4IMLB

Crossfab binding to human angiopoietin 2
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
212
structure length
212
Chain Sequence
PGLTQPPSVSVAPGQTARITCGGNNIGSKSVHWYQQKPGQAPVLVVYDDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHYVFGTGTKVTVLSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of an Anti-Ang2 CrossFab Demonstrates Complete Structural and Functional Integrity of the Variable Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Crossed heavy chain (VH-Ckappa)
total genus 38
structure length 212
sequence length 212
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4imlB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4imlB02
3OAYH 5EZJA 1HHIA 1JWMB 2VISA 3OB0K 4Z7OE 5DEFA 5DXWA 3AU1A 5D8JL 3VFWB 2G2RA 3QHZL 5LGJA 3VFWA 5B3JE 2A2QT 2BRRH 1IEAB 4M7JH 1KACB 3QUZC 3PIQA 1LE5B 3JZ7A 4X5XA 1QFOA 4D3CH 4XVTH 1V3KA 3HI1B 1A3QA 3HI6L 1FDLL 1DE4B 3FB5A 1ZWIB 3S5LG 3BZ4A 3D87B 1IAOA 4PRIA 1F4AA 5D70L 2IAMD 3WS6A 1QQDA 1BIIB 5HYSA 1MFNA 3QUZD 4S1DC 4OCYH 1KEML 1H3PL 1UXWA 3QQNA 1I75A 3KPPA 4Z18A 3ZLQC 1ZT4B 3OKOA 2IBZX 1ZOXA 5ICXB 1CLZH 1NCAL 3O6MH 2O5YH 2GFBB 4OB5H 4FFVC 4P4RA 1IGYA 4OGZA 2N4IA 4R0LB 3LV3A 4PV9A 1HKLH 3VFUB 5ALCH 4ALAL 4PRDA 1NMAH 3KHOA 1YPZB 4JG0L 1YEDB 2BVEA 1JHKL 4LCUB 4PTUA 5HGHB 4NFBA 4ODXB 4LGPB 5E03A 4JGUA 3RTQC 5ITBH 2B4CL 1IM3A 4FFWC 3H3PH 4H88H 4KROD 5J89A 4TN9A 1E4JA 3PL6D 4HKZA 5H35B 5DK2A 2FEDC 1NJ9A 5JOPD 2JELH 2NXYC 1XF4B 2AKRB 5TDOA 1ZVSA 4UT9H 2UWEF 5FO9A 3NVQA 5C7XL 2XN9D 1KV3A 3EBAA 2V9QA 4MS8C 3ARFC 2BNQB 3KDMB 3LQAH 1I4FA 5SWZD 4JGMA 3JWOL 3V52L 1V3JA 4P59H 4BH7B 5GRYA 1W0YT 3G5VA 3FO0H 4KJQD 1A4JA 4I18C 2R4SH 2OQJB 5L2KD 4XHJC 4LHJB 2OR7A 4EKXA 1L0XA 4KK8D 2O5ZL 4P46C 3LEVH 2J7LA 4KJYA 1IE5A 1JK8A 1FIGH 1VEPA 1YMHA 3WMSA 1OTUD 3B5GA 4I77L 3BWUC 1OP5H 4H1LB 3IFLL 4X80L 4HV8B 4PRPE 1G0YR 