 5TE0A 3CY3A 5FEEA 3PWDA 4UZDA 1ZY4A 1YD8U 1YHWA 2EB3A 3NIEA 2FB8A 4H58A 5EOLA 1JRUA 2XK4A 4XV3A 1IEPA 2NPQA 5AP5A 1ZMUA 4AOFA 1Q41A 2C3KA 3NAYA 4QMLA 5J79A 1FVTA 2UV2A 4BL1A 4D1ZA 1HCLA 2VTMA 4MCVA 3SOCA 1REJA 4YBKA 3VS2A 4ZEGA 3LMHA 3D9VA 5TR5A 4QQTA 4F7NA 4GSBA 2YVCA 4XC2A 3PVBA 1UU3A 2PUUA 1XH9A 3NDMA 4XV2A 1SYKA 3ZFXA 1Q24A 4BBFA 3VVWB 2UZBA 4X2FA 3VUGA 2R3NA 4PYUA 1MRVA 4G3CA 1R0PA 2KX3A 4YLKA 4L53A 3SA0A 4KS8A 3JVSA 1BUHA 2FVDA 4MXZA 1TBEA 4DDGD 1PJKA 2N1WA 2OWBA 3WZEA 3MJ2A 3HHMA 2BRBA 2GU8A 5JH6A 1IRKA 3SRVB 4MYGA 3O96A 3DXNA 2V1YA 3HECA 4YJVA 2O8YA 3G33A 2PMLX 4FZFB 5J5TA 4ITHA 5KKRC 3GENA 1VYWA 3OP5A 4O0YA 2BAKA 5BVWA 4EONA 2ZYBA 4EC9A 4GMYA 3A4PA 1OI9A 3COKA 2OF4A 1NVSA 2UW8A 3PXQA 1HE8A 2I0HA 3R2YA 4FIIA 1JVPP 4HZSA 1UVRA 4WUAA 3OLMD 3RYTA 3VS4A 4EI4A 4ZS0A 3PXZA 4IZ5A 3U6HA 5F1ZA 1Q8UA 3CS9A 4WWPA 4ALWA 4AUAA 2R64A 4L68A 4W4YA 4O2ZA 1EUVB 5DMZA 3QYWA 2OOBB 5CHWA 2BKKA 4USEA 3ZNID 4A9RA 4FTIA 2WAJA 3MTFA 3EKKA 3KUCB 4CT1A 1PXLA 2LRWA 4YTHA 4MD8E 3RAIA 3EHVA 4NH1A 5FP6A 3EHAA 4PMPA 5GJFA 4BKZA 4YSJA 3VUWA 3ULIA 5H8EA 4J95A 4G2FA 4EBVA 3KRXA 2ITZA 3QD2B 1L7YA 5FTGA 2XVDA 4AGDA 1NA7A 4CV8A 4ZIMA 1JSVA 2HZIA 4BKGA 2VGPA 3OZ6A 5CX3A 2X9EA 5HBJA 3R8VA 2A19B 3BHUA 3VUHA 2IWIA 4DFYA 2MX2A 3L9MA 1G8SA 2GNGA 3QALE 3FYKX 3PA5A 3QWJA 3WIGA 1E8XA 4HGLA 4U40A 3I81A 4TKNA 4HCPB 1GIHA 4A4LA 2XJ0A 1SVHA 2FH9A 3NW6A 2BUJA 2XBAA 5FBOA 1ZYJA 4H3BA 3PVWA 2IJMA 4E4NA 2BKRB 4EOSA 3KGAA 3O8PA 1B38A 4WUNA 2V55A 4AA4A 2OIBA 3P08A 3L08A 3NRMA 5CF5A 2W17A 4E6DA 4JX3A 2P33A 3VBWA 2WMUA 2GHGA 2NBWB 4R6VA 4I4FA 3QYZA 4KKGA 5K9IA 3IONA 2UVYA 3VQUA 1MRYA 5F20A 3S00A 3QWKA 1A48A 2A1AB 4GT3A 4IE9A 2YZLA 2CGWA 2EU9A 4RWIA 3GCSA 1KLVA 4EH3A 1OKVA 4QYYA 3TCPA 2DYOA 3ZDTA 3FMEA 1WCCA 3BI6A 3G5DA 4AN9A 5LVOA 5HI2A 3MA6A 3CPCA 4NM0A 2LGDA 1WM2A 1X1MA 4JAIA 4TWCA 2WOUA 2FNJB 3KF4A 2JWZA 4C34A 3MIAA 4GT5A 4ANBA 3RULA 4TXCA 1DI8A 4R78A 4BCMA 4FK3A 5IA1A 3GGFA 5A9UA 3IG3A 2BDJA 2B4SB 2PVRA 3TTIA 1SVEA 3C50A 2UZNA 2R3OA 3UIPB 3UBDA 3ZO4A 3HMOA 2VO0A 4RFZA 4IM0A 5HD4A 4FTCA 4FYOA 3IOKA 2HZ4A 3VAPA 3DAJA 2UVXA 3FMNA 3E63A 5KMMA 2ITWA 3TI1A 2JY6A 3H6NA 2L0FA 4FNWA 2JDOA 4ZAUA 5J2RA 4YSMA 4WIHA 3PS6A 2BCJA 1OL6A 4LJOB 4S2ZA 3IOPA 5HZNA 4PS8A 2WQOA 4FIFA 4AJYB 3ZM9A 1ATPE 3TDWA 3ZTCA 4I4EA 4ZRIA 4O7NA 1CKJA 4KKEA 4EYMA 4MGKE 4JX7A 2PPQA 4HPMB 1I09A 3QARA 3BGZA 3SXFA 2J90A 2XNOA 3AOXA 2REIA 2GNLA 3OHTA 4F0IA 1WVYA 3LCSA 4NEUA 3QX1A 4OTHA 3MV5A 5DWRA 4EJNA 3FDNA 5E7RA 1J7UA 2XRUA 2CJMA 5AAGA 4YHTA 4QTAA 3R1SA 3MHSD 3ELJA 3V5QA 4CLIA 3IGOA 4FHKA 4FSZA 5HORA 4IAKA 4BICA 3MVLA 3M3JA 4LV8A 1EO6A 2KJ6A 4AGUA 4XRLA 4JJRA 4JDJA 5CVFA 5JEBA 5HOAA 4PNIA 2Z7RA 5HKMA 4P90A 2UWQA 3Q6UA 4BI1A 3SV0A 4DG3E 2L00B 3LVPA 1Z5SB 5EOBA 4XEYA 2RIOA 2XNBA 4E4XA 5FM3A 1DI9A 2EKEC 1YXVA 2VN9A 2ZCBA 2LGCA 4RC4A 2EXEA 3C4FA 3PLVA 4RMAA 3LAUA 1CSNA 5AUYA 3DU8A 5AP2A 2P2HA 3UODA 4MEMA 5IA2A 3OG7A 4GV1A 4JG6A 3BQCA 1TVOA 3ZSHA 4E6QA 4OTIA 3G2FA 3EH9A 2E9OA 2RSVA 3P79A 5EKOA 2VWIA 4DA5A 4X2JA 4KRCA 3ZUUA 1GJOA 3DXPA 1VCBA 3V01A 4HW7A 5A54A 3DDQA 1Z5MA 4JQ7A 2OZAA 4X2NA 3GXLA 4MH0E 4W9HA 3CJFA 2NP8A 2QHNA 4OAVB 4QP2A 4IBMA 3KN6A 3N3KB 4C58A 3ODYX 5J18A 5DE2A 2OICA 5BVFA 2WWZA 1H1SA 