4IM2A

Structure of tank-binding kinase 1
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
659
structure length
618
Chain Sequence
b'GSMQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRNIKPGNIMRVIGEDGQSVYKLTDFGTEEYLHPDMYERVLRKDHATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVMGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase TBK1
molecule tags Transferase/transferase inhibitor
source organism Homo sapiens
publication title Structure of Tank-Binding Kinase 1
rcsb
total genus 212
structure length 618
sequence length 659
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF18394 TBK1_CCD1 TANK-binding kinase 1 coiled-coil domain 1
A PF18396 TBK1_ULD TANK binding kinase 1 ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4im2A02
1.20.1270.420 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4im2A04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4im2A03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4im2A01
1UBIA 4LM5A 3E63A 3FY2A 2K39A 3CCNA 4R78A 2CKHB 5KZIA 5IQBA 2PVNA 3D2IA 4F6WA 1GY3A 2C6TA 3VXWA 3PIYA 5LMAA 4GSBA 1Q5WB 4GT3A 1UU8A 4QNAA 4AFJA 1V49A 4WJOA 1AD5A 4BCJA 2L0FA 3HMMA 4JNWA 3ZDUA 2DZIA 1BMKA 1JKKA 2UW3A 4W9IA 3IGGA 3VH3B 3ZRKA 3FI3A 4AX8A 3JYAA 3BINA 2I0YA 2PVKA 3L0WB 4FYNA 5IQHA 2IVSA 3CE3A 5A4CA 5HTCA 4IUMB 3PRMB 2JT4B 3BELA 4F1MA 1VR2A 2WU6A 4IX5A 4EHEA 4EH3A 4BOSC 3BYMA 1E1XA 4FTNA 3I6UA 4GN1A 4W9WA 5HNBA 2ZEQA 4HCNB 4X3FB 5DPSA 2CNUA 3IDCA 3FLZA 1WF9A 5I9XA 4PS7A 1A06A 4AN2A 3COMA 4E20A 1TTNA 4GH2A 3PZHA 1RFAA 2KDEB 3LFFA 2MBEA 3V6EB 5CAPA 3AMAA 3EH9A 2IPXA 3QQFA 4JR7A 4W9XA 1OEYJ 2AEHA 4FK6A 4H1JA 3TACA 2GNHA 3OHTA 3FKOA 4V0GB 3NNWA 4FYOA 3V3VA 3BLRA 4QTBA 3VBWA 1GJZA 4LJOB 4E4NA 4NU1A 5BQ0A 4RGJA 3HV4A 3L16A 3RPRA 3AC5A 3F88A 3PJ3A 4JAIA 4F08A 4IJ9A 1IG1A 5A46A 4JDIA 4AACA 5LMKA 2R3QA 4NZWB 1JSVA 4EOMA 3N51A 4JT3A 3JXWA 4FTJA 3ALBA 5KMOA 3IGOA 5DR9A 3REPA 4PWNA 4RIWA 2C7MB 4IDTA 2OJGA 4RC4A 4RWKA 3WAMA 3FAAA 4FX3A 3IPHA 4YJPA 3AD4A 4U97A 2RF9A 5EFQA 4XZ4A 3VH4B 4BWKA 2BDFA 4GGQA 2JAMA 2YAAA 1U54A 2FUHB 3HP5A 4I6BA 2VAGA 3VQHA 3MVHA 3TUBA 4G6LA 2LWPA 3NR9A 3UYTA 1ZMUA 4F7ZA 2R2PA 3R7VA 1M2RA 3UZTA 1K8RB 3VW8A 2RFDA 4MCVA 3LQ3A 1GJOA 2Y9QA 3TDVA 3AD5A 4YGAA 4HGSA 3LFSA 3H7PB 4WIHA 1OUKA 2C30A 1PXOA 4XX9A 3TKUA 3Q6WA 2ZV8A 3B2TA 4A4XA 4JIKA 4XCUA 2YCFA 3CS9A 5IZFA 4IWPA 5AUWA 4NJ7A 2CLXA 3A4PA 4RJ3A 4BTMA 2VTOA 4Q9ZA 2LVOA 5GMVA 5KHQA 3UIPB 3Q2JA 5TE0A 3F82A 2JDTA 4DAWA 3OOMA 3R66C 2IW9A 3SV0A 4H39A 1PXPA 3EN4A 1HE8A 4MGYE 4BCMA 4Z16A 3GC7A 3PXFA 3R01A 4FKPA 3FQSA 3EQHA 1BX6A 3F9NA 4JVGA 2EMTA 2F7EE 2R0IA 4HYHA 3DBQA 4G6OA 4EHZA 2KDBA 1V6EA 3G9NA 4KS7A 5HU3A 2D2QA 4CG9A 2JKOA 3S0OA 3T3VA 4IFCA 4BDFA 1WXSA 4PDYA 4G0NB 3HEGA 5HOAA 4TXCA 2XJ1A 5BVWA 2EUFB 2VTMA 3O50A 2PJHA 3GZNI 4F7LA 2VWWA 2P2IA 3GCVA 4AOJA 3VBXA 4U42A 3ZUUA 4AFEA 3H30A 3OWLA 4LG4A 4MXOA 4HJOA 3M42A 2MP2A 1APME 2EB2A 3QD4A 4PMPA 2RSUA 3VQUA 2BZKB 4RVLA 5L2IA 2N9XA 2I0EA 2YISA 2XBBC 3DVGX 4WNMA 3KW5B 2J2IB 1WYWB 2YJRA 1M94A 3AC4A 2WDTB 3T9LA 4HLEA 2P3GX 3V5PA 3ANRA 5FP5A 1PMNA 2BRGA 2EB3A 3BU5A 5KCVA 3UNKA 4LUDA 1G8AA 3OFMA 4B9KA 3HVCA 4YTFA 3SX9A 2HD5B 4A4OA 3R02A 4BCFA 1HOWA 3PWYA 4Z3VA 4QTDA 3VUXA 3CIKA 3HV6A 3NVMB 2NNWB 4O83A 3OWJA 4YO4A 5L2SA 2VTPA 5C03A 2E9OA 5A4QA 4OBOA 3WE4A 3W2QA 4BI2A 4B4LA 4LYNA 4AUQC 2BVAA 1PKDA 4RIXB 4X2GA 2CKEA 1E8ZA 3EQGA 3R1NA 4II2B 3A7GA 4PF4A 5KUPA 4UX9A 1JSUA 3R8MA 2VGOA 3JS2A 4C02A 1R4MI 4UWCA 4YJQA 4LDTB 4CKJA 3A4RA 3KKVA 2QI8A 3CQEA 4DH8A 2XBJA 3PG1A 1FVRA 5C27A 4XLIA 2GBKA 1DAYA 2XK6A 4NFNA 4OTRA 5EW9A 4CFUA 3TZMA 2LRUA 2L76A 4NAWA 2UZWE 5EYCA 4PS8A 3OMVA 4D0WA 5EK7A 5BMSA 1E8YA 2G4DB 2CHXA 2GHLA 4MNEB 4MD8E 4FV1A 1WXMA 4Q5EA 1BLXA 2QOQA 5IUIA 4XV1A 2CN8A 4FBJB 2VUWA 2FCMA 2ZOQA 3RCZA 2G2FA 3V6SA 3DAKA 2Z8CA 2X2MA 1KOTA 2QQ7A 5JFVA 3W2RA 5J9YA 2Y5BB 4E4LA 3PPKA 4JBVA 4RA4A 3QX4A 5BVEA 5KHXA 2YCSA 4DFUA 3Q3JA 5JGDA 2E9PA 4KKHA 5CNNA 4BY9E 2XZSA 4FKVA 5HE0A 2BTSA 3FI4A 3VS2A 2FSTX 3BIZA 2JF5A 1WVYA 5FXRA 3RHKA 4FN2A 5HBHA 2ITXA 4YTHA 4C62A 3U8WA 1PXKA 3SVVA 4FADA 1ZW7A 5AUUA 4IAKA 5AV1A 1E8WA 4FEXA 4RX8A 4CZUA 4CT2A 1TKIA 3I0QA 4Z55A 5CSHA 2Y6MA 3W1SA 4YPDA 3ZIMA 2R2QA 1B39A 4IC8A 3UVQA 3A9KB 1Z9XA 4LMUA 2JIVA 1YJ1A 2IW6A 3O71A 1ZOGA 2XNMA 4CLJA 4CO7A 2F49A 2WB8A 1YOJA 3F2NA 3PXYA 2IO2B 2C6LA 4EH8A 2AL3A 4BBNF 2PYWA 2KJHB 4G6NA 1WE7A 3A9KA 4TPTA 4ACGA 4M14A 3RPVA 4J96A 3WF9A 1FOTA 1KJTA 4HNIA 2CHWA 4EQCA 3KA0A 1XHAA 4P4CA 1JKLA 5IH4A 2Z0EB 3HM6X 2Y4PA 2Z7RA 4BDCA 4F0GA 4HVSA 4MELA 4FTKA 1FVTA 4IVDA 3QC4A 3C7QA 2F9GA 2ZDTA 4BYJA 5CEKA 3OC1A 3UQGA 4HPTE 5G2NA 3X23A 4DHJD 2NBVB 2UV2A 3RK7A 5GZAA 3KCKA 3E3BX 4CMOA 5AV2A 5IA7A 4RQKA 4TTHB 4EYJA 3ZUTA 3IVFA 2KFKB 3NUYA 4JG7A 4EZLA 2N1WA 5CSWA 4GB9A 2JVCA 3CKXA 4AW0A 2HE7A 3KXXA 5D6JB 3UIUA 3QWKA 4WG4A 3DKFA 4R7IA 2KJRA 4KBKA 4MNEA 2C3JA 3R0TA 5FQDC 1H1RA 1M2PA 4GEOA 5IEVA 4UYAA 3OCBA 5J7HA 1H8CA 4I4EA 4CLIA 1F3MC 2ZPNA 4X2FA 1W7HA 5L4QA 2R3RA 3NZUA 4NW5A 4TZRA 1B6CB 4HYIA 4OT5A 1FGKA 5J79A 2V4LA 2WMWA 3UVRA 4BCNA 3BV2A 4BFRA 4FV4A 4MF1A 4ACHA 1PYEA 1P2AA 4YSJA 4NJ6A 