4IM2A

Structure of tank-binding kinase 1
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
659
structure length
618
Chain Sequence
GSMQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRNIKPGNIMRVIGEDGQSVYKLTDFGTEEYLHPDMYERVLRKDHATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVMGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase TBK1
publication title Structure of Tank-Binding Kinase 1
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 212
structure length 618
sequence length 659
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF18394 TBK1_CCD1 TANK-binding kinase 1 coiled-coil domain 1
A PF18396 TBK1_ULD TANK binding kinase 1 ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4im2A02
1.20.1270.420 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4im2A04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4im2A03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4im2A01
3DAEA 4F1TA 3UGCA 2X4FA 2OK1A 4YO4A 3PLSA 4O0WA 2WU7A 4C37A 1I35A 3BX5A 2GQRA 2CGUA 4IB3A 1CKJA 3Q32A 4EWQA 3AT2A 4R5SA 4A3OA 4PL3A 4D4VA 5T6KA 3DJ7A 3QTXA 3ZRLA 3A9JB 4GMYA 4MKCA 4ZZNA 5A3XA 3UNKA 4O0RA 4ANSA 4M8NA 1SNXA 3KVXA 5T68A 3UNJA 3MJWA 4QMQA 3V6CB 4B6LA 2N9EB 2CHXA 3HMPA 4JAJA 5IUIA 4W9CA 2QOLA 5K5NA 3ORPA 4GK4A 2R3FA 2J4ZA 3D2IA 4FA2A 3PLVA 1J1BA 3NY5A 3W2PA 3DS6A 4YNEA 2W1GA 2UW8A 5L8JA 4BWKA 3HYHA 3QD3A 4EZ7A 4FA6A 5AUXA 3FXXA 3BINA 2DENB 4RX7A 2KTRA 4WSYA 3TXOA 4S31A 1PJKA 4TW9A 3R28A 4DEIA 4IUMB 4UALA 2H96A 3ATSA 4O6EA 3T9LA 2I0EA 4EEWA 5JT2A 3GFWA 2QKRA 3HMOA 4XRLA 2MBQA 4I23A 2FSOX 1KV2A 3V5TA 2WTCA 5CX9A 2Y6OA 3F82A 4JG8A 1WX9A 4PWNA 4DBXA 2CR5A 2PUUA 4WWOA 4RJ6A 3UE4A 2UV2A 2GQSA 3DBEA 3HM6X 5GINE 4XNEA 4U6RA 1H25A 4N6ZA 4LMNA 3KXNA 4LV5A 4P5QA 2VWYA 4W9EA 3A7FA 2QC6A 4ZTNA 3D5WA 1Y8GA 5IA7A 4AGDA 5HIEA 2JXXA 2ZV8A 3MS9A 4A4XA 3O7LB 3OROA 2DS1A 3ACKA 1STCE 1S1QB 2W99B 4U40A 3BV2A 3RWPA 3MHSD 2BZJA 2R7BA 3FMNA 4MNEB 4PQNA 4LQMA 3QCXA 5L2QA 2HYYA 2OLCA 3HRBA 2O65A 2IG7A 1NY3A 3F7WA 1E1XA 3E8DA 4L3JA 5ANJA 2FCQA 1YDTE 4AN2A 2Y7JA 5DT0A 1MQ4A 3SG8A 3SXSA 3KXHA 2KVRA 1SVGA 3NNVA 4N57A 1IR3A 1SVHA 5A4CA 4BCNA 2ERKA 5M07A 5D2MB 4IVCA 2XNGA 3ZYAA 5IG1A 3ODZX 5M57A 1BX6A 2V4LA 5D41A 5IH6A 4D2RA 3D15A 2J90A 3GU6A 2ZNVB 4XG2A 2KTFA 4WBOA 2ERZE 1A9UA 3OP5A 4O7YA 4O1OA 5EI2A 2RL5A 3HA8A 2QNJA 1PW2A 4I0SA 3C0IA 4BCGA 3EOCA 2JKQA 1KM7A 2C7HA 4QMPA 3TBLD 4NY0A 4RIYA 2HZ0A 4ZJVA 4L46A 5LCJA 4RJ5A 4FIJA 3QBNA 4ERKA 2PE6B 2HY0A 1GIHA 3OZ6A 2BAKA 2KFJA 3PSEB 3VUTA 1UU9A 1L3RE 5C4LA 1HCKA 2DUVA 3JYAA 4ACCA 3R6XA 4ENXA 3ZU7A 3MY5A 5ETIA 4BDBA 5C9CA 4AAAA 3CJGA 4ANLA 5AEPA 1OIQA 4XHKB 1YQJA 5F9EA 2XKFA 1VR2A 2XIRA 2V0DA 4L42A 1OL6A 4E8AA 4F9BA 3UIUA 4BC6A 2CHWA 4IB5A 1UH6A 4W9LA 3DPKA 5CZIA 5LVLA 2ZJDA 4E4XA 2XBBC 4YUQA 4CFMA 3PLUA 2XJ2A 5CU3A 3WF7A 3H9OA 5CLPA 3VUXA 3H0ZA 3ALOA 3NWWA 2ZB1A 3HMMA 2ONLC 2ZJWA 4QYYA 2KDEB 4F64A 4BBMA 3ZHPC 5KMKA 3BWJA 1E7UA 4LOOA 5HKMA 2I7QA 3A4RA 4MH0E 2GDOA 3MB6A 2W5BA 2YM3A 5L2SA 2O0UA 2FGIA 4F4PA 3MI9A 3EZVA 2B7AA 4FKIA 4AT3A 3MH2A 4AX8A 2IYDB 5KCVA 4GIVA 3A1QA 4EH9A 3VUYA 4O6LA 4BKSD 4XYFA 3TNHA 4NUSA 4A9YA 4OTQA 1VD2A 3LXLA 2XK3A 4RLKA 1REJA 4GVAA 3EJ1A 3DFCB 4ENYA 2WMUA 3T3UA 3ZUTA 4FBJB 4GU2A 4BICA 2WDTB 3OXTA 2X2KA 3BI6A 4E6DA 4DCAA 3G6HA 2KFKB 4I21A 4ID7A 3QD0A 3L0WB 3TDWA 1YVJA 4DH8A 4D5KA 5D94A 3MJ1A 5CAVA 2R64A 3L13A 5D11A 5EQEA 4MK0A 4W9JA 4NQLB 4CGAA 3JY9A 2R3NA 4EH4A 3FMJA 1WBVA 4EKKA 3BYMA 2BKRB 2Y6MA 3T8MA 3O65B 3JVZX 2XEZA 4FTOA 5HO8A 2VO3A 3U7DA 5A14A 1VYWA 1WF9A 1U59A 3RI1A 5BX0A 4AOFA 3UMWA 4XP2A 3FWQA 3IG3A 3VUHA 2KC1A 2C6EA 2HK5A 4UMUA 4QO9A 1ZXEA 4ALVA 1WCCA 4DH5A 4BWPA 1PMUA 4W4XA 3ZO1A 2W4JA 3F69A 3RM6A 2V62A 3CY2A 3NYXA 3QRKA 1OPLA 4KZ0A 3R73A 2QOOA 2JUOA 2WPAA 5EW3A 2KK8A 3A61A 3THBA 4E4MA 2JZ3B 2W9ZB 1VEBA 3WF6A 3FPMA 3RHXA 5AUWA 4B8MA 1Q62A 2QONA 3ULIA 3P9JA 1P4OA 4KA3A 3QHTA 4HDOA 2QCSA 3RPRA 4EH2A 3PTGA 5A46A 2JY6A 2RSUA 4LOPA 4JIAA 2PE9A 4U81A 5M4FA 2KWUB 3QXOA 4EK8A 3CTQA 3Q04A 2YIQA 2QVSE 2MBBB 2I1JA 2BHEA 3MY0A 5CENA 3Q6WA 4I5MA 5EKOA 1PY5A 4B95A 2GFCA 3WYYA 5LWMA 4NAWA 3A62A 3G51A 4BCQA 3UIOB 2UZWE 4YJQA 1UD7A 3PJ3A 1WH3A 4I5HA 2W96B 3GU8A 2N7DA 4XBUA 4ZJJA 3ZLXA 1FVVA 4FZ7A 2X6DA 1P0RA 1S9JA 5J9ZA 5AV1A 5D12A 4XEYA 3ZO2A 2VRXA 5IA0A 4I0TA 3DXPA 3TZ7A 4AZTA 2DYOA 3C0RB 5L6OA 5HX8A 2UVXA 4C59A 4M3QA 4URKA 5D9HA 3IDBA 2OJ9A 4FUXA 3QUPA 4W4VA 2JD5A 1MQBA 2UZLA 5JHAA 2XIZA 3SLSA 3H3CA 3C13A 4HWIB 3CTHA 5C1QB 2N7EA 4H1JA 5BYLA 3WZUA 3BZ3A 4F0IA 5FTGA 4BZOA 3BGPA 2JIVA 3C4WA 3HECA 2BZHB 4Z16A 5GMVA 2BDJA 5E8ZA 1Z9XA 4EHGA 3WIMA 1JKTA 5DFPA 4M0WB 5J5TA 2KMCA 2V22A 4GSBA 2IVVA 3QX2A 2L7RA 1ZOEA 1YXVA 5DPVA 4TYHA 4UXQA 3WARA 3QGWA 3KRLA 2KTYA 5GZ8A 1OL1A 3PY3A 1OIUA 2QO7A 3T3VA 1AGWA 3ZDIA 3PPKA 5FD2A 3R21A 4DFYA 2VTLA 4GIHA 4BDFA 3KF4A 5TR5A 4EH3A 2GQGA 4G3FA 2CMWA 2IO1B 5DEYA 2GTMA 1PKGA 3NDMA 3BYUA 4RMZA 4RVKA 2YAAA 4W9FA 4ZAUA 3QJZA 4BFMA 3TKUA 3BU6A 2QOQA 2IY0B 3ZRCA 1RJBA 4UYAA 2GHLA 4YL8A 4PPBA 3IW5A 5IA5A 1L2NA 2CN5A 2XJ1A 4F1OA 5JH5C 4DFZE 1H07A 3OG7A 3VS5A 2REIA 3FQEA 1YKRA 4C34A 4IJ9A 2PVHA 4L7SA 