5AUZA 4I20A 1APME 3PJ1A 5AP7A 3CTQA 2IPXA 4O0VA 3GCVA 5LXHA 2OBJA 5DRDA 1OITA 3F5GA 4I6FA 3VHTC 5CYIA 4LOPA 2JC6A 2VWWA 3SU8X 5KHOA 4UXLA 2NS5A 4FIHA 2KANA 5BVEA 3TTJA 4BDDA 4UWCA 1M7QA 3A99A 1UU9A 2WTIA 2GNHA 4RX5A 2MSED 4QMQA 3LHJA 3TWJA 5DRBA 5EQEA 2VO6A 2JDSA 3VUDA 4BDIA 1Q61A 5IMXA 3GU7A 5E1EA 3PXYA 4MELA 4TRLA 4TN6A 4BI2A 4AFEA 3HZTA 4FBJB 3AC1A 4KIKB 2W9ZB 2XA4A 2HXLA 2M4NA 1YXXA 1VR2A 4Y72A 3WYYA 4IX5A 3FQHA 1XH6A 5DLSA 1FMOE 2C7HA 4JIOU 2VRRB 1P4FA 4ZYNA 4C37A 1JNKA 3RPSA 1J19A 3RP9A 3H9DA 5ETAA 3HMNA 3VRYA 5CEQA 2C7NB 1FBNA 3OBGA 2YIRA 4JOAA 4WO5A 5C26A 4WJQA 4PTGA 4TQ0A 5EM8A 2VWZA 3LFQA 5E90A 4BYIA 4RWLA 4YO6A 4F70A 2QU5A 2AC5A 2KX0A 1DS5A 5AP6A 3PDTA 2YISA 3SHEA 3QLFA 3W1YA 4I93A 5L8JA 4AP4C 4IAZA 3CY2A 1WJUA 4KBAA 3RCJA 5AEPA 4EEWA 3PY1A 2UW5A 3R6XA 4MJSB 4RA5A 4YJSA 3FKOA 5CT7A 3QHWA 3QWZB 4LG4A 2Y4IB 2M8SA 4YNOA 2W1EA 1RFAA 5FBNC 3TV4A 5CQUA 5LXMA 3R1QA 1GIIA 5CANA 5IQAA 2ZV7A 4FEVA 4XX5A 5M51A 3BV2A 2O2UA 2UZDA 3R7YA 3NW7A 1OTRB 1XJDA 4MEDA 2HE7A 4WSQA 1ZYCA 3PT2B 2GS7A 4KUJA 1ZMVA 5DR9A 2YDJA 2F7ZE 1B39A 2X8EA 5ETCA 2REXA 5IA3A 3ALBA 3F3TA 4D4VA 5FXRA 2CCHA 2KVRA 4UWBA 3AMBA 4X6QC 2OFUA 4FTOA 2QC6A 4WNOA 3SC1A 4ASDA 2VRXA 4WWOA 3UZRA 3E88A 2WMBA 4KIKA 1EH4A 4G3EA 4GG7A 2DX5B 2DS1A 1ZXEA 4AA0A 4C62A 4YJPA 4U5JA 1V5TA 4EWQA 4IEBA 2PE9A 2XKCA 1LQBA 2B53A 4EKKA 2SRCA 1XR1A 3ZZEA 3MIYA 4AWJA 4DINA 5J9YA 3KCFA 4I92A 2ZEQA 5KHQA 1BYGA 2WB8A 3CR0A 4KBCA 4II5A 3RM6A 4CYIA 3VBVA 2YAKA 2D3GA 2CHXA 4FKIA 5A4EA 4DT8A 5CEKA 5EH0A 4HVSA 4JRNA 3ZKJC 5AP4A 3I1AA 1YOJA 5KMOA 4JGHB 2NBVB 4L7FA 2PVNA 1GC6A 2P3GX 3NYOA 4FTRA 3RT3B 3SG9A 2R2QA 1UELA 3AMAA 2PPHA 4EHVA 2H6DA 3BIZA 3MFRA 2F49A 4AF3A 1URCA 4UMTA 5D12A 4KB8A 3PREA 2JZ3B 4RG0A 2Y6MA 2M1MA 3QRJA 4H36A 1U4AA 1RW8A 3DTCA 3ZO5B 5HIDA 4ZZMA 2QLQA 4RX7A 3QX4A 2K25A 3G51A 3OWPA 1LXDA 4O83A 3R71A 4GU6A 4BBMA 1W83A 2I6LA 3RAWA 3GOKA 4AZWA 2XIKA 5DT4A 4PRJA 4HGSA 5HG7A 4I21A 4UZHA 4NKAA 1AGWA 2ETMA 4FT0A 2C3JA 1ZARA 4IX6A 1E8YA 4D5KA 4WG3A 1BMKA 3VXWA 3CC6A 2ITQA 4F9AA 3N4VA 3BYSA 4CLJA 3HRBA 4TTHB 1OZ1A 4QYGA 3O0GA 3GQIA 4L42A 3OTUA 3PPKA 4ANQA 3BLRA 3NZSA 4OTFA 3A9JB 4YU2A 3KQ7A 5EHYA 2LAVA 4R7BA 4C3PA 2J5EA 1WGYA 3WF8A 3FJQE 2VTAA 5CU2A 4EL9A 2EXCX 2ITVA 4AOIA 1REKA 3VRZA 5ACKA 3NZ0A 3VUKA 4ERKA 2A5UA 1KV1A 1KUTA 3D7TB 3MY1A 2FCMA 3TIYA 3ZUNA 4D2RA 4W9KA 3MH1A 2GBNA 3ORZA 2K8BA 2HIWA 4DGMA 4HWIB 5HVYA 2DAJA 2PZIA 4GCJA 3VUTA 2G3QB 1ZRZA 4AW1A 4BTJA 5BO4B 4QP4A 2ZPYA 3PJ8A 4I0RA 4DH1A 5IUHA 3CQUA 4FV5A 3A8WA 4G1WA 4XG8A 2W05A 3T8OA 2J0KA 3P7CA 4IXPA 3FL5A 1Z9XA 3FI4A 3RK5A 4C2WA 2YN8A 4RIWB 4O7LA 4APPA 2EMTA 2R0UA 5AMNA 1UKIA 5D1JA 4LCDE 3OUNB 3HDMA 2ITXA 3SW4A 2OFVA 2Q0BA 1K2PA 2QKRA 4EZJA 4FTLA 4IJ9A 2A4LA 2DYBA 4U81A 3Q52A 3ORPA 2YLEA 1E8ZA 3CD8A 1KE5A 5HNBA 1V6EA 3P86A 3KK8A 1YHVA 3E93A 5E8WA 4FT9A 2PY3A 1WIAA 4FOBA 3IW4A 3S4QA 3R04A 3ZHPC 2YABA 4NU1A 3DJ5A 3LXKA 2ONLA 2B52A 4NJ3A 4DFBA 3D5UA 5F9EA 2V3SA 3MJWA 4QO9A 3PLUA 3CE3A 3GUBA 1FXTB 2XK8A 4ITIA 3A7FA 5TKDA 3A9JA 3HK0A 2XIZA 4N4SA 4XG3A 2WMVA 2IYDB 5DBXA 3KXHA 4XX9A 4BCFA 1FMKA 4D55A 3ITZA 4FICA 3TM0A 4QP3A 3NNXA 3D7TA 4FTJA 4BDKA 5DOSA 3Q5IA 4FA6A 5K4IA 4P5ZA 4FOCA 2R2OA 4LDTD 1IAJA 5T68A 3QD3A 1WJ4A 