2I40A 5HEZA 3ML8A 3D83A 5DEWA 2HY0A 2AYOB 2QO2A 2XEZA 2XK8A 3PXZA 3IQ7A 5G1XA 5BNJA 5J9ZA 2XIRA 2JIUA 4GMYA 2EWAA 2XYNA 5AEKB 4KKGA 3E8EA 3LIJA 4IW0A 2VTRA 2W1CA 3R7RA 3RT3B 3WE8A 5AR4A 3GVUA 3G6HA 5FLFA 4FBXA 4FTAA 4U40A 3V5TA 4XG7A 3VN9A 3ZLYA 1WGYA 3MH2A 1WM3A 1Z2MA 2KMCA 4ORKA 4EHVA 4LOPA 4BHZA 4DLJA 1V86A 2KTFA 3MHSD 3D2KA 5KMKA 4FHJA 3U54A 5KKRC 3BQCA 4UMPA 2M1MA 3A9JB 4JIOU 4FT5A 3ZCLA 4IADA 3C4CA 2R3LA 2BYEA 3BYUA 5L8KA 2A27A 4RIOA 2BAKA 3BQRA 3G0EA 5A3XA 3RPYA 2ETRA 2OJ9A 3Q04A 4QP8A 3KULA 3MI9A 4RLLA 4FHKA 3N9XA 2OZAB 3IOKA 3AC3A 3NYOA 2R3IA 2DS1A 4RVTA 4UMQA 4WJNA 4F1OA 4DEDA 3RZWC 3NUUA 1YHSA 4FNYA 1J3HA 4DEHA 3LDZE 3ZO3A 1IP9A 4EYMA 2AC5A 2BAJA 2F2CB 3FMNA 4C2WA 1VD2A 4Q5HA 1Q0WB 4EK8A 3QC8B 1A48A 3APDA 1WZYA 2IVVA 2W0JA 4YUQA 5DPTA 2ZCBA 3C5IA 2J0JA 3F61A 1S9IA 4IB1A 4QP3A 3LHJA 5ETFA 3QQLA 3TKHA 5EHOA 3TUCA 4F0IA 2DYMA 4X6RA 2MBOA 2VTIA 4HPUE 4FIJA 4UMTA 4G5PA 5LQFA 4ANUA 1F9JA 4FTMA 4APCA 2H96A 5L2TA 2YIYA 4L3LA 3MFUA 5CU4A 3TI1A 1UH6A 2WXVA 3BBWA 2O0UA 1PF8A 4BN1A 3DBHI 4RWLA 3TNQB 3QTUA 1GUAB 1YHWA 4DGNA 1KE5A 3E7OA 4DA5A 2R3MA 4RPVA 4XRLA 2ZZPB 3RGFA 5GZ8A 2P2HA 2FB8A 2R3JA 3E93A 4ZOGA 4O38A 2UUEA 2BR1A 3H9RA 3OROA 4FC0A 3LFBA 3ZXTA 5LWMA 3D7TA 4FSRA 2GBNA 4PS3A 3I60A 4HGEA 3GC9A 1RQQA 3IKAA 3Q9WA 4I6FA 4DH7A 5GIPE 4FL3A 4M0WB 2DUVA 2I1MA 5IKWA 3WF6A 2WYQA 2WTWA 5FXSA 2QU5A 5CHWA 5HVJA 2J51A 4NM0A 4G2FA 2C5LC 2C6EA 3MFRA 3VS5A 3G5DA 4O0VA 4DN5A 3W32A 4F64A 4GU2A 2B0QA 4QMNA 5FTQA 3OXIA 2XK4A 4K18A 5EYMA 3FMMA 4II3B 5L83A 3UP2A 2PL0A 4FTUA 4FV8A 4FVRA 3R7YA 4ACCA 2IO3B 1MUOA 3F5PA 3CGFA 3FKLA 2QODA 4LI5A 4QMLA 3WIKA 4Y85A 4EOSA 1V0PA 5I9ZA 4LL5A 3EFLA 1WJUA 5BPYA 1C1YB 4Y8DA 4Y95A 2ZNVB 2Y7JA 4FKUA 4QP4A 3M95A 2GSFA 4FMQA 4UMRA 1I35A 2OW3A 4BIEA 1TZ1A 4WKQA 2JFMA 4UMUA 2HYYA 1XR1A 5D7AA 1CKPA 1QPDA 3R1QA 2C7NB 5M06A 5AZGA 4QTAA 2IBIB 4WNKA 2WEVA 2ZVOA 4TYGA 4RJ6A 1O9UA 4TT7A 1XH9A 4V01A 4EH2A 1ZYJA 1ZGUB 2C6MA 5IQAA 2GNJA 2O65A 5CWZA 3RCDA 4YZ9A 4RRVA 4TYHB 5GJFA 3UYSA 3DV3A 3UNZA 2YWVA 3P78A 1QL6A 3F2RA 3OTVA 2YVCA 4G9RA 3U8ZA 5E8VA 4MQ1A 3RAKA 4U45A 1I09A 1PXMA 2F7ZE 4EOQA 4A20A 3S2AA 4B99A 1JSTA 1GZNA 4IQ6A 5TOZA 4KIKA 3B08A 4OVUA 5L95C 4OTFA 1WVXA 1J7UA 3OT3A 4QNYA 4XOZA 5E1SA 3WI6A 2Z7LA 5JSMA 5EOLA 2MSED 1FMKA 4V04A 1IEPA 2B9JA 1W84A 4AGCA 3O65B 3AMBA 1U5RA 1UU3A 2VTJA 2BF8B 4HCPB 2QR8A 2DZJA 3Q9YA 5M57A 2I0VA 5CTPA 5DVRA 3PVGA 2R3PA 3ZTXA 3QCAA 4W9HA 5DHJA 5FEQA 4GYIA 5AAEA 1OL7A 4AGDA 3ID6C 4ZMFA 2UW7A 3PRIA 4TNDA 4M7IA 4JL9A 4BHNA 4ZZNA 3O7LB 3PTFC 3ENMA 4DDID 3HDMA 5FRIA 5JFWA 1H8FA 5KBQA 4D2TA 5FEEA 3KRXA 2FCNA 2R3HA 2KZRA 4IJPA 4M0ZA 3MH1A 4QO9A 3R04A 3BPRA 3NHEB 3NCGA 4TQ1A 3VF8A 3IBEA 3PPAA 3MBLA 4EL9A 1NDDA 3EYGA 5FBNC 3GP0A 1WRDB 3E5AA 3Q9ZA 2BPSA 3P2BA 4UB7A 3R1YA 3FZOA 3NAXA 5DN3A 4BDAA 2PVMA 4MH7A 1PXIA 4NJDA 2XK5B 3W1SC 2KNBA 2KWUB 3O17A 4E5BA 3Q32A 3W2OA 2XMYA 4PP7A 5HLNA 4RJ8A 5BYLA 2XIZA 4EOPA 4EOLA 5CSPA 4ZP5A 1UKHA 5CVFA 4M12A 3TN8A 2YZAA 3HV7A 4E74A 3KF4A 4FR4A 3Q4ZA 1WAKA 5JGBA 4XC2A 1WBOA 4MM3A 5FWKK 2OXDA 2YCQA 2X7GA 2EKEC 4YZMA 4OW8A 2MA9B 2XNNA 4GS6A 4C37A 2R3KA 3EN6A 3CTQA 3BGQA 3IO7A 4RVMA 3OLMD 5AP0A 3CPCA 5HU9A 2BHHA 2ZMDA 4HW7A 2MLBA 4WNPA 3CJFA 3U87A 4ANWA 5AP4A 1EF1A 2QU6A 1B38A 1UELA 2PULA 4XG6A 4DC2A 3PDTA 2HXLA 3VW6A 1ZRZA 4F4PA 2Q0BA 4FEVA 4MK0A 1OL6A 4KBAA 4EH5A 4HCVA 1WY8A 2BRMA 3QHTA 4U41A 2XYUA 1P9DU 3NS9A 3RHXA 1BL6A 4M69A 1KE6A 4X6QC 2XK5A 3QKMA 4MKCA 4OAVB 4IAIA 2M8SA 2OWBA 4P7IA 2QOFA 3DLSA 3KREA 3L9MA 3VF9A 4ANBA 4TKNA 3UZRA 1KOBA 4LRKA 3QX2A 3FLYA 2QURA 2RSVA 4V05A 1QPJA 4X2KA 3W16A 2BUJA 2CHLA 2WIPA 3P1AA 3FMJA 1YOMA 4GIHA 4NCTC 1M17A 3VUMA 3C0GA 5M51A 2BDJA 4JI9A 2NBWB 1OM1A 4F9YA 2Z7QA 3ZBXA 4HOKA 3DBLI 4FT9A 3DU8A 2OIBA 4PTGA 5LMBA 5KMJA 3SKCA 5L6PA 3C0IA 3QWJA 3DVNV 3DB8A 4I4FA 4HVGA 4O7SA 4CYEA 1JAMA 2UZOA 2LGDA 1PYXA 5AR7A 3RMFA 3N4UA 3DQWA 2XNOA 5I4NA 1ZOHA 2OO8X 3OJ3A 4RM9A 2O2UA 2PZIA 3TXOA 2WOTA 2Y8OA 4D58A 1T46A 4C0TA 2R9SA 4DG0E 4ZJIA 3FHIA 4NFMA 3II5A 3UIMA 1H24A 1XKKA 2VWZA 4BDKA 5IA1A 5F20A 3ORZA 5CANA 2OLCA 1Q8UA 1GZKA 5DPRA 4AJYB 3AU5A 4DDGD 4CTCA 1REJA 1ZWSA 4IVBA 5ACKA 1FINA 2XS0A 2GMIC 1OQYA 2GNFA 3BEGA 4O0UA 3OY3A 4II5A 5HNGA 2C47A 2QLUA 3VUKA 5K4IA 3S1HA 3A33B 2YA9A 2O6VD 2PVYA 3HDNA 4FTCA 5IPJA 3CR0A 4CG8A 3ORKA 4KS8A 2G1TA 4XG8A 3C4EA 5D41A 1WZ3A 1ZYLA 5AM7A 4X7QA 3LOKA 2KFKA 2QD9A 3LFEA 3R9DA 3K9PB 3DK3A 3PJ8A 2XM8A 3A7HA 1YDRE 5FP6A 2KC2A 3TJPA 3K3IA 3R8LA 5HZNA 3AXCA 1MG8A 2EMSA 3ERKA 2LGYA 3RULA 3OCTA 3KC3A 1F5QA 4I23A 3PZEA 2PY3A 3K5UA 4X2JA 3RTPA 3V04A 5CVHA 5IQGA 5FBOA 5JQ5A 2BILB 2E9UA 3R7QA 5J1VA 3D5UA 3SQQA 4MJSB 2JGZA 2XNEA 3KN5A 2J0LA 3ZYAA 3CXWA 2WMSA 2R5TA 4L44A 4R1VA 4U44A 2OKRA 1O6KA 1R3CA 4C4FA 4DEBA 4HWIB 3IW6A 3VUGA 4K77A 3MGYA 1RRBA 1BI8A 3DKGA 3AGLA 5DEYA 2PVJA 5EM7A 1UWJA 2WQNA 3JVRA 5HE3A 2OJIA 4ENYA 4NYEA 5AP5A 2GHMA 2SRCA 3WYXA 3DKCA 3VUWA 3P08A 2E9VA 2KWVB 4DG2E 2KDFB 5I3OA 3QYZA 4FIIA 4EH4A 2XM9A 3HL7A 2HOGA 3RVGA 4BBNC 3R30A 1NW1A 1UVRA 4JR3A 1O6YA 2CSNA 3DTCA 3QFVA 3RAIA 4ZLZA 4AOTA 1MRYA 3UOJA 4MNFA 5D10A 4H3QA 2L00B 2YIQA 1UNGA 3ZEWA 5AP2A 3DXNA 