4IMKA

Uncrossed fab binding to human angiopoietin 2
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
229
structure length
229
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARSPNPYYYDSSGYYYPGAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy Chain
publication title Crystal Structure of an Anti-Ang2 CrossFab Demonstrates Complete Structural and Functional Integrity of the Variable Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4imkA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4imkA01
3WSQH 3SBWA 5C0JA 4R8WL 4PBWD 2OBGA 4MWFB 3UTPE 4LSDA 4PD4J 3RWGA 4OSUL 3D2UA 8FABA 4PBXA 4ZG1A 4MNQD 4QTIL 1FRGL 3ARFD 1RV6X 1UZ8B 2GSGB 3JTTA 2ESVB 2PTUA 3UTTD 4Y5YC 3MUHL 4HC1L 4KUZH 2A6IA 3L3GA 3P30L 4FQHA 3BRFA 4R97B 4E42B 3I9GL 3VXTA 1I1YA 4ZFGL 1OAXH 1CGUA 2RHEA 4HGWB 1NBVL 4PTUA 4WUUE 2V7HB 1FORH 1MCEA 3QXVA 1NUNB 1JNHB 2WQ8A 5C0IB 5C0GB 1HQRB 3AM8A 3QWOB 5JW4N 2IFFH 3QA3B 4UT6H 5IKCB 5B3JF 4J12A 1YNLH 3MO1A 2BVPB 5EUOF 5E94A 5L0QC 4CN1A 3NA9H 3VA6A 3P4OA 3AXLA 3TO2A 1QP1A 4DCQA 1IT9L 1TTFA 1BX2A 2BSRB 4XPTL 4XNZC 3T0WA 1ACYL 1JJUA 3GMOB 4YK4B 2H6PA 4GRWE 5D6CB 3T2PA 3BDYL 4FABL 1N4XH 2XKNA 4XWOD 4D8PB 4Z76A 3PGCB 1FHGA 4HAGA 4Z8FL 3LMJL 2ED7A 3OKNB 2P8PA 4JZNB 2I9TB 1IM9D 3O8XB 4RFEB 1Y6MR 4K3EH 5BCAA 5J13C 3H7LA 1J1PL 5E9DB 4G8FA 4RGOL 3HAEG 3F8UB 1Z9SA 3BO8B 3NIGE 4RGNB 2WBJB 1IGML 5TJWK 1U93A 3P77B 3QDJB 2HT4D 4M9OA 3FFCB 5E08L 4JM2F 4MJ6B 3QFJD 3C08L 2G5RA 3C5ZA 3O41A 3KYKH 4Y1AB 2F5BH 5FYJD 3T0EA 1DE4A 4G42B 2IBBA 1RZ8A 2ZSVA 3QI9B 5L7XH 1KCSH 4MB4A 4OF5A 3TT3H 1FZJA 4GKSB 1FNEB 2JJWA 3QQ3A 1YY8B 1KNOA 1SBSH 4RRPA 1U8QA 1YYLH 5HHOA 3K3QA 1KCUL 3TIDB 1JHKH 4LLWA 4C4KO 1RZIA 1FZOA 1M4KA 2DQDL 5E2UL 5I1DB 1NCWH 4KQ3L 43CAA 1A1NA 3EZJB 4PIRF 3DXAE 4PJDA 3IXTB 2BVOA 1LO3L 4PV9A 4QTHB 3WJJA 4ZFZB 4WENB 3UXFA 1DBKH 4YGAB 5KVGL 1ZWIB 4G6FB 1MH5A 1A6VH 3ARUA 2NY3D 5TPWL 4ODTH 3PWJA 5DK3A 3E3QE 1MFEL 3VMOA 2V9RA 1RUML 4POYA 1KC5L 2P5ED 3O3BB 5FYLD 2D31B 2P7TA 3VFOB 1K8DA 1MLBB 3KPRE 4LPWA 1BLNB 1T6WA 4NKDB 5CZVH 2CDEA 3MRKA 3A6BH 1NLBH 1KJ3L 3QDMB 5FA3B 3SGEH 3P0YL 3V6OC 3NTCH 4R9HA 3QNXA 4YNYB 4XXDB 2GYSA 5JOPD 4LGRB 5F9AC 4KJQD 2ESVD 1DEEA 3S35X 4HKZA 2EC9U 4L5FH 2H3NA 4HH9A 3H7BA 5F93C 3QDGA 1AR2A 4TTDD 1N3NA 4MB3A 2W9DL 5DR5L 4XHQA 1R3HB 2GKIA 2R0LH 4YHNA 1AI1L 4G9FE 3T65B 1I8IB 4BH8B 4QXGL 1T3FB 2HWZL 1QFWL 2I26N 2VKXA 1FH5L 2EIZA 4LASH 1F90L 4M6ML 3RZCB 5FHBL 3QCVL 3QXAA 2H41A 5L88H 1IC7L 1YEHH 3CGTA 2A83A 1SBBA 3BW9A 3PWUB 2NXYC 5J6HB 5JNYB 1FG9C 2SEBA 4KV5E 3RL1A 1P2CA 1G7PA 4HGMA 3WUWB 5E00B 4LNRA 1H8OA 1WF5A 5DK2B 2NTSP 4HQQL 3MJGX 1KCRL 3O8XD 3TCLB 1BVZA 5JLZB 5I73C 4LSRH 4Y4HC 4F33A 3GSVB 2R2BB 1HIMH 2RR3A 3DV4A 4RGND 2VZUA 2WBJD 5IQ9B 3AMKA 1BFVL 4N5UA 1MJ7L 3QDJD 4XTRD 2VDLH 4A2MA 1KELH 1WISA 1MCIA 4P5KA 3FFCD 1NCDL 5L9DL 5CJOL 4Y1AD 3O9WC 3LZFH 1ZHNB 4PRAB 4MDJA 1GAFL 3QI9D 5F7UA 1JMZA 5KSBA 3UZVB 3KJ6H 3R0MA 2YPKA 5FO9A 3CMGA 4YWGL 1FAKT 1ZV5A 5ISZB 4HW6A 1UCBL 4RQQA 3CMOL 5LWYL 1CLCA 1RHHB 4ZUVB 1P7KA 2FJGA 3ULUD 2J4WH 4KI1A 4C4KT 4FN0A 4M4PA 4XI5C 2IGFH 5FA4B 2QQLH 4BSWB 1AGCA 2J8UF 4NO5A 3SO3C 3I6LD 4YX2L 4DFIA 3VCLB 2BRQA 5K9KA 4JO4L 3SDYH 3HC4H 3L5HA 2BVUA 5T33H 2X4SA 4I2XE 3LN9A 4G6FD 1CGTA 5TQ0L 4TSAH 3VH8G 3PWNA 4RMWA 1A22B 4H8WH 4PJ9B 4DW2H 3LKRA 3RWJA 5MEQA 5H94A 1AP2A 2DQTH 7CGTA 2ENYA 5ITBH 5JIPA 4K7FA 1UA6H 4LHUA 2J5LC 3WHE0 5JUEH 4I5BA 2W07A 1J87A 3ZE2F 2GEEA 1MFAH 2HRPL 2D0HA 3GBNH 1EEZB 3QDMD 4X7DC 4XHJC 1DDHA 3CU1A 4KY1H 2HT3C 4H25A 2V5TA 4CW1A 3HMXL 4QO1A 2RFXA 1J7VR 2Z92B 4L8SB 1QACA 3SEPA 4P4RB 3WXVL 4I3SH 5KTEL 4HF5L 5I1GH 5MHSD 3OF6D 4D9RE 4R4BA 3D9AL 4LDEB 1ND0A 1WWWX 5HGAA 3MTRA 3BKJL 4FQLH 4XBGB 4NRYB 4LF3A 4L3EE 1JGDA 2YRZA 2I24N 1MWAH 2A77H 1TITA 5M95B 2WUBL 4OUUB 5FYJL 1CDJA 4TUJA 3TH4T 3BGMB 5DGRA 3HE7C 4L8DB 3RZCD 5I1HL 4QHKJ 2VSCA 2CDGA 1JHLH 3MBXL 4P3DA 2VZTA 5HDBF 3QB7C 4OCSL 4PJGB 1KN4H 2ZCLH 3P0VL 4LK4A 5DRWA 2PN5A 1NMAH 4QRRB 5E8EA 3BUYA 1GC1C 1B88A 4R4ND 4XB8A 5JXEC 5BW7A 4O58L 4QYOB 1H3UA 4EUPG 2PCPA 4MDIA 5EA0L 3GSNH 1MF2L 5D7IF 1ZGLM 5BV7L 3QUMH 4AT6B 3WIFA 1MFBH 2GAZA 3ZYOA 4KK8C 4Y5XA 4KXZI 4GLRI 4JRYA 4NN6C 1RZKC 5JZ7D 4EN3C 4HWBH 1E0OB 2WMPA 4TNWK 1ZA6A 4S1RL 4FP8L 5GSRA 4L9LB 1I8LA 1DLFH 3U36B 4IIQC 5EU3A 3BIKA 1SJHA 3O11B 1GIGL 1T66D 5FYLL 1G9NL 4BK4A 4Q9BA 3RUGF 5CS7A 2VQUA 4NDMB 5FCUL 4V2BA 3VMNA 5JORA 1X5YA 2ZG1A 1UACL 4LDOB 1AXTL 4R7DA 4UNTA 1NAKH 4UB0H 4RFOL 5F6IC 3MLWH 5ISZD 4UIMB 3H9SE 4OZ4A 2EE2A 1DSFL 1SY6L 3IDGA 3WS6C 4ZQKA 2UUDH 1U95A 5ESAA 2X44D 1F6FB 2PETA 1WWCA 5E5RB 2LV4A 3QPXL 4F8TA 5FKPB 3TNNB 1B4RA 4JHAH 4RWYL 4XRCA 5ICXA 3KPMA 2MCPL 3C09B 1XH3A 4J3WA 5T1MA 3AS1A 4HH8A 2CPCA 1BZ7B 2EEAA 4GXVL 4PJHA 5DJYB 4OI7A 1GPOH 1KJVA 4PJ9D 4OM1L 5KZCB 5FM5O 3G6JF 1ES0A 4HXBH 1YNTA 2J88L 3RPKA 4DEPC 3LB6C 2G60H 2NY2B 2C3GA 2Z93A 3AS2A 4F57H 3S4SG 2W0PA 3GI8L 4LPTA 1A4KA 1ZANH 5DJ2A 3P4NB 1OD7A 2VLME 1ADQA 1M7DB 2FD6L 3B3IB 4WUKH 3ARDC 4MS8D 4X4ZA 1RUKL 4M7LL 3SDCB 5DURB 4R90H 1F8TL 4WIQA 5IG7B 5H37G 3MLYL 4MXVE 3V0WH 4JFDA 2EDWA 5I1CL 3GBMH 