1Q5WB 3UPZA 2VTOA 4M67A 2IVUA 5DR6A 4LRMA 5BVOA 4TV3A 4EWHA 4WJOA 4WKQA 1YI4A 4GXBA 2PVJA 2XF0A 2BYEA 4YJRA 5IDPA 1GOLA 5ETFA 3RTPA 2GBKA 5H8BA 4LM5A 3ZVVA 3FZ1A 2PZRA 4M68A 1Q8WA 1U5QA 2KWVB 2FCSA 4FGRA 4AE9A 1Q3DA 4W8DA 4JT3A 2M17A 3HUBA 3V8TA 3ORLA 4AT5A 4RIWA 4PDOA 4XBRA 4E5WA 4D1SA 4FNXA 3PSBA 1ZOGA 4D2WA 4QQJA 3DBDA 1KE6A 2FSMX 4YBJA 3HLLA 2UUEA 2YA9A 3OJ3A 5GHVA 4TKSA 4UB7A 3UGCA 4G9RA 3UO5A 2GQRA 1GJZA 2O0UA 1WBOA 3LW0A 3DVGX 3C4ZA 3NHEB 3Q9XA 1VEBA 4G3FA 2NBUA 4M3QA 4CMUA 2ZPNA 4K8AA 5AZGA 4XV9A 4ZMFA 3RKBA 4ZZNA 1Y8RC 2CSNA 2O5KA 3GC8A 2NCNA 4IWQA 3IW5A 2XKEA 4IVAA 4YTCA 3H30A 4F99A 1GC7A 3MY0A 4IACA 5AP3A 2FAZA 4JDIA 1SNXA 4G3XB 2KHWB 1UH6A 1M94A 5IA4A 1R39A 3NUNA 4BGQA 4O86A 3UIOB 3P78A 4OLIA 4CTBA 2R3JA 4Z9LA 2VTTA 1QCFA 5K0KA 2GTMA 3THBA 3NWWA 5ANIA 4C3RA 2W1FA 5CF8A 2XZSA 2VWBA 2OSCA 3ZO2A 4NM3A 3R7RA 2MBOA 3DAKA 3I6UA 3KB7A 4QMNA 4C3FA 3RPOA 4HVHA 4Z3VA 3ZLYA 1IP9A 2W0JA 4ZS4A 3PSDA 3R63A 3DDPA 4D0WA 3HAMA 4KDIC 5FEDA 3D94A 3ZNHB 3W2OA 3R8PA 3JYAA 2PULA 4A9SA 3RCDA 4NPNA 2GQSA 1WXAA 2KTRB 4GMVA 4RGJA 4FEUA 3BYVA 4K9YA 3QTWA 1J8CA 3OAWA 3W2CA 3ETAA 3TZMA 1OQYA 4EZLA 2FSLX 3FXZA 2DYMA 4FJYA 4P4CA 2WO6A 3EKNA 2E2BA 3ROYA 4D4YA 3R7QA 3BHHA 3B8RA 2C69A 4I6PA 3VWAA 3KULA 4GGQA 4PL3A 4K81A 3W55A 5D94A 2YCRA 3MPAA 1PMUA 2WMRA 4Q5HA 2O65A 4XMOA 1GIJA 2EXMA 3H9OA 4FJZA 1R4MI 2ETRA 2QKWB 3F2AA 1WR1A 3WIMA 4Y5QA 4HYHA 5AJQA 3GU6A 2JIVA 3OD6X 2GFCA 5M55A 2JITA 1E9HA 3KRLA 4FUYA 2HWPA 2Y5BB 4GIVA 4EH6A 4KRDA 3VBYA 4M8NA 1YQJA 2FYSA 3FHIA 4MBLA 4XZ4A 2X2KA 5FEQA 4FNYA 1F3MC 3PPJA 4IB5A 4FTMA 2EUFB 2BIKB 5HE0A 3V5TA 2O3PA 4OBQA 5E4HA 4BCNA 5CX9A 3AI5A 4WD5A 5IUIA 5M07A 1Q8TA 4MXCA 5DN3A 4N6ZA 5ICPA 4BCQA 2OXDA 2V4LA 2ZV2A 3SDLC 2VTIA 2ITOA 1ZYSA 3KN5A 4O96A 3CF6E 4BCJA 1V0OA 4W4VA 2GDOA 4ACGA 3QCAA 1LUFA 2UW6A 1PQSA 3HVCA 1CMKE 2WQBA 1H0VA 2XK3A 5AUWA 2KTRA 3GOEA 4LL5A 3ATSA 4YO4A 3H7SA 2MRPA 3QZHA 1YKRA 4ITJA 3GCQA 2ZNVB 4DHJD 3FY2A 4HGEA 3R7OA 3DLZA 3COHA 1A5RA 3PJ3A 3DXQA 3PFQA 5CSWA 2JRHA 3I79A 5A4LA 2F2UA 3TKUA 3HM3A 3GU8A 3FBVA 4O1OA 4FVPA 3I0QA 2ZJWA 5C8KA 3GI3A 3F66A 3CKWA 5HIBA 3KCKA 4RFMA 4KABA 3SDJA 4EYJA 2OXXA 4OT6A 3Q4TA 3VUMA 1IR3A 1Y6AA 1KOBA 5DT0A 1YDTE 1OGWA 2B9FA 2RL5A 2IZRA 2JFMA 4MWHA 4ICVA 1OIRA 4FSYA 3FPMA 2PEAA 3F9NA 3KVFB 2G9XA 3M1SA 4UX9A 2OJJA 5DEWA 4NW6A 4QTCA 2Z60A 3DGKA 3FC1X 3QKKA 5AUVA 4QMTA 2G45B 2HAKA 1OBGA 4AGCA 4GKIA 3IGGA 3EB0A 2CLQA 3QJZA 2RGPA 4DBGA 2CCIA 4BKSD 4JVGA 2BKFA 4P7EA 2YJSA 4BFRA 3MJ1A 1YW2A 4CKJA 4O0SA 5EW9A 5C1ZA 4AA5A 1PF8A 5EQYA 4BDFA 3FKNA 5M4UA 3I60A 4FG7A 2LVQA 5F4NA 4BKJA 2IZSA 4E3CA 4ZJIA 2JKMA 5HG5A 4M13A 3X23A 4ASZA 3LZBA 2PUIA 3L9NA 2Y9QA 5IAAC 4FA2A 4D2SA 3G15A 2X39A 3W1FA 3G6HA 2N4FA 4BC6A 2JEDA 4CRLA 2LASA 5CI6A 2R3MA 3PJCA 2WX0A 3JY9A 2R2PA 4YJTA 5ETIA 3K9PB 1IPGA 4RT7A 4RBLA 1UU8A 1PRYA 5IQDA 2MP2B 3UQAA 3ORKA 3B2WA 4FKRA 4BDJA 3NAXA 1UV5A 5KHWA 2OI4X 4W9IA 4RJ5A 3DBSA 5AAFA 4Q5EA 5IQGA 3F5XA 4F7SA 4XCUA 5CAVA 3PUPA 4AT4A 1P14A 2VWXA 2ZV9A 3VUIA 2C47A 3O7LB 3ZOSA 3QD4A 2XNPA 1LFDA 3PHXB 2VTNA 4QOXA 4RPVA 3KREA 4YLLA 4DGLC 4PDSA 2PMOX 4MDKE 2G1TA 3PZDA 3A60A 4F7ZA 4BIBA 3U4UA 3ZMMA 4H1JA 3ET7A 1WYWB 5IPJA 2JVCA 2XCHA 3GC9A 2WDTB 5A4QA 2VTHA 3R1NA 