3W33A 4W9CA 4E4XA 2CR5A 3LW0A 2KULA 1MRUA 2A0CX 2HWPA 2J0MB 3L8XA 3ACJA 2W9FB 3QKKA 5EM8A 3VJNA 2W4OA 3WZKA 2C69A 4GCJA 3R7UA 5HIBA 3UO5A 4U3ZA 1H00A 3IW8A 4O0WA 4R3CA 1WBTA 3LXPA 4IB3A 5DRDA 4YC6A 4AT4A 4CZYB 1OPJA 5FTGA 1YDSE 1OIYA 4MTAA 2GQRA 1GIIA 1A9UA 4UWBA 2RR9A 3ONSA 4QMWA 4J7BA 3TV4A 2W1GA 4S32A 4A4LA 1LFDA 3NIEA 1EH4A 3QA8A 5E8XA 3SAYA 2J5EA 4IVAA 4D2PA 1J19A 3MYGA 4PNKA 2UW6A 1DI9A 3MVLA 1VZOA 3BU3A 5AADA 2KDIA 4E8AA 3V8WA 1YHVA 3NGAA 4QP1A 2O64A 2GMXA 3M11A 4U7ZA 1TBEA 4FSMA 4LL0A 4TY1A 1SE9A 3KULB 4FJYA 4I0TA 2YM4A 4Z9LA 4ASEA 2VTQA 3ZM9A 4NW6A 4LGHA 4OVVA 2GFSA 4HVDA 4RIXA 5M4CA 3AC1A 4QTCA 4RIYB 2GFCA 2ZV9A 3OWPA 4PTEA 3SRVA 5CAUA 3I5NA 4BIBA 3PE1A 5TO8A 4K1BA 4CRLA 5ICPA 4GMVA 3DZQA 4AA4A 3MWUA 3PFQA 4C57A 5IF1A 5D94A 3EL8A 4IZ5A 3GEQA 3MPMA 1D3ZA 4RSSA 3GT8A 3ATSA 2KKCA 4FUYA 2WPAA 3OP5A 4GRBA 3HMIA 4DFZE 5JZJA 2V3SA 4E3CA 3DA6A 3KF7A 4YZBA 4BZDA 5AX3A 4FZ7A 3HA8A 3RJCA 2KQ7A 5JH6A 5CU3A 2OF2A 3VQIA 3AMYA 3BHUA 3QGYA 2ZNVC 3CY3A 3AI5A 3F6XA 3B8QA 4ZY5A 4G3XB 3ZKJC 2ETMA 4YL8A 1J0GA 4O7NA 2Z2WA 4C4GA 4X57B 1FQ1B 4CFFA 3HECA 3HMNA 3EZRA 3MA3A 5J17A 4IAYA 3RI1A 3DBEA 1R4NI 1KE8A 4E71A 5M4FA 2RPQA 1NY3A 5HLWA 5DI1A 4FKLA 3A4OX 3VO3A 4WJQA 4O2PA 1OKYA 3OOGA 3QXOA 4M0YA 4DGLC 4D4YA 4B8LA 3OY1A 2WTIA 3ZNID 4A9TA 1WBWA 4UZHA 4JX3A 2YAKA 4RFYA 4DK5A 4AA5A 1H1PA 3NNVA 5EYDA 5DMZA 2GS6A 3QUPA 1QMZA 4ID7A 4D9UA 1ZKHA 1R39A 3KH0A 3HMPA 4JOAA 3TTJA 3UNJA 1G8SA 4W9LA 4DT8A 4P2KA 4F0FA 3RM7A 2V62A 3BHYA 4GL9A 1V0BA 3DJ6A 2UW9A 2ZAZA 2UZLA 2XIKA 3O23A 3LJ0A 3R21A 2VTLA 3R2YA 4BCGA 1KE7A 4D5HA 4FG7A 4EONA 3IDPA 1E90A 2I7QA 2FA2A 3MA6A 5E9EA 2JKKA 2DYOA 1UWHA 3A7JA 3BE9A 1U4AA 4X21A 4M67A 4FTLA 3ZM4A 4DBNA 2BYFA 1NVRA 4EH7A 2WFYA 1Q4LA 2PVLA 3OEZA 4O0SA 3A62A 3UO6A 4FI1A 4WBOA 3PXKA 3LCDA 2AWTA 2VWUA 2PE1A 2FCQA 3L9NA 4ZJVA 3ECIA 2X39A 4MBJA 1YWVA 2W5AA 1R0EA 3BRBA 4ZTNA 4BFMA 4HJKA 5HG8A 3I81A 3GXLA 4IH8A 3QGWA 1KV2A 3HGKA 2FO0A 4RBLA 4DITA 4P7EA 3KUZA 3PJ1A 2O3PA 4A9YA 4JG6A 4O81A 3MFSA 1LQBA 2KMAA 1Y91A 4QQ5A 2MCNB 5C01A 2XVDA 4YSMA 3HNGA 4NM7A 1Q8WA 4GSWA 3ZH8A 4S34A 4RJ5A 5AP7A 1KE9A 5AP3A 2I1KA 4S2ZA 4EZJA 4GU9A 3CQUA 4Q9SA 4IXPA 4LJPB 5CI7A 4JXFA 2O5KA 3V8SA 3LXLA 2PVHA 1BYGA 2YLFA 4G1WA 4MD9E 4C7TA 1X1MA 4E5WA 1I44A 4YR8A 3QK0A 4KDLB 4KZ0A 3BI6A 2PE9A 4RA5A 1YOLA 5IDNA 2BWES 3M62B 4KZCA 2QKWB 4MXYA 4F9AA 2IVUA 3S4QA 4YBKA 3V8TA 4PTCA 5I3RA 3EN9A 3OD6X 1OKZA 1ZZLA 1OUYA 4HZSA 4MEDA 5GIOE 2ZPYA 5AV4A 3TEIA 2RG5A 3S3IA 4CMTA 4HNFA 2XKDA 3R9NA 1DS5A 2WMRA 2BRHA 1JVPP 5HD7A 4A9RA 2KANA 2WGJA 2YABA 2B3AA 1XQQA 5CTRC 4OBPA 4RC2A 2R7IA 5E8ZA 3NX8A 5HGIA 5K9IA 2REXA 3CSVA 2YLEA 2NS5A 2PMLX 3NW7A 4PYZA 4FKQA 4R5SA 1IAJA 3QRKA 3N3KB 4BI0A 1L8TA 3G9LX 2ITTA 2WQEA 3JY9A 5ACBC 1GC7A 4ZRKA 2ITOA 1ZLTA 4GV1A 2JKMA 2WMBA 3ATTA 4FOCA 4W4WA 3SRVB 3FL5A 3ZS5A 3DQXA 3GU5A 3PE2A 1KV1A 4ZRIA 5IEXA 4IC7A 5HTIA 2DHZA 4O7TA 4IANA 3NVKI 3FV8A 5DPWA 1ZXEA 4ZIMA 4MXZA 3L8PA 3VBVA 3EC8A 3QIJA 3WF5A 2IZUA 4LQMA 2FIFA 4FUXA 3NUPA 3OTUA 4BZOA 3QCYA 3N32A 5D9HA 3I79A 3QA0A 4ZLOA 5AIRA 2YEXA 4MAOA 4BVUC 3NUNA 4QQJA 4DTAA 4O21A 5CXZA 4F9BA 4GG5A 4LV5A 5H9BA 5HG5A 2JRIB 4IX3A 1SGHA 2IYDB 1R0PA 4B6WA 2BGFA 5DIAA 3G0FA 2RGFA 1WR6E 3DKOA 2ONLC 3JY0A 1SNUA 4MQ2A 4ACMA 3Q5IA 4ZYNA 4MWIA 1RJBA 3C5UA 2J0KA 3BKBA 4FGRA 3EB0A 5BVDA 5LCJA 1WGRA 1XD3B 4DH5A 2R7BA 1GNUA 1WI0A 1LEZA 3R8PA 3UQBA 4M8TA 5E8TA 3ORXA 5AAFA 3HRCA 3GU8A 4EKKA 3GU7A 3F5XA 2QNJA 3DT1A 3ZC5A 4TYEA 3BYOA 3QQJA 2G2IA 3KRJA 2RFNA 4JDJA 5CU6A 1EUVB 3KB7A 4GOCA 4P5QA 3RALA 3RINA 4FKOA 4OT6A 1DI8A 2RFEA 1Q5KA 3PA3A 1STCE 4BF2A 1WGDA 3WOWA 5HI2A 3UC3A 3CPBA 4W9GA 5T68A 3K54A 4GK4A 4FSWA 4HZRA 4PPCA 4P90A 3I3TB 1K2PA 3CLYA 3E87A 4IDVA 1MQ4A 3GU4A 5BMMA 3LCTA 2RL5A 4CFXA 2KLCA 3G33A 1H01A 4TRLA 3OG7A 3SLSA 5DR6A 5JRQA 3NZ0A 3PREA 2P4IA 5AR8A 1OECA 4W9EA 4BGQA 4CKIA 5G6VA 4RM8A 2UZEA 2PUIA 4FSYA 1IRKA 3OW4A 3MIYA 1K9AA 4FIEA 3PIXA 4N0SA 5B0XA 4HCTA 4K0YA 5JH5C 2IZTA 4XP0A 3K5VA 1WBNA 3EKNA 2X2LA 4U0IA 5CX9A 5EHLA 3UGCA 3R8ZA 3ZUVA 4D5KA 3QQ8B 4GJ3A 2ITUA 4IVCA 3HLLA 4W4XA 1T0YA 3VRZA 2OBJA 4TWCA 3QCXA 3IW5A 3PHXB 2PTKA 1I42A 3PJ2A 3GCPA 3WALA 4JDHA 4DWFA 3PTGA 5KHOA 4MXCA 2GNIA 3QF9A 5FD2A 3ETAA 3RNIA 2ZB1A 4G34A 3FXWA 4ICVA 4H3PA 2BIYA 1R78A 2X8DA 5DWRA 2IN6A 3VJOA 4AZSA 5IUHA 2G2HA 1FVVA 4L68A 3VDZA 3FY0A 3OXTA 3PUPA 4FZDB 4GK2A 1IA9A 3UIXA 4UWYA 4O7WA 5E8SA 1JPAA 1MP8A 4CV8A 4X0MA 1OBGA 3O2MA 3EQPA 4MXAA 1G3NA 4G3GA 4JRNA 4E6AA 3LVPA 4BI1A 2W1HA 4X3FC 4C3PA 4W9DA 4W9KA 5T3QA 3WANA 2WNTA 4I3ZA 4QP7A 3C4FA 2Q83A 1CMXB 4PNIA 5I9VA 3DCGA 5GINE 1E9HA 4FTRA 2AC3A 3MTNB 4O7LA 4CFVA 4RMZA 4DH3A 1V9JA 2PWLA 4TW9A 5ANDA 3HK0A 1YI3A 4J8NA 3JYUA 4N70A 4EOIA 3P5KA 3FLSA 4Y83A 4FTQA 3FYKX 3ZZEA 5CF5A 5LOHA 5JHAA 3Q6UA 4ZY4A 1UD7A 2FH9A 3MB7A 1Z57A 2YDJA 4MHAA 3MSSA 5CEOA 4E93A 4WWOA 4XJ0A 4IB0A 5DPVA 4FIGA 2OJFE 4FV3A 2YFXA 2C5XA 3Q60A 3THBA 4BDBA 3L13A 4EH9A 3RP9A 4DTKA 4CCBA 2BHEA 3VAWA 4PPAA 1FMOE 2BTRA 2YDIA 5HD4A 3LMHA 3E62A 3QALE 3R2BA 4QOXA 2OFVA 5IQFA 4YJNA 5BVFA 1KM7A 4WRSA 4CRSA 5IDPA 2BRNA 4DINA 4XV3A 4M8MA 4FGBA 4CYIA 3NPCA 3TV6A 4DGMA 3V5QA 4K7SA 