1J0JA 5DQDL 3RVTC 1FNGA 3L3IB 3W5NA 5JDJA 1U3YA 1IVLA 1CE6B 3IDNA 4HJ0C 2V5RA 4PR5A 2YBRA 3KYMA 5F7WC 1OY3B 2H32B 4JGJA 4Q6IC 3O6FD 3CDYA 5D7LB 5CHNA 3HB3C 4MXQD 1OGTA 3DRTA 3O0RH 1CT8A 3AFLA 5CJBA 3FQWA 1H5BC 3OPZL 5H37H 3DJ9A 5KVEL 1AFVH 4OFYD 4Q74A 4CVXA 2QEJA 1XF2A 2FATL 4QRRD 1L9NA 4LCYB 2EH8L 4OGYL 3QHTC 3V6OE 4XVTL 5K9JH 2R2EA 5LGHL 1VEPA 1Z0MA 1MELA 1RU9H 2GT9A 1GL4B 4PJAF 1N0LA 5EU6A 5TFSH 2M2DA 5ANMB 4ENEC 4JRWA 3DWTA 2BNUB 4Y0GA 1B4JL 3C8KB 4S1DD 3S5LG 4EI6A 1K4CB 3MUY1 3MLSH 1HWHB 2OXHA 5B8CC 4R7NB 3ZLQC 5HVFB 5SWSA 3RIAF 1XGYH 2HKHL 4JRXB 2VAAA 4NFDA 3QIBA 1OL0A 3JV4A 4UZGA 5KJRH 1TJIL 1CDCA 3PV6A 1BEYH 4P0DA 2VABB 5T1KB 3PIQB 1C7TA 2UVEA 2APVA 3QEHA 2ZKHH 1UKQA 3TZVB 5C8JA 2G5BB 1SJVA 4KK9D 2R4SH 3TPUA 3EJZC 3ARBA 5AYQA 1F2XK 2APWA 2P24A 1JZ2A 1AKJB 4AEIL 1KJMA 4L3CB 5GIRA 2VJXA 3P9LA 1IAMA 1U36A 5IMLA 3U2SB 5C07A 3AREC 2RIKA 4NKOA 2UWEE 1NCBH 4I3RL 1YQVH 4EQ2A 1GSMA 4MJ5B 5I17B 1GGCL 3ILPA 1Q94A 3JWDC 2J8HA 1W0WA 1C1EL 1QRNE 1RK1B 5IB3A 3Q1SH 5KZCD 3GHBL 1T7ZA 3EOYG 1OD9A 3ARGB 3QJFA 1R5VA 4IRZH 1ZLVK 3VU2A 4CNIB 1NKOA 1J18A 4HIEA 2NY2D 3WFCH 1H3WM 4Z7UE 3SDXA 3W0WA 3TT1L 2BSTA 1WZLA 3SY0B 1T22B 1MHEA 1JRHL 3S36L 5C0CE 15C8L 3JV5A 4L1HA 1QQDA 2O26U 4LCUA 3SDCD 5INDB 5DURD 2KKQA 3TBYB 3DPBA 4NP4H 1YC8A 3WDHA 1VGEL 3D18B 2F58L 3VE0A 4N8VG 4YAQA 1N59A 3U0TA 2CK0L 3RX8A 1ZT1B 4K94L 1KPVA 4UILH 4M1DH 5AD0A 4WHTA 1A7PH 1T2QL 1HXMB 3VA2C 3STLA 3GSNB 1V3JA 2ILLA 3CFJA 1BQHA 3VW3H 5DJAA 2V2TA 4Q9RL 5AWNL 4MQTB 5D7LD 2E3VA 5E8PA 1D5MA 1RFDL 3TF7C 1J0ZA 6CGTA 5MEOB 4P4KC 5FFLA 1OPGH 3SDDB 3G6DL 1I3RA 5IGXL 1Q9WA 2Y06L 3WD5H 5DD3L 3T2OA 1C12A 5E95B 1LE9B 3WKNA 1I9JL 4JVWA 1CG9A 2ZJSH 3S6CA 1XZ0B 5GRVK 1DLHB 3UBXA 3HC3L 3QIWA 5E2JA 3S3SA 3VI4E 3FQXA 3LRHA 2WSKA 4ZAKA 1F4XH 4I9WE 5T3XH 1H3TA 1M6OA 4WEUD 3WFEH 4Z7WB 1RJCA 2YUVA 3F7YB 1RJZA 1S7XA 3LRGA 4YFLF 1Z9LA 1G0XA 1GCFA 1BVKA 4GQ9L 5D8JH 4O02H 3VGAB 4WY7H 4RX4D 1ZT7B 3A67H 2XRAL 2IPKB 4MLSA 3PABA 4JRXD 5C3LD 1DVFA 1AH1A 1B3JA 1WFOA 5IEHB 3QIUA 3HUJF 4JN1H 5T1KD 1T4KB 3QFDA 1U8MA 5CIPB 3MCLH 1KLGA 4UT6L 5I1JL 3REVA 1YNLL 3NA9L 3VRLF 2QR0A 4WU5B 3TZVD 4XWGH 1FAIL 2HVKA 1X5AA 1FDLL 2NPLX 3NZ8B 1AKJD 3BN9C 1LDSA 3AMLA 3FL7A 5ETUA 1V8HA 3L5WB 2I9LA 2VE6B 5D1QC 5HHQB 2OR9H 1N4XL 4JQXC 4HT1L 2AXGA 5HHNA 1HOCB 1U8IA 2VLRA 4HWZA 3OKMA 4UU9B 5CZKA 1A6AA 4K3EL 1EBPA 3EYQC 1HEZB 1TJHH 2C1PA 3RWFA 1XF1A 3RWHB 3ARGD 4IHOB 2NX5A 4R96B 3MV8E 2NLJB 3EUUA 2OS7A 4ORZC 2JKXA 4NC1C 3UYRH 3KYKL 2F5BL 4LLVA 3F58H 4G8EB 3T1FA 4F9LA 5KVFH 1PYWB 1RK0A 3MLVH 1I1CA 5L7XL 5F1KC 3MLTB 4OIAA 4TOYH 1MCWW 1Y0LB 2KQNA 3UPRB 2EDTA 4OFKA 3FRPG 1EFQA 4RFNB 4HSQA 1AXIB 5FHAH 3P4MB 3DBXB 1EHAA 3O4OC 4GG6E 4TVPE 2FZ3A 1FLRH 4Z95H 2BNQA 4PV8B 1YYLL 2HT2D 3CIQA 2AQ1A 4M6OL 2JELH 2GITA 1V3LA 3CAFA 3TIEA 2CH8A 4FXLA 3TNMA 1Q72H 3VFVB 4GBXB 1ZVSB 1FC1A 5D2NC 3PNWA 2XT1B 2FLBT 3VDCA 1WBZB 4X6FB 4EVNB 5TQ2H 1A6VL 1RZGB 1U8JB 5GRUL 3ILQD 2EC9T 3BPNB 3QXDB 3GMLA 5B39B 4OZHE 2X9WA 5I2IA 3LKQB 5TF1L 5I6XB 4MCYA 4WUUB 5GS3A 3HTLX 5JHLH 1QFHA 5C0AE 1QR4A 1UADC 4X6CF 5DD6B 5EO0A 4LP4A 5IW6A 1ZEAL 3ZE0F 4PJIB 4DGVH 1KEMH 5FO7A 5CGMA 2G2RB 1NLBL 1T89C 2X9YA 3UROR 5FB8A 4ZNCD 1YUHB 4Y16A 3LKNB 1NDGB 5KW9L 1XF5B 4GRWB 1DANT 3I6KA 4LVOC 2FH6A 3B9DA 3FQTA 5IEKB 4X6DF 2OL3A 5D7SH 1N8ZA 3GJFK 4NOBA 4OIIH 2H2PD 1JN6A 2EDDA 5F1OB 2B0SH 3CFBA 3LPGA 4LAQL 4FQXC 3O6MH 3RVWD 1T83C 3RVXC 3HZMB 5MERA 3VWKC 5I16B 1LEGB 4KKAD 2B1HL 2J6EH 2Q76B 3RPIB 4YHKH 4LASL 2AABH 1JF1B 4LCIH 2W0FB 5E99H 2APTA 1J12A 3ZT7A 2P8MB 4ZOCA 1YEHL 4ZO9A 4HMCA 1QSVA 3MNZB 3VXMA 3G04B 1U8NA 4XP1H 2EDRA 5T3ZD 2GW5A 5JMOC 5I1EH 2PTTA 2XZCH 1NAMH 1T5WB 2PO6A 3BEWB 3FB8A 4OZFB 1I7RA 5C0RH 3DYMA 1QNZH 2GTZB 5CILH 4YEEA 5I8CA 1NCCH 5FYKE 1J1XL 2YMXH 5EU6E 5A16B 3GK8H 1WGOA 3DXAB 5JOFB 1EXUA 4B5EA 2VDLL 1WT5C 4BFGA 3RP1A 3SCMB 3CSYB 4NT6B 1ZKAA 3LKPB 4F7EA 1CBVH 3UAJC 3QEQB 1NQBA 4LEXH 2F74B 4H5SA 4YDLC 2Q20A 5DVMA 5SWSE 4ONGL 2FH8A 4IRJC 3HNTH 3CZJA 4QXTB 4E41B 3GM0A 2JB5H 1KJ2B 3PL6C 1TIUA 2VKWA 4U49A 1OW0A 3QUKA 3BXNA 4GAYB 3PF2A 4Z5RB 4OZGA 2GTWA 3UTPD 2H2SC 2CMRH 2GHWB 2ATKB 2R2HB 4PJBA 1R24B 3DROB 1U3HA 1YJDL 1BWWA 2IGFL 5C6PB 2QQLL 4U1KA 5J11B 4GBXD 4X8JB 1QEWB 4NNYA 5D1ZA 3UC0H 4DQOH 4LLDB 5F1SA 2NMSA 3SDYL 1A4JA 5T33L 1R3JB 4QF1A 3U0PB 3FAXA 2AQ2A 3HKFA 4OD2A 1OP9A 1F5WA 2VXSL 5DMGD 3CH1A 4JY6A 4G9FB 2IPTH 3VJ6A 4WUUD 2C7UB 2O61B 5GGQH 2DQTL 2DQHL 4OT1L 3BZEB 5C9KA 4HIXH 5FDWA 4HIJB 3NCJH 1J9CT 3ZZ1A 1H3VA 3QZWG 3STZA 3W0WE 4FZ8H 3JWNC 3FMGH 4Y5VB 3KNBB 5F7EL 3ETBF 4NQDB 2IBZX 2AK1L 4I3SL 1AO7E 4UT9H 4LSTL 3NCMA 4H88H 3BZFB 1YN6B 3L3OA 5F9WB 5C6TH 1A1MB 5DQJA 4M43H 1UM4H 3CZFB 3LQAC 2F8VA 1AR1D 2DDQH 2IALA 3QUYB 4FTVE 1T0NA 3BVNB 4XMPL 2YD6A 1JI1A 4POZC 1ORSB 1A0QL 1JHLL 2HG5A 2VIRA 3D69A 5IESH 4N9OB 4I18C 5M7QA 2CSPA 5CP7B 4NCDA 4OCWH 1MLCB 3DRQA 1Z9OA 5HYQB 2ZCLL 1NEZB 3AAZA 1CD1A 5KBNC 1GXEA 2XY1A 4WFGE 4PJEE 1JZ6A 1CDHA 1L0YA 1QLEH 2H9GB 2DWDA 4P9HL 2NY6B 4QNPF 5FIEA 4ERSL 1OP5H 3GSNL 1UCTA 5DVNA 2X1WL 1VEOA 4NWTL 4S1QH 3NCYS 2AK4B 4LDLB 1NGZB 2GFBB 1DUYA 