3ZW3A 3RCZA 1GNUA 2X2LA 1WBVA 3REPA 5G1XA 2IW6A 2WYQA 3Q04A 2JKQA 2V7OA 3EN6A 3WARA 5EI6A 2B9IA 2XP2A 4O1PA 4EK6A 2YZAA 3WE4A 4EQUA 3EC8A 3RPRA 3S0OA 3EYGA 2I0VA 3WBLA 2RFDA 5B7VA 4FEWA 1IA8A 4A4OA 4FEXA 2XIRA 2R5TA 2OJIA 4BZOA 1ZKHA 4HCVA 3ZDMC 3TEIA 2OJRA 4NCTC 3GU5A 4JIKA 3K5UA 5FQDC 2LGXA 3U8ZA 3OOMA 3NMUF 2Z8CA 3UF8A 2CNUA 4MNFA 4KAOA 4FV0A 2G2HA 4O82A 4PDYA 3LXNA 4DG2E 2WTKC 2JAVA 4Q9ZA 3AC3A 2QOIA 4IAAA 2YM7A 3GB2A 4GIHA 4MXAA 5CAQA 1YQBA 5T6KA 5GMVA 2PYWA 4J6IA 3UC4A 5EM6A 2QOOA 4F7LA 3ZLZA 3BINA 4PWNA 4E5AX 2E9VA 1PW2A 4FKVA 2O6VD 4YMJA 3OW4A 4I23A 2ITTA 4O7VA 2HELA 1XBCA 3DB8A 4ALVA 3QAQA 4IJPA 1GUAB 3QCSA 3EQRA 1XKKA 2KMAA 3HL7A 4DYMA 4DEAA 1PXOA 1WGGA 2XRWA 1WMHB 2QR8A 4A9UA 3L1SA 3WZUA 3NS9A 5L6PA 2QCSA 4BCPA 3LCKA 4AS0A 3QUDA 4U0IA 1QMZA 4ARKA 4CD0A 4YJOA 5DPVA 1NW1A 5IH5A 2JUOA 5AUUA 1P9DU 1WGDA 4NFNA 4ASXA 5JFWA 3CSVA 5J1VA 3OW3A 3KU2A 5EG3A 4EUTA 5CF6A 3DTWA 5AV1A 5J7HA 3Q4UA 4YZDA 3HRCA 3UG2A 4IIRA 3HKOA 4D2VA 3VIDA 4ZRKA 4PTEA 4O21A 4K33A 2NPTB 3NEWA 4GN1A 2XYUA 1ZWSA 4AGWA 4O81A 3GZNI 2GOWA 5HE3A 3DT1A 3PLSA 1BKXA 4NT4A 4AW0A 3IDCA 4DFNA 3K5VA 4PPCA 4LUDA 2W1CA 2BMCA 2BVAA 4FT7A 3A33B 1VJYA 2J7TA 4OTDA 5KUPA 3LLTA 4MAOA 4MGIE 4PL5A 1UNGA 2VNWA 2HJ8A 1YI6A 3U4WA 5KZIA 4C59A 3DOWA 4O0RA 2QLUA 3V5PA 5DYJA 1Q99A 1D3ZA 3R7EA 3C4CA 4EQCA 1TQIA 3MSSA 5JZNA 4I5PA 4I5CA 3LOKA 3W1SC 3OXZA 4WNMA 1WMHA 3ZUVA 4U9AA 4YZBA 3CIKA 4IWPA 3JVRA 1PXIA 3QQHA 2I7QA 4MWIA 2QOHA 2PE2A 4AJWA 3FHRA 4IWDA 1XHAA 2HCKA 3H10A 3A2CA 4YZMA 3V8WA 3QTXA 3D15A 2PUNA 3UQCA 3B1LX 4DDID 4RWKA 2WPAA 2ITNA 4NSTA 5DPRA 3BEGA 3KKVA 4U80A 4IX4A 3I7BA 3C0GA 1M2QA 3MY5A 2OZOA 3F61A 1RAXA 3T3VA 1NT2A 4DHZB 1J91A 3I5ZA 3E7VA 2UZVA 2IO2B 4NCTA 4Y5HA 3DNDA 4G50A 2C6IA 2AC3A 1XWSA 4UBAA 3A1QB 2BHHA 4HPTE 2PSQA 2NPTA 4W4XA 4M69B 1YIWA 4FULA 2WHBA 1MRUA 2X0GA 3GT8A 3OROA 3BKBA 3ANRA 2OW3A 3MTLA 2QD9A 3VVHA 5BUJA 5C27A 4ASEA 2XNNA 2MQJA 5JQ8A 3ZNZB 3OY3A 2GBJA 2UZUE 2W5AA 4MGYE 4U6RA 4DFXE 2G2FA 3TT0A 4IADA 1OL1A 3L8SA 4FNZA 3AGMA 4YURA 2HXQA 4CTCA 5EW3A 5DCNA 4H05A 4Y95A 2O64A 3CTHA 3EQIA 3V5WA 3C13A 5HLPA 2HW7A 1WJ6A 3TUDA 4PMMA 2FUMA 2C6KA 2KTFA 2C6MA 2KDFB 4BTFA 4IW0A 3WZKA 4A20A 4BCKA 5J9ZA 4AN2A 5DVRA 1ZAOA 2HD5B 2QOCA 3JS2A 5CALA 4I41A 2OK1A 4JNWA 2VNYA 4XJ0A 4KSLC 3DBCA 4HCTA 4DXAB 3V62A 3MFTA 3RAHA 1JSTA 2XM8A 4O7WA 3FZRA 4NZWB 5JMSA 4DGGA 2X6EA 5TR6A 3TV6A 4FV2A 5CHFA 3L10B 3PA4A 4BCOA 1JLUE 4ZLZA 4MGZE 4FZ7A 3CTJA 2UZTA 2C5XA 5AM6A 4USDA 3TUCA 3HMMA 4HZRA 4GH2A 4U8ZA 3BQRA 4GDKB 5CEMA 3HV6A 2OJ9A 4BF2A 3DBQA 3TG1A 4CQGA 1P5EA 3A1QA 3L9LA 3P7BA 5EI8A 2HK5A 4TWOA 4AWIA 4FT3A 4LFIA 4M69A 1WAKA 4G5PA 1V80A 1Q5KA 4NM5A 2DZJA 4B4LA 2L7RA 3QTUA 4RIYB 2XS0A 5LVLA 4GYIA 4R8QA 4A3OA 3TJCA 4E6CA 2GBRA 2NO3A 4DH7A 3AMYA 4FK6A 3NYVA 2PK9A 1E5WA 2WXVA 3FMHA 2OH4A 5B0XA 2R7IA 4U3YA 3LMIA 3W1SA 5CU0A 2QG5A 4AFJA 2XBJA 4E1ZA 3A62A 4W9GA 3RZWC 3EN4A 5DT3A 1Q97A 2PE0A 4XOYA 2KD0A 3PSCA 4ANMA 5CZHA 2ZDTA 3NZUA 4LYNA 5LMAA 4JAJA 3PTFC 1T0YA 5FP5A 4GFGA 5H8GA 5FD2A 3ZUTA 4K6ZA 4JL9A 4GK3A 5FWKK 5AR5A 2B7AA 2KOXA 5C4KA 4AACA 3BYOA 3PWYA 4I6NB 4G5JA 4WAAA 5FG8A 4TZRA 4BN1A 5FTQA 4K2RA 3UIBA 3BWJA 2Y4PA 2R3PA 5E6OA 2D07B 3WALA 4I5HA 4GDKA 3TXOA 5I9ZA 4IFCA 