1P98A 2UZVA 2IJMA 4DEEA 4ANVA 2I40A 3MTLA 2CGVA 2WMVA 4FOBA 1ZYJA 5FP6A 4QQTA 3LFSA 2BRMA 5DMZA 3FKOA 3FI3A 4A7CA 1NT2A 3KYDD 4F8CB 4JVGA 4ALUA 3VBTA 5AR7A 4XUFA 2C69A 4AGUA 4RIOA 4JG7A 2GNHA 3RCJA 3DQWA 2ZMCA 4GFGA 3B8QA 3UVRA 4TV3A 5I9ZA 2I6LA 1RRBA 1WGGA 3KUDB 3W8LA 2FB8A 5AA9A 1XBAA 4BKGA 2E9OA 4OTHA 5AP6A 2XS0A 2W1HA 3EQIA 3GOPA 5E8YA 4B8LA 3BPRA 4ACDA 3A9KB 5HBHA 4K33A 4I5PA 2ZVNA 5JH6A 4FV7A 3ZTXA 2IVSA 2VTOA 4B9DA 1WZ0A 3E7VA 3DBCA 4FKLA 1GIIA 3U55A 3ZSGA 2WTIA 5LLIA 4CFVA 3IPHA 4MSQB 4C35A 2YWPA 3O0GA 4M8MA 4LOQA 3PRPB 4JQEA 5EKNA 3FMDA 3MH3A 4ASXA 4WO5A 1X1MA 4FX3A 4D2WA 3WE4A 3N4VA 4OBQA 4AE9A 1DAWA 4FT7A 4BL1A 4BKJA 2MRPA 4DGLC 1V49A 2CLQA 4CCUA 3LJ3A 3MH0A 3W2RA 4RBLA 5EI8A 3BLRA 3QALE 4M68A 1WBNA 1R39A 3JUHA 5G6VA 5HO6A 4HW7A 5JEBA 2MBOA 1XT9B 2WGJA 5FM3A 4X2NA 2G01A 4DHJD 4EH8A 3SDJA 4YJVA 2RR9A 3CKWA 3OXZA 3ORIA 2ETKA 4UZHA 3P7CA 3WZEA 3FLSA 4O38A 4FZ6A 1ZY5A 4R3RA 3VHEA 2PULA 1JKLA 4DHZB 1P5EA 5HBEA 2C3JA 1H08A 3CGOA 2BFYA 2R0UA 4YTCA 5F20A 5AP3A 4NNJB 3PLAE 3MPTA 3FMLA 4EQMA 2GNIA 5I5ZA 2BVAA 3A4OX 4YTIA 1A48A 3C51A 5IQHA 2H6DA 3TZMA 3VBWA 1D3ZA 3OW3A 4GH2A 4FV0A 4X3FA 2WX1A 2NBVB 2P2HA 3L8PA 3AMAA 3F5GA 5BVDA 4K1RB 2H34A 3C4EA 1WIAA 4N0SA 1JSVA 3EKNA 2HW7A 5AR5A 4KUJA 4PX6A 3PG1A 2O6VB 4X6RA 4EFOA 5J1WA 4IAAA 1F9JA 3VF8A 4CSVA 4KDIC 4LDTD 3OTUA 2UW4A 3COKA 4IHPA 3GC7A 3IOKA 4PS8A 2XNMA 4MD8E 2PL0A 4NM3A 2OH4A 5DT4A 2WMBA 2IVUA 4KD1A 3LVPA 4AFEA 4O83A 5DVRA 4AW5A 2NBWB 3A7JA 3IW4A 1J7IA 1W7HA 3ALNA 4DINA 3DLZA 1H0VA 2AC3A 1V2YA 4J6IA 4U7ZA 3HHMA 2J9MA 2LGDA 4DFXE 5HVYA 5KHOA 5LMBA 5AADA 3KH0A 2WD1A 3H7PA 3U4WA 1WJNA 3W8QA 3GT8A 3CD8A 1DI8A 1I09A 3VTVA 4MH7A 3SD0A 2QOBA 4Z7HA 1UWHA 1MRUA 2BPMA 3TKHA 4O96A 2BZIB 5HNIX 2N9XA 4RVTA 4YSJA 3QTRA 3OLMD 5KX8A 3TZ9A 3FBVA 3FZTA 4BBNF 2N1VA 1Q8YA 2ZVAA 2UZNA 4RRVA 4BCPA 3PPJA 2BKFA 4X3JA 3NZUA 3EQCA 2YCSA 3POOA 4DC2A 1Q5KA 2JT4B 3IQ7A 4GMVA 1PMVA 3VBQA 5C26A 5IISA 4TQ0A 2EB2A 4F1MA 3C9WA 4TWNA 4FV4A 3TWJA 2W17A 3HMNA 3PA3A 3X0WA 3PP1A 2HAKA 4HGTA 4IG7B 2VUWA 3GCVA 1BI8A 4ACHA 4H3QA 3FC1X 1IAJA 5BPYA 2C6LA 3RALA 5AP1A 4ALWA 2BPSA 4QD6A 4FG9A 2R9SA 3QU0A 4E5AX 3C5IA 3QWJA 4KS7A 4U5JA 1H24A 2FYSA 4KABA 2FCNA 1YIWA 4HXDA 5CI7A 1XH4A 4B9KA 1WFCA 3IECA 4M0YA 3ROYA 4EHVA 4HGEA 1Y57A 4GW8A 3F3UA 3EH9A 2K39A 2YAKA 2AYOB 3CQUA 1PYXA 4IX3A 2MSED 2VTAA 4QMYA 2C7NB 2PMIA 3K2LA 4IC7A 4OTGA 2J51A 3DKCA 2IW9A 4ZMFA 3BHVA 4DFUA 2GS2A 4WWNA 3SGCA 4AA4A 5HGIA 1XQQA 1Q99A 3NUXA 4Q5HA 1H01A 3BBTB 4XV1A 2GOWA 5FXRA 4FHKA 3GU7A 3HDMA 2LUEA 2O2VB 4M7IA 4BYIA 2HE7A 3IOPA 4O0VA 4X0MA 2NNWB 1OKZA 2KTRB 1H1PA 3WYXA 4FLHA 3UJGA 4ANXA 1WMHA 5ANEA 5C23A 3LXKA 4O7WA 3ZNHB 3CE3A 3L8XA 3W2QA 4HPMB 5DN3A 4AZEA 4ZY4A 4C2WA 3R66C 2OZOA 4IMYA 2WHBA 4UXLA 4IE9A 1ZY4A 2VWZA 2C30A 2X7OA 4E6AA 2HZNA 5D7VA 1H4LA 1Z57A 2ACXA 2I0VA 3HA6A 2MP2A 4BKSA 3NHEB 4UYNA 4L52A 2UW0A 1JKSA 2J7TA 3UC4A 2N9PC 4P7IA 2OI4X 4YC3A 3IKAA 2YM4A 4BR3A 3COIA 5CF8A 4AGCA 3VDZA 5AUZA 3II5A 4EUUA 3A7HA 3VXWA 4O0TA 3COHA 4G9CA 2IY1B 4BZNA 2WO6A 4C0TA 3A33B 3R9RA 2RKUA 5FM2A 1Q3DA 4C36A 4AGWA 4ANQA 4J97A 4NKAA 2QR8A 3A4PA 4M69A 2PZYA 4G6LA 5HE0A 4IVBA 2OICA 2DYMA 3BHUA 4I4FA 4LYNA 5E8WA 3MVHA 3KEXA 3OXIA 3Q2MA 3D5XA 4GXBA 1P3QU 5JFWA 3QTQA 2FSTX 1ZZLA 4J96A 3ZLWA 3SU8X 3G2FA 4NL0A 5IQBA 1ZMVA 3GZNI 5K4JA 2J5FA 1TKIA 5CHFA 2OZAA 4E1ZA 1J3HA 3LW0A 3P5KA 1Y8YA 4EK6A 5FUTA 3V61A 2BGFA 4CYIA 3AGLA 5CQWA 4PL4A 3P4KA 4XLVA 3KXZA 4PPCA 3CPBA 4V01A 4K2RA 4E7WA 3DBSA 4LJOB 2PE0A 4GG5A 4OTFA 2A0CX 4KNBA 4EK4A 2Q0NA 3MH1A 4ERWA 3RHKA 2PZPA 4IZ7A 2A5UA 4LM5A 4G3GA 2X9FA 5HICA 1MP8A 2AEHA 3L8SA 2YM5A 4NJ7A 1R3CA 3HK0A 3V5QA 2OW3A 4NFNA 2XNNA 1OI9A 2C47A 3M42A 3TV7A 4X2JA 3X23A 5DOSA 1BYGA 4IAYA 4BCIA 1ND4A 3PREA 2OJIA 2ITYA 2Z02A 4W4WA 4FKJA 2GBMA 2DZMA 2YCRA 2IZVB 3M1SA 2CHLA 5CTPA 4KV2A 4YTFA 4XLIA 5BNJA 2FUHB 2YA9A 1KOAA 5IQIA 4ZP5A 3VUWA 1WGYA 5A4EA 1PXOA 3IO7A 1S3SG 4HDQA 2PVRA 5DE2A 5E90A 4GDLB 3IS5A 5C8KA 3UP7A 5ACBC 4EOJA 3AQVA 4GB9A 3TN8A 4PYUA 4ZZMA 3C0GA 4DDGD 4GIIA 5CX3A 2OJRA 2ZDTA 3BQRA 4E20A 1V5OA 4FKUA 4WG3A 1E8XA 5FXQA 4MYGA 1CMXB 3VJNA 1YI4A 1FVRA 4LI5A 5L2IA 1Q4LA 3PRMB 2R3PA 4IX5A 3POZA 5CT7A 4K77A 4WRSA 4O7LA 3OWLA 5HHWA 3FYKX 4YLJA 3VUMA 3QZIA 1V81A 2YABA 1E5WA 2VWVA 4D2SA 5HORA 1P2AA 2VNYA 3EMGA 3PXZA 4I6QA 1RAXA 4BZDA 3A1QB 4MGIE 3FMMA 3PSCA 5HVJA 2HZIA 2XMYA 1BUHA 3LFCA 3ORXA 1XKKA 3QQKA 3ALBA 3IK3A 5HG9A 1V6EA 4FG7A 1ATPE 1RW8A 2JAVA 4YZDA 3PPAA 2B55A 3PVLA 4DGNA 2DWBA 4YR8A 5HEZA 3HEGA 2Z0EB 2JIIA 3UBDA 2R7IA 3W10A 3RULA 2CKEA 2QR7A 4IM0A 2Y4IB 4N6YA 1OKVA 3E3PA 1GZNA 2REXA 3ZFMA 2JIUA 2QHMA 5AAFA 5KMOA 3W1SC 3CPCA 5CSXA 2ITUA 4C4HA 4IDTA 3PXRA 4HVHA 4MEDA 3PJ8A 4OTWA 2EKEC 5I4NA 4BDEA 3DBFA 5IQCA 2C5OA 2O2UA 3F3WA 3HNGA 5H8EA 4FNWA 3ZC6A 3CF6E 2ZVOA 3Q60A 2IVTA 5LVNA 3HAMA 3DVNU 4MWIA 3FLNC 4W9HA 2OF4A 3K54A 5A6OA 4JS8A 1J7UA 3AC3A 3QRJA 3R30A 4NT4A 3H1UA 2JPHA 1M2RA 4AUAA 3TV6A 4TWOA 1WJUA 1PXMA 4QQJA 4LGHA 4GT4A 1HE8A 2BMCA 2OU7A 5BYZA 4XV2A 3NPCA 4FUYA 4O7ZA 2JKKA 3RYTA 1H00A 2OXDA 3REPA 1WGHA 4J71A 1XWSA 3IBEA 3PJ1A 4D2VA 4IAKA 4FNXA 1WZ3A 4D4YA 1U5RA 3P0MA 