2W65B 3QO1B 4PP1C 3QH3A 5AUMA 2NY5C 3BYYA 5IVZB 1OAZH 2CLRA 5TDOB 4OLXH 4HWBL 3FQNA 4TUKH 3KPLA 3N9GH 3DXAD 4HJGB 1Q38A 1DLFL 1KTLB 5CJQL 4YHPA 3ZKSD 1BOGB 4BSJA 4DKAA 3SCMD 4C54A 4ZDHA 2W9EH 4I2XB 4HKBA 4IOFD 2R4RH 1RMFH 2FJHA 1TQBC 1X44A 1X7QB 3QEQD 4L8BA 2HMID 3T3PE 2DYPA 1NC2B 1VESA 2ZG2A 1M7IB 3MRLB 4UB0L 1KXQE 3OKEB 4DUWA 1QVOA 1ONQA 5EC2A 4E41D 4ZYKB 4U1IB 3BRGC 4K8RD 3NPSB 1XGUB 5I15H 4JO3L 5T1LB 3EO1A 3SKNA 3FQUA 2VXUL 5B4MD 1S9XB 3JBG7 3TN0C 4KQ4H 2MNUA 4I0KA 3MRNA 4B53A 1I9RL 1NFDF 3O4LE 4I48B 2D7TH 3HZYB 5FUCC 3VFSA 1JFQH 5EBLA 3T4YA 4AK1A 3BP7B 4Z77A 5T5NG 5L6YH 3FT2A 2CKBA 1GPOL 1MCRA 2WBWB 4D0BA 3BGFB 1FZKB 2EDEA 4G9FD 5JR1H 4XPAL 3MJ7A 4HXBL 4L3EB 4NC1E 2VLRE 1CFTA 3DNKA 4NRXA 1PD6A 1R5IB 2FLRT 5F97E 3IDUA 2G60L 1CXHA 1LP9A 5F1NB 3GGWA 5T3ZL 2VSDA 4JFHE 3WIHA 3G5ZA 3T09A 3QNYA 4KGJA 4ZSOB 3MREA 1CF8L 1MPAH 4LSUH 1T1XB 5ERWA 5AAMA 3L3JB 4RAVA 4L29A 4OQTH 3OG6B 4NM8H 2YA0A 1KCKA 4QRUA 4Z7VA 4NQDD 5GZOD 4XNQB 2JK5B 2R1XB 2AJZA 3WNMA 4NHUB 1DQMH 1UM5L 3GBML 2Z31C 3CSPA 1CN4A 5D2NE 1JWSB 4GRLB 1YMHA 2XFXB 4BZ1H 3MV9A 3GMQB 2B2XH 4LHUG 1HHJA 4C56A 1JE6A 1XCTB 1ZAGA 5C0JB 3QUYD 1F6AB 5DYOA 4PJ8A 3RWGB 8FABB 2IH3A 1KN2H 2JCCE 4JFOA 1YPZF 3K2UH 3CVHB 4KMQA 2VLJE 3EOBB 1INQA 3JTTB 5BS0E 3IVKA 1CXEA 5FM8A 3L3GB 4MCZA 1F00I 4PJ5E 4FQHB 1NMCB 5GS1C 1Z5LB 3RTQC 4QT5A 4JE4B 1BZ9A 1T1YB 4MD5A 3VXTB 2BNRE 1I1YB 3VXRA 1OP3H 1S7RA 1T1ZB 2NY6D 4JFQB 1A6TA 4DN4H 2JLLA 3H9SB 3U30B 1S78D 2ZWLT 2IBGA 1MCBA 2QQNL 2AK4D 3N50A 4OGXH 12E8H 4JY5L 1S5HB 1SYSA 1A6ZA 5IMMB 4RZCA 1RSFA 1T03L 2HLFD 3MLSL 3KAAA 3RY4A 4JB9L 3TBSA 3SN6N 1BFOA 1YDPA 3QULB 3S9DB 1BX2B 4NZTL 5CEZE 1L0QA 1MIEL 3C6LB 2FX7H 4ZO7A 2A6JA 3F6IA 2MQ3A 4N8PA 3S35L 4HD9A 1FNSH 5DWUH 1XGYL 5FF6B 5TGBB 3BKCH 3QPQC 3TVMC 2CJUH 2FSEA 2XKNB 4Z76B 4P23C 3GJFA 3V8CA 1NFKA 3LKSB 1BEYL 1NC2D 4IRSC 3P3YA 1UKTA 1GHFH 2P8PB 2R0KL 1XF3B 1IAKA 3IFOA 4MNGA 4QRPA 2BVQA 2ZKHL 5F88A 4E5XA 2OK0L 4G8FB 5T1LD 4X6BA 5IHBA 3NZHH 1CL7H 2DQUH 1U93B 2MHAB 4MQ7A 1NCAH 2BSSA 2QQQA 3DX6B 1SYVA 3F12A 3O41B 1LO2H 3C5ZB 4DGYL 3V0VA 1NCBL 3WEXA 1DE4B 3OGOE 3RL2A 5HVHC 3S97C 1CE1L 4HWNA 2ARJA 4M48H 1X9QA 1BAFH 4W81A 4D9RD 1LEKB 4WFEE 3EZ8A 4G6AC 3QQ3B 5AG9A 3KLHC 4L3ED 1CFSA 1CFBA 3CX5J 1U8QB 3IRPX 2X1QA 1GGTA 2FHFA 3CFCH 5D9SA 5L8LB 2CKNA 1BM3L 1P9MC 4HPYL 3WFCL 3H0TA 1MCKA 2Y25A 4LLWB 3SQOL 2WANA 1RZIB 2OI9C 1FZOB 4X9GA 4PRPA 4M6NH 1A1NB 1QFWM 3EDEA 3O9WA 1I1AC 2BVOB 3VXQB 3E8UH 4ZPTA 3TYFB 5BXFB 1J05A 4R2GC 1MVUA 4ZMAT 4LU5L 1MH5B 4BQCA 3SGDI 5C0BE 2GK0A 3PWJB 3R1GL 3MLUH 2DTSA 1NGPL 3GO1H 3IF1A 5DD5H 2OJZH 9CGTA 3QEUA 3BQUC 4GRLD 3ZTNH 2H45A 1B0GA 3LEXA 3L3DB 3DUSB 4M1DL 4QRTB 1A7PL 5E8OA 2XTLA 2E7BA 4NGHL 3VW3L 3BWAB 3MRKB 4KZDH 3R4DA 3MGOA 4AQOA 2YEZA 4F37F 2XTJB 4PJBE 1AHWA 1LK3L 4NNPH 1WAAF 3UYOD 1OPGL 3C2AL 1F4AA 3ULUF 3OR6A 1D5ZA 1DEEB 4KPHH 5CWSA 4O2EA 3KGRA 1KJ2L 4HKZB 1EHXA 4K8RL 3WD5L 3C5JA 5HGHA 3H7BB 2GY5A 2BC4A 5LAXA 3MRMA 2ZJSL 1EK3A 2ORBH 1P84J 5EN2A 4YHNB 3LH2H 1UWGH 3H9SD 3IDMA 4OFIA 4U1JA 1F4XL 2A9NL 2EIZB 1U58A 3B2UC 3WFEL 5EB9A 4C59B 1ADQH 3FB6A 3LKOA 4NYLB 3D0LA 2VOTA 4KVCL 3P9MA 3HE6A 3BW9B 2IADA 3C6LD 3HFMH 5I73B 2DN7A 2MFNA 2APXA 3A67L 2XOTA 5I75C 4NRZA 3QHFH 3TLRA 5I66A 4XCNA 4J3TA 3RL1B 1P2CB 5LCVH 1G7PB 5IFJA 1U8PA 4P2QA 1HNFA 5L2JA 2IQ9H 4G43B 4FQ2H 2VH5H 5C2BH 3W5MA 1QFUH 5K93A 2VO5A 3KYNA 3HE7A 2AEQL 4Z7UB 4F33B 2FBJL 1F3JA 2E7LA 3BKML 3ZL4H 2FEDC 3OZ9H 1YYMH 2VLMD 5C0CB 1A14H 1J86A 2AEPL 2VXTH 1F3DJ 4P5KB 4S2SB 3VGFA 4NSKA 3D85B 4NBZB 1YMMA 1SMAA 4LSPL 2LVEA 3DV6A 2Z91B 3SDAC 4HCRH 4PYHA 3GKZA 4ZS7H 2D7QA 3EDDA 4ZUTA 4F9PA 4EI5C 3TWCH 5JHDE 2PR4L 3C60A 4KI5F 4NJ9H 1FO0H 3O6KL 2CRIA 3ARFC 4RQQB 3TJEH 3UJIL 1P7KB 3A6CH 2R9HD 1ZSDB 4HUVB 4Z7OF 1K5NA 3UYRL 5EUOA 5I76A 1AGCB 4XP9L 4LPYA 3F58L 2VMFA 5AG8A 1IGJB 3SKOB 1JTPA 4OD3L 2X4SB 5H2BB 4TOYL 1WC7A 2ERJC 2DI8A 3U4AA 3ZYJA 1MCOL 5FHAL 1IE5A 4OLWH 4UMGA 3WCYA 1H8SA 1QD0A 1FLRL 3RWJB 5MEQB 2RAMA 2K7QA 5H94B 4RDQG 4CKVX 5JW3H 4GRMA 1UWEL 4PJFF 2W59A 5C09E 4G80A 4U1GB 4F7TA 3LSOB 4YHML 1RZJH 4I4WB 3BH9A 2AS5M 4MD4B 4XWOC 5J9PB 2XTJD 5EPMA 4S10A 5EOCL 5MP6L 1S7VB 3VXSA 5KSVA 1ZGLA 2DBLH 3BHBB 4YR6A 4H25B 2F53E 4CW1B 4K71B 1PVHA 4EZMA 4JM2A 1SM3H 2HKFH 2RFXB 3AY4A 4G7YH 2IWGA 3L7FB 3LPWA 3CX5K 3RNKB 1NBYA 1TZIA 1WJ3A 3OKDA 1ND0B 4JHBA 5F8RC 4YXLL 3S98A 2VWEC 4NO0A 4ZD3H 4W6YB 1G9EA 5ITFA 5IB5A 4LF3B 1GH7A 2OTWA 3RGHA 1V7ML 2CIKB 1ZTXL 2VLLA 1BWMA 4LARL 4YDJB 4NHCH 1NH6A 5E1AA 4GKNA 2CDGB 4QRQA 4P3DB 2CUHA 1HE7A 4LVHC 3FRUB 2DQGH 5EH1A 4YJZL 3BD3A 4FQ1H 3W9EA 1SVZA 2LTQC 4FQCH 2B0SL 3VI3E 2C3HA 4Z7VE 3AS3A 1MAKA 4IDJL 4G8GE 1U0QA 5CJ8A 2PCPB 3UBXG 2DMKA 4JDZA 3UDWC 3ULVH 3NBNA 2F5AL 3IGAA 4YHKL 4GUPA 2FJFA 1GVIA 5BV7C 4XAWH 3WIFB 3U7YH 2ZCKL 3MV8B 3MV9E 3V6FA 3UMTA 4Y5XB 2YWZA 2A0LD 3V5KA 3J8F7 4X9FA 1QSEA 4FQJL 5CEXB 1FVDA 4U0RB 1ZA6B 2NY3C 4LAJH 5GSRB 5C0CD 4FZEH 1D6VL 4MMXC 3MLRL 3DHMA 2XZCL 3D85D 1U2HA 1NAML 3WKML 3RIAK 1G9NC 3VXPA 3X13A 5T5NF 4OLUH 2FO4B 4G7VL 3SJVA 4GG6B 5KSBF 1XGRA 2EEBA 4Z7QE 4R7DB 1QNZL 5F3HA 1MHPL 2WIIA 