4HYUA 3SXRA 1BLXA 3A7JA 4MTAA 3QTZA 1PXJA 2JDTA 3G6GA 4D4RA 1M14A 5JGBA 2O2VA 4LQMA 2C5OA 4L3LA 1YWNA 3QC9A 3V6CB 3T3UA 4F8CB 4RMZA 4HVBA 4DE4A 4DTBA 2DZMA 3AD4A 3HA8A 1GNGA 5CAUA 3C5IA 4EH8A 3T9IA 3QF9A 3RWQA 4RIYA 3VFKA 3PPAA 4DHFA 4W9CA 3OTVA 3KMMA 3A61A 3HNGA 3FKLA 4Q2AA 2Z7LA 2GFSA 5M06A 2ZAZA 3QC8B 3Q9WA 1MG8A 5AADA 3TL5A 5CF4A 4BOZB 3EJ1A 5KMNA 3RNIA 4M14A 2BAQA 4O6LA 3DBEA 1CKIA 3S2PA 2IVSA 3ZO3A 2QOKA 4FKLA 3AULA 4O0UA 2P55A 3QZGA 2MWSB 4IZ7A 3ERKA 4PPBA 2I1JA 3AQVA 5E1SA 3R28A 3RJCA 4UN0C 1WX7A 4K11A 3R8ZA 3WF6A 2KK8A 1Q1OA 5DPTA 2WQMA 5HLNA 3BHYA 2YFXA 2F4JA 4X3FB 4D9UA 4IAIA 4D58A 4XHKB 5LCKA 3QTRA 3OWJA 2C5VA 3N30A 1W8CA 4G17A 4F64A 3PSEB 3BWFA 3DQXA 2G01A 3RM7A 2ZVNA 3QFVA 4RSSA 4S32A 5GINE 4D9TA 3U9NA 2B1PA 2PL0A 3M62B 5A6OA 5CSHA 1TZ1A 2QHMA 5E8TA 2VO3A 4ZJJA 2XUUA 4DLIA 3ENHA 4GG5A 3OS3A 4QYEA 4L67A 3GEQA 4FKGA 3UNJA 4KWPA 5E8XA 1CDKA 4JDHA 4G11A 4M7IA 4DG0E 2LXAA 4AU8A 5D7VA 4BKSA 4RC2A 3LKMA 4IDVA 3D83A 2BWES 4ALUA 2W1IA 3W33A 4W9JA 4FUXA 3DKGA 2PZPA 3UGBB 4XG6A 5KX8A 1FPUA 1M7NA 5CSPA 5K5XA 3RWPA 3GU4A 5JT2A 4GYGA 3VTVA 2YIXA 3BU3A 3OCGA 3FQEA 5LOHA 3ZRKA 3NR9A 3Q4ZA 4NJDA 1VD2A 4CKIA 5AFVA 2R3LA 2K39A 1FGIA 3DK3A 4MF0A 1SM2A 3UG1A 2P4IA 4U43A 3K3IA 3EQBA 2WTWA 5IQFA 3V6EB 4L46A 3TNHA 2AUHA 2W1DA 3ZU7A 4W9LA 2RSUA 2WFYA 5BPYA 5ANKA 5ANOA 4BVUC 3UOJA 4K7SA 2O6VB 4F1SA 3QCQA 5FDPA 5GZAA 4X3FA 4DCEA 5FXQA 3VH3B 2BZKB 2XJ1A 4TNDA 3ZRCA 5K0XA 1PKGA 1UD7A 4EOYA 2XIXA 3ORIA 2FCNA 5CQWA 1MP8A 1OKWA 4HYSA 2LGYA 4FSWA 3EN5A 5ANJA 5L6OA 1H1WA 4CO7A 1PMEA 3TJPA 3AD5A 3F88A 4HNIA 3QQFA 4IX3A 5M57A 2P2IA 2YCSA 4OUCA 5LVPA 3QRUA 4BKTA 3QK0A 3LPBA 4CZYB 4OT5A 1YXSA 4F0FA 4FL1A 1T45A 1Q8ZA 2LXCA 4YJNA 3ZEPA 1HCKA 1FVVA 4ZTRA 4PS3A 5CZIA 3A7HA 4U45A 3IW6A 5F95A 3SX9A 2WQEA 3F6XA 4X2GA 4DHZE 4J97A 2KQSA 2C60A 4TW9A 4FKSA 3L9PA 5KKRB 4QMYA 4RM8A 3ZNGC 3NIZA 2KFJA 5ANDA 4QMZA 4N9F4 5EQPA 3FLSA 4OVUA 3II5A 3ZLXA 3TKIA 3O51A 4ANXA 1BL6A 3V60A 2BROA 4QMPA 4LMUA 2B0QA 4R3RA 3TV7A 1PYEA 3RD2A 3GC0A 2W4OA 4MK0A 4QMVA 2WEIA 1S1QB 2A2AA 1SZMA 2KC2A 4V0GB 1Y91A 1J1BA 1OBDA 3GC7A 5E8YA 3NUSA 3KRWA 1E1XA 5HX8A 3NVKI 3R30A 5AV2A 5G55A 2O6VA 3BCEA 2RGFA 3N51A 3CQEA 3FY0A 3QTIA 4AN3A 1NI2A 4JR7A 1PXKA 2D10A 5I9UA 2C4GA 4C4EA 2OH0E 3W8LA 4BR3A 2C7MB 1L3RE 3CSTA 2WU7A 3VS5A 1P3QU 2QI8A 2HZ0A 4JRVA 5HVKA 3UYTA 4FYNA 4GFMA 2GS2A 1H08A 4EQMA 1ERKA 4KINA 5I4NA 4XLIA 2L05A 4FKOA 4GS6A 2OZAB 2VWUA 2W1HA 2YERA 2CDZA 3ML9A 2Z0DB 4XBUA 4GUBA 2OKRA 3EN7A 2IW8A 2WIPA 3F3WA 4KA3A 3S95A 4FODA 1UWJA 1JKLA 4EZ5A 1B6CB 4CSVA 4DEHA 3QXPA 3V8SA 1UWHA 1H00A 3PIYA 4BTMA 1H24A 3GCUA 3OCBA 2ZDUA 1R0EA 4ICUA 3WE8A 1SVGA 3V6SA 4ZLOA 3COIA 4L7SA 3LQ8A 5HIEA 4N57A 4KIOA 4QPAA 5FR6A 3OJ4B 4G3GA 3C5UA 3QIJA 4IQ6A 4DGNA 2RR9A 3R8MA 4I5MA 2MA9B 3HMPA 2ZV8A 4V0GA 3Q3JA 3LCTA 4C7TA 1OMWA 2YHVA 2IVVA 2ZMDA 3FE3A 1OGUA 5B2LA 2BIYA 2YIWA 5JRSA 2X4FA 3RNYA 4QYHA 4ANVA 4ANOA 4BRXA 3LCDA 3FI8A 5CVHA 5IQIA 4HVDA 3PHWB 4IVCA 4GVAA 1OIQA 4KSPA 3WAPA 5EYCA 4NTSA 3KUZA 4L3PA 4JS8A 4V01A 2MBHA 4H3PA 2QNJA 5D6JB 4FZ6A 3BRBA 4ZLYA 3C0IA 3IW7A 1WI0A 2UW9A 4H39A 2C1AA 4WA9A 3W10A 1AQ1A 1YX5B 4D4SA 3PP1A 2Z0EB 4FTKA 5C9CA 2BZJA 2ZMCA 4OTRA 3UQGA 3DA6A 2UZOA 3ROCA 2NVUI 3DJ7A 5HICA 