2M1MA 4D1SA 2GMIC 4G6NA 5BMMA 4M12A 4K81A 3UG1A 2VO6A 4NW5A 4L43A 5IUHA 3LFFA 2PPQA 2G45B 1UGMA 4DEDA 4V0GA 5ANIA 2NP8A 1OMWA 3HIZA 3HV3A 2WMWA 3UIPB 3DZQA 4NAWB 3EYHA 5DR6A 5EDPA 2E9VA 3MYGA 4O0SA 5LOHA 4UMRA 5C01A 3NS8A 4MJSA 3F88A 2FNJB 4D9TA 1IA8A 4WD5A 3HV4A 4KRDA 3D5UA 4YC6A 5FLFA 2BDWA 4W8EA 4FJVB 3R8MA 5LVPA 3DJ5A 4RWKA 4OBOA 4BY9E 5HNBA 1WM3A 3EQGA 2ZOQA 4AW0A 3RUIB 3OAWA 2ITTA 3RAIA 4MXXA 4BHZA 3Q4TA 3KB7A 1BL7A 4ANOA 4R7HA 2Z2WA 5KZIA 3I60A 4DITA 2WXVA 2Z7SA 2HOGA 1UELA 3GC9A 3V62A 4K0YA 5DIAA 4IZ5A 2CKPA 3NAXA 4EQUA 5HKHA 3UG2A 3R8UA 5A6NA 5IMXA 2JGZA 2X8DA 4EZ5A 5GZAA 4F7NA 2E9UA 2ZZPB 5EK7A 4MAOA 4RX8A 2ITVA 4NWMA 4QMNA 4AOJA 2WWZA 3HVCA 5L6WL 3LZBA 2B52A 4FSMA 3KGAA 3NS9A 1E7VA 3WF9A 4BDAA 3ZLYA 3V8SA 4GG7A 2V55A 1UBIA 3BHHA 3NUUA 4LG4A 4F9AA 5B2MA 3RT3B 4N4SA 2WX0A 3C4FA 3ZNID 4GFMA 2H8HA 3QA0A 4C58A 3PT2B 2EUFB 3ZO3A 3ERKA 4I24A 2BRNA 2C5YA 4O1PA 5CVFA 2GNJA 3VTUA 4GJ3A 5CU0A 4IH8A 3PPZA 4BCFA 1YDRE 3VW8A 2IN6A 4G5PA 5EOBA 4DXAB 4FK3A 3VS0A 2QHNA 3HKOA 3KW5B 2OKRA 1GJZA 4FEXA 4EEVA 5IZFA 2WTJA 3ZDUA 3LFEA 3R0TA 3APDA 5LXIB 1WBOA 4P7EA 3I81A 5EM5A 5JQ8A 1WE7A 4EORA 1WXMA 1KE5A 2ZPNA 4CV8A 3BEGA 2JFMA 3MJ2A 4X2KA 4DWFA 2VN9A 1W84A 1JLUE 4TUUA 1OKWA 4TYEA 4CLJA 4BFRA 2XKDA 4XZ4A 3EHAA 1ZARA 4ZEGA 4AQCA 5HE2A 2LXAA 2YWVA 2XYUA 1J91A 4WG4A 3U6JA 1M2PA 2AL3A 3I0QA 5LMKC 2X1NA 3VS1A 3NVMB 1K9AA 2GFSA 1M52A 2W1DA 3PXQA 5HE3A 3IW6A 2GSFA 3FSKA 2FSMX 3E88A 4RZVA 3VRYA 4F9YA 4RWLA 2OOBB 2LVPA 3IFWB 5A9UA 3H9RA 2WELA 3R22A 3V8TA 1J0GA 4RJ7A 4F65A 4FSWA 3VBYA 3DBRI 1OKYA 3UO5A 4C57A 3EIDA 5JGDA 4JG6A 4NJ6A 1U4DA 5ANOA 3FXWA 4I6HA 4Q2AA 4FYNA 3KMUA 3ATTA 2D10A 3AMYA 5HG5A 4HPUE 3DPDA 1LR4A 2FCSA 1R4MI 1Q5WB 3UOKA 3TIZA 4FV2A 2ONLA 5IA3A 4AJYB 3DKFA 1K2PA 3LCKA 2X0GA 2QKWB 1WXAA 2YDIA 4FTAA 4K7SA 5HESA 4Y8DA 4M66A 3HUCA 2Q0BA 4E26A 4CNHA 4FSRA 4L01A 4YURA 1RLFA 2VWIA 3EQRA 2OJJA 3QHRA 3UQFA 3AC5A 4XOZA 3PIXA 5CAOA 3MDYA 3ONSA 3AD6A 4YZNA 2YZAA 3F5XA 3MIYA 4APCA 3NW5A 5KKRC 4WHZA 4EOYA 5E91A 4BCJA 4JGHB 4FL3A 3QLGA 1FGKA 3OJ3A 1H0WA 5J1VA 1YJ1A 5ACKA 4FTJA 4EC9A 4L45A 3APFA 1UA2A 1KE9A 3C4XA 3NLBA 2F4JA 3QC8B 4F6WA 3DK6A 3L08A 2ITQA 4UBAA 2QODA 4YHFA 2IW8A 2RFNA 4PL5A 3TIYA 3I7BA 3U8WA 4I6NB 4DTKA 1NBFC 3MA6A 1TZ1A 4WJPA 2JBPA 4CMUA 2JDSA 4NEUA 4O0UA 2YIRA 4I22A 4TXCA 4G3DA 3VBVA 2VWWA 1QL6A 2KKCA 4F0GA 4PNKA 2PE2A 3JS2A 2K25A 1WVXA 4YLLA 2HWPA 3QQLA 5C8NA 3JR1A 4IEBA 4R1YA 2Z0DB 2QQ7A 3TJDA 4F7SA 4ZTSA 2BAQA 2XK5A 4XG8A 1JBPE 5JRSA 2KJHB 5EG3A 1F3MC 4IC8A 3ANRA 3OF0A 4MD7E 1WMKA 4CMOA 4PUZA 3I1AA 3ZM4A 2G1TA 3UVQA 4G31A 3LJ2A 3A9KA 5BYYA 1PF8A 5FEDA 4X3FB 5KZ0A 1TQPA 2AC5A 2E9NA 5HLWA 4FC0A 4FL1A 1V86A 4A4LA 4BN1A 4CFWA 4XV3A 2GTNA 3RZBA 4K6ZA 4PRJA 3RNIA 3OUNB 4QMUA 3SAYA 4H3PA 5IEXA 1ZYSA 5EOLA 2ASQA 4FTCA 3SVVA 5KMIA 2O5KA 5LQFA 4FV5A 5KBRA 3MN3A 2W5HA 4IB0A 2DAFA 3H10A 3E8EA 1YOMA 3V6RA 4QQ5A 3TJPA 3ZZEA 5AAEA 2MLBA 3OOGA 3AXWA 3OY3A 4BGQA 4FICA 3CTJA 2E9PA 3WOWA 4HVSA 4U3ZA 3E8CA 4W8DA 4EZLA 5BUEA 5IAAC 1CM8A 5T3QA 1IPGA 5IH4A 4AS0A 4S30A 2RFEA 2HELA 2OJGA 3D2KA 4KKHA 5E6NA 2FO0A 2F2CB 1A5RA 3P7AA 4QQCA 1WGRA 3QD2B 4K1BA 3NUAA 2YDJA 3E8NA 1OEYJ 2R3MA 4D9UA 3HP5A 4KKGA 3U9CA 4DFNA 4U44A 1K8RB 2NRUA 2XIXA 4M8TA 3VNTA 2D3GA 3OEZA 2R3RA 4G11A 1FBNA 4J53A 5AV3A 5HCYA 3DLSA 2BR1A 5G2NA 3T9IA 2GCDA 4Z3VA 2XRUA 5IUGA 2QLUA 4S32A 1U54A 3O71A 3F61A 3CP9A 3CS9A 4RJ3A 4YHTA 4PTEA 5AV4A 2FA2A 4RIWA 4MGYE 5KKRB 5FTOA 3F2RA 4CTCA 3PUPA 1YX5B 5KMLA 2I1KA 3QWKA 4W9XA 4ANBA 5HTCA 1FGIA 2VTRA 3KREA 1BKXA 3OCGA 2C4GA 2J0IA 3VJOA 4YBJA 4EC8A 4FYOA 4FTUA 4GL9A 2AWTA 2BWFA 4W9IA 3DAKA 3R02A 4OTRA 3C4CA 2G4DB 4KSKC 3HUBA 1YXUA 3OWPA 3L10B 4DEBA 1SYKA 4EUTA 4U97A 4CYJA 1YWVA 5E6PA 2GU8A 4IC7B 3UOHA 2IZTA 2XP2A 5EDQA 2L8JA 3Q53A 3RCDA 2XF0A 4PY1A 4ZSGA 4JR3A 2F49A 2O8YA 4FNZA 2PSQA 2VZ6A 5KMJA 1QPCA 4BIEA 3D32A 2Z7QA 4DEGA 4IADA 1OGWA 3NGAA 4KB8A 4BVUC 4TPTA 1ZOHA 1YI6A 3KCKA 2ZB0A 2D2QA 1PXJA 4ZJIA 5AZFA 2SRCA 3RTPA 4C4IA 3ZNGC 3D83A 4ZTRA 3R9NA 3WIKA 3PVUA 4CVAA 1WMHB 4WNPA 4FSYA 5H3QA 3VBXA 4GU6A 2BROA 2PYWA 2JDVA 5EW9A 3W1FA 2YDKA 4E71A 3CXWA 4JX7A 1Y6BA 2XBJA 2KLCA 4NJDA 3ORLA 1OPJA 3OJ4B 2JF5A 3VW6A 3R01A 3ZCLA 2R2OA 3MSSA 3UZRA 3B0AA 3PIZA 2R5TA 3BHYA 5EM6A 4E93A 2YISA 3NCZA 4Z9LA 3TCAA 4AE6A 3PSBA 3LFQA 5FXSA 3FQHA 4B6WA 3PY0A 2BYFA 1CDKA 4S2ZA 2ZV2A 3NIZA 1GUAB 1KE8A 4U42A 4DAWA 1KV1A 4FSQA 1QZEA 4OVVA 4HVGA 3AT4A 1IEPA 3G90X 1CTPE 3JVSA 4F1SA 4J98A 4F7ZA 2FIFA 3P79A 3UIMA 4XG6A 5ANKA 2WEIA 4HNFA 1PHKA 2X8EA 3FYJX 4OAUC 1V5TA 3MTFA 4AZVA 1KE7A 3EN4A 4M69B 1NVQA 4RVLA 4C2VA 4QTBA 3KVWA 3B08A 3FUPA 1KE6A 3W16A 2VWXA 2O3PA 3VRZA 4XG7A 4C62A 5JGBA 4EJ7A 2O2VA 4XOYA 4YU2A 4AZFA 2HW6A 4FF8A 4MDKE 4NIFB 4UX9A 2QOIA 5L2WA 2XRWA 2OZAB 5BMSA 3Q52A 3SHQA 2CKHB 3LCDA 1GZKA 3PWYA 4FEVA 5AP0A 4QMVA 3D7TA 4ZK5A 4M14A 3DKOA 4UB7A 5M4CA 2J0JA 3VS7A 5HX6A 2AYPA 4BRXA 2ZV9A 3KXXA 2JC6A 4D0WA 4QMWA 1ERKA 5LXMA 2PVNA 5AZHA 2YLEA 4G1WA 5CXHA 5DWRA 4PMMA 1FMKA 3SW4A 4XC2A 2CKQA 4RMAA 4EWHA 5AWMA 4IFCA 3VVWB 1WI0A 4A9UA 1OL5A 1GOLA 5HOAA 2M17A 2WMXA 3PY1A 3RP9A 3CSVA 2CLXA 1YD8U 2MW5A 4BDKA 2XYNA 