5H8EA 4EH6A 5E4HA 4R7HA 2RG6A 4RJ4A 3IG3A 1KUTA 5I9UA 1GOLA 4GK3A 2LASA 5A6NA 2C1AA 5IH5A 1IPGA 1WJNA 2CU1A 2JRHA 4URKA 2FIDA 4GT5A 3B2WA 3WARA 4ANSA 4O7YA 1QPEA 1YQJA 3A4SC 3JVZX 5H2UA 4HVIA 4K7WA 3ACKA 4RVKA 3B8RA 4EC8A 3CSTA 3NY5A 2XEWA 3DXQA 2PE2A 3HAVA 4WOVA 4GJ2A 3BYSA 4O84A 5BVOA 4QMZA 2WTDA 2Z59B 4XG4A 4AN9A 2ZVAA 5B2LA 3CSFA 2A1AB 2F4JA 4C4HA 4GKHA 5C9CA 1BI7A 2GTNA 3ENEA 2R64A 4A9SA 3EECA 4FODA 3KEXA 1RW8A 4RFZA 5EDQA 3TZ9A 5LXMA 4OUCA 5G55A 2H6DA 2DAFA 3H9FA 2K8HA 2WQOA 1XQZA 1P4OA 1PJKA 5DLSA 2X9FA 5KHWA 3KRRA 5EOBA 4FTOA 2XP2A 3VHKA 5IAAC 1U46A 3KVFB 4IE9A 4JQ8A 3OCSA 4QMMA 4U81A 1S3SG 3MH0A 4TWPA 4PDSA 3PGEA 4BOZB 1WBVA 4J71A 2HZIA 4QYHA 3C9WA 2BKFA 4EWQA 2CLQA 4ALWA 4NNJB 3A60A 3MN3A 1Q61A 5DRBA 4DEAA 2O2VA 3NMUF 4BGGA 2QOBA 3FDNA 2QONA 1EF5A 3GQIA 3HMOA 1OPLA 4D2SA 4EK3A 3HM3A 3WAPA 1WBSA 2ERZE 3HP2A 3SW7A 1YD8U 2XJ2A 2VTNA 4OLIA 3SXSA 2RIOA 3W10A 5BUJA 3R00A 3T8MA 4CNHA 2FGIA 4BL1A 3P86A 2JPHA 3RWQA 4EBVA 2XNGA 2WU7A 3DDCB 2ZM3A 4LCDE 3ZLWA 5CX3A 3ZTCA 3R28A 1WGGA 4HGTA 5CQWA 3UQCA 3GOPA 1OEYA 2ACXA 4I94A 2JITA 2OU7A 3BU6A 2BFYA 2PUUA 4X2NA 3ZRMA 5CF6A 5E7RA 3U6JA 2KOXA 4BWXA 1GAGA 5FM2A 2VWVA 5JHBA 4E6DA 3PSBA 2XA4A 2MWSB 1YWRA 4F99A 1H08A 1OIUA 4YJSA 4ANVA 5C4KA 4QTEA 2ETKA 3PLAE 4FKGA 3Q53A 3PA5A 4AWJA 3TCAA 3KMWA 4NTSA 1Q8TA 2CCHA 5CEMA 1AARA 2K8CA 3DOWA 1M14A 3F3VA 3PVBA 1NT2A 3QCQA 2X81A 4OTDA 4BBFA 4ANMA 4NQKE 2UZUE 4CHKA 1IASA 3R71A 5CALA 1OGUA 5HE2A 5L6OA 4MSMB 4ONAA 5A4TA 3V01A 3R7IA 4IACA 4LGDA 5CYIA 3SOCA 4AT3A 4R3RA 3TIYA 4BGHA 2MW5A 3SDJA 4JQWC 4L42A 4J99A 4C4IA 3D0EA 3HV3A 5CS6A 3VTUA 1Q97A 2FYSA 4LOQA 5ANJA 3AT4A 5AUZA 1P1AA 3QQUA 3ORLA 4DHFA 2KX0A 2NR2A 4JIAA 5IISA 3LFQA 3PJCA 4OR5A 3PY0A 4FL2A 4L52A 3U9NA 5J2RA 3CTHA 3SG9A 3PVWA 2C60A 4Y72A 2CNQA 5ETCA 5D1JA 4ZS0A 2JZ3B 2VWIA 2GDOA 3F3UA 2NPTB 4NM3A 4F1SA 3PP0A 4R1YA 4L8MA 2C5YA 2HW7A 1H27A 3HZTA 1E5WA 3KN6A 4FEQA 1FBNA 5LVLA 5EQEA 3I6WA 3AC8A 3O7LD 5FUTA 4AT5A 4FOBA 4FV6A 4C38A 3TUDA 4G3FA 4RX9A 3V51A 3RM6A 3W1FA 2OOBB 3GCQA 2W06A 5DCNA 3VS1A 1AGWA 3DXPA 4DCAA 3BGPA 3QCSA 4Y5QA 3HA6A 1SIFA 3OXZA 3AGMA 3NCZA 3RAWA 1NVQA 4A9UA 2WAJA 3LQ8A 4BCIA 3DPKA 2PZ5A 5JRSA 3UMXA 3BWJA 4C4JA 2WQMA 4FZAB 5CF4A 3H9DA 4J97A 1ZAOA 2HAKA 4IWDA 4IWQA 4O6EA 1YWNA 5JFSA 3V6RA 4E7WA 4F65A 3M63B 1PXNA 3FUPA 3NLBA 3MB6A 5J95A 4LUEA 2R3OA 5TT7A 5IUGA 5AP6A 1LPUA 3EQFA 4B0GA 3GFWA 1OKWA 3PXRA 4Q2AA 3LCKA 3KXNA 2ERKA 3SD5A 3QTQA 3BWFA 4BKZA 4EFOA 5F94A 3IOPA 4XX5A 5FTOA 5K5NA 2N9EB 3ZLSA 5JN2A 5C1ZA 5M44A 4I93A 1YVJA 2YZLA 5BX0A 3BBTB 3GOEA 3Q4TA 1BKXA 2PMIA 4W8DA 3R8VA 2BYVE 3DPDA 3EQRA 4NQLB 3FSKA 2GU8A 3NNUA 4RX5A 4DE4A 1WH3A 4I6PA 5KNJA 1OZ1A 2W05A 3FZRA 5D7GA 2J9MA 3IW4A 3ZSHA 4D4SA 1IA8A 3HX4A 4XH6A 4AOIA 5T6KA 3NSZA 2VNWA 3ZW3A 2LXAA 5KE0A 4FLHA 2Z0DB 4NY0A 2WMQA 2QVSE 3PG3A 4FV5A 3ZVVA 2QKRA 4G3EA 3R7GA 4A06A 1J7IA 5AV3A 5AFVA 4I21A 3Q3BA 3R9RA 4MGKE 4ZXTA 3UF8A 1M7QA 4FTTA 3IS5A 4K11A 5CEQA 2ITQA 5DA3A 4WUNA 3ZNZB 3MPTA 4QP2A 4ZTMA 1YDTE 4ZSAA 3DBDA 1H1QA 4G3DA 2X9EA 4ICUA 3OS3A 5AR3A 3WAOA 4C59A 2L0TA 4ZTRA 5LVOA 3F3TA 4FNZA 5HVYA 3OZ6A 3R9HA 4BIDA 4EZ3A 3G6GA 4CZTA 3L54A 3E8NA 4CCUA 1O6LA 1LR4A 5C26A 4CT1A 4DEIA 4KIOA 4OGRA 1TQMA 5AUXA 2GHGA 3AT2A 3KRLA 5AM6A 5HQ0A 1P98A 2PZYA 1JKTA 1XH5A 2K6DB 1VEBA 4F8CB 3Q3FA 4ZDVA 3U55A 2B9FA 3HRBA 4XYFA 1CKJA 3MVMA 4JQ7A 5J7BA 1PMEA 5IQDA 2O63A 1MRVA 3GGFA 3LCOA 3QD0A 3R8UA 4WG3A 4AWIA 1WMHB 2R3GA 4PL3A 5TR6A 1NXKA 5KKRB 4TWOA 1VCBA 3KFAA 1Y8RC 4ASWC 4R77A 5LWNA 2J0IA 4IC7B 3OBJA 2R3NA 5EKOA 3PSEB 4YJRA 3ZSIA 3FEGA 5AEPA 3LFCA 4D2VA 3OUNB 2HELA 3L9PA 5D12A 1OGWA 3U4UA 2OI4X 3NDMA 3L10B 2X1NA 4WWNA 4LRJA 2A4LA 5AWMA 2QG5A 4D4RA 2O6VB 2VX0A 4FK3A 5AA9A 3ULZA 1OMWA 4QYEA 4CGAA 3ORNA 2VWXA 3V61A 3LKMA 5IA3A 4BKSD 4IEBA 5ETAA 4QYGA 2RKUA 4ACDA 3FMLA 5GZ9A 1H4LA 4NEUA 2BCJA 4MVFA 3X0WA 1OIRA 2XRWA 1WXVA 1A5RA 3JR1A 5AUYA 2CN5A 3C51A 3NAYA 4PX6A 5JZNA 3Q9XA 1YW2A 3MY5A 2ZCCA 4YHTA 3I1AA 1Q1OA 1OKVA 2HWOA 4RT7A 5EM6A 3DAJA 5HCZA 4I24A 2HTHA 4I0RA 4EEWA 2C0OA 1WMKA 4PL5A 4AF3A 4CQGA 4GUEA 1Q99A 1WMHA 3NYXA 3QRJA 5H8BA 1P0RA 4KINA 3P7AA 2OH0E 4U9AA 2C9WB 4AAAA 4ZJJA 3WIGA 1RAXA 5KMLA 1WJ6A 3CTJA 3DBRI 3VS6A 2PPQA 4DFLA 3WF7A 1OTRB 4WAAA 3U51A 3FBVA 2XEYA 3QXPA 3QLFA 4HYSA 1P14A 3P7BA 4WHZA 5F4NA 2LVQA 4CD0A 4ZTLA 4CFNA 1YXSA 3R83A 4CVAA 3BV3A 4AW1A 1YIWA 4ZSEA 3V6CB 3G15A 4U80A 2H34A 3PLSA 3FZSA 4UBAA 3KL8A 3TV7A 3FHRA 3RZFA 1YI6A 4B95A 3VFKA 3EFUA 2KC1A 5EW3A 2X6DA 1M52A 4JRVA 4WRGA 5E8WA 5EM5A 4AU8A 2Y0AA 2GBRA 1BUHA 3PVUA 4W8EA 4BB4A 1ZARA 4UZDA 4JGHB 3V62A 3D9VA 4APPA 5E8YA 2UZTA 4BCHA 3KK8A 3E92A 2CKQA 5HG9A 3UODA 2WKMA 1YQBA 1ZY4A 4MEMA 4O86A 2R4BA 4I5PA 2V7AA 4KDIC 1PXJA 1UA2A 4IMYA 5HICA 3LJ3A 3A61A 4U8ZA 3FSFA 4CYJA 3JSVA 3KMMA 2HK5A 3ZO1A 4CXAA 2C5OA 4M68A 1DM2A 3P0MA 5EW8A 2G4SA 4GKIA 4ZSGA 5CNOA 3QZGA 3VWAA 1H28A 4BC6A 2D07B 5CAOA 5HO8A 3FLWA 5L2QA 3C4ZA 2JDVA 1CSNA 4HGLA 2YIXA 4FA6A 4RIWB 3QTRA 3C0RB 5DGZA 5IMXA 2ZJDA 4IG7B 1ND4A 4NKSA 1WM2A 2D3GA 4FVPA 4W4YA 4BKJA 2WO6A 2Y4IC 4O27B 4WO5A 2W5HA 3H1UA 1CKIA 3TIXA 1P5EA 4D9TA 3QWZB 1PHKA 3D32A 1RE8A 5JEBA 3PWDA 