3G0EA 1ISNA 3SAYA 4Q9SA 3MTNB 3DZOA 3ZEWA 3RI1A 5G2NA 5HD7A 3BGPA 4M15A 1Y8YA 4APCA 4YC6A 3VJOA 1URWA 3PVGA 5IH4A 5IUGA 4WHZA 5KMIA 4RLKA 4B6LA 3DQWA 3C4EA 3P5KA 4MM3A 4BIDA 5HE1A 1MUOA 3BU6A 3V61A 3Q4CA 2J0LA 4ZDVA 5ANEA 2NRUA 5EYKA 1H8CA 5FXSA 4DAWA 5L2IA 4RIOA 4AZTA 3ANQA 3VQIA 1ZZ2A 4CHKA 2HY0A 2RFEA 1ZYDA 4MD7E 1PKDA 4XOZA 4TL0A 5C8MA 1TGZB 2FIFA 4XS2A 3EN9A 4WJPA 3UQBA 2BDWA 1PMVA 1GZOA 3TDVA 4J8NA 2A27A 1OB3A 2R7BA 3EQHA 2GCDA 3QGWA 5DPSA 5GIOE 3Q3BA 1UZXB 3ZDUA 4ZY4A 4YZNA 4EBWA 4I6BA 3POOA 5HU3A 4II2B 3RAKA 4Z55A 5HTBA 4F1MA 4C4GA 3TUBA 4WNPA 2MBQA 5AR7A 4H3QA 5JFXA 4MXOA 5CVGA 3R7GA 5M4IA 3AGLA 2QOBA 2WMXA 1OKZA 5IDNA 3N4UA 2BAJA 4JDKA 5L2QA 2V5QA 3HV7A 5CU4A 3L16A 4WQOB 3R01A 1WXVA 3SOAA 4J52A 3P1AA 4TWNA 4BHNA 4C57A 3QRKA 2A4ZA 3PZHA 3FZTA 2LI5A 4JQEA 3D2IA 4O6EA 4EZ3A 2XKFA 3PRPB 3EFUA 5AP1A 2F2CB 3VUXA 4D5HA 2Q83A 4AG8A 1H07A 2KN5A 3IPHA 3ZTXA 3O17A 2JGZA 1ZOEA 2N9PC 4YUQA 4HDOA 3PE1A 4I94A 2PHKA 1XH7A 3H7PB 5JFVA 1JSUA 3UC3A 1SE9A 4ZTMA 3C7QA 4G0NB 1JKKA 4YHJA 5AR4A 1R3CA 5IQEA 3F82A 5JN2A 1NY3A 1Q62A 1OL5A 4X21A 4YJQA 4GU2A 3FV8A 1H27A 3DK6A 2YDKA 3DVNU 5EYMA 2ERZE 2Q0NA 4CVAA 2VZ6A 1AD5A 3GOPA 2IBIB 5AAEA 2QQ7A 3O8UA 3KXMA 2V62A 2J5FA 3HRFA 2GPHA 3NUYA 4DC2A 3JUHA 5L8LA 5I0BA 4G16A 3E5AA 3P2BA 2QONA 4FLHA 1IAHA 3LQ3A 2VU3A 3JSVB 2L0TA 2BF8B 3AU5A 5J95A 3UQFA 4EH4A 5L6WL 4WG4A 1XBAA 3FSKA 2BR1A 1W98A 4ZTHA 4YPSA 1OUKA 2KMCA 2GHMA 1TKIA 2YM5A 4G34A 4S31A 4U41A 4WRGA 5HU9A 2R0IA 5E8UA 4OTPA 4Y83A 1VYZA 1V81A 1UGMA 2HZNA 5C01A 2VTRA 3E8DA 3B8QA 2ERKA 1SMHA 1GG3A 2GNJA 4XG9A 1V49A 3I6WA 5AX3A 3EZVA 3V5LA 4CT2A 3ORXA 4F1OA 3NCGA 3CGFA 2IG7A 2X4ZA 4UALA 4R3CA 4DTAA
chains in the Genus database with same CATH superfamily
4KZ0A 5EE1A 1L8TA 4GKHA 1HTYA 1F9JA 2I1KA 4ACCA 1BT0A 3MB6A 2ZVOA 4ZTNA 3H7PA 3UNZA 3CEKA 4HGTA 4G6LA 3KW5B 3N20C 2BFXA 1GZNA 4RZVA 5JRQA 3O3OB 4XG2A 3VBQA 1KFYB 1XD3B 1ZLTA 3HP2A 1UNLA 3FQSA 3W2PA 2VTQA 1YVJA 2AYPA 1XMMA 2XEYA 4WBBB 2WMWA 4CFNA 3M11A 4IHPA 1NVRA 4RIXB 3AG9A 2WX1A 3S3IA 3WIKA 3BE2A 4G6OA 1RQQA 5GZ8A 2CN5A 2NRYA 1TT5B 4OW8A 4HK2A 2KMMA 1RE8A 4KIPA 3AT4A 2FICA 4HY9A 4UYAA 3E3PA 4XP2A 3CMMB 5EHLA 2HWOA 3EFKA 4FSMA 3SR6A 4TNBA 4O22A 4O0XA 1FEHA 3IVFA 3D52A 4L3JA 5LQFA 5C23A 3VRAB 4YP8A 5KCVA 4O4DA 3JSVA 1W0XC 1QPCA 5JFSA 1U54B 3AE2B 3WAOA 2CJNA 1ZW7A 2LFIA 4XWWA 3ACJA 3G0FA 4MHAA 1J1CA 1M52A 5CENA 3RK9A 3UJGA 3KYCD 3VBTA 3W18A 3UP7A 4O7RA 2NYAA 1G6JA 4RJ8A 3GE8C 3IS5A 3H1UA 3CBLA 2AWTA 1A70A 3NVMB 4R1VA 3KRJA 3Q32A 2YLMA 5C4LA 2Z7QA 1V2YA 4FI1A 2G4SA 2O63A 5C5BA 2VX0A 3M95A 2B76B 2XH5A 2BTEA 1OEYJ 2X7FA 4TYHB 4WURA 2CGUA 4MKCA 5HO7A 1OPJA 1SE2A 1WZ3A 3F5UA 1L2NA 2MBBB 3DBFA 1OEYA 5AEKB 2HTHA 3VW6A 2KDBA 3P23A 3DFCB 1YHSA 2W55A 1H25A 4TT7A 2AQXA 4JQWC 4M12A 4B95A 3BBTB 5FM2A 1CKPA 5K4JA 3AC4A 3C9WA 2VTPA 2BRGA 1UNHA 2YJRA 2Z2WA 3NRZA 3SHQA 2EWAA 5HESA 1IASA 3D0EA 1WBPA 3HAVA 2K8CA 4C00A 3VS7A 3EQDA 3MVJA 3I2WA 4NYEA 5H3QA 3CZNA 4L00A 1OA0A 1V0PA 3AKJA 2YM8A 2RDBC 1ZYLA 5I4DA 4RIXA 2JD5A 3WF5A 2YITA 2X9FA 5LVNA 4IH8A 4UMUA 3QTQA 1QPEA 2C9WB 3A4SC 4GJ2A 1YJ1A 3ZRFA 5D41A 5DR2A 1E90A 3VS1A 3MH0A 2QU6A 1WVXA 5J9LA 4RX9A 3O2MA 4CFXA 4WWNA 4G3DA 4D2PA 2NTSA 2KWUB 5LXIB 5K3YA 