2DAJA 5J2RA 3ROCA 3NUPA 2YVCA 5CF6A 3DA6A 3ODYX 4J1RA 3SC1A 4RA5A 3VS6A 2HTHA 5LXHA 2M0XA 3CMMB 2ITNA 2CCIA 3ZRFA 2FIDA 1W83A 2W05A 3CR0A 5EH0A 2BYEA 2NVUI 2VV9A 3CEKA 3BV3A 4CCBA 4GUBA 2WNTA 4PDSA 4CFFA 3FKLA 4K11A 3OD6X 4FE2A 3ORNA 4JDKA 5AUYA 5EHLA 5IA2A 2K1FA 1I44A 5HIBA 4APPA 2GBNA 4NQKE 3BE2A 2XNEA 1LEWA 4Q9SA 2NPQA 2XM8A 4G16A 4MNFA 1JQHA 4PMSA 2XVDA 2MBHA 3FL5A 2XK6A 5B2KA 5E8SA 3QYWA 2OXYA 3IONA 2QG5A 2GMXA 4D0XA 1XH7A 5J17A 3PDTA 3BLQA 2L00B 1ZZ2A 3ZTDA 4HJOA 2IZUA 3BCEA 3GI3A 3KY2A 1O6KA 5KE0A 3K3IA 2WMSA 1H1RA 5AIKA 2VNWA 5JFVA 3HDNA 3QTZA 4QYGA 4EL9A 3PWDA 4I3ZA 3WA0A 4EK3A 4O81A 4XBRA 2V5QA 3FZSA 4DG0E 4K7WA 4I20A 3TUCA 1B39A 3LQ8A 3RVGA 3JVRA 4EOIA 4UWBA 4RC3A 5F95A 2K6QA 3WZKA 3FLQA 4FKGA 2ZMDA 4BCHA 1K3AA 5L6PA 5D7GA 4A4OA 2FAZA 1G5SA 5EDRA 4H39A 1O6YA 4LGGA 4OVUA 4WJNA 4AP4C 4GS6A 3F2NA 2C0OA 4GDKA 3DCGA 1OM1A 3T8OA 3DBQA 4BTMA 4TKNA 4ASWC 5DPWA 4GDLA 5C4KA 3F66A 2PVMA 3EN5A 4TNDA 1IP9A 4EI4A 2G2IA 1OUKA 5HLNA 4KIQA 4F6UA 1REKA 2IZSA 4R5YA 2R3HA 4W9DA 3VFKA 4RVMA 2JEDA 2C6IA 3D94A 2C7MB 1V0BA 2LVQA 3QARA 3O2MA 3CCNA 3D0EA 5CEIA 3OT8A 4R77A 3B8RA 2VTQA 4BCMA 4UEUA 2MQJA 5BVOA 1Q41A 5DRBA 4FSNA 3SKCA 3C50A 2XCHA 3MFRA 4FKTA 3S4QA 4D5HA 1YXXA 3TV4A 5IEVA 2OSCA 5E1SA 3E7OA 4YZ9A 2PMLX 4TNBA 1QMZA 4FIHA 3LXNA 4HGLA 1TVOA 3RAHA 4FEUA 3MWUA 1ZYLA 2XK8A 5ETCA 3ET7A 2KMAA 2C5VA 4LUDA 3COMA 2UVYA 4V0GB 3GB2A 2VGOA 3OEFX 4AFJA 3MVLA 4W4YA 5KHQA 4NPNA 3EZRA 3KK9A 4E4LA 5AP4A 1KOTA 2KDIA 4HCNB 4MJSB 5M53A 5DRDA 5AUUA 5LVMA 3A99A 2KANA 1JSUA 2RSVA 4EBVA 2JVCA 3UODA 4OTIA 4WAAA 3KVFB 1AARA 5E6OA 1UU7A 2ZCCA 3NZSA 4KWPA 4O21A 3UOLA 4FTKA 5DPTA 5CEMA 1GNUA 1WBSA 2EXCX 2XUUA 4K18A 4K9YA 5F94A 3QQJA 4R1VA 5FBOA 5C1ZA 1SNUA 5HNGA 3ETAA 5G55A 2F2UA 5K9IA 3OC1A 3D14A 4BTFA 5AR8A 3ZH8A 3DVGX 4NYEA 1R4NI 2IWIA 3R3MA 4KBKA 3TCPA 3PVBA 3QRIA 3VUKA 4MWHA 2WTDA 4ZTLA 1BL6A 2D07B 1I42A 4BHNA 1XBCA 3ZBXA 2WYQA 4DHJB 3PRZA 3PTFC 2W0JA 4PDOA 1M14A 2HXLA 5IQDA 1LEZA 1H26A 4BYJA 2DZJA 4USEA 4TKSA 4FHJA 3A7GA 3E64A 2RD0A 5C8MA 4L3LA 3A2CA 4KBAA 4FVQA 4D1ZA 2XNBA 2OIBA 4ZRJA 3EN7A 1W98A 4G50A 1PQSA 3PFQA 1CKIA 3CKXA 4NFMA 1PRYA 2KLGA 1XH5A 5DR2A 4FV1A 3BE9A 4EOMA 4FTIA 4D28A 5FTQA 2IO0B 2HJ8A 4P2KA 3Q6UA 2ZYBA 3SHEA 5CEPA 2XZSA 4C4JA 5BUIA 3DJ6A 4DFLA 3C4ZA 3GXLA 3PA5A 1JRUA 1BMKA 3NRMA 2GNFA 2OG8A 4HLEA 3EFWA 4GT3A 2EXEA 4LDTB 2X6EA 4H1MA 3QCSA 2BUJA 5M51A 5AIRA 5IQFA 4EOQA 4ZY5A 3M3JA 3NYVA 4U0IA 4CKIA 1JKKA 4II5A 1ZRZA 3Q96A 2QD9A 5HD7A 3VF9A 2CS4A 4OLIA 2YACA 2Y0AA 5CTRC 2OGVA 5DBXA 4GKIA 3L9LA 2PZRA 2CHZA 3P23A 2A4LA 5A54A 2OIQA 2ZM4A 5CVHA 5J87A 4HCVA 4MQ1A 3NSZA 2J2IB 2FUMA 3DXQA 1P4FA 4O22A 4I4EA 4O27B 4AWJA 3A8WA 2K8BA 2Q83A 1FVTA 1YOLA 3FE3A 3QFVA 4RC4A 5HQ0A 2B9JA 5AP2A 4LJPB 3FJQE 5FQDC 3BGZA 3N51A 4ZSEA 3GQLA 1W0XC 2WQOA 5CI6A 1PMEA 3K5VA 2KD0A 3KRXA 3ZEPA 4FSZA 4ITHA 5TF9A 2PVYA 3VIDA 3P08A 4XRJA 1P9DU 3QCQA 5HG7A 5EHYA 4KZCA 4BB4A 3PRIA 4BTKA 3M95A 5K0XA 3VQUA 2PUIA 4HZSA 1TQIA 3ZVVA 4YJPA 4GK2A 5IF1A 3JSVB 3ZO4A 5J95A 3BHTA 4FR4A 3LFNA 2C0IA 3P2BA 4CQGA 3LCOA 2CU1A 4FG8A 3WBLA 2QLQA 5EQPA 2M8SA 4D58A 5ETAA 3W18A 3W1SA 2X2LA 3R7UA 2YFXA 4AF3A 5CU6A 4AT5A 5K5XA 4ZLZA 5E1EA 3QIJA 1XD3B 3G15A 4UMPA 2KQ7A 3O8TA 2CCHA 3G6GA 3O8PA 3OY1A 4AZSA 3EECA 2F7EE 2R3GA 1AD5A 3ANQA 3RCZA 4TYJA 5CANA 1V0PA 3E62A 3VWAA 3EFJA 1P14A 3AC1A 2NS5A 2J6MA 4AXAA 3DFAA 4PV0A 2UZOA 3F3VA 4JBPA 1WFYA 2B3AA 2KJ6A 4C8BA 5IQEA 3QXPA 4PS3A 3OHTA 5FR6A 3R8LA 3LFAA 2KC2A 2OFUA 2Y4PA 5E7RA 1O9UA 4G9RA 2C5XA 3KXMA 3M2WA 4I92A 4BWXA 3GCQA 3EQDA 3TEIA 1GJOA 2XK5B 2DZIA 5DPRA 3ZW3A 1SVEA 5J9YA 3TG1A 3ZC5A 5L2TA 3QYZA 4MD9E 3GENA 3FL4A 1LFDA 3FHRA 2UUEA 3NOBA 1QPEA 3VQIA 3IHPC 2R3QA 5CSVA 3DDCB 3VS2A 5AEKB 1FINA 4MEMA 4ZMEA 4J8MA 4UMTA 3QWZB 3KULA 4CMTA 5CASA 4D4SA 4MGZE 4O2PA 1IASA 2C5NA 5GIPE 3RD2A 1OEYA 3RPYA 3UVPA 5AX3A 4IM2A 4DDID 1E8YA 5CAUA 5ANGA 3FZRA 2WOUA 2X39A 2PTKA 2R2PA 3KA0A 4L00A 5HTIA 3DNEA 2BTRA 2VTSA 1TBEA 4LRJA 4HCPB 3IW8A 4YGAA 3H6NA 2WZJA 2YN8A 4DHZE 5AM6A 3CBLA 2IW6A 4C33A 4RFMA 3G0EA 3PV1A 5LMAA 2YJRA 4NTSA 5DCNA 4JRNA 2AUHA 3PP0A 3AXCA 3VC4A 4RFZA 4BI1A 5CXZA 5LCKA 2QURA 4IX6A 2C3LA 2A19B 2PVFA 4WG5A 2VO7A 4CG8A 2D11A 3WIGA 2YEXA 2NBUA 2ZPYA 3ML9A 3L16A 4FL2A 3NYNA 3QHWA 5AMNA 1M7QA 4FKPA 2F7ZE 5IPJA 5JHBA 4UWYA 2YIWA 2XJ0A 3LAUA 4HPTE 3BY4B 3HLLA 3E87A 4IZYA 5E8XA 5EDSA 2PVJA 4WWPA 1Q3WA 1XR1A 4BI0A 4E5BA 1KWPA 2AL6A 2C1AA 3VAWA 4MVFA 2OXXA 4GKHA 3Q5ZA 4RLLA 2VO0A 2KQSA 1GC6A 2B53A 1U54B 2DYLA 2W1IA 3ORKA 2GBRA 4RZWA 3R7YA 2NRYA 4GK3A 3QC9A 3MBLA 2RF9A 4O86A 4BDJA 4C4GA 4RIWB 2XKCA 3UP2A 4I5CA 5CSWA 3V01A 5FDXA 3VUGA 2QOHA 3AC2A 4C3PA 3NNWA 3KMMA 5LVOA 3R2BA 4DG2E 2XNOA 3IGOA 2A1AB 3R9HA 3GC8A 4NZWB 3PXYA 5BVWA 4QYHA 2FVDA 1BT0A 1T45A 5CHVC 4QPMA 4UZDA 1NA7A 5LMKA 4I6BA 4R7IA 3EC8A 5EHOA 3GCSA 5IA1A 5EYCA 5EM7A 4ZS0A 3VTWA 2XA4A 4H3BA 3ZDMC 1WYWB 2YM8A 5IDPA 3CY3A 4IAZA 3O17A 2G2FA 3U4UA 4WNOA 3TJCA 4NM0A 4DK5A 5HE1A 1O6LA 4DT8A 3DBLI 3GVUA 1ZOGA 3GU5A 1QPJA 2H9VA 3G5DA 3OCSA 2UZUE 3QQ8B 5J8IA 1RDQE 2IZRA 4QP1A 2QG7A 3MVJA 4V04A 5DH3A 4FKSA 4XV9A 3BBWA 1KUTA 4WNMA 4UMQA 1H4RA 4LRMA 