2Q3ZA 2CR3A 5E03A 2KZ1B 4KTDH 5JA8B 2ITCA 3GK8L 5B8CA 2WP3O 2X4PA 1QO3A 3CVHL 2EDLA 4KJQC 3LEYL 4R4FH 2X42A 1U95B 5D7JB 4ZQKB 5ESAB 4HWEL 4LLUB 4UV4H 1CWVA 3MR9A 3T8XA 4MA1B 4MJ4A 3T2NH 4M93B 4TTDC 4Q9QL 4XRCB 4R97C 4FMKA 3GUTA 4LEXL 3KPMB 4OZHB 3WNNA 1OCWL 5EO1B 4O2CB 4PGJA 2HAZA 3ECBA 4U6XA 5C0AB 3DUUB 4PJHB 3ZE1F 3MNVA 4LKXA 1Q0YL 1T2XA 4XAKE 2XA8L 1AD9B 2HT3D 4NQUA 1VDGA 4ALAL 4PREA 4HUXA 4NM4H 1YEFL 1Y18A 4I9WD 4GKZA 2CMRL 1JTTA 1ZGLP 2FECI 5I19H 5F71A 2F9BT 2GUOA 5F89A 3BE1L 2Z93B 4YK4C 5J57B 5D7KE 5FAAA 5IR1A 1WVZA 4L4VE 4DQOL 3GSOB 5DJ2B 5GGUB 1YEIH 4ZUSA 1RUQL 1KB9J 2GSIA 1VKXA 1FPTH 5I8KL 1EVTC 3ET9F 3SE4A 4K7PH 5LVEA 1MUJA 1FJ1B 1UB6A 4Q6IB 3O8XC 1XR8A 4HHAA 1D5BA 1XF4A 1Q9KA 1G7QA 2GI7A 5GGQL 1FFOA 4J3UA 4RGNC 3I2CL 2WBJC 4XVUC 8CGTA 1H5BB 1T1WA 4PRDA 2DL9A 4NQCE 4OLZH 5DD0H 4D9LH 4XTRC 5B21A 3QO0A 4POUB 1NUDA 3NCJL 3IKCA 5DVKA 4LCCA 4Y2DA 3IDNB 5DDHA 2FB4L 4PR5B 2YBRB 4X99A 4D9QE 5JXED 3KYMB 4JY4B 5SX4I 1KIQB 2R0ZH 1HSAA 5CHNB 3QI9C 4ELKA 4I13B 4KKNA 3B6SB 3HCVA 5FO8A 2BDNH 1OGTB 4PRPE 2J8UA 3DRTB 5SWZE 3FQWB 32C2A 4BJLA 1YEEH 4UT9L 2CIIA 4CVXB 3BOVA 4H88L 1DUZA 4HMDA 4OV5A 1IGYA 5C6TL 1F4WL 1VGKB 1CS6A 1JGUL 2R2EB 4M43L 4CDGC 3CFEA 2DDQL 5EU6B 3T2QA 1CXIA 3MV8D 1CXKA 1FP5A 2NQCA 5GISH 4PJCE 5J89A 5LBSH 1A7QH 1WEJH 4EI6B 1OAYL 3MRPA 4ZPVA 2EYRA 2VISB 1M1SA 1H3PH 3QHZH 2VDOL 3L5XL 4QHKI 3VFTA 5SWSB 3BSZL 1OOAA 2VAAB 4JFPA 4M61A 1R3IH 3DX7B 4YIQA 3QIBB 4HZLA 4X8XA 4WO4C 3ZDZF 5CCKH 4TVPD 4EBQL 5E1HB 4S1QL 5J3HD 35C8H 4CMMA 3VFUB 1FL3B 5BRZA 1ZT4A 2YD8A 1JGEA 3B4NA 2JJSA 4OLXL 3PWPA 1GGIL 2ARWA 3N9GL 2WP3T 3TPUB 2P24B 4LSSH 5D7JD 1NBQA 1KJMB 5D6DC 2VUOA 3RVUD 1BBJA 3P9LB 5IMLB 1NGWA 1RMFL 4HIHA 1WV7T 2HA1A 5IIEB 1NC4B 4WI6A 4MAYA 3V9FA 1S8DB 4QOKA 2IBZY 1IEAA 1Q94B 5C0AD 1LK2B 1U9KA 5IB3B 4KDWA 1FG2A 2AERT 4P2QE 4QY8B 3RZCC 3IAQA 2EDBA 4GG8A 4NO2A 4ELMA 1BVLA 1R5VB 2W0KA 5DHXB 5D7IA 4AEEA 4HIEB 5DJDA 1X5KA 3W0WB 3X14A 2YHGA 4HS8L 5D1QA 2C3XA 1JFQL 2ICWJ 5EO9A 4R4NC 3W39A 4DFHA 4MNQE 1QLFA 1AO7B 3PHOB 5L6YL 3WNKA 4LCUB 1ZHLA 2D3VA 3DO7A 3DGGA 5HHVH 3IDXH 3Q6GH 1GYAA 5JR1L 3RUGA 5IUSA 3MX0A 3VE0B 3DX9A 3GIVA 1NEZG 4YAQB 4DKFL 2VZVA 2ZSWB 5JZ7C 1N59B 4FTVB 3U0TB 4HBQA 4K94C 4FQQA 3STLB 1BQHB 1N7MH 3U7WH 2V2TB 4OJFL 5FGSA 4KTEH 3LIZL 4PG2C 3HC0B 1D5MB 1TZGH 3FN0L 5B3JE 2P5WA 4NM8L 4OCRH 1ZMYA 4PJEB 1AGDA 4H1LB 3GNML 1Q9WB 1DQML 2YXMA 1MAMH 2R0WH 1CDIA 2ATPA 3QNZA 1MCSA 2DLHA 3OKKA 4GSDH 2ADJA 4V1DA 1C12B 1HZHH 4G6KL 5SV3A 3K4DA 2B2XL 2YPLE 5FYKD 3QIWB 2DQCL 2GJ6A 2IANA 3GMRB 5EU6D 3G6JA 3FQXB 4ZAKB 2YPVL 3ARRA 4HUUA 3O3AA 5F3BA 1KB9K 5E7FA 2I5YL 5AZEL 1EA9C 3VG9B 3VFMA 1F4YH 2CR6A 4WFFE 4ODBD 1S7XB 4RNRA 5TE6H 2VWEE 4OLVH 4PJ9C 3F5WA 1KTDA 3D87B 4WW2B 2WLZA 2EIEA 4LLYA 5SWSD 1EO8H 2EIDA 3MLXL 3WIIH 3QIBD 5DUBB 2X4TA 4D3CH 2Z35B 3G5YA 4JVUA 3QIUB 4PGCA 3PP4H 4TQEL 5EOTB 4DVRH 1HHHB 3QFDB 1RIHL 12E8L 1T89A 1U8MB 3IU4L 4K2UL 2WWMD 3HI1A 5IJKA 4APQC 3O4LB 2QR0B 5JQ6L 3U48A 4B41A 4EDXA 3WHXA 1MJJA 1FN4A 3MBEA 5EWIH 4HFWA 5CJXA 1MJUL 4GAJL 3KR3H 2YUWA 2FX7L 1IMHC 4L8SC 5MI0C 5EUKB 5ETUB 1FNSL 5DWUL 5F9OH 3RFZC 3BKCL 4F7MA 5DZLA 2BK8A 3IJHA 2AXGB 4KHTH 5HHNB 1NC4D 3VFNB 1U8IB 3QWQB 3SKMA 2VLRB 2KUTA 4HWZB 1FGVH 1A6AB 5DRNB 4ZOBA 3KPPA 4RDQF 3LY6A 1S3KH 1RULH 3GHEH 4PJAA 4LMQE 5EG6C 4DOHE 3NZHL 2DQUL 5F7HA 4L3AA 2XXMB 2DLIA 1C8PA 5FUOH 3W0WD 2J1KA 3HAEA 2BHUA 3EFDH 1OGAA 3X3FH 5MENE 2NTFA 2VDKH 2EDYA 1MRCL 3RWIA 1RK0B 1AO7D 1WZ1H 1A02N 2C9AA 5F7KC 2A38A 1BAFL 4HLZG 1F45A 5GJSL 2ESVE 4J23A 2A6DA 1G7HB 1ZOXA 1PKQA 5T1DH 3WUZA 1MHHB 2CO6B 2FZ3B 3I6GA 4OQ1A 4F58H 2BNQB 3CFCL 3MGTB 4FTVD 4RMSA 5ABDE 1FFNA 2VDQL 4L9LC 3MROA 3TIEB 3EW3B 3FQRA 3NCCB 3RIFF 2JCCB 4MGXA 2VLJB 5D1XA 1SEQH 5BS0B 4LRIC 3T0XA 3CK0H 1A3QA 4TVPL 4HLZH 4IRJA 4PGBA 4PJ5B 4OF6A 3O45A 4WFGD 1NANH 1L6XA 2X1PA 1MCNA 2BNRB 1VENA 3JWOH 4WV1A 4D0DB 5ID1B 5I2IB 2HTKC 2OJZL 1JUFB 4NPYA 4MCYB 3NH7L 5HYSB 4UOW1 4XP6L 1Q9OA 1IAII 3ZTNL 2VDPL 4KK9C 1PDKA 1QSFE 4J4PD 5EO0B 3HNSL 5IW6B 1PAMA 4PB0L 3EO9H 1MCFA 3QIWD 3MRCB 1ZHKA 4X7TA 4P49A 3KYOB 4ZAKD 5FO7B 4HPOH 1CGXA 4KVNH 1BQLH 4XP5L 5E9DE 3C09C 4DUVA 4JPVL 4Y16B 4NNPL 4XH2A 5E56A 2LFGA 2R15A 4FHBD 2CKBH 3FQTB 4KMTH 4L8CA 1WBYA 2VL5A 2OL3B 4MXWH 1N8ZB 3QDJE 1A7OL 2AJYL 1YEDB 1P4BH 1JL8A 3S37H 3CFBB 5GRJL 1OF2B 3BN9D 4J3XA 1I3VA 3LH2L 4XB7A 1NSNH 1O5DT 4MA8H 5DA4A 5K33A 3B2VH 1EJ6A 1UWGL 3CCHB 2VRAA 4X4XB 1BBDH 3L7EA 1ADQL 3O4LD 2C5DC 3IFNH 3NIFF 5MEPB 3SDCC 1INDH 1NGXB 4KC3B 1H8NA 1U8NB 1RY7B 2H26A 5CAYB 2YD9A 4MB5A 3MRGB 3ROLB 4EQ3A 3U6RA 5LQBH 3E2HB 5LCVL 4KRPB 1REIA 3C8HA 1I7RB 2VLRD 4HGKC 3GSRB 1X5FA 1R0AL 2XWJB 4FQ2L 5E5MB 3H3KA 2R69H 1QFUL 3QSKB 3BUTA 3U46A 4JFHD 5I8CB 4NFBA 5C70A 4YZFE 2KBGA 1AC0A 3WLWD 4I18A 3GSUB 3V4UL 3VXUA 3V8OA 4IMKC 3ZL4L 3OAZK 1UEYA 3OZ9L 1FE8L 5CD3B 1EXUB 1T20B 3D3VA 4PRBB 5ENWB 4R26H 4HJJH 1KFAH 4DZ8A 2V2XA 4ONFH 4F7EB 1OTTD 5C0BB 1I1FB 3SE8L 2CDFA 4H5SB 4ZS7L 1QFWI 5FYKL 3PXJA 4PGZA 4CU8A 1K6QH 4JLRA 2DKSA 3GFUA 1WWAX 1A3RH 3FHAA 3ARZA 2AXFA 1I7ZB 4NJ9L 5MHSE 2BNQD 3BXNB 4U05A 3HUJA 