1PBYA 2OTWA 2BNQA 1CG9B 4KKBC 4U31A 3GM0A 1EBPA 4OFYA 3TBTB 3S8WA 5KVMC 2F19L 5HI4C 4RMRA 1KN2L 5FO8A 1WUNT 3G04B 5FOBA 4XP4H 1FZJA 5I8OL 1HNFA 1OGAD 4WHDA 2XA3A 5J0BA 1U3HB 5IQ7H 3O4LE 5BCAA 2VRAA 1OF2B 3BKCH 3I9GL 5C6TL 2ICWA 2F53D 2A6IB 1MEXL 4ZOAA 2FRGP 1GOHA 4TSAH 4TUJA 3BUYB 3BWAA 4CDGC 1JWSB 1MIMH 2BMKA 3QUXA 5FB8A 3MRMB 4FRWA 4M61B 3GK8L 3X12B 2OTWB 2CK0L 4QXGL 1C5DA 5CJQL 3WIHL 2WP3T 2EYTA 3RAJL 1UYWL 1WWWX 5EBWB 4TNWK 3UMTA 5BS0A 3HZVA 1KCSL 3RWHA 3SQOH 1UQSA 1AI1L 4JANA 3DX7B 2VZUA 4BZ2H 5IM7B 3VFRA 5GIRA 1VFMA 4JRYA 4NZDA 3EYFA 3QZWB 3K2MC 2MPAL 1W72A 1TQCC 3TJHD 1WITA 1FORH 2Q1EA 2R2EB 1D5XA 4AL8L 5I73C 1W0WB 4JG0H 1TNMA 1YC8A 4G8EA 1LEGA 1F3JA 4PG2A 5A2FA 3VFMB 2VLKB 3ZSTA 1KTLB 2GSGB 3MZTA 4PRAA 1VFAB 2X9WA 1ITCA 3DGGA 5TGBA 3MRGB 3H3BC 4Y5XC 4ZFFB 4WFED 3U46B 1WGOA 4P23B 3LH2H 4ISVB 5E5MA 4TSBH 4G8GE 2JELL 2P5EE 5CP7A 1MRDH 1RZKH 1JFQH 5DWUL 1T1XB 2NY6C 3V4VH 5HXMA 4YDJB 3TCXA 3O3DA 3SDCB 3MLWH 3G5YB 5IJVB 2XZCH 5D2NB 4HBCL 3VXQA 3CXDL 4JJ5B 5IHLB 4V2BA 4ZDHB 3O9WA 3QI9B 1AJ7H 2I9TA 5JHLL 3BMWA 5C0CB 1U3HC 2FGWH 4YNYA 3P0VH 4HMDA 1RUML 2MCPH 3GIZH 3QAZC 3WE6B 3SJVD 2NY6D 4LKXA 1KIPB 3VH8G 4YNYB 1QLRB 3QISA 2AQ3A 1NANI 3HS0A 3L3GA 4QTHA 3UTZB 3SGJC 2ESVE 3TA3B 4GAYB 1BOGB 4L8CB 5F96L 4J4PA 1KB9J 1WTLA 1C1EL 5GPRA 4LSDA 2HTKC 5F7WC 1NCCH 1XR8A 3LVEA 3MOBL 5E5MB 3QFDA 2NPLX 4WEMB 3IU3B 1IAMA 4BFBD 1FBIL 4YHYB 1JRHL 2R56H 5CINL 5KSVA 1PG7H 5FOJA 4LKXB 4MWFB 1WK0A 3TESA 3VW3H 2VYRE 5F1NB 1RIHL 1RJCA 4OD3L 4P3DA 1OTUC 1ZS8A 4E42B 4QRRB 2BNRD 3U7WL 4NN7C 1CGWA 1FL6A 4K71C 5E2VH 4NJAH 2XZZA 5KJRL 1HIML 2YHGA 3C60A 3CVHA 1H9VA 2MMXA 5KVDL 5KSBA 5SX4H 3E2HC 1IC7L 1YJDL 4ZUSA 5I2IB 2F53B 5EU6E 3I85A 1Q0XH 4TUOB 4JM2C 5JHDE 3LKNA 3L5XL 1QYGL 5FGCB 4GMSH 1HXMA 3WJLA 4NQCD 3ZYJA 4U2ZA 4HCRH 4GBXA 4Q9QL 3X3GH 2HTLC 4ZS6C 1AI1H 4I13B 3AC0A 1B90A 3MUY1 