3EN5A 2L8JA 1ZMWA 2F2UA 4O0TA 2XB7A 4L3PA 1U4DA 3KY2A 1PXLA 4XUFA 4X3JA 2K8BA 4IBMA 3BHVA 3G2FA 3GC0A 4EQUA 4L45A 4RQVA 1VYZA 2B4SB 4K81A 3PRFA 2GNLA 3ZLXA 3FQHA 2UW5A 4USDA 1J7LA 3F5GA 3FWQA 3ULIA 3WZJA 2J90A 3EOCA 5DH3A 1E7VA 3A7IA 4WQOB 4RJ7A 4EKUA 2Z02A 4ITHA 4K6ZA 2CGXA 2W4JA 1M7NA 5GJDA 2VWYA 3PLVA 2NRUA 4MSQB 4JBOA 2R0UA 4Y5HA 3PYYA 4DEEA 3A7FA 4XG9A 3K3JA 4DF3A 5HHWA 1YXXA 3GNIB 3VS3A 4IHPA 4WD5A 5L8JA 4EORA 4LRMA 4EOOA 5HNIX 5M53A 3ZNHB 2WOUA 2LD9A 1YXUA 2A2AA 5J87A 2WMUA 3FJQE 3ANQA 3CEKA 3QAME 4PUZA 3DLZA 4YO6A 4YLKA 4EKLA 2ITVA 3EL7A 5CAQA 3LCSA 5A6OA 2J7QB 3VTVA 4EZ5A 2VX3A 4N6YA 5J18A 2WMAA 2YM5A 1ERKA 5TF9A 3K9OB 4BBMA 4K8AA 1E8XA 2W96B 5CHFA 1WXAA 5BO4B 3OVVA 3RNYA 2UVZA 4DCEA 3R6XA 4PMMA 4C4EA 4DG3E 1GG3A 4CMUA 5LJJA 3G90X 3UJGA 3VIDA 4DFNA 1OIQA 2RFSA 4ANXA 3ELJA 4FKIA 2GS2A 3ZFMA 3C4WA 4J6IA 4BVUA 1NA7A 3QUDA 4ITIA 3KXZA 3PPZA 4AP7A 3UPZA 4EK4A 4WWPA 2IO0B 2C3IB 2HENA 1SYKA 3L8SA 4FKRA 4J53A 4XEYA 3KYCD 3I4BA 3BYVA 2IW8A 2W9ZB 1WX9A 4MJSA 4OTWA 2WTVA 2QO7A 3FZPA 2YM7A 3H0YA 1Y8YA 4YMJA 4Z7GA 2KTRB 3NW6A 1V2YA 2WMVA 2ZDUA 4YZDA 3QAQA 2VD5A 1K3AA 3ZRFA 2YIRA 4JQEA 4ERKA 1WZ0A 2X4ZA 2UYZB 1XO2B 5AR5A 3VVHA 4FSTA 4QMPA 4F9WA 4IX6A 2BPMA 5M09A 4ZEGA 4AG8A 4TWNA 2CDZA 3LXNA 4XRJA 5E90A 3U6IA 4BZNA 2QOHA 1P3QU 1V0OA 4M66A 2UZVA 3K2LA 1MQBA 2PZPA 4KKEA 4PPBA 3ZO2A 2I1JA 4R3PA 2PU8A 4U3YA 4ANLA 4DGOA 4S30A 2YM8A 3O0GA 2GBMA 3BLQA 3SXRA 4E73A 3QHRA 1REKA 3F2AA 3GFEA 2KTRA 3HRFA 3U6HA 4R8QA 2NPTA 4BCOA 2FSLX 4E5AX 5ITAA 2KQSA 3EKKA 3EQIA 4OTHA 4AZTA 3C0HA 4DFBA 4I22A 5CXHA 3VS4A 4JS8A 4XV2A 2YITA 3W18A 4AE6A 4CSVA 4NH1A 4J52A 1V80A 1WR1A 3E8CA 4B7TA 4GIVA 4NIFB 5E6OA 1Y57A 3ZEPA 1SMHA 4L9IA 3B1LX 3NIZA 4KSPA 4M84A 4XV9A 2PE0A 4BDDA 2GNGA 4MDKE 2WTKB 5LVMA 3Q2MA 5DR2A 5L2WA 3D5XA 5ETIA 4HPMB 4OTGA 3MY1A 4Z7HA 1XJDA 4D1ZA 2QHNA 4FKSA 3AULA 4IX4A 4IZAA 1GIJA 2XK7A 5M4UA 2FCSA 3IFWB 4TV3A 3GCSA 3PA4A 1Y8GA 3TCPA 4LOOA 4BKYA 4XP3A 4DEGA 4O7RA 5HG7A 2N9PC 3UMWA 2JBPA 3F3WA 2MX2A 4I1ZA 4C3FA 2WQBA 3PV1A 4FJZA 2XK3A 3NOBA 4WT6A 2QOOA 3ROCA 3UQAA 4H58A 3O8PA 4JLCA 5IG1A 4D28A 4IM0A 3LMIA 3PRZA 2B53A 5IEYA 3OEFX 3SD0A 1H26A 3NUSA 1S1QB 2IG7A 4AUAA 3PPJA 2PUPA 3U7DA 3KYDD 5M56A 3L8VA 3LFAA 3ODZX 3P4KA 2VTHA 3R7OA 5DG5A 4FJVB 3N4VA 2KTYA 3G51A 1L7YA 1QZEA 2VNYA 3ZO4A 3DGKA 4KSLC 3PRPB 5EI6A 5F9EA 4ASDA 5B2MA 4K2RA 3AU4A 5HO6A 4YJOA 4N9F4 1KSWA 1ZZ2A 3O8TA 5CSVA 4ASZA 4EUUA 1ZYSA 2J4ZA 2W1FA 4DFYA 2DZMA 3ZDMC 4MWHA 4HDQA 5CT0A 5I5ZA 4KRCA 4AGUA 4EHGA 3MJWA 2BDWA 2W5BA 2NVUI 1W83A 4PY1A 4JG8A 2VRRB 3COKA 2YERA 2QOIA 3MFTA 5HLPA 3DQVA 3R3MA 3H4JA 4GXBA 4O7ZA 5I9WA 3PIZA 4C36A 4N57A 4ZMEA 5AIKA 1J1BA 4MGZE 3NRMA 5HBJA 4RMAA 5JT2A 3CJGA 1UU7A 5IH6A 2NBUA 2JIIA 3W2PA 3ZNGC 5L6WL 4EJ7A 1WBPA 3NWWA 3PSDA 3QKLA 3WZEA 2W1EA 4EOJA 1BT0A 3FKNA 2L7RA 3TDWA 3FYJX 2XCKA 5LARA 2XCHA 5HX6A 2GS7A 2BALA 5F95A 5JMSA 1CMKE 5K0XA 4HVBA 4NUSA 3ZMMA 3NS8A 2K6QA 4OAUC 3S95A 5TR5A 2B9HA 2VTTA 3I7BA 4ZTSA 5HE1A 3DBFA 4CFMA 3H6NA 1YXVA 4YC3A 4GW8A 3D14A 4MXXA 5KZ0A 2KD0A 3A1QA 4L53A 5AJQA 4ANQA 3WF8A 1OL2A 2JZZA 3CKWA 2E2BA 2JDRA 1Q24A 2G9XA 1JBPE 1Q3DA 2XKFA 4ZTQA 5A9UA 4XNEA 3FZTA 2R2OA 4BCQA 5JZEB 4L3JA 3OUKA 2W1IA 4U5JA 1Q41A 3MY0A 3D7ZA 5B2KA 2BIKB 1Q8YA 5I9YA 3ZRLA 2X6EA 4A7CA 2B1PA 2WZJA 4IZ7A 1J8CA 5IQIA 4FV9A 2O2VB 2OG8A 3KUDB 3DNEA 5EQPA 2IZRA 4XS2A 3V60A 5DE2A 4JDKA 4EUTA 5AMNA 5H8GA 2KXJA 2OF4A 2LI5A 1CTPE 3ORPA 4BKSA 4Y73A 4ANOA 2LGXA 2HIWA 4G31A 4B6LA 4K7UA 3UOLA 3M2WA 4PDPA 1ZYCA 4FIFA 2G45B 1Y6AA 3EYHA 4A3PA 2XKCA 1E1VA 2G3QB 4KUJA 1OI9A 3PHWB 2X4FA 3BY4B 3AC2A 2NO3A 2LAVA 4D55A 3DJ7A 3TBLD 3JVSA 2X7FA 4IAFA 2H8HA 1JQHA 4J95A 3VRYA 3WZUA 1SVHA 1LEWA 4KWPA 4USEA 5FG8A 1UGMA 4IAAA 3EHVA 4O82A 2WX1A 1G6JA 2EXMA 2F57A 5KMNA 1CDKA 5E91A 4FV0A 4W4VA 5K0KA 1H4RA 3QD3A 4AXAA 2BKRB 2LJ5A 3NUXA 4GIIA 4L00A 3TTIA 4YTCA 3HUBA 3D4QA 5E6NA 3RAHA 4DFXE 3APCA 3QL8A 3UC4A 2UW8A 2KLGA 2MBBB 2P0CA 3BGZA 4NJ3A 3QD2B 3TZ8A 4J1RA 3LM0A 4YC8A 3KVWA 5DFPA 3DDPA 2WMTA 2ZV7A 4NTTA 4DHZE 4EI4A 4I20A 4EZKA 2K1FA 4L46A 4K9YA 4I41A 3VS0A 2OIQA 4A3OA 2UZNA 4BTJA 3TIZA 1SVEA 3IK3A 2X7OA 3EFWA 4BTKA 3VUIA 2PMOX 4E1ZA 4EK5A 5J9LA 3ZBFA 5EI2A 5CF8A 3QHWA 1NBFC 2N7EA 1KOAA 4NWMA 2LXCA 2FSMX 1PMUA 1H1SA 5IU2A 3UINB 3C4XA 4S33A 4YJVA 4XBUA 5KO1A 4WSYA 3QZHA 4DBGA 1GZOA 3N30A 2HXQA 3EN7A 4H36A 3QX1A 5L8LA 1J91A 4FE2A 4P5ZA 5A4EA 1V81A 5D2MB 4QMTA 2Y4IB 2N4FA 3CC6A 2OZAA 3OW3A 1Q3WA 2P55A 3P23A 4JBPA 4QPSA 4DYMA 5C23A 5LXHA 4NIFA 3VBTA 2QO9A 3JUHA 1JKSA 3RPOA 1U59A 3RD2A 2DQ7X 4PYUA 1R1WA 4LV8A 4CV9A 4DHZB 4KD1A 4QYYA 2NPQA 3MJ1A 3KK9A 4QMVA 3WYYA 1J1CA 2HCKA 3A9JA 4FULA 5CVGA 4ALVA 1OB3A 4GDLA 3KVXA 2FNJB 3C13A 5HIEA 1RDQE 3WILA 3IW7A 4WUAA 4AS0A 2XRUA 1LUFA 5A54A 1TGZB 2CPKE 2XBAA 4ZLYA 1OBDA 3FZ1A 4E4MA 1OL1A 4TQ0A 5C8KA 2N1VA 3APFA 4O7VA 5EG3A 5CQUA 4O91A 4O22A 2PHKA 4ERWA 2AYPA 4YHFA 5CASA 3ZDIA 3OT8A 2KX3A 2B55A 4ANNA 2C6DA 2W1ZA 2Z60A 4WSQA 4B8MA 3LJ1A 3TM0A 4FSNA 3OWKA 3S2PA 3EQCA 2ZV2A 4IAZA 3W2SA 1DAWA 1ZYDA 3RK9A 3PY3A 2MBHA 1H25A 3RK5A 4KSQA 3F69A 3RYTA 3DVNU 3EFKA 3ITZA 5DNRA 2Y6OA 3KXMA 3ORMA 2ITYA 5DT4A 5HCXA 