4TQ1A 2VX0A 3L1SA 4KVGB 3DNDA 4AT4A 3OBGA 1UWJA 1E9HA 4U9AA 2L0FA 3AULA 5HZNA 1TQMA 4F7LA 5DEWA 3HX4A 3SA0A 4EHZA 2VD5A 3VQHA 5CSHA 3I79A 3APCA 3FI2A 4MXOA 3TDVA 4QP6A 1SIFA 4CRLA 1OECA 4HYHA 3QTSA 3A60A 4DA5A 1EUVB 1Q8UA 1B6CB 1M2QA 4NK9A 4Y46A 3GCUA 1VYZA 4OTDA 4QMSA 3ZLZA 4Q5EA 3PHXB 3Q4UA 4MTAA 3MVMA 4RM8A 1LUFA 2PMNX 3AD4A 1WVWA 2NPTA 3L9NA 2OIDA 1FXTB 1BI7A 1RQQA 1IAHA 4Y5HA 3QQHA 3VN9A 1YXTA 1Q0WB 1UU3A 4O0XA 4MQ2A 3MPMA 5E8UA 3LFDA 4BBEA 1C1YB 2Z7RA 4QTDA 1ZMWA 2XM9A 2ITXA 2C5LC 4E6QA 4MELA 4JRVA 2KDFB 4EOPA 4QMMA 3KC3A 2WAJA 3UZPA 3IG7A 3LLTA 4U3YA 3SW7A 3RJCA 4ORKA 3PIYA 3CSTA 3QKMA 2ETRA 3ZRMA 3TIXA 1Q1OA 2ITOA 3P7BA 2YIYA 3FV8A 5L95C 5JGAA 2P55A 2KWCA 3DVNV 2VGPA 4BTJA 2JDOA 1OBGA 4FGBA 3MIAA 4EQCA 4GJ2A 3N32A 3V5WA 4G34A 3Q3JA 4I6LB 4USFA 2LZ6A 4O84A 4K8AA 3D7TB 3ZM9A 1YHSA 2O63A 2NO3A 5I3OA 5HVKA 3SX9A 3K3JA 4R7BA 2QU5A 4QT1A 1OVEA 4ZTQA 3Q3FA 3VHKA 4WRGA 5HLPA 5H8GA 2UVZA 4QP8A 3FY2A 3L17A 4QRCA 2JZZA 3HGKA 2BIKB 2C68A 1WE6A 3NEWA 1YHVA 3QQGA 1W82A 1WBWA 3WAPA 4I41A 1GZ8A 2R3OA 4XG4A 3ZUNA 5KUPA 3PG3A 3E63A 3ULZA 4TYIA 2VAGA 4FZAB 1WXVA 5GHVA 2KJRA 2CNUA 1LP4A 4FMQA 4FEWA 3WALA 4D4RA 4AACA 1EF1A 4CFNA 3S2PA 2P3GX 4KBCA 2I0YA 3U9NA 4TL0A 5M44A 4ZRKA 1X8BA 5HCXA 4FTQA 2GPHA 2EVAA 3PZHA 3EFLA 2R3KA 2DX5B 2EXMA 5JFXA 4CG9A 5GJFA 3QCAA 4D2TA 4FSTA 4TTHB 4FIGA 4X2GA 5GJGA 4AN3A 2X7FA 4WBBB 1OBDA 4C7TA 4AG8A 3Q5IA 3JXWA 4MBJA 4WKQA 1MG8A 2VTPA 1YI3A 4YNOA 4BIDA 3E5AA 1RE8A 3EB0A 3PJCA 4NIFA 3MESA 2MX2A 1JNKA 2XK7A 1UKIA 2O64A 4FKOA 5A4TA 4KAOA 1YX6B 1R0EA 4DTBA 4OT5A 3DK3A 3KK8A 3R63A 3RGFA 4EKUA 4XJ0A 4IBMA 3BYVA 5AUTA 3FY0A 3D9VA 3IDCA 2CNQA 5KNJA 1G8AA 2F9GA 2CSNA 4RIXA 4G3EA 4HCTA 5KMMA 4O7NA 3OCTA 5FEEA 3A4SC 3JYUA 2OF2A 1YWNA 1ZWSA 2XK4A 2X2MA 4RJ4A 3UYTA 3L9PA 3L8VA 2JDTA 1IA9A 2CJMA 2KHWB 5B0XA 2YCFA 2PUNA 1TGZB 5A4LA 3DZOA 1WBTA 4BKTA 3RWQA 5BQ0A 3QQUA 3UTOA 5AA8A 2A4ZA 3ZNZB 1SZMA 3RPVA 1L7YA 2ESMA 3MFUA 5G1XA 1CKPA 2BRHA 4FIEA 2KDBA 3WILA 2BTSA 2JAMA 4GDKB 3PRFA 3PA4A 4HCUA 4A9SA 5J18A 3WAMA 4FTNA 2GNGA 3A8XA 1NXKA 3S2AA 2C6KA 3R7EA 3FAAA 2J0MB 5DLSA 5K0KA 3E3BX 4OR5A 3E93A 3KRWA 1WR1A 3ZFYA 4DT9A 4BVUA 4OT6A 3BIZA 2J0KA 4QTCA 1KSWA 2XIKA 1GG3A 5I0BA 5CEKA 3SXFA 4QP7A 2KXJA 5EFQA 4MHAA 3ZZWA 2PU8A 3F6XA 4BBFA 3KRRA 5I9WA 1MRYA 3TL8A 3LPBA 3DOWA 4IIRA 4KIKA 1SMHA 3V5PA 3O7LD 1HOWA 3K9PB 2VX1A 1Q24A 4L3PA 3DCVA 1ZYDA 2LRUA 4NCTC 4FZFB 1XH6A 4DGMA 3GBZA 2C1BA 4O7TA 5CSPA 2CNVA 4XX9A 3OUKA 2LRWA 3AC4A 4GU9A 3QD4A 4K7UA 3BWFA 4P5ZA 3O51A 1G3NA 1JSTA 3TTJA 4ZZOA 4AOTA 3I5NA 5IKWA 4YJTA 3RPOA 3G9LX 4A06A 1VJYA 1TTNA 4IWOA 2PE1A 2WIHA 4CD0A 1Q8ZA 3PYYA 4D55A 4JR7A 4EOKA 5GZ9A 2XH5A 3TNIA 2XEYA 3FSFA 4M67A 4UY9A 2KNBA 4FT5A 4IWDA 4JLCA 4JXFA 2C6MA 3WF8A 4J95A 2XEWA 3EYGA 3R8ZA 2YM6A 1T46A 3G33A 5CWZA 1NI2A 4AU8A 4JQ8A 3UO4A 4IJPA 4BGGA 3M63B 4QNYA 4JNWA 3R7OA 4YJSA 3KU2A 1G6JA 2K8CA 3B2WA 5CYIA 4CT1A 1ZW7A 3Q3BA 1UZXB 3EL7A 3EQFA 3WAOA 3R2YA 2Z59B 3NYOA 2MBEA 5ICPA 3P1AA 4HGSA 3ZLSA 4AUQC 4MBIA 4AWIA 2UZDA 2Z8CA 3SV0A 2GHGA 3DBDA 4HPLB 4N70A 3N4TA 4NM7A 3OS3A 4J7BA 3TM0A 3NW6A 4F6SA 3NUNA 3RNYA 3ITZA 4EOSA 4EZ3A 4U45A 1AQ1A 3ZXTA 4MXYA 3VULA 3F7ZA 4UN0C 5FWKK 3ZBFA 4CQEA 2EMSA 4HZRA 3QKKA 1WGDA 3C7QA 5DNRA 3MGYA 4BKZA 3I7CA 4MXCA 3UQAA 1FQ1B 4DEAA 3KUZA 1Y6AA 3GGFA 3NUYA 4L7FA 5CS6A 3FI8A 3C0HA 4CV9A 2WTVA 2UW3A 4ZSJA 4FKVA 3BELA 2QO2A 2C6OA 1DS5A 3QZFA 2VTTA 4R78A 2BALA 2W9NA 3TTIA 2OJFE 3H9FA 3AU5A 5IQGA 4ITJA 3V6EB 5FG8A 2KX0A 4FSUA 2JLDA 3QC4A 4WIHA 2JBOA 3QCYA 5CT0A 2OBJA 4QPAA 3BU5A 4BOZB 4O82A 3CLYA 4RG0A 2EB3A 4BDDA 1KJTA 5IMEA 2QOFA 3WANA 3GQIA 3WZDA 3AI5A 1B38A 4W9WA 3KXGA 5L8KA 2YLMA 2R3IA 3SD5A 1ZGUB 4YSMA 3VH4B 3F3ZA 2YITA 3KQ7A 3WZJA 5JMSA 2UZEA 3UIBA 4WJQA 3IDPA 3ZRKA 4CZTA 5CF4A 2G3QB 3TUDA 4TN6A 2BYVE 2J50A 2VWBA 5AUVA 4IB1A 3UDBA 3VS4A 2HXQA 4EYJA 3H7SA 2MWSB 2QU6A 2ITPA 4YZMA 4FT3A 3VUDA 4QMLA 1W8CA 2CN8A 4X57B 3UYSA 4E73A 3QAME 4NH1A 2OFVA 3GCPA 3TT0A 4QYEA 3DQVA 2PHKA 3OWKA 3QF9A 4F08A 4PMTA 3QAQA 5LARA 4FULA 1Z2MA 5H2UA 4HVIA 3QK0A 4XG3A 3R7GA 4AW2A 2C3KA 3SOAA 5E92A 4ITIA 1H1WA 2WOTA 4OGRA 3Q9XA 3ENHA 5HO7A 4FNYA 4EYMA 2I0HA 4ASZA 3DK7A 5KO1A 4KSLC 4J99A 4CKRA 3SQQA 4PF4A 5J9LA 1U46A 1UBQA 2LD9A 3EHVA 4IACA 3NIEA 1OZ1A 3AU4A 3U54A 2XNPA 2WTKC 1Q8TA 4M84A 4E4NA 4NJ3A 2B4SB 2V7AA 3V3VA 2UW9A 1CSNA 4GSWA 5CAPA 4FTRA 2PVKA 2LGCA 1LQBA 4YC8A 3FMHA 3CQEA 4I6PA 3HM3A 3SRVA 1KOBA 3Q9WA 4DH1A 5DI1A 4ANNA 2J0LA 1PXPA 4PTGA 2G4SA 4EOLA 3U6IA 3R71A 3R7VA 5BVKA 4EH5A 3PSDA 3RK5A 3AD5A 1F0QA 3AGMA 3FI4A 3ZONA 3LXPA 4JJRA 2R0IA 4MX9A 5TKDA 4EJNA 5TT7A 3W2CA 5DPSA 4NM5A 3KULB 2BKZA 3AT3A 4FADA 4JBQA 3JPVA 4CYEA 3QA8A 4CFUA 5J7BA 3MB7A 2XIYA 3JSVA 1MUOA 4LV8A 1WAKA 3ML8A 1WX8A 3GOEA 5D7AA 4M15A 3BEAA 3TMPB 2W1ZA 4RPVA 4KSPA 3R8VA 3ACJA 3OCBA 4M13A 4X7QA 3RPSA 4KIPA 5M4UA 4BOSC 3OTVA 5DGZA 3UOJA 2WMRA 3LQ5A 3UZTA 2VTNA 4FIFA 4ACGA 2KWVB 1LXDA 4G3CA 3FQSA 5D1JA 3FDNA 4F09A 2ZCBA 3QX4A 4OUCA 4DCEA 1GY3A 4CLIA 1WXSA 3RAKA 3Q4ZA 4DH3A 4AZWA 4IXPA 3ELJA 2GBKA 3QZHA 4ARKA 3DTCA 2N1WA 4ZSLA 4O0YA 5CAQA 3NNUA 1WJ6A 2J5EA 4R3CA 3FHIA 4XH6A 3TZ8A 2FH9A 3FLYA 4II3B 