4L2YA 2DZKA 3AXWA 3BEAA 4JBPA 3DPKA 1WRIA 3IG7A 4C8BA 5TO8A 1WXMA 3QA0A 4EK4A 5D2MB 3TN8A 3CVRA 1O6YA 3OOGA 3PYYA 3MC8A 3TNPC 4EK3A 4FZDB 4GDLB 1TS4A 1U54A 2ZW0A 5A14A 4EZOA 2BRHA 4AZ6A 4CFUA 3UIXA 1K52A 4E93A 1WJNA 3EL8A 3H0YA 4HNFA 3R00A 3D51A 3LFSA 3U55A 3UVQA 1D4BA 3OWLA 2BGFA 2B54A 4IB1A 1W2DA 3P9JA 4A3PA 4OZCA 5HO6A 2WU6A 4C02A 5L2TA 3BYUA 3ZIMA 1FINA 1QPDA 2R3RA 3GB1A 5EYDA 4A8XC 2MLBA 4TYHA 3PRFA 4L45A 2HW6A 2XANA 4PYZA 4E73A 5EDRA 1HZ5A 3QX2A 3RUIB 3OXTA 3IECA 2ZB1A 4LV7A 2QMTA 4U3ZA 1T6BX 3IFWB 2I40A 2J7QB 2GHLA 5IZFA 1WBWA 3EIDA 3GS2A 1MI0A 5HNGA 2YEPB 3JR1A 5TSSA 3TYKA 3BELA 4AKVA 2B55A 3B9JA 4EK8A 4QYFA 4DBXA 1H1QA 1LPUA 4LJPB 4NWMA 2NR2A 2WP9B 3W0OA 2RFNA 3TNQB 1YJJA 4YC8A 2PVKA 4YJUA 2PTKA 3PRZA 4M0ZA 2C6LA 4HPLB 4GSWA 1S9JA 4J8MA 3T9TA 1V9JA 5EK7A 1G5SA 2XNMA 4L6QA 4AZSA 3G9NA 2QJLA 3KXGA 4GRBA 4YLJA 2IGGA 4EZZA 3N1YC 5JSMA 4AT3A 3R66C 2E9NA 1E2UA 1HTOA 4O2PA 2YDIA 5CTRC 4HCNB 3MHZA 3KMWA 2RD0A 4O1NA 1ZMWA 3QQGA 3KULB 3EJTA 4BDCA 2JBPA 4FJVB 1JWAD 4D2KA 2GSFA 2X81A 2BWFA 3OEFX 2N0SB 2FO0A 2XK7A 5M4CA 1WMKA 3SRVA 2ZM4A 5IEYA 2XAMA 4QPMA 3PVLA 4UYNA 2IO0B 2N9XA 2XK6A 4XG7A 5D7GA 4JBOA 1WGHA 2VWYA 4ID7A 4HOKA 4FSTA 3NPCA 2N7EA 2DAFA 3ENMA 3FEGA 3EQFA 1PY5A 2W1GA 5DPWA 4GDLA 3LJ0A 4R5JA 1ET9A 4XNEA 2K1FA 3NYXA 4N0SA 4RC3A 3VHEA 3CP9A 2QG7A 2W9NA 4ZSAA 3K54A 4RFYA 1SF0A 3W8QA 4ANUA 2QO2A 3QU0A 1OPKA 2YI8A 4Y85A 3T46A 2E9UA 3PXRA 4CYJA 4YTNB 2JDVA 3R7IA 3ZFMA 4LV5A 4BBEA 2C68A 1OAOA 2X8DA 4O7SA 3GE3C 2CPKE 2Z59B 2INNE 4C33A 2W4JA 4BZAA 3PRMB 2EVAA 4BGHA 2X0QA 1WBSA 1V1PB 5T8IA 3W2RA 3Q69A 5AIRA 3CSFA 2WOTA 4BGGA 3ZYYX 4JR3A 3FYJX 4PTCA 4YHFA 4EZKA 3MS9A 3LFNA 3MFSA 3C4WA 3AV8A 3R9HA 4DEGA 1LQ7A 1JQKA 3NVWA 2OU7A 4NSWA 3R7UA 1QL6A 4NKSA 2UW4A 3GP0A 3G90X 3EFWA 1OUYA 4ORKA 4BCIA 4EUUA 2R3QA 2F57A 2C5LC 3ALNA 5IQBA 3D5VA 1ZGUB 3F2RA 2R61A 4B0EA 3SVVA 1OECA 5J17A 3LE6A 5BVNA 1D5XC 4QQCA 3P4KA 3K9OB 4FIGA 3FWQA 4I24A 4A9TA 1P2AA 5E9EA 4FJVA 3U6JA 4O4EA 3KMUA 4EE2A 3CKXA 1J3HA 2V22A 1H4RA 1R4MB 4X2KA 4QP1A 3CV5A 4N70A 3TZ9A 2ETKA 3WILA 5GJDA 4E7WA 4DH3A 2IJ0A 1DAYA 5DGZA 5AWMA 3F3ZA 3N9XA 4BOSC 1C76A 4ANWA 1YN4A 2QR7A 1AARA 4TSSA 2F1AA 2KDEB 4X57B 1W84A 3PRIA 3QE6A 4IC7B 4AXDA 3GFWA 4W9FA 3PO0A 5CSVA 5BYQA 4IAYA 4TUUA 1WR6E 2ZVAA 2FYVA 5IU2A 4L01A 2F9GA 2WTDA 1BI7A 3A7GA 2UW7A 2XIYA 4P2KA 2GMXA 3NNUA 2EKIA 4RVMA 5I9YA 4P7IA 2YIQA 3U51A 5LNK1 2LWPA 4LUEA 1G8KA 4MSQB 4U97A 3UNKA 4WJNA 3ZBXA 1LR4A 3ZXTA 1P0RA 3EFCA 1YRPA 3QLGA 3QCYA 4FV4A 4D28A 5LLIA 1MQBA 2QO7A 2BT6A 2QOQA 5AR2A 3RGFA 4DH8A 3BYMA 3MI9A 4JQ8A 2OIDA 2PVGC 2N1VA 3FXXA 1V1PA 3W0QA 4PV0A 3KEXA 3TEXA 1UWXA 2DHZA 4V04A 4MBIA 1J7AA 4XV1A 4MX9A 1BI8A 1M2RA 2ZJDA 3LM0A 4BHZA 1IYFA 4FHJA 3U4EG 5CTPA 3C4XA 1Q3WA 3PY3A 4CV9A 2GQGA 2PVFA 3JY0A 2BYFA 5HEZA 1C3TA 2VUWA 3UIMA 4EKUA 4TYEA 3Q96A 2KLCA 2KFKB 5BUIA 4FVQA 5IEXA 3GVUA 5FR3A 3R2BA 3K3JA 1YOLA 1E1VA 4S33A 2OJFE 2AL6A 3EOCA 5LMBA 2WMTA 4RM9A 3RPYA 3ZXZA 4DEDA 4M8MA 4FKUA 3W2SA 2PW9A 4FTNA 4J53A 3QZFA 4ZTQA 3F3UA 4IUMB 3MESA 3DBHB 2VTLA 4QTEA 3DBHI 4GEOA 2Y4IC 2WTCA 4H8SA 2QVSE 4KD1A 1ZUD2 2LJ5A 3HDNA 2H8HA 2DLBA 4HJGE 3Q6WA 1R1WA 4E8AA 5BUEA 4YL8A 5BYLA 3RFZB 4PX6A 2FA2A 4IC7A 1SXTA 5CT0A 1BL7A 2B9HA 3MB7A 