3TJEL 2GTWB 2V9QA 5EU5A 5J1TC 3A6CL 5BRZE 4OZIF 4PJBB 4MAUH 1YJDC 3LV3A 3IDJA 1A7NH 4U1KB 2VLJD 2MTPA 4NNYB 1TTGA 5D1ZB 4Y19E 5BS0D 4HIIA 4OI9A 4HK0B 3TCXA 4ZTOH 5CBAA 3UZQA 3GJFH 4KKBD 4P59H 1EEUA 2QHLA 4Q7DA 4PJ5D 4PG9A 3S88H 4OD2B 1A5FH 4XC3L 1RI8A 2BNRD 1PLGL 4JY6B 2QSTA 5SX5K 1N5YH 4OCNC 3VH8A 5JW3L 1IKNA 5TDNA 4YDVA 2V5YA 5DI8A 1G7LA 5KSAA 1HKLH 5FDWB 3H9HB 2PYFA 1UJTA 3KDMA 3ZHLA 4JFFA 3VXOB 1GRWA 4N0UA 5D7IE 3TP4A 1VFBA 3RVXD 4Q0XH 3STZB 1K4DA 5F8QC 4ODXA 4Y16D 5LXGH 1AE6H 3GSXA 3CPLA 4X9HA 1S9VB 4CGTA 3L1OL 4H20H 3CLFL 3ARGC 4MX7A 1A3LH 1E4XI 2X4UB 5D2LF 1FYHB 5DQJB 4N0CD 2AJUL 4J2XA 4P2YA 3MA9H 3FO9A 1N0XL 5C08A 2OYPA 4OAWB 3RDTA 3TA3C 1UM6H 2IALB 3OMZA 4LIQH 3NFSH 4OGAD 3UO1H 1JNNH 4JHWL 4BUGA 1DQJA 3AGVA 1IZJA 1G84A 2HG5B 3CFKA 3D69B 4BSVA 3TBVA 1MHCA 4FXGA 3MA7B 4NOFA 2DQGL 3DYOA 4FFYL 1JPSH 3DRQB 3MXVL 2P5WE 4FQCL 3AAZB 5DMIH 4ZO6A 2HT2C 4UIKL 1MI5E 3AUVA 4QLRA 4KRPD 5JHDB 4P9HC 2DWDB 1MRFH 1C5CL 2OSLA 3ULVL 3NACH 1IBGH 1IGFL 1DQDH 4V1DE 1BIIA 3MOAL 2P46B 4XAWL 3U7YL 3O3DA 1BHGA 4X6CA 5DFWH 4EUPA 2AJXL 5AUMB 3EO0A 5EOQH 2CLRB 3G6JE 1I9IH 4TSCL 1WBXA 1J8HA 3RX7A 3ILQC 3SDDC 4XPBH 4O00A 5HY9B 4UI2A 5FGCE 3W2DL 4HKBB 1UYWH 3N1GC 2H2SD 2WNGA 5GS1A 2ID5A 2I60H 5C0BD 1TJGH 4I3GA 3HLAB 4QHLA 2AJSL 4L8BB 5F7DA 4LGPB 1JWMA 4JJHA 4X6DA 5IVXF 4M62H 2YRPA 2DYPB 4X6EA 1TVDA 1FL6A 1FCCA 3CD4A 3EOAB 1QVOB 5EC2B 1UGNA 1UB5B 2O5XL 1NKRA 4OZGF 1CFNB 1FNAA 1UZ6E 2O5ZH 3EGSB 4FFVD 3EO1B 3SKNB 2DLGA 1GZPA 5HVGB 1NJ9B 4R4FL 4XZUA 1A7RH 1M05B 4O9HH 5J4MA 1BD2A 3MRNB 4UV4L 3VGAC 4ZFOA 2H2PC 2F53B 3BPOB 1FYTE 1I7TA 2E27H 4P46A 4ZXBA 1S5IH 3VFSB 5D1ZD 2CRYA 1IM3A 3GSQA 3RVWC 2AJ3B 3T4YB 5K9OB 4Z77B 2G75A 3GKWH 3O2WL 4R3SA 4PRNA 4JQVA 3WS3A 3STBA 5AEAA 1AJ7H 4AENA 4Z0BL 5LGJA 4WU7B 5BZWA 1NL0L 4NM4L 4PP2A 2VR9A 3S7GA 4NRXB 1KUMA 4GAGL 2X1XR 2UV3A 4U3HA 3RWEA 3G5ZB 4TPRH 3QNYB 1VPOH 1CXFA 4LMQI 3L9RA 2BOCA 1GC1H 5ERWB 1FPTL 5T5FH 4L29B 4NUGH 5ADOH 4N1HB 3M17A 2UZIH 1OB1B 4W6XB 4QRUB 4G5ZL 4TSBH 1W0VA 4Z7VB 3FT3A 3LAFA 4PRHA 5TDPA 5JPNA 1ITBB 2J12B 5E4EB 1DBJL 4M1CC 1RZKH 4P5TA 2PW1A 3OV6A 3NMEA 3P73A 4W4OC 1YMHB 2FCBA 2W9LA 3QUXB 1PKQE 3MV9B 3C5SA 1C5DA 1HHJB 2IAMB 4RISH 4C56B 4DKDC 3EBAA 2AKRB 1LO4L 2Q7NA 3J7HA 1I1AA 4PJ8B 1BFSA 3I50H 4YO0A 1SJXA 1HQ4A 3DO3A 4F37K 1YA5A 3DMMA 3DSFH 1XGTA 3OL2A 2BDNL 4JFOB 5HSFA 5TE4L 1A21A 5HDQL 5DTFB 1INQB 3MJ9L 5L2KE 4OBSA 4RFNC 3IVKB 2VDRH 3ZKMD 4TYUA 4U1HA 3VG0H 4MCZB 4NKMA 1E4WL 2BMKB 2DTMH 4RWHA 3TM6A 2XIDA 3H3PH 5C6WH 1F97A 4MD5B 5JHDD 3VXRB 2VXQL 2FHBA 4P48A 4Y89A 3BGAA 3MACH 4JKKA 4M8QA 4GBXC 4XP4H 1X5JA 3CUPA 2BOBA 4UT7H 5ID0A 1X4XA 2DQIH 4RZCB 5GISL 5IHZA 5FKAA 1EHLL 3BN3B 5IBTH 4FXKB 4N0RA 4IRSB 4DGIH 2ICWA 3U82B 5C0DA 3CC5A 1BFOB 3BPNC 3DIFA 1TCRA 1P4IH 4QEGA 5DMGC 5DMYA 1B0RA 3S34L 5I6XC 4ORGA 3X11A 1P4LA 4LVEA 5KVDH 4D0CB 1MEXH 4W68A 2C3WA 5GGVH 2DYPD 2QHRH 4UTBH 4BK5A 3HZVA 4LCWA 1IAKB 5H35A 3IFOB 4MNGB 4QRPB 5CSZA 1TNMA 5F88B 4E5XB 2P1YA 1E27B 4X6BB 1OM3H 1UH3A 2XNAB 4L4VB 1BFTA 2OL3L 3QUZC 4MQ7B 1S7WA 2Q8BH 1TETL 2F53D 1SYVB 3AC0A 4ODHH 1D9KA 4KU1A 3HR5B 1DFBL 4IM8A 2Q8AL 3V0VB 3WEXB 3CLEH 2FECL 2Y07H 2BRRL 3RL2B 1IARB 4UQ2B 3B9VA 4AL8H 1AR1C 2A74A 4WWKA 2FEEL 5CSGA 1W0YT 3FB5B 4NQCB 3C6SA 4M3JA 3DYPA 3O2DA 1IGIH 1CFSB 2YK1H 5D9SB 1L7TH 3BP6B 4WDIA 3L95A 5C7XL 3HHRB 4FA8A 5DT1H 4PRPB 4AIZB 5HVWA 5DQ9B 1OTSD 3EAKA 4RBPH 4PJXF 3D3VE 3KPOA 3TGXA 3OAYK 2H8PA 1J05B 3IRZA 4HWUA 3R06A 4N0YH 2V6HA 2QADB 5HHVL 2ZOLA 1PZ5A 4HUMB 4KAQL 4UOJA 2GK0B 2Z8SA 4IEFB 4KKCC 2DLEA 1IJ9A 4N0FB 3VMPA 1IC5H 3VFPA 2CUIA 3MJ8A 3U9UA 4MXVF 3QUXD 3UTTA 3L6FA 3MV9D 4JFEE 1GZQA 1OP5K 3S96A 3L5IA 2IAMD 2WINA 4PJCB 5E8OB 3SCMC 2R29L 1U8HA 3HUJE 4IOFC 3LDBB 4PJ8D 2UZYB 5I18L 2YEZB 2VC2L 3E3QC 1GGBL 2HMIC 4UUJA 4DN3L 1NFDA 1JGVH 2IG2H 4L4TE 4XT1C 3OR6B 1D5ZB 5CWSB 4O2EB 1TQCB 4K8RC 4NQSA 1MAML 2R0WL 3C5JB 4JFZH 4JZJA 4ETYA 2LU4A 5EU4B 2BC4B 5I8EA 1DN0B 3VGHA 2DRUA 5DJXB 5DJ8B 3MRMB 4LP5A 5B4MC 2V5MA 4PJ7E 3JVGC 4ODSH 3VXRD 1WWBX 5EN2B 4GFTB 2P8LA 5J11C 1G6RA 3IDMB 4LPVA 3QPQD 2NY4C 3KPNA 2AAVA 1JRHI 1E4KA 4HUNB 2NCMA 1F4YL 4P2RE 5EZJA 4MYWB 2A6KA 4IRSD 5DGQA 3FB6B 1UH4A 2Q1EA 5TE6L 3JWDH 2X1OA 3D0LB 4JFFE 4N0UE 1EEYB 3P9MB 1WCBA 4OLVL 2IADB 3B9AA 3AS0A 3LD8B 5BVPL 4IMLB 1EO8L 4NRZB 3V5HB 5I66B 2OTUA 4LSVH 4XNUL 4XAKD 5GS0D 1G1YA 5IFJB 1U8PB 1AGEA 4P2QB 1KT2B 1FFRA 5C9JA 4U7MA 3PP4L 5FOBB 3P9WB 2X4NA 3VDAA 3ZDXE 2BVTA 5I30H 4QRPD 3KYNB 5J12B 1JV5B 4Y5VC 5KAQG 4L4VD 5EWIL 5GGRA 3KR3L 5F7YC 4G6AD 5GZOC 2N7AA 3ZKQD 2ZUVA 5IFHH 3MLZL 2N56A 2YD7A 1UWXK 4Y4FB 1YPZA 5F9WC 5FUZL 1T0MA 1OAQH 4NQXA 5EBMA 1KPUB 4J8RA 1I1RA 3GJEA 4OLEA 2CGRH 5FV2A 4KJWD 5AAWA 3KLAA 2UWEF 2ADGA 4ZUTB 3PJSA 4X98B 4NQCD 4H1LG 3ESUF 3SGKC 2XN9E 3C60B 3GHEL 5KS9E 3CDGA 4D9QD 2APFA 3RI5K 5E8NA 1MCWM 4JJ5A 5FUOL 1P6AB 2ADFL 1K5NB 2Z4QA 3WV0A 4FG6C 5EUOB 5I76B 2P5EA 1J8HE 4PRPD 1HHGA 2VDKL 3K81A 5SWZD 3JZ7A 1L9MA 1MY7A 3MRFA 2X4QB 2F54A 3T1WA 3HNVL 3PWVA 1WC7B 1S78C 2QADD 5T1DL 3FZUD 3O3UN 4X6DE 4MQSB 4EIZC 2YPLB 5GRVL 2NY0B 2HLFC 1SY6A 1MFNA 1UZ8A 2YKLH 