4EJNA 5EKNA 5KMMA 5J1WA 3OAWA 2OK1A 4BICA 2ZMCA 3COIA 3L1SA 2C6OA 4GFGA 3VTWA 3IHPC 2CGWA 3ZUNA 4EK6A 4BR3A 4GG7A 3LFDA 5HBEA 5K3YA 4DBXA 2JDOA 2C0IA 2QOLA 4D0XA 1WE6A 4F6UA 1XWSA 4FV7A 3R9OA 3QZFA 3NEWA 3MH3A 4BDIA 5JGAA 3ZFXA 3TT0A 3L17A 4NAWB 4QP9A 2OZOA 3OBGA 3UDBA 2JUOA 4DTBA 3T8OA 4C34A 2EU9A 3QTZA 4GT4A 4USFA 4FSUA 1HCLA 4NCTA 3MS9A 3CBLA 2CHZA 4NK9A 4F09A 4BDEA 2QOKA 5HKMA 2VN9A 2WMXA 4YTIA 4F9CA 2UVXA 4UV0A 5EH0A 5H3QA 5J5SA 4CFWA 3SG8A 4BCKA 1S9JA 3PXQA 5AZHA 3D5VA 1WVWA 3QQHA 4L6QA 2VU3A 4PDOA 5AP1A 2MQJA 3PLUA 3SC1A 1ZY5A 4YP8A 3GI3A 4FF8A 2WIHA 3AG9A 4I5MA 3V5LA 3U30A 1TQPA 3A8XA 3R1SA 5CU0A 4YNOA 1TQIA 3GU6A 3NUAA 1H0VA 2DWBA 1XH4A 4XLVA 4DHJB 2QG7A 5FR6A 2GPHA 3F3ZA 1PKGA 2UW4A 5JQ8A 3KGAA 4WA9A 1UBQA 2LUEA 3I5ZA 4UYNA 3LQ5A 1WFCA 2QOCA 4XG2A 4YZCA 4MH0E 1Y6BA 2VWBA 3PY1A 1AQ1A 2LGCA 3UIBA 4W9FA 2LZ6A 5BYYA 2OJRA 4C35A 5CAVA 3BX5A 5ANGA 4TNBA 1SZMA 5B7VA 1XT9B 2CKPA 4H1MA 3VAPA 4JJRA 4GVAA 3QQGA 2HY81 2JY6A 2XIXA 4D1XA 1TVOA 1UV5A 3AD6A 1GIHA 3UG1A 3UE4A 1LM8B 3PZDA 1GC6A 4JAJA 3ALOA 2GBJA 2NRYA 2PE6B 4QRCA 3UOHA 4HDOA 1FPUA 5FEDA 1ISNA 2BRBA 4XBRA 4EWHA 2LVPA 2V22A 4ITJA 5HTBA 1L3RE 2HZNA 2BZJA 2P33A 3QTIA 5AV0A 3FMEA 4F6SA 1EO6A 2IY1B 2PEAA 4YJTA 1ZOEA 2KO3A 3QJZA 1X8BA 3ZHPC 1PW2A 4EEVA 1JRUA 2YIWA 4QT1A 2W9NA 4AN3A 1QPCA 5CZHA 1H0WA 2PVRA 4AW5A 2EXEA 3AOXA 1GNGA 2C3KA 4QPMA 3WZDA 5EQYA 1IR3A 4FL1A 2V1YA 2W7XA 4L67A 5M55A 3I0OA 1E7UA 2VX1A 4ZSJA 2OXXA 4MX9A 5JFXA 4RG0A 2QC6A 1V5TA 3F7ZA 4QMQA 2C1BA 3PT2B 4KABA 2JBOA 3DY7A 4GFOA 4DT9A 4ZY6A 2XF0A 2NP8A 3HKOA 4IZYA 4FSZA 4FG9A 4FT0A 3KQ7A 3PS6A 4FEUA 2MP2B 4FSQA 3KXHA 4ZZMA 4O1PA 4TN6A 4CQEA 3AXWA 5KBRA 3JSVB 2YWPA 4HPLB 3H0ZA 4GUBA 5M4IA 2C4GA 2VO6A 5D7VA 4NM5A 3TMPB 4NKAA 5CZIA 5BVKA 3IG7A 4N4SA 4C58A 3HV5A 3QRTA 4FICA 3ZU7A 2R3FA 2VRXA 4A07A 3COHA 4D4VA 4IWOA 2C5NA 2M4NA 3NZSA 3MDYA 3DJ5A 4RC3A 1FGIA 3UPXA 2AL6A 3EQDA 2WTKC 3FMKA 2OJJA 3DBCA 1UNHA 3CP9A 3DK6A 3SHQA 5KMIA 1Z5SB 2FVDA 3EQBA 1CM8A 5JK3A 2L3ZA 4XOYA 3ROYA 5IA0A 1W0XC 2IZSA 4FEWA 3D15A 1YX6B 3QU0A 3M3JA 4RWJA 4O96A 4YLLA 4H3BA 4K1RB 1QCFA 4FVQA 5CI6A 4U6RA 2EVAA 3F66A 3FXZA 4UEUA 1H07A 2ZM1A 2WD1A 4G11A 5AZFA 3V5JA 4BDJA 3VBYA 3BCEA 3DVGY 2GQSA 5LVNA 2BKKA 3SGCA 4LMNA 4OBQA 4G50A 1OL5A 5C4LA 2XK9A 5GJGA 2NCNA 3H7PA 5AUTA 4AOFA 3GOKA 3KUCB 5LCKA 3U4WA 3CD8A 4UN0C 4L43A 1WFYA 2DX5B 3VHTC 3NNXA 3QZIA 2X8IA 3GC8A 3NW5A 4G3CA 5AR2A 3T3UA 3H7SA 4L01A 2HZ0A 4RLKA 4C33A 4EBWA 2X2KA 3FPQA 2MRPA 5AA8A 3KMUA 1KLVA 1NI2A 4DGGA 2WTJA 5IQCA 4XP2A 5CEIA 4BWPA 5DT0A 3FQEA 1OPKA 2FSOX 3LZBA 3O51A 5EI8A 3R22A 5M07A 4Y46A 5C8MA 2PZRA 3L9LA 3RPSA 5LLIA 4BKGA 1Q8ZA 4AZVA 4AW2A 3IECA 1JWHA 5A4LA 2JWZA 4YURA 4MYGA 2QR7A 5F1ZA 2ITWA 3VVWB 1V1KA 4UXLA 4CTBA 3W55A 3KXGA 4BBEA 4PP9A 4UXQA 2C3LA 3RKBA 3ENHA 3TWJA 4EZ7A 4QD6A 2HW6A 4IM3A 4UY9A 4RX7A 3RCJA 5IMEA 5CHVC 3BLHA 2VV9A 3DFAA 3MPAA 5HX8A 3I7CA 5EDSA 2QHMA 2IO6A 2H9VA 2VO0A 2WEIA 3H9OA 2VTAA 2KN5A 2HZ4A 1U5QA 1XH8A 4QMSA 3V5WA 4IFGA 4D2WA 4F7NA 3WBLA 3ET7A 2K25A 5M08A 4TKSA 4FT7A 4HVHA 2OIDA 2VO7A 3M1SA 4ZZOA 3QYWA 3BE2A 3TL5A 3JPVA 3Q96A 5HO7A 4KNBA 2YCRA 2UWQA 3QLGA 3SXFA 5C8NA 2J6MA 4I5CA 3UP7A 2PSQA 2J50A 4XG3A 1ATPE 3LMGA 1JNKA 3UQFA 1UU9A 3T9IA 1IYFA 1XH6A 2CGUA 4L7SA 3H10A 2CJMA 4HCUA 3TL8A 1WX8A 2IO1B 2IVTA 2O6VA 4E26A 1LP4A 4KAOA 4PL4A 3ZZWA 1F0QA 2W99B 4V0GA 2JD5A 2VGPA 1YKRA 4KV2A 2PVFA 4BCPA 4U43A 2J0MA 4RIYA 4NT4A 5E92A 5FGKA 4PV0A 3A8WA 5CU2A 5FM3A 2CNVA 4QMXA 3FLQA 3VUYA 2KJ6A 3AQVA 3BHTA 5ANOA 3HIZA 4D1SA 4M13A 4X3FA 4EQMA 4DH1A 4I6NB 3GENA 2O8YA 4AZFA 1U54B 3DS6A 5CY3A 2N7DA 3VUHA 4WJPA 5GNKA 3FMDA 3F7WA 3SU8X 2GCDA 2OFUA 3QRIA 1PMVA 4U79A 2X0GA 3W8QA 5CEPA 5TKDA 2JEDA 2XH5A 2YLMA 2UW0A 2V0DA 5ANKA 4ALUA 1OITA 1WJ4A 2QCSA 4IIRA 2B52A 1T45A 3ORIA 4G17A 2JAVA 3UG2A 2WWZA 5EDRA 3ODYX 1W98A 4C2VA 4YLJA 3PSCA 2LRWA 5DOSA 3ZO5B 5HKHA 5E6PA 3LPBA 1YI4A 4OTIA 3RBWA 5BUIA 4FTIA 2AUHA 2DENB 3CMMB 3LM5A 3QARA 3CF6E 4LDTD 1PY5A 3LE6A 3WIMA 3UOKA 4QP6A 1SVGA 4IB5A 2KVRA 3KCFA 2RD0A 2BROA 1SM2A 5E1EA 4FT3A 1JOWB 2OGVA 3SA0A 3NYVA 3HUCA 3VC4A 1IAHA 4ZS4A 3LLTA 4JX7A 3OF0A 4O0YA 1H1WA 2GTMA 4CEGA 2JLDA 4O0XA 2ZVNA 4AP4C 4DXAB 2BAQA 3VUTA 2OH4A 3POZA 3FLNC 4L7FA 2GQGA 2UVYA 2KFJA 4J98A 4MF0A 4AQCA 3POOA 3GQLA 3P7CA 3QTXA 4PMSA 5C1QB 5HORA 5HESA 4MD7E 2GOWA 3MW1A 4MBLA 3HHMA 2Q0NA 4O1OA 4YBJA 4TL0A 4AA0A 4I92A 5HCYA 3ZFYA 3DZOA 4FG8A 3TZ7A 4BDHA 5DT3A 5EYKA 4KIQA 4E6QA 4O0RA 2BMCA 4M3QA 4E6CA 2W4KA 3CGOA 2CS4A 2JDSA 3HAMA 3TG1A 1W8CA 3HYHA 3Q4UA 2QLQA 4QMUA 3UVPA 3MV5A 5HVKA 3SDLC 2CKOA 2YJSA 3T9TA 4KSKC 3ML9A 1ZMVA 4GYGA 2REIA 4PMTA 2V55A 5KX8A 4NPNA 4FV2A 3CQWA 3VNTA 1UNLA 1XBAA 3FC1X 3FPMA 4MBIA 2BKZA 1UZXB 2A4ZA 3R73A 4LGGA 3JW0X 2ITZA 3QBNA 4I5HA 3UTOA 4YU2A 3GB2A 3EFJA 2PUNA 3ZOSA 4KVGB 3CY2A 1RLFA 3EWHA 2KK8A 3Q5ZA 1HCKA 1VJYA 4PRJA 1XBCA 3H3CA 4F7JA 2ONLA 3FL4A 2IWIA 5J5TA 4TUUA 3Q4CA 2B9IA 4RZVA 2VO3A 3DB6A 4JBQA 3UO4A 4MGIE 5A14A 5LVPA 4G16A 3LFNA 2C5VA 4RWIA 2BFXA 4FNXA 1Z5MA 3EZVA 4QPAA 4WBBB 4BYIA 4PQNA 4EC9A 4I0SA 5I0BA 2UZBA 1URWA 2YM3A 4KRDA 2JXXA 3FC2A 4D2RA 3UIOB 3N4TA 3L08A 4OTQA 4XMOA 4ZTHA 