2JK5B 1EGJH 1UC6A 2B0SH 4YHOH 4IDLA 4PRHD 4KFZC 4FFZH 1IARB 4KROC 4C57C 5JW5A 2P49B 1EAJA 3FTGB 3E6HA 5T1KB 2VXTL 1TQBB 1FVDB 3ARGC 2V5RA 3AS0A 3BZEA 1INDH 1WWBX 4X4YB 4GRWH 1QHOA 2R4RH 5FUCE 1IQWL 1CYGA 3HMXH 4C56A 1AR1D 4RGNC 4AEIH 1KENL 1T80A 4LCIH 3FQWA 3ES6A 1L9MA 4O02L 5CMAA 5IB5A 5DQ9B 2AJSH 4MXVE 4XCNB 4TTDD 2GJZB 2ZCKL 4JZOB 2A83A 2W0KA 3SE9H 5BRZB 2RQ8A 2F54B 5DHVA 4FNLL 3S37L 4NM4L 3D39D 4UIKL 1B4JH 5L8LB 1JMXA 5KZCD 1OP3K 3GDBA 4KI1A 5I17A 1BVLA 4RA3A 1KJMA 5I8CB 4OLXH 4LPVA 3VFTA 1NH6A 1QG3A 4X5WB 5I9QC 1YMME 4LLAA 4YBLC 2FYYA 5AUMB 1VFBB 1XH3A 1UH4A 2P1YA 3EO1B 2HFFA 5JW3L 3O3EA 2HJLB 5T1MA 3IAQA 3QUXD 1EZVY 4KAQL 2APFA 5E8EA 3NAAH 5FCUH 3TYFB 2VR5A 1O0VA 4EVNB 2KQMA 4KKCD 1YYLL 1KIUA 5DDHA 4OM1L 3LKPA 4HJGA 4YIQA 4XCCH 1WICA 5J12C 4QEGA 3ISWA 4DKFL 3SGJA 3O3DB 4JM4L 3SDCA 3QUKA 3GMNA 4Y8AA 4HMCA 1DBKL 3LQMA 1CF8H 2X4TB 4LSRH 2VQTA 3S34H 4JFHE 1BFVL 4F33B 4G6MH 2XQBL 1SM3L 1J1OL 3QH3B 4YC2C 5MP6L 4JFDB 1KT2A 1QLFB 4QRRE 2WINB 3T4YB 5C6WH 4E41E 1S7WA 5CGMA 5INDB 4I9WE 1RAMA 1LEGB 4NKIH 4H5SB 4PJAB 3B9EA 3OX8A 3RDTB 3VXSD 3C2SA 3RX5A 5F96H 1TTGA 4XBGB 5DUBA 1AO7B 3VE0A 3DYMA 1MCHA 3BAEH 2VNCA 2PTTA 4ELKA 1E4KC 4DTGL 5HPMB 2X7LB 2D0HA 1QSFA 3IDYC 3D85B 2A1WL 4JR9H 4HS3B 4NQED 1UACL 3LMJL 5DVMA 3GO1H 3HZVB 4WTXA 3ZE2F 4G6FD 4LDOB 5HHNA 1K2DA 1T66D 4O2FA 2QTEA 4BFIB 4EDXA 1P4IL 4PJ8A 4BFIA 2J8UA 1EO7A 3CXHK 3QR2A 4I3GA 4N1EA 2ESVB 1V05A 2XN9E 2X70B 5K9OA 3HNTH 4YUEH 3C9NA 1IAIL 1FNLA 1M7IB 1ES0A 1Z9OA 2FO4A 1M7DA 3W39B 3SDAB 5C07E 5BRZE 5E5RB 1E0OB 2VXSL 4R97B 1ZLSL 3OJMB 1EMTH 4PJCF 2EDJA 1B88A 2YMXH 3KPOB 3GIVA 3GSWB 4D94A 4O2CB 2BOBA 1MRCL 5EO1A 3UPCA 5DJ2A 4RGMB 3U4EB 5T5NG 5MHSD 5CCKH 2EH8H 2BDNH 1FE8H 3OPZL 5C0EB 3BUTA 4AZ8A 4I0PD 1LE5A 2IMMA 2WBKA 3D2UB 1FHGA 5C9JA 4RIRB 2G2RB 4P5TA 5IEKB 2EIZB 1KLGB 1U8IA 3MRCA 2YC1A 4MX7A 4P4RB 5GSRB 