3FRPA 2GSGA 4JG0H 3WFBH 4G6ML 2ZG3A 6FABH 5KOVC 3N85H 3L5JA 4E42A 3ES6A 4NZUH 4X7EC 1BD2E 1U8KB 5KSVB 5HI4D 4YR6B 2V7HA 4LLQB 2A9ML 4OCYH 5F9DC 3DX8A 3BDBA 5C0IA 4NCC1 5C0GA 1HQRA 3QWOA 3CSGA 1PX3A 3RHWF 3JWOL 5IKCA 2FR4B 3HMWL 2P48B 4QRSA 3SE9L 4RGMC 4P2OB 1NBYB 1TZIB 4PLOB 5ALBL 4TULH 2V7NA 1N64H 5ITFB 5F6HJ 1IGTA 2LTQB 3BEVB 1EZVX 1MFDL 2OTWB 2B4CH 5CMAA 25C8H 4XVJH 3ZT6A 5E1AB 4BQBA 4GKNB 3FTGB 3GI9H 3H42H 2R1WB 5HGBA 1PKOA 4JZNA 1ITCA 4OFDA 4MXWL 4Z18A 3I3EA 1U92A 2ZZUT 3BGFC 5F70A 3W9EB 2Z0BA 1MREL 1P4BL 3BO8A 2YSSB 4XPGH 2XKUA 2FEDD 2MKLC 1CICA 3GMNB 4GOSA 3HPLB 4MA8L 5LKNA 3KS0J 4P2QD 5DSCB 3T0AA 3FFCA 3WIHL 4KZEH 1RUAL 3IGAB 4Y1AA 1IC4H 5ACMA 4GUPB 4DOHB 1BBDL 1CDUA 3MRDA 3PHSA 3Q2CA 4MLIA 3V52L 3QI9A 1RZFH 2CLZB 2YA1A 1QSEB 1GOFA 5FGBC 3DI3B 5MENB 1FVDB 1R5WB 4EI5D 2Q7YA 4JKMA 5CINH 3VRIB 2OTPA 3TBWB 1YY8A 3U4BH 1LO0H 4LHQB 4WCYH 1HHIA 4Y4FD 1WAAA 4M7KH 3MPCA 4GRLC 3X13B 3U9PH 4YHZH 1W8OA 1K8IA 4YXHL 3SJVB 4CADA 1TDQA 3UTZA 3K8MA 1URLA 3SBWC 1YC7A 2R69L 1Z3GH 2R1YA 3IXTA 3SKJH 3SGEI 3EKCA 2ZOKB 4QTHA 5GSVB 3C60D 4JCMA 2WIIB 4ZFZA 2XZQL 4YBQD 4XNYH 1ZWIA 2ITCB 5HYSG 2EE3A 2X4PB 1IZKA 1JGLL 1KFAL 4PJIE 3RY6A 2Q3AA 5DUML 1JPST 1WTLA 4UDTB 3MR9B 4YHIA 4O5LH 3T8XB 3T0BA 1I4FA 3O3BA 1CFVH 4BQ9A 3LHPH 1NMCC 3IDYB 1SQ2N 3HA0A 5IBUG 4A6YH 4NKDA 3O6LH 1C5BH 1W72H 3ECBB 3K1KC 4U6XB 3U30C 1MFCH 4AH2A 1QSFB 3MNVB 4LKXB 4ZUWA 3AM8C 5FA3A 2YPLD 5DVOA 5GGVY 1DJSA 3HG1A 1INEL 4YNYA 2LU7A 4XXDA 2NY0D 1KENL 1RJYB 3L3KB 1HYSD 4HUXB 1TVBB 2VR4A 1KPRB 3DTXA 1J5OL 3C6LC 1A7NL 2VQTA 5CP3A 4ACPA 4WFFD 5B38B 1L7IH 2GJZB 1IAIL 5IR1B 1E6OH 1QUNA 5GS0L 1X5ZA 3T65A 1I8IA 2GSIB 1VKXB 1A6UH 1SMOA 3QRFM 1XR8B 1NCUA 4NKQB 5C71A 4IOIB 1MCPL 3EIFA 4ODUB 3RZCA 1XF4B 5D72L 4P2OD 2FX9L 5EZOH 1G7QB 1RIUL 1ERNA 3PWUA 4OZHF 4O4YL 4PRDB 3LS5L 3IKCB 2WWKO 3HAEH 3T3ME 1JK8B 4LCCB 4Y2DB 2WZPD 5KOMC 1AY1L 3C5ZC 3CDCA 4X99B 3T0EC 5A1AA 1EGJA 4NJAH 4M1GH 1HSAB 4BFEA 1I7UB 4ELKB 3TV3H 5LXGL 3QZWA 4M5ZL 2XQYG 4JKLA 32C2B 5JLZA 1VSCA 3BP4B 3RAJH 2CIIB 5DUPH 1ORQA 2KDGA 1RURL 1A3LL 1DUZB 2P45B 4S1SH 4YFLI 3QEQE 5D5MF 4JO2H 1FBIH 2R9HC 3FO1A 1K85A 1Z0NA 1KIPA 4YHYB 4UV7H 1TZHB 4UQ3B 1ZLWK 4GMSH 4ODVH 3QEGH 3BZ4B 3RBSA 5ADPH 1CK0L 4E41E 4PJFA 4WO4B 2FGWL 3UO1L 1V7NH 2XV6B 3RJQB 5DEZA 4NZRL 1J1OH 2E8ZA 3QXUA 3OJDB 1QSED 2A73A 5MEND 1AQDB 1UJ3A 2F15A 2EO9A 4OCXH 2Y9RT 5D70L 3U1SL 1F42A 2EYRB 4DWHA 2WUCL 4CRPA 1JZ5A 1PX4A 3GRWH 3VFTB 5DJZA 5DMIL 3PP3K 4BQ6A 1RHHA 2ICEB 4PFEA 5T3XE 4JFPB 4M61B 4YFEA 4YIQB 1J11A 4XCFH 5FECB 3OGCA 1KF9B 3SJVD 3V6BR 4BSWA 3D0VB 4PUBH 1IBGL 1DQDL 3MFFA 1EAPA 3VCLA 4GJTB 5BRZB 5JIHA 2XTJC 1JGEB 1ZLSH 4LL9A 4XMKH 2OQJB 4HK3N 1F3DH 4EKXA 1I9IL 4LQFH 3E1F1 3PWPB 2DM3A 1ED3A 3FCTB 3BPLC 1EVUA 1CGYA 4XPBL 1UVQA 3TO4B 4Y19B 1M71A 4NO3B 4B50A 2CXKA 2R8SH 2NY7H 4Y4KA 3ZMRA 1UYWL 2VN4A 1NGWB 2W38A 2D03L 3EYUL 1HXYB 4JPWH 1TJGL 4XVSH 1EO5A 4M03A 1DANU 4WJ5A 2BY1A 5BO1L 4MAYB 3NIDF 1IEAB 1Q1JH 4G6JL 1QSFD 4NQDE 1EEZA 1PG7X 4LHJB 3MOBH 3F62A 1IQWL 1FG2B 2O5ZL 4GG8B 1BVLB 3WFHB 1YN7A 5D7IB 4JO1H 3TYGH 2BY3A 4P4RA 5E9DD 3X14B 5L8JB 3MRBA 2E27L 2ZUSA 3O3EB 4XVUD 3U4EB 1CLOH 3PQYA 5E2TH 1VFAB 5EO9B 1DL7H 4LPCA 1JPFB 3W39B 5HYJE 4XC1L 4EXKA 3LQAH 3EYOA 1LDPH 1ZHLB 4OUUA 3DGGB 2FX8H 3D39A 4WI7A 3ARTA 3BGMA 4OQTA 3O6FA 2H1PL 3TH3T 2A0LC 3GIVB 1G7IB 1CGSL 5DF0A 1CI5A 5I1IH 1BIHA 3IS0X 4FQQB 4H0IA 4TPRL 4AJ0A 3TJHD 4J6RH 2WWKT 3RIFK 4Y2DD 1E4XL 2LE9A 3BP5A 1T7VA 2AK4E 3WL9A 4AMKL 4U1SB 5DHVH 5DD1L 4X7FC 2P5WB 4XNMA 5ADOL 4WHDA 2CRZA 2UZIL 1AGBB 1S7TB 3BYTA 4CUCA 4AT6A 1AGDB 1MI5B 5KSUA 2F54E 4JFXA 2BP3A 4WTXA 2NY5H 2JJTC 4EOWL 1NMBH 5C0NC 2L0DA 3OKKB 2ADJB 1U41A 4V1DB 2AJVL 1T0PB 4GW5B 4RISL 4TNVF 3G6JB 4ZS6C 4I0CC 2VZ3A 2V17L 4K3DH 1A7BA 2V9TA 3I50L 3O3AB 5F3BB 4NDMA 4WO4D 4LRIA 3VFMB 4YE4L 4YQXH 1HILB 5FGCB 3ZKXB 5KAQF 1EPFA 2ZCHL 3RJDA 4BM7A 3ZSSA 5IQ7H 3EHBC 4XNXH 2VDRL 3NGBB 1MCCA 3F5WB 1KTDB 4APQB 1FFPB 1MSPA 2IH1A 5BMFL 3B9KA 3ZKND 3PDDA 4EDWH 5MI0B 2DLFH 4U1GC 2X4TB 2HJLA 2X7LB 3MV7A 5FKPA 1O0VA 3MACL 4FFWD 1W2KT 4PGCB 1A6WL 4PJEF 5GRXG 4UT7L 5BRZD 2DQIL 5IW3A 3SPVB 3N0PB 3OKOA 3IFLL 5IBTL 3HI1B 1MOEA 1K3IA 1I85C 5EIQA 1FYTB 1WITA 3PWPD 1DR9A 4K71C 1MJJB 1FN4B 1I8MA 5DJYA 2BXZA 3MBEB 1LO5B 1MQKL 1BJ8A 1QKZH 4HFWB 4HUWA 1H9VA 3TO4D 4Y19D 1GOHA 1O7SA 1JZ8A 4ZSOE 2UYLA 4YXKL 4A2LA 3N06B 3QJHA 3IJHB 5GHWH 1KIRA 3H9ZA 4MAYD 4UINH 5GGVL 3SKMB 3E6HA 3G6AA 1OAKL 1VACB 4HEME 4WW2F 1RVFL 5BQ7A 3PWLA 1M7DA 4NN7B 3B3IA 3KPPB 1MCDA 5DEFA 4ELMF 5ILTH 1NGYB 3AROA 4PJAB 4CDHA 5E6ZA 1GGUA 5IG7A 1JNLH 4WWID 5IT2L 2XQBL 1YNKH 2X4OA 4QHNB 2Q8BL 4TN9A 4OF0A 4XPHL 1KBGL 3HAEB 2PXYA 1OGAB 2NTFB 3CLEL 1DZBA 4ODWB 4M5YL 2Y07L 3ARVA 3TH2T 5BW7C 4RMTA 1F58L 3LEVH 4AL8L 1CE6A 4B0MM 4ZTPL 1WAAE 4NC0B 4I0PB 4K3JH 1PKQB 2H32A 4HV8A 4EUPH 4Y5XC 4IBLT 1OAUH 1IGIL 3I6GB 1P69B 4IMKA 4BH7A 2OJEA 4WEBH 4U0RC 1BPVA 5F96L 4JG1L 1RIVL 5BOZG 4HC1H 3MROB 5IB4A 3QQ4A 1OSPL 3FQRB 3P30H 4DVBB 4HBCL 1B2WH 1FCGA 4HK3J 4LLMB 5L2KB 1I3GH 3QISA 4ZFGH 4KK5C 1PBYA 1LVEA 2P5WD 1NBVH 4H0GA 4NNXA 1M7XA 1XEDA 