The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
212
|
sequence length |
659
|
structure length |
618
|
Chain Sequence |
GSMQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRNIKPGNIMRVIGEDGQSVYKLTDFGTEEYLHPDMYERVLRKDHATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVMGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQET
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structure of Tank-Binding Kinase 1
rcsb |
molecule tags |
Transferase/transferase inhibitor
|
source organism |
Homo sapiens
|
molecule keywords |
Serine/threonine-protein kinase TBK1
|
total genus |
212
|
structure length |
618
|
sequence length |
659
|
ec nomenclature |
ec
2.7.11.1: Non-specific serine/threonine protein kinase. |
pdb deposition date | 2013-01-01 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00069 | Pkinase | Protein kinase domain |
A | PF18394 | TBK1_CCD1 | TANK-binding kinase 1 coiled-coil domain 1 |
A | PF18396 | TBK1_ULD | TANK binding kinase 1 ubiquitin-like domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Transferase(Phosphotransferase); domain 1 | Transferase(Phosphotransferase) domain 1 | ||
Mainly Alpha | Up-down Bundle | Substrate Binding Domain Of Dnak; Chain:A; Domain 2 | Substrate Binding Domain Of Dnak; Chain:A; Domain 2 | ||
Alpha Beta | Roll | Ubiquitin-like (UB roll) | Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 | ||
Alpha Beta | 2-Layer Sandwich | Phosphorylase Kinase; domain 1 | Phosphorylase Kinase; domain 1 |