4WJOA 5I9XA 1Q97A 4DEHA 3LIJA 4EK5A 5CALA 4QMOA 4YO6A 3TUBA 2JITA 4YHJA 2M4NA 1V0OA 2VWUA 1NDDA 2VU3A 4X21A 4BKYA 1JPAA 1FOTA 3PJ2A 4J8NA 1YWRA 2LWPA 5AAGA 4FV3A 3V5LA 4L68A 4BDGA 2PVLA 3OFMA 2G15A 1YRPA 1XJDA 3ZOSA 5CNOA 3DKGA 2KN5A 1E8WA 5HI2A 4WT6A 4RSSA 3W1YA 2JKMA 1DM2A 5E8VA 4JL9A 4R6VA 1T0YA 4L6QA 4JBVA 3QQFA 4RX5A 3DT1A 3DY7A 5J5SA 2FSLX 4N9F4 2VTIA 4BDIA 1V80A 4A9RA 1JAMA 4XMOA 4KDLB 2F57A 4IAIA 5HBJA 4RA4A 2BRBA 4IZAA 4D2PA 1L8TA 4NW6A 3RK7A 4ZLYA 4X6QC 4E6CA 5CVGA 1OTRB 3NR9A 4W9GA 3LJ1A 3LKMA 3I0OA 3RINA 5HD4A 3DU8A 1WRDB 4EZJA 5HU3A 4Y5QA 4ASEA 5ETFA 3LHJA 3CC6A 3ZMMA 4EBWA 2IO6A 2G2HA 2WTKB 4Z55A 1OIYA 1QPDA 4DLIA 5JKGA 2LJ5A 4BDCA 4S33A 3ENEA 4JI9A 4DBNA 4B99A 3QZGA 2L0TA 2X7GA 2ZAZA 3B1LX 4YJUA 2WMAA 3TACA 5IA4A 3S3IA 4JOAA 4FTMA 2UZBA 2W9FB 4DLJA 5BVFA 1H28A 2QOKA 4I94A 1M7NA 5KBQA 4MXZA 5CEOA 4FODA 5L4QA 4DBGA 3AOXA 1E90A 1KLVA 4DTAA 2GHMA 4EOOA 4I1ZA 3V51A 1RFAA 2BAJA 4S34A 5M06A 1WBPA 3BLHA 5JK3A 1H1SA 1PXLA 4QOXA 4DHFA 1R78A 5EW8A 1XH8A 3GNIB 3HMIA 1WJ4A 1URCA 3N9XA 2ETMA 3S1HA 2L05A 4JDIA 2Y4IC 4GV1A 2JFLA 2ZDUA 3W2SA 2V1YA 2PEAA 3A9JA 2PPHA 4HVBA 3FMEA 3CSFA 3LM5A 1FPUA 4RWIA 2ITZA 1VZOA 4KIOA 2P4IA 3OW4A 4YJRA 4BF2A 2NR2A 4ZTHA 4Z7GA 5AR2A 3CGFA 1OQYA 1YXSA 3EN6A 3JW0X 4QMZA 2RGPA 5JN2A 4D1XA 2NPTB 3SXRA 5K3YA 2QI8A 4HOKA 4YZBA 3VO3A 3W32A 1VCBA 3V8WA 4GYIA 2UW6A 3BGQA 2UW7A 3CQWA 5CU4A 3PXKA 3UINB 2K6DB 2P0CA 2GNLA 4L44A 5JQ5A 3HRCA 4DE4A 5CHWA 1Y8RC 1ZYCA 3NCGA 3LM0A 4B4LA 4CKJA 1BLXA 3NVKI 3PVGA 3F5PA 4TYGA 4GN1A 1WZYA 5A4QA 2CKOA 2W1CA 4Y83A 1XHAA 4MF1A 3FZOA 2B9HA 1Z5SB 4IX4A 5H8BA 2BWES 3U6HA 2HD5B 3LQ3A 2HENA 4ZDVA 2CDZA 1U5QA 5AX9A 4DN5A 1ISNA 3KUCB 3BQCA 3W33A 2BHHA 4RIYB 4Y95A 2O6VD 3O23A 5HTBA 4RGJA 5JZEB 5EI6A 4ANUA 3B2TA 2F7XE 1LM8B 1G8SA 4KKEA 4GOCA 3ORMA 3TNPC 3RZWC 3OVVA 3DDPA 3LDZE 2X81A 4E74A 1ZKHA 4LFIA 4DGGA 3OT3A 3QUEA 3EKKA 3ZUVA 3LMIA 4H05A 1XQZA 4XG9A 2UZTA 3JY0A 1H27A 5EYMA 3QGYA 3UPZA 4CO7A 4RFYA 4GUEA 4JX3A 5DA3A 4M97A 2HY81 3SOCA 3TNWA 3UPXA 3U30A 4ZOGA 5DG5A 1UNLA 4MNEA 2GBJA 4FV6A 2WIPA 1YQBA 2ITWA 3MTNB 4DH7A 4ICVA 5AR3A 4F9WA 2C60A 4KS8A 4YBKA 3EN9A 2X4ZA 4X2FA 5TE0A 2V7OA 5KHWA 1OGUA 3IW7A 3QKLA 1YHWA 1SGHA 2B9IA 2BILB 4UV0A 2C0TA 3KFAA 3EQPA 2WKMA 4C4FA 4PMPA 4BIBA 4O2ZA 5I3RA 1FMOE 5C27A 4L9IA 4ZLOA 3F3TA 5L83A 2C6DA 4OW8A 3W2OA 4RWJA 3PZDA 3UNZA 3M11A 3I6WA 3DAJA 2RIOA 1UU8A 4BBNC 4DG3E 3G9NA 3ZDTA 1XO2B 2OWBA 5FDPA 3VHTC 4C38A 2Y5BB 2PK9A 3FMKA 4FKRA 4WQOB 4P90A 3C5UA 3DOGA 5DHJA 1V9JA 3FZ1A 1PYEA 4JDJA 4PDPA 3A7IA 4I0RA 4IM3A 2UWQA 5HU9A 5EYKA 3FLWA 3V5JA 3FXZA 2KOXA 1OIRA 2DYBA 5E8TA 3R8PA 3U51A 2NCNA 4F63A 4JT3A 4IW0A 3RMFA 3DVGY 3PVWA 2QOCA 5AP7A 4L8MA 4ANMA 3EFKA 3ZUUA 2JDRA 3EL8A 4G17A 3SDLC 4GEOA 4FVPA 2YERA 4G2FA 2P33A 3PXFA 4B0GA 2E2BA 2A27A 4IANA 5AP5A 4RIXB 5CU2A 4Q9ZA 2B1PA 5F4NA 2A2AA 4ZYNA 3KL8A 4TRLA 2B0QA 4CRSA 2J7QB 2JKOA 4ACMA 1JWHA 5FRIA 4PTCA 4MXAA 4ZS4A 2HZ4A 3H30A 4FOCA 4R3PA 2B9FA 4II2B 4QTEA 1Y91A 1ZAOA 2MA9B 3OBJA 2LVOA 1EF5A 3VVHA 3D5VA 5FEQA 5IU2A 3CD3A 2W4OA 2WMTA 1EO6A 1J8CA 3IGGA 3D4QA 2YLFA 3VH3B 1NVRA 3DBHI 4G5JA 4LL0A 3LJ0A 4KRCA 3H4JA 4USDA 3N3KB 4JIKA 5BUJA 3LE6A 4PP9A 1YDSE 3LLAA 5EYDA 2XK9A 4G3XB 4IQ6A 2LASA 3AMBA 5JSMA 3KKVA 3ECIA 3HV6A 3L54A 4EONA 2JRHA 2BF8B 2VTJA 4FJYA 2YHVA 4RT7A 4OTPA 1PMNA 4FEQA 4V05A 5DT3A 4CT2A 4NSTA 3BU3A 4WSQA 2VTHA 4MBLA 5EM8A 3H9DA 3ORTA 2RGFA 4ANWA 4FZDB 3C1XA 2W1FA 2VTMA 1Q61A 3U87A 1WM2A 4HYIA 2R2QA 1E8ZA 4PYZA 1J7LA 2W5AA 4F0FA 3PGEA 4KIKB 3NAYA 1WY8A 4YMJA 4U41A 2KFKA 3GEQA 1WVYA 3O8UA 4QMXA 2IPXA 3HL7A 3R04A 2CPKE 3O50A 4TWCA 3GU4A 2Y8OA 3UQBA 3R1SA 4HVDA 4R8QA 5DR9A 4I93A 3N30A 1SM2A 3FPQA 1M17A 5KHXA 3HRFA 2UW5A 3PE1A 2BIYA 2GS7A 2C3IB 3MPAA 3LMGA 5B7VA 2P2IA 5AFVA 2LI5A 2WQBA 4IWQA 4CFXA 2L76A 4BI2A 4RX9A 4RM9A 3GFEA 3CIKA 2WB8A 3QLFA 1IRKA 4FV8A 2RFSA 4U43A 4M0ZA 1H1QA 2XKEA 5M56A 3DB8A 1XH9A 3WE8A 3MFSA 4MCVA 2VX3A 3TNQB 3HP2A 5CF5A 4C4EA 1GIJA 4E3CA 3EWHA 4QP3A 2J0MA 3QTUA 5F1ZA 5GJDA 1CMKE 4GYGA 4A3PA 2YJSA 3MFTA 4UWCA 5E9EA 3LFBA 4FT0A 4TYHB 4FVRA 1APME 3R7RA 2I1MA 5HG8A 1EH4A 1WX7A 3N4UA 1H8FA 4X3FC 4FGRA 2UYZB 3TI1A 1LPUA 2DZKA 2BCJA 4YZCA 3QTWA 4ONAA 5AV0A 5JZJA 5C03A 3ZXZA 2WEVA 4U79A 1Z5MA 5LJJA 4C3FA 2RFDA 4IVDA 4IWPA 4RC2A 3FZPA 2WU6A 3R1NA 3RZFA 4QP9A 1U4AA 3GP0A 3RM7A 4GT5A 4QYFA 3BYSA 4H58A 4Y73A 3FKNA 3PS6A 2RG6A 2EMTA 4PPAA 2EU9A 4QP2A 4CZUA 3NW7A 3LOKA 4U80A 4I6FA 2IBIB 2R4BA 4WA9A 4RQKA 1URWA 3NUSA 3R00A 3EFUA 3V04A 3P86A 1ZLTA 5BO4B 2PMOX 3ZO5B 5AM7A 5D6JB 4KINA 3ZIMA 4OAVB 4Y72A 4WUNA 4MGKE 4TY1A 2IO3B 3MW1A 1MRVA 2DHZA 2DQ7X 4GCJA 1OL7A 4LUEA 2Z7LA 2YZLA 2GS6A 3BYOA 3VUIA 4OBPA 3QRUA 2ZEQA 1A06A 5KMNA 2OH0E 1V1KA 3F5UA 1PXNA 2BFXA 4PP7A 4WUAA 4YJNA 5B2LA 4YPDA 4QNAA 4AP7A 3NNXA 2YCQA 4LGDA 3HZTA 4FTLA 4PS7A 4A07A 4BGHA 3HV5A 4PNIA 3KN5A 1GNGA 2C9WB 1R1WA 4GFOA 3T9TA 5IH5A 1YOJA 1UNGA 4FKQA 3AG9A 4GVJA 3G0FA 1JVPP 3ZKJC 3PE2A 2MCNB 5CY3A 4F9CA 3LMHA 1OITA 5D10A 1OPKA 5K4IA 1DI9A 3VS3A 3I5ZA 3MV5A 1IG1A 3BRBA 3U8ZA 2Y9QA 1Q8WA 1PXIA 4W9KA 5H9BA 4C61A 4J52A 4JQWC 5ITAA 3HV7A 5J7HA 3WI6A 4MF0A 2WMQA 3DTWA 4QMTA 