4X4MA 3O45B 5J3HC 2ICWI 5ANMA 1GJIA 1MI5D 2HFGH 2CLVA 1RUPL 4P9ML 3C8KA 4WV1B 4MD0B 2OMBA 3CSBA 3F7QA 4V1DD 1T7YA 1Q9OB 2OR7A 4R7NA 1IT9H 4XPTH 5D7JC 3RA7L 4DZBA 3PG2A 3T08A 3KPQA 3HG1E 3RVUC 4MA1C 2EC8A 1E6JL 4M93C 4JRXA 4GKOA 3BDYH 4RCAA 1CIDA 3PDOA 1B90A 2DJSA 5HHME 4MHHG 4Z8FH 4YBLB 1Q0XL 4XH2B 5T1KA 1WSST 3LMJH 5I74B 3PIQA 4ETQB 2JB6A 1JPGA 4L8CB 1WBYB 2Y23A 1R3LA 4EIGB 4APQD 2JCCF 4NQTA 3WXWH 1J8KA 5GRYA 3TZVA 3IXAB 3RWDA 4RGOH 4TUOA 1C16A 3VWJA 1IGMH 3T0EE 5E8DL 1AKJA 2DOCA 4QWWD 4L3CA 4Z0XA 3U2SA 2DICA 1ROWA 1LD9A 2RB8A 3C08H 3O2VL 4PB9H 1RAMA 2HFFB 3L7EB 4FFZL 3K8LA 3HRPA 4KI5E 1FYTD 4OM0H 1RK1A 3MBED 3DLQR 5HHOE 5IV2B 3K46A 2H26B 1PEZA 3SO5A 4HKXA 4N90D 2PTVA 4PJDE 4LSVL 4OGZA 4X7SL 1GOGA 4OIBA 4U7KA 4KJPC 3K8KA 2QTEA 5E2UH 3W9DB 4KQ3H 4O2FA 3VFRA 4LBEA 5I30L 3V5DA 5I9QB 2N1KA 1LO3H 4HCRA 4HAFA 2KQMA 1JYWA 3ABZA 5KVGH 4URTB 1NUFA 3VXUB 3TBYA 5TPWH 1JNJA 2WAHA 4PJFE 3D3VB 1FO0A 4OLYL 3MRQA 4DZ8B 1OGAD 3K4AA 1ZT1A 2XTJE 1VERA 1BJ1H 2CDFB 4UDUA 1KV3A 1HXMA 5C86A 2CGRL 3KLSA 4G3YL 2PW2A 4JDTH 1XIWA 1YZZA 4I0PD 4JLRB 3HPJB 4WEMB 1A64A 4JFEB 3P0YH 2AXFB 1U8LB 4S0TD 3QDGE 2EECA 1YECL 2YRLA 1NLDL 3HUJB 1FV1B 5EU5B 2HTKD 4U6VH 4H0HB 3CFDB 3HZKA 3IFPB 5CEYA 4L4TB 5I8OL 5DR5H 5JW5B 5L2KD 3HRZB 3QIBC 5ESQA 4JANA 4HIIB 1DLHA 1AI1H 5DJ6B 5CBAB 3LPFA 2HWZH 1S7UB 1FH5H 2B7DT 4L9DA 2M8XA 3UTQA 4PJ7B 3OXRB 2WWMC 4Z7WA 1F90H 5IROA 4M6MH 4WHYG 3F7YA 1VADA 3P11H 1PG7H 2AI0L 3KWWB 3QCVH 3VH8B 3FB7B 1IC7H 1NDMA 3M8OL 1T6VN 2FBOJ 4FQIL 3ARBC 6FABL 4YDVB 3FOLA 4P2RB 2KL6A 2PYEA 2PYFB 3QCUH 2IPKA 3KDMB 1FIGL 1CLZL 4JFFB 4N0UB 3MODL 4NZUL 3ZTJG 4MQXD 1K4DB 5IM7B 4ODXB 1MWAB 3TA3B 1T4KA 4HQQH 1KCRH 3GSXB 4AYFA 3B9EA 3W11D 4YLQT 4WU5A 3O2DH 3L3HA 4MX7B 1BFVH 1N6QL 5M94B 1MJ7H 3WFDL 3RDTB 1NCDH 3L5WA 3ZYIA 5KSBE 2VE6A 5L9DH 2B4CL 5CJOH 5HHQA 4M7JL 1KOAA 1ZLUK 4LNVA 5FDYA 3OAZH 5INCB 3QDAA 4XVJL 1HOCA 3BI9X 2B5IB 3CFKB 4PY8I 3QUMB 3TBVB 4BSVB 4FXGB 1PGRB 4F7CA 5C0EA 2E9JA 1HEZA 3MRIB 4YWGH 1QZ1A 3K2MC 1UCBH 5DJ0A 5FYJU 4IHOA 4R96A 1PQZA 5EZLA 3AU1B 2NLJA 4YDKH 2XN9B 2X2YA 3I3BA 2FWOA 5KS9B 3ULVC 3RU8L 2OSLB 3AB0B 1IC4L 2NZ9C 1BIIB 4YHOH 4YX2H 3Q5OA 3O3DB 4JO4H 4EXPX 1PYWA 1U3ZA 1RZFL 3MLTA 2K3TA 3WSQL 5EFIA 3EO0B 3HR6A 2HFTA 1WBXB 1J8HB 1FFQA 5TQ0H 5IJVB 3D3VD 1MQ8A 3CH8A 1LO0L 3NFNA 2YN3A 3GZKA 1LHZA 2ZUYA 4QHLB 4J4PC 2HH0H 1NGQH 5F7DB 4KUZL 1JWMB 4X6DB 3C9NA 3QIWC 1ZVSA 1FL6B 5SX5H 1G6RH 4XGZB 4ZAKC 3FFDA 3EOTH 1OAXL 4JFED 3JUYA 5EBGA 4KKLD 3VG9C 3MV7E 2XXCB 1FORL 5ESVA 4X6FA 1BREA 4EVNA 1RZGA 1U8JA 1HH6A 4L4JA 3QXDA 4XXCA 3PHQB 1GZPB 1HDMB 2IFFL 1EZVY 1I9EA 2EDJA 1BD2B 3LKQA 4WW2C 2JF1A 5KTEH 4HF5H 1G9MH 4O5LL 4ZFOB 1I7TB 2DBJA 1CFVL 2W1NA 3IYLW 3LHPL 4P46B 4L4TD 4ZXBB 3ZT5A 1DVFC 5BVJB 3GSQB 3BKJH 3K74B 2UY6A 2XICA 1ZXQA 1C5BL 3QIUC 1LILA 1QG3A 1XT5A 1OQXA 1Q8MA 3Q0HA 2G2RA 2WUBH 4R3SB 4PRNB 2QQKH 5FYJH 3WS3B 3BAEH 4AENB 1NDGA 3DVGB 5HHPB 1XF5A 4PP2B 2F8OA 3MBXH 5HGGS 5I1AA 3ROOA 4S0SD 5TE7H 4OCSH 2DQJH 4P2RD 4HDIB 4OKVB 4X5LA 5DK0A 3RWEB 2DMCA 1DBBH 3P0VH 3Q3GB 1L7IL 2M1KA 4P57B 3WJLA 5K59F 2K9UA 4JFFD 5DFVD 4MA3A 4GW4A 2BOCB 4O58H 3TA3D 3S4SB 1LEGA 5J1AA 4JRYE 1RZ7H 3MRJB 5EA0H 4UNVA 1P7HL 1MF2H 3M17B 2GJJA 2Q6WB 5BV7H 1JF1A 1HWGB 2XPGB 3VFWA 1KCSL 3T0VA 2K1MA 1U91A 2P8MA 5EZOL 3TT3L 3WLWC 5E6IA 5CLTA 2PW1B 3PXHA 4FP8H 1XR9A 4GXUM 3BDXA 1S9YB 1SBSL 1Z9MA 1P7QA 4H26B 3B43A 3ZDZE 3RDTD 1GIGH 1UEMA 1OTTC 4KDTA 1P1ZB 5DRZA 5FYLH 1TCMA 1G9NH 2D7NA 3QAZB 3DVIA 1JHKL 4YO0B 4F9LC 1HQ4B 1HI6A 4OZIA 4OZFA 3UJJH 1NCWL 3DMMB 4JDVB 1XGTB 1AXTH 2P4AB 1X4YA 4RFOH 1DQQB 2WIMA 4N8CH 1DBKL 3OB0K 4U1HB 1WZKA 2FHCA 5A16A 4NKMB 1SY6H 4ODTL 3SDDD 4JM4H 4KDVA 2HTLD 1FBIL 1D7FA 2XN9D 4JN2B 3QPXH 5JW4R 4NT6A 4UV7L 4M8QB 4PJHE 4RWYH 2EZ0D 3OXSB 5ADPL 3CUPB 2BOBB 5ID0B 2HFEB 2F74A 5IHZB 2XI9A 5FKAB 5CZVL 4KKBC 1J8HD 3A6BL 4GXVH 2ICWB 4OCXL 5JW4M 3DIFB 3NTCL 3KPRA 4OM1H 3S5LB 5DMKA 4GAYA 2J88H 3H8NA 2GQHA 5IOPA 5B38G 4ORGB 1SEBA 3X11B 1CQKA 2R2HA 3QUZB 1R24A 3DROA 4L5FL 5JPMA 1UXSA 4PUBL 4X8JA 5DHYA 1QEWA 5EC1B 3GI8H 5E70A 2F19H 4MNHA 2R0LL 5D2LA 4BZ2H 4JFDE 4XMKL 5CSZB 1G7JA 4Y16C 4G8IA 4LQFL 4Z7QF 1RUKH 5EBWA 3FT4B 3EYSH 2CQVA 1F8TH 2D4FA 4NWUH 2R8SL 1BD2D 1S7WB 3GBLA 1A6PA 3UJTH 1X3DA 5L88L 4P46D 4ZXBD 4XVSL 4F15B 1ETZA 4N0CC 3WNPA 3BZEA 5DQDH 5J7CC 4HIJA 1Q1JL 3WDJA 2ZUWA 2ZUQB 4WWKB 2E6QA 3TPKA 3OX8B 5A2FA 2J2ZA 2V2WB 4OGAC 1W8NA 2DI9A 4JHZA 1MCJA 4Y5VA 4WDIB 4JO1L 3L95B 3TYGL 3OPZH 4LSRL 5CKGA 5KVEH 2NNAB 2VITB 1HIML 4M1CD 3UZEA 5F44A 1CLOL 1YN6A 2FATH 1A1MA 3E2HC 5E2TL 1PSKH 1DL7L 4OGYH 3GSWB 1KELL 3ULUH 4KRPC 1CFQA 4V2CB 3I75A 3QUYA 3LZFL 2FX8L 2ZOLB 1EJOH 1PZ5B 5LGKA 5DFTA 4U1NA 1CD8A 4UAOB 4U6HA 4XBPA 5IVXA 1UH2A 3T4AA 3KJ6L 1S7QA 1N26A 3FOMA 3S96B 1JIBA 2WINB 5HYQA 1NEZA 4N8VB 1R3KA 1IEBB 4U1MB 2MCG1 1KLFA 3UX9B 1NBZB 1U8HB 43C9B 1HH9A 5E0QA 2ADIB 2OP4H 3WNOA 2J4WL 1EFXA 3OWEA 3IKKA 3DMMD 3LN5B 3DARA 5D71H 1TJIH 2NY4B 4PBVC 5JTWA 4R0LA 4LEOB 2HJKA 3HC4L 3WMSA 3RHWK 4IS6B 4NQSB 1OW0C 4JZJB 3EDKA 5I8EB 5C07E 4TSAL 5HDLA 4FFVC 4HJGA 4H8WL 4DW2L 4C55A 