3MTLA 1YRPA 5JKGA 2WELA 3BZ3A 1M2QA 3EMGA 5CSXA 4HK2A 4R6VA 4BKTA 2XNPA 1YXTA 3BEAA 3DNDA 1KWPA 4LFIA 3D5WA 5BUEA 3W1YA 2B7AA 1V5OA 3TKIA 1P4FA 3DFCB 3U9CA 3NYNA 2E9NA 3QUEA 4YZNA 4ZSLA 5L3AA 4M15A 2V7OA 4M69B 4AZWA 3SOAA 2ZYBA 2WHBA 4GDKA 4HYUA 4ZK5A 2I6LA 2ZM4A 1WGHA 3Q52A 4QQTA 3RZBA 3C1XA 3QRUA 4KIPA 3IONA 4G9CA 5AAGA 5K4JA 2JFLA 5J8IA 1C3TA 4F70A 3PVLA 4GFMA 3TNPC 2VZ6A 2DYLA 3A2CA 2J5FA 4N6ZA 4YHJA 4AJWA 2YACA 4O2ZA 4FA2A 4W9JA 2WTCA 4O6LA 5D11A 4ARKA 1LXDA 2WX0A 3S00A 4R7BA 3QC9A 3GUBA 4UALA 3UBDA 4K33A 2JC6A 3LAUA 4YPSA 4WNOA 1Q62A 1XH7A 5CLPA 2YHVA 3VHEA 2D10A 3FI8A 3QTWA 3VS7A 1OVEA 3GCUA 3EIDA 4G5JA 3MVJA 5CENA 2X8EA 4FIHA 3KRWA 3ZSGA 4CKRA 2IZVB 1BL7A 2PMNX 3P79A 3O8UA 4J8MA 5FDXA 4ASXA 5ANIA 4H05A 4S31A 4XHKB 3UGBB 3D94A 4YJUA 4I6LB 3QQKA 3R7EA 3VBQA 2J7TA 1NVSA 2FUMA 2OICA 2QHOA 2W17A 2PK9A 5EHYA 2OXYA 2HJ8A 4I6QA 3ORTA 4QQCA 4FKTA 2C7HA 4FZFB 4KB8A 2C0TA 4RFMA 4AE9A 2YN8A 4C61A 3DTWA 2C68A 4F7SA 3MJ2A 5FXQA 1FXTB 2CGVA 1YX5B 2EXCX 2XKEA 5BYZA 1XBBA 3EHAA 3OJ4B 4QMOA 3O96A 3PP1A 1VYWA 1PRYA 4KA3A 4RZWA 1PQSA 2B54A 2CCIA 3DOGA 4YNEA 3FE3A 3D7TB 4I6HA 5E8UA 3DBSA 4HXDA 2YM6A 5DYJA 4QMYA 3ALNA 4ZRJA 2XJ0A 2DZKA 4GU6A 2G15A 5LXIB 3SHEA 5DBXA 2XUUA 1W82A 3OCGA 4WG5A 3MTFA 2YDKA 3TNIA 3W8LA 4F1TA 3ZLZA 1L2NA 2DAJA 4BDGA 2ZB0A 3FI2A 1UKIA 3DDQA 5K5XA 3ZRCA 2CMWA 4AGWA 3MIAA 4NL0A 2ITNA 3E7VA 3DAEA 1URCA 5IA5A 2IY0B 4ZAUA 4GDLB 2A5UA 4F63A 2XNBA 2V5QA 4FNWA 2ESMA 2BZIB 3MESA 5FDPA 5CT7A 3E88A 3CD3A 4C3RA 3E3PA 1WCCA 2C6KA 2JKQA 3E8DA 2XIYA 3ZTDA 3LJ2A 3A99A 1SNXA 4TYHA 3EJ1A 3SW4A 3E64A 4M8NA 4DLIA 3KU2A 4EOKA 4TYIA 3TJDA 3FMHA 3FXXA 4ENXA 2ASQA 3A1QB 3AT3A 3IDBA 5GHVA 4BTFA 3P9JA 3DK7A 5EDPA 2FAZA 5BVNA 3W2CA 3BHHA 4NSTA 2I0HA 3ZONA 3R63A 3RUIB 2MBQA 2D11A 4C8BA 1WIAA 4GDKB 4QYFA 2C6IA 4OTPA 3ZDTA 1G5SA 2OSCA 3ZXZA 2L05A 2KWCA 1GZ8A 4TYJA 2BWFA 2ZJWA 3QTSA 3LLAA 2M0XA 5HIDA 4KBCA 5AUVA 2G01A 4KIKB 3TNHA 2A19B 5AX9A 5IQEA 1JLUE 3TNWA 2BZHB 2PPHA 4AZEA 1WX7A 3LXKA 2ITPA 3VULA 5IA2A 3F5UA 2RGPA 3UZPA 5IA4A 3ZC6A 4EOYA 3TJCA 4R5YA 2W1DA 3C50A 4B9DA 4BRXA 2DYBA 3WA0A 3GBZA 2KHWB 3DCVA 4FKJA 3RWPA 2M17A 5LMKC 4FKWA 2F7XE 2Z7SA 2VTSA 5ANEA 3VUDA 4IM2A 4FZ6A 3B0AA 2IJMA 4GVJA 2UZDA 4M97A
chains in the Genus database with same CATH superfamily
2K39A 5IQBA 4N6EB 3CCNA 5KZIA 2Q5WD 1GY3A 3QNIA 3VXWA 1Q5WB 1UU8A 1V49A 2OZNB 2L0FA 3IGGA 4AX8A 3JYAA 3CE3A 1AW7A 2JT4B 1ZP0B 1KRHA 3BYMA 4GN1A 1WF9A 3FLZA 4AN2A 3BUIA 4E20A 2KDEB 2IPXA 4FK6A 4H1JA 3TACA 3FKOA 4FYOA 3VBWA 4QTBA 4LJOB 5BQ0A 1NYRA 3PJ3A 4F08A 4PO2A 5LMKA 4NZWB 4JT3A 3ALBA 3IGOA 4RWKA 3FAAA 3IPHA 4BWKA 2M56B 3UYTA 3A98A 3PO0A 1GJOA 4YGAA 4WIHA 1OUKA 2C30A 1ZWWA 3TKUA 3CS9A 4NJ7A 3A4PA 1MHHE 2VTOA 3UIPB 3OOMA 2IW9A 1P7EA 3EN4A 4Z16A 4JVGA 3F9NA 2EMTA 3DBQA 3G9NA 2V3PA 3T3VA 4IFCA 4BDFA 1WXSA 5HOAA 4TXCA 5BVWA 2VWWA 3H30A 4LG4A 4HJOA 1F52A 2MP2A 1APME 2RSUA 3QD4A 1DOXA 2YISA 3AC4A 2P3GX 3ANRA 2EB3A 4O83A 3VUXA 2L83A 3NVMB 5L2SA 5C03A 2KVZA 4RIXB 4X2GA 3R1NA 3A7GA 5KUPA 4C02A 4UWCA 3A4RA 1E9MA 1WWTA 2LRUA 3RV1A 1WXMA 4Q5EA 1BLXA 2CJOA 3RCZA 3W2RA 5BVEA 2YCSA 3Q3JA 2E9PA 2XZSA 2JF5A 5FXRA 4USAA 3U8WA 3SVVA 5AUUA 5AV1A 1DKXA 4FEXA 1TKIA 3I0QA 2OEDA 3W1SA 2Y6MA 3A9KB 1ZOGA 1FXIA 1YOJA 3HAJA 2AL3A 3A9KA 1LO5D 4ACGA 3EUB2 2LEKA 4J96A 3RNCC 1FOTA 4HNIA 3HM6X 4F0GA 4BDCA 4HVSA 4IVDA 3C7QA 2ZDTA 5CEKA 3X23A 4DHJD 2NBVB 1VRAB 4CMOA 5AV2A 3IVFA 2N1WA 3KXXA 5D6JB 3DKFA 4R7IA 5FQDC 4UYAA 1F3MC 1W7HA 4NW5A 4HYIA 2V4LA 4FV4A 3MP9A 4LDTA 3D83A 2QO2A 1NENB 5G1XA 3IQ7A 2XYNA 2W1CA 1WM3A 4ORKA 2KTFA 4LOPA 1V86A 5KMKA 4FHJA 3A9JB 3C4CA 4A8XC 2ETRA 4RLLA 4F1OA 1ST4A 4EYMA 4S0RA 3MFGA 3F61A 3TKHA 2DYMA 4HPUE 5LQFA 4ANUA 5L2TA 4L3LA 3BBWA 2O0UA 1PF8A 4BN1A 1GUAB 1YHWA 4DGNA 1ZXIA 2R3MA 4ZOGA 3OROA 3LFBA 4HGEA 3IKAA 2PLPA 2WTWA 2C6EA 3W32A 2B0QA 3D50A 1TZOA 3OXIA 3FMMA 3UP2A 2PL0A 4FVRA 4LI5A 4EOSA 1V0PA 4Y8DA 4QP4A 3M95A 4F01A 4UMRA 3RPMA 2OW3A 1TZ1A 2JFMA 4UMUA 4EH2A 1XH9A 1ZYJA 2C6MA 2O65A 3UNZA 1QL6A 3F2RA 1I4TA 2JNKA 3U8ZA 1JSTA 1GZNA 5L95C 4QNYA 4XOZA 3CAZA 2BF8B 2VTJA 2QR8A 2DZJA 3Q9YA 4XWTA 5DHJA 4GYIA 2UW7A 3PRIA 3PTFC 4DDID 1V97A 4D2TA 2R3HA 2KZRA 3NHEB 4A6QA 4EL9A 5FBNC 3GP0A 3E5AA 3Q9ZA 2BPSA 5DN3A 1PXIA 2Y5CA 3W1SC 2KWUB 1MJDA 3W2OA 5BYLA 4EOLA 1NYQA 3TN8A 3KF4A 4FR4A 4XC2A 4MM3A 4C37A 3IO7A 5HU9A 4HW7A 4WNPA 3CJFA 2QU6A 1SJED 4YSZB 2PULA 2Q0BA 4EZRA 4MK0A 1OL6A 4KBAA 4EH5A 3QHTA 2BRMA 3RHXA 2WHIA 3QKMA 3DLSA 3KREA 3L9MA 3U7ZA 3UZRA 2RSVA 4V05A 4AW1A 3FMJA 3C0GA 4JI9A 1TS3A 4HOKA 4FT9A 3C0IA 1SBBB 4I4FA 4HVGA 5HFYA 4O7SA 2UZOA 2LGDA 2XNOA 1ZOHA 2O2UA 2R9SA 3UIMA 1H24A 1XKKA 5IA1A 2OLCA 1Q8UA 4AJYB 4IVBA 5ACKA 2XS0A 3VUKA 3S1HA 2PVYA 4CG8A 3C4EA 2QD9A 3LFEA 3R9DA 3PJ8A 3A7HA 1YDRE 2EMSA 1TS2A 3OCTA 1F5QA 1UF0A 3PZEA 5IQGA 5JQ5A 1QQRA 3R7QA 4K3BA 2LGSA 3ZYAA 3CXWA 1I4RA 4H2AA 3AGLA 4NYEA 4ENYA 2GHMA 2KWVB 3QYZA 4FIIA 3MC8A 2XM9A 2KT7A 1I4DA 4AOTA 1UNGA 3W33A 4L23A 4W9CA 3Q2AC 2HWPA 2WDRB 2C69A 4GCJA 3Q0KA 3UO5A 5FTGA 1OIYA 4UWBA 4QMWA 4J7BA 4S32A 3DYTA 3NIEA 1EH4A 3SAYA 2J5EA 4IVAA 4PNKA 3MVLA 3BU3A 4E8AA 3V8WA 4QP1A 2O64A 2BTEA 1TBEA 