2JFLA 4TYGA 4I6QA 3TACA 3K2LA 3NFGB 2PE6B 2IF8A 3ZJUA 4MUQA 4MNEB 4FSQA 3ODZX 3APCA 2UVZA 3L8XA 5D7AA 4J96A 4K0YA 4P6VF 2JNKA 3FL4A 3NX8A 4HVIA 3UZPA 2R3FA 5FRIA 4NFMA 3KFAA 4C36A 2CU1A 5GNKA 4CYEA 5TOZA 4GFOA 4FKJA 3QA8A 4AXEA 4C4FA 3PIZA 4IANA 3MDYA 3MGYA 5KZ0A 3RMFA 3PP0A 2HJ1A 5EKNA 4I0SA 4AZBA 2WXKA 4FTAA 4ZSGA 4I6LB 5I9VA 5IH6A 4IDTA 3TBLD 5IA7A 1I4DA 2C5NA 1WBTA 2C3IB 4EOMA 3MBLA 3VR8B 4CQEA 2CS4A 4LOOA 4FTUA 4ZY5A 4FIEA 1SIJA 4F6SA 5LCJA 4RJ4A 3VDZA 1U46A 2WMAA 5A4TA 3PZEA 2D2QA 2NMQA 2J0IA 1ZDXA 3FMJA 4EZ7A 1HXKA 2KFKA 4EOLA 3AC5A 1TQPA 3HMIA 1FGKA 3C51A 3VEAA 3SKCA 4QRCA 4RX8A 4MXXA 2X7GA 4DK5A 5J5SA 4RCOA 2FSOX 2XBBC 2G15A 4IM2A 1SNUA 4XP0A 3VAWA 1KE9A 4FVRA 1YWRA 5HHWA 2PE1A 1H26A 3IQ7A 4OGRA 1PXMA 4AZEA 4JLCA 4TY1A 4QNYA 3HVDA 2YL6A 2JDRA 3FZSA 5E8SA 2AX5A 5EDSA 4FN2A 4C4HA 3QKLA 1S3SG 5CSXA 3HAHA 4WT6A 3KXZA 4M84A 5DG5A 3LJ2A 5KNJA 4R5YA 3VULA 5CHVC 3DB6A 3TZ7A 1H01A 2BRNA 3RALA 1P7EA 1CJEA 4WBOA 2OF2A 4MNEA 3LFEA 3VUYA 2WXLA 4BBNC 2CNVA 3QQUA 2ONLC 1OIUA 4MH7A 1JWSD 1YI3A 4J98A 3FAAA 2V0OA 3ALOA 4FKPA 4BCHA 3R21A 4BCGA 1QOAA 3BU5A 2K8HA 2D11A 2JBOA 1WY8A 4EHEA 2RKUA 5H2UA 3WF7A 3HUIA 3V6RA 1K8RB 4NW5A 4L23A 2EFLA 1IGDA 3JW0X 3ORTA 3BVVA 4Z7HA 4HDQA 4I6LA 3SG8A 2Z0NA 4W9XA 2L32A 4M8TA 5J7BA 5BVKA 2RAJA 3Q53A 4DXFA 5KO1A 1QF6A 4ARIA 1LP4A 3EJQA 3Q2JA 2CKOA 3AECB 2PMIA 3LCOA 1K50A 2BTSA 3ZRMA 2G1EA 3QZIA 5M08A 3UZTA 1IG1A 3RNGC 4F4PA 1XH4A 4CMTA 2GB1A 3UDBA 2OLCA 1C1YB 2CHWA 4RA4A 4EOQA 2XMYA 3COMA 2EWFA 3V51A 4U42A 4ANSA 3OMVA 1JRPA 5D9HA 4D2TA 4WOVA 4UMQA 1L6UA 3VH4B 4NM7A 1QWUA 1C4PA 4MJSA 1XEEA 4GW8A 1NVID 4EORA 4QMMA 5I5ZA 4J71A 5DHJA 1L0XB 3E8EA 4DITA 1D5MC 3O7LD 2XCKA 4W8EA 3WI6A 5A3XA 4X6RA 3AE6B 1YDSE 3VJNA 4KDLB 4MQ2A 3GNIB 5AP0A 3QTSA 3QBNA 3RHXA 1RLFA 4UDUC 4ANLA 2QOLA 3RVGA 4HROA 3PG3A 4JXFA 3EYHA 3KWLA 4PY1A 3WF9A 3LM5A 4FE2A 4BWKA 1WSPA 1X8BA 2F7EE 4EOIA 4KV2A 2H96A 4MF1A 3VO3A 4BDAA 4ACDA 3CJGA 1E9MA 2R9SA 4F9CA 3CD3A 4XUFA 3ULZA 2HDEA 1GAGA 5C1QB 4I6HA 1OKYA 5J87A 5I9WA 4HJOA 4BB4A 3QQLA 5FKAC 2VX1A 3KH0A 5CU3A 3UOKA 2C0TA 1Y56A 5KMKA 3BWUD 4S30A 4GUEA 2ZZPB 2KLGA 1V1KA 2TSSA 2NNWB 3OEZA 4JBQA 1CM8A 4KSQA 2IVTA 3I5NA 3NUXA 4ZTLA 4IG7B 4BFMA 2RDHA 2Z7SA 3FSFA 1DM2A 4UY9A 3B51X 2ZM1A 3NNWA 3BLHA 4F09A 3EQPA 2B9JA 4RVKA 5CAPA 4O84A 4CFVA 4PS7A 2H89B 4M0WB 3MA3A 4BY9E 2XEZA 4GK4A 1U5RA 5CI7A 2XAOA 4C4VA 3BVTA 3AKKA 4PMSA 4LDTB 2WTKB 4LRKA 3GZNB 4FR4A 5GZ9A 4KKHA 3O3NB 3PGEA 3KVXA 2JKKA 3ZYAA 3WOWA 1M17A 3PXFA 4JI9A 3UOLA 1KOTA 3RZBA 5C03A 2VV9A 3EJSA 4CFWA 3N1ZC 3FMMA 4BI0A 3VQHA 1TY2A 4NAWB 2KDIA 4QMXA 1ZXIA 2JZPA 4MT5A 4QP7A 3DDGA 4PQNA 5JH5C 2MJEA 3R9RA 1UKHA 4KGSA 3ZDIA 1KM7A 1BX6A 3FMKA 4BDGA 2YM6A 1FMAD 3L3PA 3MH3A 3S1HA 4PP9A 2FUHB 2GMIC 1GAQB 4YGAA 2ACXA 2I0YA 4TYIA 4B6WA 1NI3A 2CR5A 2YCQA 4QMOA 3DVNV 2OO8X 2HY81 5AA9A 3NNVA 4LRJA 5AV0A 3ZRLA 2KTYA 3FUPA 4Y8DA 2LUEA 2OBLA 3M42A 3KXXA 4IAFA 1T0SC 3ACKA 1DAWA 3JYUA 2EX3B 4DEEA 2UZLA 3T8MA 2YM3A 3SD5A 3VS0A 4DFUA 4BDEA 4J1RA 4IVBA 5LWNA 4B7TA 4BTKA 4DBNA 4DGOA 2AEHA 4E4MA 3PLAE 2JLDA 3DCVA 3APFA 1LO5D 1O7DC 3HEGA 1ZE3D 3F5PA 3GI7A 2W06A 4CGAA 3OK8A 1N61A 3UYSA 2WNTA 3PVUA 4F9BA 2RDGA 3UE4A 4ZY6A 4K1BA 3SOGA 2DYLA 4NUSA 2ZB0A 2DZIA