4AEIH 3BESR 4HS6B 4N9GA 2P8LB 4I2XA 5CP3H 2MQCA 4K3DL 5ITBL 1UA6L 4O51B 3U79A 1BP3B 5D1ZC 4I3RH 3WUWG 3NPZB 5EZJB 5JUEL 4WI8A 2A6KB 1GGCH 1Z2KA 2V5SA 1NC2A 1MFAL 1C1EH 4E0RB 3GBNL 1WCBB 4XNXL 4PJCF 4KY1L 4ZYKA 3SDXE 3GHBH 4PGEA 4OBRA 5DEGB 2VYRE 3I84A 1S9XA 2OTUB 4EDWL 3V79C 3QUZD 4B7IA 5I1GL 2YD4A 3V7AG 4I48A 3F7RA 5C9JB 5A2LH 5CUSH 3HZYA 3MYJB 3G08A 3ALXA 4X0KA 4RAUA 4JPIA 4FQLL 5IW1B 1R6VA 15C8H 1NFIB 3BP7A 1EGJH 1CDGA 1MWAL 2A77L 5KVMC 3Q5TA 2LAAA 4NZDA 5GGRB 5CLWA 1FZKA 4WI5A 1J0YA 5HYJB 4L3EA 3ULVE 1VGEH 4RIRB 5DRXB 2YZ8A 5DJCA 2F58H 3KHOA 3OAYH 1R5IA 4D94A 5BZDB 4NQVA 4NQXB 5EBMB 1KN4L 3GJEB 4UINL 3RGVB 1T2QH 1NMAL 2EO1A 5E2VH 2W60B 4WWKD 3MCKB 2ADGB 4Q9RH 5AWNH 2EKSB 3SGJA 1RFDH 2YUZA 2YXFA 4PYGA 4KUCD 3QUML 3CDGB 1MFBL 4JZOA 3UCRA 4KKCD 1MRDH 4XNQA 5E8NB 2E8YA 2R1XA 3LQZA 4NHUA 2Z4QB 3ZKMC 2Y06H 1CR9H 5DD3H 1I3UA 1HHGB 5DO2D 4Y5YA 3MRFB 5HPMA 1KCLA 4LGSB 3WNLA 2F54B 1T2JA 4KH2A 3HC3H 1EAJA 3PWVB 3WN5B 3V6ZA 4GW1B 1F6AA 4P3CH 2VZSA 1OWRM 4K3JL 4HKJB 1OAUL 1UQSB 2BZDA 4PLJD 3JTSB 2XYCA 3CVHA 1NCTA 5K9QG 4WEBL 1NAKL 3EOBA 2RQ8A 1PY4A 4WI2A 2EDXA 4Z78A 4GQ9H 3MLWL 5IK3B 4RGMB 2ITDB 4M02A 2XRAH 1B2WL 1Z5LA 5FOJA 4HG4J 2HJFA 1T1YA 3ES6B 1I3GL 1JVKA 1XMWA 1T1ZA 1X5HA 2EDHA 4JFQA 4JHAL 2EDOA 4WTZG 1G0YR 3H9SA 1FVEA 2NY4D 3NIFE 5T3XD 3DX8B 2FIKB 5IMMA 1S5HA 3RWCB 2HFGL 5I1JH 3JWOC 5HYFA 4QRSB 1FAIH 3QULA 5DZOA 1CL7I 2V7NB 1JBJA 1FDLH 3C6LA 4J1UA 1IGTB 4ZFOL 2B39A 3BPOC 5FF6A 5GZND 1A2YA 5TGBA 2MMXA 4IDLA 3MNWB 4HT1H 5CMAB 5GGRY 5CZXC 1MJ8H 4KROB 3LKSA 4F57L 4LOUC 3ZHDA 1ZANL 2FDBP 5HGBB 4XCCH 2NX5E 1XF3A 1UWXH 1U92B 4WUKL 3WXWL 4F80A 4PJXA 4IJ3B 1E28A 3RNQA 4R90L 3DVNB 1CICB 2MHAA 4HMEA 4U6YB 3V0WL 3DX6A 1NAMB 4PB9L 5IHUH 1LE5A 4XCEA 1OTSC 2HRLA 3MRDB 5ICYA 3QWRA 4OM0L 2BNQE 1LEKA 4NBXB 2Q7YB 3MOQA 3D2UB 2OMNA 1XAUA 5HYJD 3LCYA 4OZIE 3G9AB 5E4EC 3NFPA 4LPXA 1HHIB 1G6VK 3BMWA 3H9YA 3O0RL 4RBPK 3DSNA 4M6OH 3QUXC 1IAIM 1AFVL 3OTTA 4FG6D 2IAMC 4PPTA 2A6IB 3RGVD 1K8IB 4CADB 3PUCA 3UTZB 3S3JA 3PV7A 4BZYA 3MSPA 1QYGH 3VFGH 2R1YB 4PJ8C 5K9JL 1G7MA 3VXQA 2CXGA 4U2ZA 1QRKA 3TYFA 5BXFA 1RU9L 4K55A 1KLUA 4PTUB 5TFSL 1RQ5A 1FQ9C 3QP3A 5GRUH 2D4DA 5I71B 4MA7H 3V6OA 4YFDB 3MO1B 5E94B 2YN5A 5TF1H 3P4OB 2D9CA 4YHIB 3AXLB 1I4FB 3TO2B 1ZE3C 4DCQB 4QRTA 3L3DA 3DUSA 4NIKB 4M3KB 2F54D 1ZEAH 4JDTL 3MRRA 1T04A 3KJ4B 5ICZA 2H6PB 5CBEA 1BMGA 1TFHA 3BWAA 5E24E 4AH2B 1A8JH 4ZUWB 5KJRL 2RGSA 1F11A 3HG1B 3OJ2C 5KW9H 4ZO8A 5D2LE 3DTXB 4U6VL 2J8OA 5HHMB 3A6OA 2EYTA 3D1MC 2R4SL 4UBDD 4LAQH 2D7OA 1XGPA 5CSBA 5GS0C 4X5XA 2B1HH 2HN7A 3G5XA 3VXME 3T0EB 1YQVL 4K7PX 1RZ8B 2ZSVB 5F1IA 3JSSA 3P11L 1ZA3A 1PG7L 4NYLA 1FZJB 3Q1SL 2UWEA 4Y4HA 1KNOB 3QCUL 2EXWC 4IRZL 3TFKD 1QRNA 1FSKB 2ED8A 3QG6A 5HHOB 4YC2B 4KROD 5IHLB 4UOW0 4OKDA 2AGJH 4G43A 4KJWC 3GMPA 4PD4K 3SKUD 5D93B 43CAB 3QZWB 4PJDB 2D7PA 2AEIT 4JFYA 2PKDA 4PV9B 2H32H 4Z7UA 1CGWA 3GMMA 4NBYB 1ORQB 3O2DL 1J1XH 2O93L 4Q97A 2EXYC 3T0DA 1WFTA 1CICD 4NP4L 5C0CA 2GCYA 2DMBA 1IL1A 1PY9A 4S2SA 3FO1B 5C0FA 1KIPB 5IVXE 5DZNA 4HG4K 3D85A 4TNVK 2P7TB 4M7ZB 5F21B 1K8DB 4UILL 3VD4A 4PJFB 5F6HI 2Z91A 2D2OA 2CDEB 4ONGH 4OZGE 2A73B 1KEGH 3ME0A 1UJ3B 2QADC 5FGRA 3D2UD 4KRNA 3QNXB 3FZUC 4JEGB 2JJTA 3V95A 3VXNA 3M07A 5DJZB 5HI3D 2DIJA 3BPLB 3CX2A 4YDKL 1ZSDA 4HUVA 2H3NB 3OGCB 4HH9B 1YJDH 3QDGB 3QXWA 4YHOL 3MFFB 1EAPB 1N3NB 3LDBC 3NCBB 1IGJA 3SKOA 1QHOA 1AHWC 5H2BA 3WLBA 5HI4C 2VDNH 1ED3B 4NKIH 5T3XL 3WO4C 3D48R 5IMOA 2AW2A 1AIFA 1UVQB 2VXSH 3UP1A 4Z7NE 4M4RA 1M71B 4YZFF 5DLMH 1EHNA 1TQCC 4B7LA 5EORH 3QXAB 4Y4KB 1CQYA 3OB8A 2DQHH 2A83B 1J0IA 2IEPA 2XZAH 2ZPKH 5D8JL 2HH0L 2YC1A 1NGQL 4WJ5B 4O02L 4OT1H 3LSOA 4WY7L 5B3NA 2VUYA 1G6RL 2SEBB 4I4WA 4MD4A 3EOTL 3WYRA 5J9PA 5JQHC 4QXWA 1FIEA 1OQOA 1S7VA 4LNRB 3BHBA 1I85A 3HG1D 4JN1L 5GGTA 3MCLL 5F7EH 3BRDA 1YN7B 3HE6C 3L7FA 2AK1H 3LD8C 5HHMD 2NY1C 1G9ML 4XWGL 3RNKA 3DV4B 1FNHA 3MRBB 4LSTH 5TF0A 1KXVC 3PQYB 3M45A 4LSQH 4AG4H 2W0LA 3EYOB 1JMXA 3C5ZD 2OR9L 4XCYA 3T0ED 2QQKL 3X17A 2CIKA 5JXEA 3D39B 3BAEL 2DQFA 4YDJA 3O6FB 4MDJB 4XMPH 2DWEA 3T04D 1A0QH 5J12C 2YD5A 5KSBB 2JJVA 1IEHA 2E7LC 4M7LT 1ZLWH 3FRUA 2X9XA 2I27N 2YPKB 4ISVA 5TE7L 2DQJL 4JQIH 1TJHL 5FO9B 1CD9B 1DBBL 1EMTH 1A47A 4KI5D 4EN3A 1B6DA 3VGDA 2ZP0T 2YD2A 3BP5B 4Y4FC 3WL9B 5HHOD 2FJGB 4IIQA 1UXWA 3UBXI 4P9HH 1U2CA 4ERSH 4XNMB 1RZ7L 4NO5B 2DM4A 2FIRT 5K9KB 3NN8A 4NWTH 3PP3H 5KVFL 3MV8A 2MKWA 4F9PC 3MLVL 4KJYA 5KSUB 3C60C 4JFXB 4YBQC 4FQPA 5CEXA 3PWNB 3ZDYE 2MQ0A 5CJQH 3LKRB 1WQVT 2IPUK 4XX1G 3V2AR 4Z95L 3IT8D 1QBBA 1AP2B 1HHKA 3WS6A 2JELL 1IQDA 4K7FB 3IJYA 2FO4A 4LHUB 1Q72L 3UJJL 4GG6A 4K23H 4I5BB 4RMVA 3ARSA 3DGCR 1Z6JT 1DDHB 3B5TA 2AXHA 1J10A 1XGQA 3K7UA 4N8CL 2IH1B 3IETA 1CZ8H 3KS0H 4K07A 4JO3H 5TQ2L 2NY0C 1HYSC 4JVPA 3B9KB 2VXUH 4JM4L 5D7JA 4LLUA 4XMLH 4NQEA 2HJLB 3MV7B 1ZS8A 1I9RH 3QDGD 5JHLL 4R4BB 5HGAB 2EDNA 3OKOB 4MZ3A 4OZHA 1JGDB 3EDJA 5EO1A 4O2CA 3U83A 4DGVL 1KEML 5C0AA 3DUUA 2XACC 1I8MB 4JM2C 3SE3C 3AY4C 5CIPH 4HUWB 4TUJB 1AD9A 1LP9E 5J1SC 2YUXA 1PJ9A 3ARDA 4XPAH 2UYLB 4Y4KD 4P2OC 5C1MB 5D7SL 3QJHB 3WDIA 4OIIL 2OM5A 1KIRB