2WQMA 3KN6A 3Q4CA 4FV9A 4BCOA 4FN2A 4IAFA 3QRTA 5DYJA 3UMXA 2PY3A 1F5QA 4NU1A 3DQXA 2L3ZA 1OB3A 4EZKA 4HNIA 4FI1A 4EKLA 2BDFA 3Q2JA 3W55A 1XBBA 3R1QA 3TL5A 1NW1A 3EQHA 2WQEA 4JDHA 3ZSIA 3KMWA 2V3SA 3NZ0A 4IDVA 4FKWA 5GNKA 4ZRIA 5L8LA 4TT7A 1SE9A 3TKIA 1ZMUA 3DXNA 4PDYA 3S00A 3ENMA 1YW2A 1GC7A 4RQVA 2PJHA 3HAVA 2B54A 5AR4A 3F9NA 2K8HA 5M08A 4F7JA 5BVEA 4HJKA 4YLKA 2W06A 5CNNA 5TO8A 3R9OA 4JAIA 4F70A 4G0NB 4H36A 4ZTMA 4Y85A 3V6SA 4TZRA 2KZRA 3RBWA 1J1CA 4FK6A 3AC8A 4LL5A 5I9UA 3DV3A 2RPQA 3SRVB 3QTIA 1UKHA 3SG9A 2KO3A 3QL8A 4GRBA 2W7XA 2C6TA 5JFSA 2LAVA 1OUYA 3Q9ZA 3GOKA 3ZS5A 4DF3A 3KRJA 2LXCA 4AOIA 3I4BA 5CEQA 1PXKA 3MY1A 3R7QA 5I9VA 2KULA 3ORZA 1IYFA 5TOZA 4JBOA 3LCTA 2HWOA 3ID6C 4XP0A 2RG5A 4QP4A 5IEYA 3DGKA 2KX3A 4DGOA 2ZM3A 4ASDA 4XP3A 4NCTA 3I3TB 2BRGA 2QO9A 4IVAA 3R9DA 4RJ8A 2JRIB 3FEGA 4HK2A 1C3TA 4TWPA 3S95A 2PWLA 4A9TA 5L3AA 3OMVA 4ZSAA 1P1AA 5IQAA 1UVRA 4FIIA 2XBAA 2OO8X 2YIXA 3KCFA 1S9IA 3UF8A 3OWJA 3ZEWA 3KYCD 5AZGA 3VAPA 5M09A 2W1EA 3ZFXA 2CGXA 4YJOA 2X8IA 3UIXA 3H7PB 3L9MA 5M55A 4AA5A 3QX1A 3UQCA 5AJQA 3F2AA 3GUBA 4BCKA 4GGQA 4IFGA 2BKKA 4DFBA 2WFYA 4G6OA 2YM7A 4NKSA 3Q9YA 4FJZA 2BZKB 4DYMA 5LWNA 3ZTCA 1OL2A 4C3RA 5EQYA 2ZV7A 4O7VA 3V60A 4EH7A 2XCKA 4JQ7A 3PHWB 4EHEA 4ZY6A 2WTWA 4KSQA 2G9XA 2QHOA 5ANDA 4AJWA 3P78A 3UC3A 2ZM1A 3RK9A 2WQNA 5GIOE 5FBNC 2IO2B 3FLZA 1JOWB 2FCMA 4WOVA 3LCSA 5M4IA 4QPSA 3M62B 4CXAA 2LGXA 4U8ZA 4FT9A 5IDNA 1E1VA 4JIOU 4MSMB 4AW1A 3EQBA 2Z60A 3DB6A 1HCLA 2O6VA 2LGYA 3NX8A 3D7ZA 5I9YA 2X9EA 3CJFA 4HYUA 3R7IA 2N4FA 3ZSHA 4E5WA 3KF7A 4YPSA 3R83A 3DDQA 5CQUA 3S0OA 4FTTA 5JRQA 4MM3A 4EH6A 1WR6E 2PZIA 4O7SA 4CTBA 3RKBA 4LRKA 3I6UA 4NTTA 4L53A 5J79A 5JZNA 2XB7A 4AA0A 4P4CA 4ZIMA 3PZEA 3NMUF 2R3LA 5FP5A 4B7TA 1DAYA 3BKBA 1GZOA 1J19A 4CHKA 3OOMA 2PUPA 2R3JA 3QUDA 2W4KA 3UGBB 3R1YA 4WNKA 4BDHA 3K9OB 4HYSA 3O96A 5HIDA 5TR6A 5CZHA 4FBXA 4CZYB 5HCZA 3IVFA 5E4HA 1GAGA 2EWAA 1NVSA 3RAWA 4XX5A 1R0PA 4ZXTA 1PKDA 2CGWA 4YP8A 3UO6A 2HIWA 3H0YA 4C02A 1H8CA 4LMUA 4CEGA 2JWZA 4QTAA 2PZ5A 2VRRB 4O91A 4YTHA 3MA3A 2ZNVC 3GC0A 4XCUA 4L67A 3WF5A 1QCFA 4XS2A 1UV5A 3FC2A 4A20A 4AN9A 5BVNA 3E92A 4ICUA 3UQGA 4O7RA 5AV2A 5FGKA 4F99A 4LCDE 1M94A 3K5UA 2MP2B 2HCKA 1UNHA
chains in the Genus database with same CATH superfamily
3DAEA 4F1TA 3UGCA 1AN8A 2X4FA 2OK1A 4YO4A 3PLSA 4O0WA 2WU7A 3DDGA 3E9SA 4C37A 1I35A 3BX5A 2GQRA 2CGUA 4IB3A 1CKJA 3Q32A 4EWQA 2D3BA 3AT2A 4R5SA 4A3OA 4PL3A 4D4VA 5T6KA 3DJ7A 3FAHA 3QTXA 3ZRLA 2SAKA 3A9JB 4GMYA 4MKCA 2V0GA 4ZZNA 4M02A 5A3XA 3UNKA 4O0RA 4ANSA 3Q2AC 4M8NA 1SNXA 3DBHB 3KVXA 5T68A 3UNJA 3MJWA 4QMQA 3V6CB 1QT9A 4B6LA 2N9EB 2CHXA 3EJQA 3HMPA 4JAJA 5IUIA 4W9CA 2QOLA 5K5NA 3ORPA 4GK4A 2R3FA 3NVYA 2J4ZA 3D2IA 4FA2A 3PLVA 1J1BA 4WAFA 3NY5A 3W2PA 3DS6A 1V1PB 4YNEA 2W1GA 2UW8A 5L8JA 4BWKA 3HYHA 3QD3A 4EZ7A 4FA6A 5AUXA 4LV7A 3FXXA 3OK8A 3PZ8A 3BINA 2DENB 4RX7A 2KTRA 4WSYA 3TXOA 4S31A 1PJKA 1HZ5A 4TW9A 3R28A 4DEIA 1OQRA 4IUMB 2MHJA 4UALA 2V9HA 2H96A 3ATSA 4O6EA 3U52E 3T9LA 2I0EA 4EEWA 3CV5A 5JT2A 3GFWA 2QKRA 2MJDA 3VKHA 3HMOA 4XRLA 2MBQA 1DKYA 4I23A 2FSOX 1KV2A 3V5TA 2WTCA 5CX9A 2Y6OA 3F82A 4JG8A 1WX9A 4PWNA 1WXQA 1E6EB 4DBXA 2CR5A 2C08A 2PUUA 4FRFA 4WWOA 4RJ6A 3UE4A 2UV2A 2GQSA 3ABVB 3DBEA 3HM6X 5GINE 4XNEA 4U6RA 1H25A 4N6ZA 4JX1C 4LMNA 3KXNA 4LV5A 4WWMA 3O3OB 4P5QA 4ZRPA 2VWYA 4W9EA 3A7FA 2QC6A 4ZTNA 3D5WA 1Y8GA 5IA7A 4AGDA 5HIEA 2ZFYA 2JXXA 2ZV8A 3MS9A 4A4XA 3O7LB 5H92C 1TS2A 3OROA 2DS1A 3ACKA 1STCE 1S1QB 2W99B 4U40A 3BV2A 3RWPA 3MHSD 2BZJA 2R7BA 3FMNA 4MNEB 4PQNA 1QX1A 4LQMA 3QCXA 5L2QA 3Q6BA 2HYYA 2OLCA 1G8JA 3HRBA 2O65A 2IG7A 1NY3A 3F7WA 1GOZA 1E1XA 3E8DA 4L3JA 5ANJA 2FCQA 1YDTE 4AN2A 1L0XB 2Y7JA 5DT0A 1MQ4A 3SG8A 1YOVB 3SXSA 3KXHA 2KVRA 1SVGA 3NNVA 4N57A 3ZJTA 1IR3A 1T0RC 1SVHA 5A4CA 4BCNA 2ERKA 5M07A 5D2MB 4IVCA 2XNGA 3ZYAA 5IG1A 3ODZX 5M57A 1BX6A 2V4LA 5D41A 5IH6A 3LVTA 4D2RA 3D15A 2J90A 3GU6A 2ZNVB 4XG2A 2KTFA 4WBOA 2ERZE 1JWMD 1A9UA 3OP5A 4O7YA 4O1OA 5EI2A 2RL5A 3HA8A 2QNJA 1PW2A 4I0SA 3C0IA 4BCGA 3EOCA 2JKQA 1KM7A 2C7HA 2XANA 4QMPA 3TBLD 4NY0A 4RIYA 3RN9C 2HZ0A 4ZJVA 4L46A 3P5JC 5LCJA 4RJ5A 4FIJA 3QBNA 4ERKA 4AAYA 2PE6B 2HY0A 1GIHA 3OZ6A 2BAKA 2KFJA 3PSEB 3VUTA 1UU9A 1L3RE 1JQ4A 5C4LA 1HCKA 2DUVA 1N60A 3JYAA 4ACCA 3R6XA 3J9CA 3BK2A 4ENXA 3ZU7A 3MY5A 5ETIA 4BDBA 5C9CA 4AAAA 3CJGA 4ANLA 5AEPA 1OIQA 4XHKB 1YQJA 5F9EA 2XKFA 2L32A 2W82A 1VR2A 3R2TA 2XIRA 2V0DA 4L42A 1OL6A 4E8AA 4F9BA 3UIUA 4BC6A 2CHWA 1DOXA 4IB5A 1UH6A 4W9LA 1J7CA 3DPKA 1HEZE 1F2RC 3MC0B 5CZIA 5LVLA 1QQRA 2ZJDA 4E4XA 2XBBC 4YUQA 4CFMA 3PLUA 2XJ2A 5CU3A 1X03A 3DX1A 3WF7A 3H9OA 5CLPA 3VUXA 3H0ZA 1TQWA 1P7FA 4XE0A 3W0OA 3ALOA 3NWWA 2ZB1A 3HMMA 2ONLC 2ZJWA 1XCQL 1T3QA 4QYYA 2KDEB 1ET6A 1FEHA 4F64A 4BBMA 3ZHPC 5KMKA 3BWJA 1E7UA 3BVMA 4C4VB 4LOOA 5HKMA 2I7QA 3A4RA 4MH0E 2GDOA 3MB6A 2W5BA 2YM3A 5L2SA 2O0UA 2FGIA 4F4PA 3MI9A 3EZVA 2B7AA 4FKIA 4AT3A 3MH2A 4AX8A 2IYDB 5KCVA 4GIVA 3A1QA 4EH9A 3VUYA 4O6LA 4BKSD 4XYFA 3TNHA 4NUSA 4A9YA 4OTQA 1VD2A 2L1AA 3LXLA 2XK3A 1T5XD 4MUQA 4RLKA 1REJA 4YTNB 4GVAA 3EJ1A 3DFCB 4ENYA 2WMUA 3T3UA 3ZUTA 4FBJB 4GU2A 4BICA 2UU7A 2WDTB 3OXTA 1XCTL 