1QOFA 2YM4A 4ASEA 4NW6A 2GFSA 4RIYB 3SRVA 3I5NA 5TO8A 4GMVA 4AXFA 3MWUA 3EL8A 4RSSA 3ATSA 4DFZE 5AX3A 4FZ7A 5CU3A 2WXMA 3BHUA 4YL8A 1J0GA 3HMNA 5J17A 1KE8A 3A4OX 4O2PA 1OKYA 3OOGA 4DGLC 4D4YA 4RFYA 4DK5A 1H1PA 5EYDA 5DMZA 3QUPA 3URYA 4JOAA 3ZJTA 1G8SA 3RM7A 1V0BA 3R21A 1E90A 1KE7A 5E9EA 3IDPA 2FA2A 1QKZA 1UWHA 4X21A 3ZM4A 2BYFA 2PVLA 2VWUA 2W5AA 4HJKA 3BRBA 4BFMA 3I81A 2EELA 4P7EA 3MFSA 1XF5L 4FXCA 4QQ5A 5C01A 4RJ5A 5AP3A 4S2ZA 4EZJA 3CQUA 4MD9E 2YLFA 3M62B 4KZCA 2QKWB 5I3RA 1ZZLA 1OUYA 2RG5A 3S3IA 1DS5A 2D5GA 2B3AA 1XQQA 3KAWA 4OBPA 5K9IA 4FKQA 2ITOA 2JKMA 2YIVX 4FOCA 4W4WA 3DQXA 3PE2A 5HTIA 3W0SA 4MXZA 3VBVA 1TY2A 3OTUA 3QA0A 4MAOA 4BVUC 1EWYC 4IX3A 1R0PA 5DIAA 3G0FA 2RGFA 2Q13A 1W2FA 2HTME 1WGRA 1XD3B 2R7BA 3UQBA 1I4QA 5AAFA 5H92C 3F5XA 2QNJA 4JDJA 2RFNA 4GOCA 4P5QA 3RINA 4FKOA 4OT6A 4BF2A 3B53X 3K54A 4HZRA 4P90A 4CFXA 1H01A 4TRLA 4EZOA 3OG7A 5DR6A 3PREA 4P1CC 1PYWD 2UZEA 2JQRB 3OW4A 1A70A 2IZTA 3EKNA 1FPYA 4IVCA 2BYTA 3VRZA 3IW5A 5HI1A 3GCPA 4MXCA 3QF9A 5FD2A 3RNIA 2ZB1A 1R78A 2YEPF 1FVVA 3VDZA 3OXTA 3CWIA 3C7NA 1JPAA 1MP8A 1QT9A 3LVPA 2W1HA 4C3PA 4W9DA 3WANA 4I3ZA 5GINE 3C4FA 1CMXB 1E9HA 4FTRA 3AE2B 2PWLA 4TW9A 4N70A 3FYKX 5CF5A 3Q6UA 2YDJA 4MHAA 2OJFE 4FV3A 2YFXA 1I49A 4EH9A 2BHEA 5HD4A 2YDIA 2OFVA 4XV3A 5H8EA 4GK3A 2C1AA 5IH5A 1IPGA 2FIDA 3B2WA 3A4SC 4K7WA 5H2UA 4EC8A 3HAVA 4WOVA 4XG4A 4AN9A 2ZVAA 5B2LA 4C4HA 1BI7A 2GTNA 4A9SA 3P4SB 2DAFA 1P4OA 5KHWA 3KRRA 4FTOA 2BBCA 3KVFB 1V1OA 5MPOA 4IE9A 4U81A 3MH0A 3PGEA 1WBVA 2BS4B 2CJNA 3VKHA 2QOBA 1OPLA 3SW7A 3SXSA 1YJJA 3R00A 4ARCA 2XNGA 5CX3A 3ZTCA 5CQWA 3UQCA 3BU6A 3U6JA 2BFYA 3W0NA 5CF6A 5E7RA 5FM2A 4F99A 3PLAE 4FKGA 3PA5A 4NTSA 3DOWA 1M14A 3F3VA 1NT2A 2X81A 4OTDA 3R71A 5HE2A 3R7IA 3SOCA 4AT3A 3TIYA 3VTUA 5AUZA 2KX0A 5J2RA 3PVWA 5D1JA 4ZS0A 2JZ3B 3F3UA 4P6VF 2NPTB 1OA1A 1HTOA 3GE3C 2C5YA 1H27A 3HZTA 4FEQA 4FV6A 4C38A 2OOBB 3V51A 3VS1A 4DCAA 4A9UA 3Q8FA 4C4JA 2WQMA 4IWQA 2OBMA 5BMGA 5J95A 2R3OA 5IUGA 1OKWA 4XX5A 3IOPA 3ZLSA 5C1ZA 4I93A 2QXLA 2PW9A 5BX0A 4AAYA 2BYVE 3EQRA 4NQLB 4ARIA 4DE4A 2W05A 2J9MA 3ZSHA 2WXOA 5T6KA 2Z0DB 4NY0A 2Q12A 2QVSE 4FV5A 3ZVVA 4MGKE 1TQWA 4JWUC 5DA3A 1AN8A 3MPTA 4ICUA 1H1QA 4G3DA 3L54A 5HVYA 4BIDA 3BVVA 3G6GA 5C26A 2LUMA 4CT1A 4DDIA 3AT2A 3KRLA 1P98A 2K6DB 2PZYA 4F8CB 1R5EA 3U55A 2K0PA 3MVMA 1FFUA 1MRVA 1K51A 4WG3A 3LVTA 3KFAA 4RNAA 5LWNA 4IC7B 3OBJA 3OWEB 2WGSA 3ZSIA 3Q8BA 3NDMA 3L10B 4LRJA 4D4RA 2O6VB 3TEYA 2VX0A 5IA3A 4QYGA 4ACDA 3T4AG 4NEUA 2BCJA 1WXVA 3C51A 3Q9XA 2HWOA 4EEWA 1WMKA 4PL5A 4AF3A 4CQGA 3QRJA 4KINA 3P7AA 2OH0E 3SFEB 2C9WB 3HAHA 3CTJA 1OTRB 3FBVA 3QXPA 4HYSA 4O4BB 3GZNI 1U00A 4ZSEA 3KL8A 2KC1A 5E8WA 4WRGA 1J8CA 2Z0OA 4JGHB 1ZARA 4FM3A 5C5BB 5E8YA 4BCHA 3E92A 2ON8A 1YQ3B 1IBXB 4KDIC 3FSFA 3KMMA 2HK5A 4CXAA 4GLSC 3P0MA 3VWAA 4HGLA 2YIXA 5E84A 3C0RB 1WM2A 4D9TA 3QWZB 3DDGA 3D32A 5JEBA 1HQRD 3D52A 1F1HA 1PXLA 3GC0A 1F2RC 4RQVA 1VYZA 4K81A 3ULIA 3A7IA 4R5KA 2NRUA 4JBOA 2R0UA 3I39X 4Y5HA 3PYYA 4DF3A 3VS3A 3TUOA 5L8JA 5HNIX 5M53A 2WOUA 2A2AA 3ANQA 3CEKA 3U6HA 3B51X 1E8XA 4PMMA 4CMUA 3UJGA 2GS2A 3ZFMA 3C4WA 4NQIA 1BUIC 4WWPA 4DT8A 1L5PA 3I4BA 3BYVA 2HDEA 2W9ZB 1WX9A 4YMJA 1Y8YA 3NW6A 2ZDUA 4YZDA 2VD5A 4NZLB 4JQEA 5AR5A 3VVHA 4ZEGA 4XRJA 2UZVA 4PPBA 2YM8A 3BLQA 3QHRA 1REKA 2FSLX 2KQSA 3C0HA 4JS8A 4AE6A 1Y57A 2GNGA 1R4NB 4D1ZA 4FKSA 3AULA 5M4UA 3GCSA 3TCPA 4BKYA 4O7RA 1FRRA 2JBPA 3PV1A 2XK3A 3NOBA 2QOOA 3MC0B 4JLCA 2B53A 3OEFX 1H26A 3ODZX 3P4KA 3O3NB 2VTHA 5DG5A 2KTYA 1E6EB 4ASDA 1KSWA 5CSVA 1Q10A 2W5BA 2VH1A 1W83A 4JG8A 2YERA 3R3MA 5I9WA 3PIZA 5AIKA 5JT2A 3VEBA 2FICA 2JIIA 3ZNGC 5L6WL 3QKLA 4EOJA 1K52A 3TDWA 3RMKC 3ZMMA 3U4EG 2VTTA 3H6NA 4ZTSA 4YC3A 4L53A 1Q24A 2G9XA 4M0WA 4XNEA 2R2OA 5JZEB 1YQ4B 4L3JA 1Q41A 2BIKB 5I9YA 2X6EA 4WPEA 4IZ7A 5IQIA 3DNEA 2IZRA 3V60A 4JDKA 3D4YA 5H8GA 3ORPA 2HIWA 4K7UA 3M2WA 4PDPA 2G45B 4FIFA 3EYHA 1E2UA 2XKCA 1E1VA 3AC2A 4D55A 3VRYA 3BK2A 2WX1A 1CDKA 5E91A 4FV0A 4W4VA 2QIEB 2LJ5A 4YTCA 5E6NA 1OQQA 2XAMA 3QD2B 4OZCA 3TZ8A 4J1RA 2WMTA 4NTTA 4A3OA 2UZNA 2KJHB 3IK3A 5BMHA 1KOAA 2LXCA 2FSMX 1PMUA 1H1SA 4YJVA 5KO1A 1NVID 4WSYA 3N30A 2HXQA 3QX1A 5L8LA 4P5ZA 1V81A 2OZAA 5C23A 3OW3A 1Q3WA 3VBTA 4PYUA 4DHZB 3AMZA 3WYYA 3KK9A 2HCKA 4ALVA 3KVXA 2ZXQA 1RDQE 4AS0A 1WRIA 3APFA 5CQUA 2PHKA 2KX3A 4B8MA 3TM0A 3LJ1A 3OWKA 3S2PA 2V0OA 3F69A 3KXMA 5KMMA 4JN4A 5DT4A 2OK1A 2KN4A 3L1SA 1FCCC 3VTWA 3IHPC 4GG7A 2JDOA 1XWSA 4FV7A 1TKGA 3MH3A 3ZFXA 3TT0A 4QP9A 2OZOA 3OBGA 1JRPA 3NRZA 4NCTA 4YTIA 2UVXA 4UV0A 5J5SA 4CFWA 3P5JC 3QQHA 1WVWA 2MQJA 3U30A 1TQPA 4YNOA 2QG7A 1UBQA 5JQ8A 4XG2A 4MH0E 2VWBA 4O4EA 5CAVA 1T3QA 4TNBA 2JY6A 4D1XA 4QRCA 1N60A 2BRBA 4XBRA 2LVPA 1T0SC 1L3RE 3QTIA 5AV0A 4F6SA 1ZOEA 2KO3A 3QJZA 1JRUA 2YIWA 2W9NA 1QPCA 2EXEA 4QPMA 4BNEA 2OXXA 3F7ZA 2GLSA 4D8JA 3EGRA 1KLGD 4GFOA 2XF0A 2CU3A 4FT0A 3KQ7A 3PS6A 4FSQA 3AXWA 1HTQA 4HPLB 2C4GA 2VO6A 4NKAA 3ZU7A 4IWOA 3MDYA 3EQDA 3SHQA 4US8A 3CP9A 3P42A 5IA0A 2IZSA 4FEWA 3M3JA 4K1RB 2K22A 5CI6A 4U6RA 2EVAA 3FXZA 4G11A 1W9MA 3V5JA 3VBYA 2GQSA 4LMNA 4OBQA 3GP7A 3Q8EA 3SEBA 3KUCB 2YEPB 3GC8A 3NW5A 1EM7A 2X2KA 4EZNA 3KMUA 1NI2A 4DGGA