2X2KA 3BI6A 4E6DA 4DCAA 3G6HA 2KFKB 4I21A 4ID7A 3QD0A 3L0WB 3TDWA 1YVJA 4DH8A 4D5KA 5D94A 3MJ1A 5CAVA 2R64A 3L13A 5D11A 5EQEA 2INDC 4MK0A 4W9JA 2KAJA 4NQLB 4CGAA 3JY9A 4NQIA 2R3NA 4EH4A 3FMJA 1WBVA 4EKKA 3BYMA 2BKRB 2Y6MA 3T8MA 3O65B 3JVZX 2XEZA 4FTOA 5HO8A 2VO3A 2Z0OA 3U7DA 5A14A 2V3NA 3TEWA 1VYWA 4N58A 1WF9A 1U59A 3RI1A 5BX0A 4AOFA 3UMWA 3AE9B 3Q8AA 2PY6A 4XP2A 2RT6A 3FWQA 3IG3A 3VUHA 2KC1A 2C6EA 2HK5A 4UMUA 4QO9A 1ZXEA 4ALVA 1WCCA 4DH5A 4BWPA 2ACZB 3AE5B 1PMUA 4W4XA 3ZO1A 2W4JA 3F69A 3RM6A 2V62A 3CY2A 1K51A 3NYXA 3QRKA 5IN7A 2G1EA 1PFDA 1OPLA 4KZ0A 3R73A 3SYVA 2QOOA 2JUOA 2WPAA 5EW3A 2KK8A 3A61A 3THBA 4E4MA 2JZ3B 2W9ZB 1VEBA 3WF6A 3FPMA 3RHXA 5AUWA 4B8MA 1Q62A 2QONA 3ULIA 3P9JA 1P4OA 4KA3A 4AXEA 3QHTA 4HDOA 2QCSA 3RPRA 4EH2A 3PTGA 5A46A 2JY6A 2RSUA 4LOPA 4JIAA 2PE9A 4U81A 5M4FA 2LFIA 5G5HA 2KWUB 3QXOA 4EK8A 3CTQA 3Q04A 4F01A 2YIQA 2QVSE 2MBBB 3Q0KA 2I1JA 2BHEA 3MY0A 4NZLB 5CENA 3Q6WA 4I5MA 5EKOA 1PY5A 4B95A 2GFCA 3WYYA 5LWMA 4NAWA 3A62A 4TSSA 3G51A 4BCQA 3UIOB 5TSSA 2UZWE 4YJQA 1UD7A 3PJ3A 1WH3A 4I5HA 2W96B 3GU8A 2N7DA 4XBUA 4ZJJA 3ZLXA 1FVVA 3U2SC 5IP4D 4FZ7A 2X6DA 1P0RA 1S9JA 5J9ZA 5AV1A 3I39X 3AE8B 4OZBA 1STEA 5D12A 4XEYA 3ZO2A 1LGRA 2VRXA 5IA0A 3FKYA 4I0TA 4RCOA 3DXPA 3CZNA 3TYKA 3TZ7A 4AZTA 2DYOA 3C0RB 5L6OA 5HX8A 2UVXA 4C59A 1E7PB 4M3QA 4URKA 5D9HA 2WLBA 4MT5A 3IDBA 2OJ9A 4FUXA 3EJTA 3QUPA 4W4VA 2JD5A 3GS2A 1MQBA 2WDRB 2UZLA 5JHAA 2XIZA 2JNSA 3SLSA 4C00A 3H3CA 3C13A 1HTOA 4HWIB 3CTHA 5C1QB 2N7EA 4H1JA 5BYLA 3WZUA 3BZ3A 4F0IA 5FTGA 4BZOA 1FXAA 1PGBA 1ZDVA 3BGPA 2JIVA 3C4WA 1YWMA 2BB5A 3HECA 2BZHB 4Z16A 5GMVA 2BDJA 5E8ZA 1Z9XA 2YIVX 3CKDA 4EHGA 3WIMA 1JKTA 5DFPA 4M0WB 5J5TA 2KMCA 2V22A 4GSBA 2IVVA 3QX2A 2L7RA 1ZOEA 1YXVA 5DPVA 1GN9A 1DYQA 4TYHA 4UXQA 3WARA 3QGWA 3KRLA 2KTYA 3BL9A 5GZ8A 1OL1A 3PY3A 1OIUA 2QO7A 3T3VA 1AGWA 4RGOS 3ZDIA 3PPKA 5FD2A 3R21A 4DFYA 2VTLA 2QJLA 4GIHA 4BDFA 3KF4A 5TR5A 2BTEA 4EH3A 3SOGA 2GQGA 4G3FA 2CMWA 2IO1B 5DEYA 2GTMA 1PKGA 4RF1A 3NDMA 3BYUA 4RMZA 1XLPA 4RVKA 2YAAA 4W9FA 4ZAUA 3QJZA 4BFMA 3TKUA 3BU6A 2QOQA 2IY0B 3W0SA 3ZRCA 3QWEA 1RJBA 4UYAA 2GHLA 4YL8A 4PPBA 1TY2A 3IW5A 5IA5A 1YJIA 1L2NA 2CN5A 2XJ1A 4F1OA 5JH5C 4DFZE 2YIBA 1H07A 3OG7A 3VS5A 2REIA 3FQEA 1YKRA 4C34A 4IJ9A 2PVHA 1QWUA 4L7SA 1P98A 2UZVA 2IJMA 4DEEA 4AZGA 4ANVA 2I40A 3MTLA 2CGVA 2WMVA 4FOBA 1ZYJA 5FP6A 4QQTA 3LFSA 2BRMA 5DMZA 3FKOA 4DDIA 3FI3A 4A7CA 1NT2A 3KYDD 4F8CB 4JVGA 4ALUA 2JX5A 3VBTA 5AR7A 4XUFA 2C69A 4AGUA 4RIOA 5E6JA 4JG7A 2GNHA 3RCJA 3NRZA 3DQWA 2ZMCA 2MI7A 4GFGA 1N5XA 3B8QA 3UVRA 3ZXRA 4TV3A 5I9ZA 2I6LA 1RRBA 1WGGA 3KUDB 3W8LA 2QKWA 2FB8A 4M00A 5AA9A 1XBAA 4BKGA 2E9OA 4OTHA 5AP6A 2XS0A 2W1HA 3EQIA 3Q8BA 3GOPA 5E8YA 4B8LA 1JWUD 2GF4A 3BPRA 4ACDA 1V1OA 3A9KB 5HBHA 4K33A 4I5PA 3T47A 2ZVNA 5JH6A 4FV7A 3ZTXA 2IVSA 2VTOA 4B9DA 1WZ0A 3E7VA 3DBCA 4FKLA 1GIIA 3U55A 3ZSGA 2WTIA 5LLIA 4CFVA 3CWIA 3IPHA 4MSQB 4C35A 2YWPA 3O0GA 4M8MA 4LOQA 3PRPB 3W5VB 3T48A 4JQEA 5EKNA 4JNEA 3FMDA 3MH3A 4ASXA 4WO5A 2RDGA 5EE9A 4UDYX 1X1MA 4FX3A 4D2WA 3WE4A 3N4VA 4OBQA 2RMMA 4AE9A 1DAWA 4FT7A 4EZNA 4BL1A 4BKJA 2MRPA 4DGLC 1V49A 2CLQA 4CCUA 3LJ3A 3MH0A 3W2RA 4RBLA 5EI8A 3BLRA 1OQQA 3QALE 4M68A 1WBNA 1R39A 3JUHA 2IJ0A 5G6VA 5HO6A 4HW7A 5JEBA 1R5EA 2MBOA 1XT9B 2WGJA 5FM3A 4X2NA 2G01A 4DHJD 4EH8A 3SDJA 4YJVA 3TEZA 1AWDA 2RR9A 3CKWA 3OXZA 3ORIA 2ETKA 2RDBC 4UZHA 3P7CA 3WZEA 3FLSA 4UDUC 4O38A 4FZ6A 1ZY5A 4R3RA 3VHEA 2PULA 3ML1A 1JKLA 1WSPA 4DHZB 2D3AA 1P5EA 5HBEA 2C3JA 1H08A 3CGOA 2BFYA 2R0UA 4YTCA 3W5UB 5F20A 5AP3A 3Q3MC 4NNJB 3PLAE 2N9KA 3MPTA 3FMLA 4WQMA 4EQMA 1UWMA 2GNIA 5I5ZA 1SE3A 2BVAA 3A4OX 4YTIA 1A48A 3C51A 5IQHA 2H6DA 3TZMA 3VBWA 3T3OA 1D3ZA 3OW3A 4GH2A 4FV0A 4X3FA 2WX1A 2NBVB 2P2HA 3L8PA 3AMAA 3F5GA 5BVDA 4K1RB 1C78A 2H34A 3C4EA 1WIAA 4N0SA 1JSVA 3EKNA 2HW7A 5AR5A 4KUJA 4PX6A 2NTSA 3PG1A 2O6VB 4X6RA 4EFOA 5J1WA 4IAAA 1F9JA 2WXGA 3VF8A 4CSVA 4KDIC 3Q3OC 4LDTD 3OTUA 2UW4A 3WCQA 3COKA 4IHPA 3GC7A 1M4VA 3IOKA 4PS8A 2XNMA 4MD8E 2PL0A 4NM3A 2OH4A 5DT4A 2WMBA 2IVUA 4KD1A 3LVPA 4AFEA 4O83A 5DVRA 1TQSA 4AW5A 2NBWB 3A7JA 3IW4A 1J7IA 1W7HA 3ALNA 4DINA 3DLZA 1H0VA 2AC3A 1V2YA 4J6IA 4U7ZA 3HHMA 1EU3A 2J9MA 2LGDA 4DFXE 5HVYA 5KHOA 5LMBA 5AADA 3KH0A 2WD1A 1QLBB 3H7PA 3U4WA 1WJNA 3W8QA 3GT8A 3CD8A 1SUFA 1DI8A 1I09A 4EZTA 1V97A 3VTVA 4MH7A 3FD9A 2H89B 3SD0A 2QFFA 2QOBA 4Z7HA 1UWHA 1MRUA 2BPMA 3TKHA 4O96A 2BZIB 5HNIX 4EZQA 2N9XA 4RVTA 5JXVA 4YSJA 3QTRA 3OLMD 1FO4A 2XALA 1JQKA 5KX8A 5KBPA 3TZ9A 3RNAC 2K3UA 3FBVA 5FK9C 3FZTA 4BBNF 5BMGA 2N1VA 1Q8YA 2ZVAA 2UZNA 4RRVA 4EZRA 4BCPA 3PPJA 2BKFA 4X3JA 4AZBA 3EQCA 2YCSA 3NZUA 3POOA 4DC2A 1Q5KA 2JT4B 3IQ7A 4GMVA 4KGSA 1PMVA 3NVWA 3VBQA 5C26A 5IISA 4TQ0A 2EB2A 4F1MA 3C9WA 4TWNA 4FV4A 3TWJA 2W17A 3HMNA 2W54A 3PA3A 3X0WA 3PP1A 2HAKA 4HGTA 4IG7B 2VUWA 3GCVA 3BYYB 1BI8A 4ACHA 4H3QA 3FC1X 1IAJA 5BPYA 2C6LA 3RALA 5AP1A 4ALWA 2BPSA 4QD6A 4FG9A 2R9SA 3QU0A 4E5AX 3C5IA 3QWJA 4KS7A 4U5JA 1H24A 2FYSA 1SE4A 4KABA 1W9MA 2FCNA 2IF8A 1YIWA 4ACFA 1EWYC 4HXDA 2D1LA 5CI7A 3IT6B 1XH4A 4B9KA 1L5PA 1WFCA 3IECA 4M0YA 3ROYA 4EHVA 4P6VF 5D3DA 4HGEA 1Y57A 4GW8A 3AEFB 3F3UA 3EH9A 2K39A