3M07A 3D0VA 2EZ0D 4CU8A 1JWMA 2YPLB 3UTZA 3MOAH 5JW5B 2N1KA 4APQA 5DD6B 1S9XA 4DN4L 5JO5B 4Z5RB 4HIJB 2C1PA 1QR4A 3RDTD 3MRHB 1NGYA 3ELAT 3MV11 1BIIA 2NTFA 5BV7C 1YYML 2B2XH 1CXIA 1WJ3A 3B5TA 4AEIL 1HYSD 3BEWA 3RGVB 3FB6B 1OB1A 5DURB 1H8NA 2FB4H 4G80B 4XP1L 1J5OH 4ODVH 5M7QA 3IDXH 3HR5B 3LKOA 4K7FB 3AFLA 3D3VE 4L9LA 4P5TD 3WNMA 1GZQA 2ICWI 4UAOC 5T1KD 4LHUA 3IS1X 1MHCB 1OQOA 4KMLB 3BDYL 1KCUL 3W2DH 4ZS6D 5B21A 1H15A 4J7RA 4GS7B 4N8CH 3S4SG 3L6FA 1GHFH 3FRUB 5FK9A 2GAZA 4AG4H 4Y4HB 2X10A 4HF5L 1RPQA 2D03H 4XZUB 1QHPA 3NAAL 1SYVB 4JRXD 1JTTA 1TVDA 3DUUB 1OGTB 4S2SB 4CNIB 3LAFA 2EDDA 3S3JA 1T03L 4XCYA 4Y19E 2CGRL 3VW3L 2DJSA 5IG7A 3QDGE 3GSOB 2BY1A 4TUJB 3QUMH 1NKOA 3DBXB 1CFNB 4KGLA 3M1BA 3DETD 2V7HA 2C3HA 1XGUA 5I66A 1AIFB 4ODBD 1FSKC 1WBXA 5KW9L 4OQTA 1EAPB 1Q0YH 5D93C 5IWLC 3EHBC 3L5WB 4PJIB 5BQ7A 4E0RA 1JGUH 3I3BA 1J10A 4PBVC 3UJTH 5D7LD 3LOWA 2PETA 3FQXA 4YFEA 1G7MB 2DQCH 3B6SA 3BDBA 4QGTA 3P0YL 2A6DA 4N0FA 5F7DA 3VWJA 5IK3B 5C0IA 1JWUA 5FHAL 1IT9L 5EBLA 4KY1H 5D9SB 4J3WA 3MQIA 4LAQL 1A6AB 4QOKA 5HJ3B 1U0QA 2VLKE 2DAVA 1VFAA 1LO4H 1H8SA 1U58A 2BFVL 4LPWA 3KPNA 1HDMA 2KDGA 2WWKT 2C3WA 4XI5C 2NY6B 4CMMA 3EYOA 1P6AB 1J1XL 1YMHB 1SBBA 1QEWA 3NFNA 4X7SH 1XGUB 2N56A 5I66B 4U3XA 2OK0H 1XF5B 4OCXH 5TQ0L 1OTTC 2WWMC 1S7UB 5DVKA 4Z7VE 4NO5A 4AEEA 3MYZA 1JN6B 5F7MC 4G9DB 1BJMA 5BS0B 3WSQH 4OV5A 3V7AG 4ZTOH 2EIZA 4RGNB 5C6TH 5C07A 3FT4A 1TTFA 1QLRA 1C12B 4YBQD 3IGAB 4WWKC 3MLYH 2K1MA 2FHCA 2H2SD 1CD1A 4LEXL 4BQ8A 2CO7B 4YHIB 15C8H 5EU6D 3PJSA 2ZSWB 3BVNB 5DEGB 3H9ZA 1YY9D 1V7ML 5E7BA 1LEKA 5JHDA 5FYKU 1XR9B 1RIUL 2YA1A 1U8NA 1KJ2A 3NCYP 1WC7B 4HC1A 4NN6B 3LDBC 3FFDB 2YWYA 4ZO6A 5FA4A 1B0RB 4ZSOE 1NMCB 3CFCL 1T0NB 1PJ9A 4YQXH 3FT2A 5E8EB 5DHYB 4NUGH 3HR5A 3LKOB 1I7RA 3TIEA 4M5ZL 1G9MH 4LPCA 3UTQB 4PGZA 1NLDL 3VA2C 3OHXB 2HFTA 1IGCL 4NO0A 3HMXL 3P2TA 1BZQK 4NQDD 3RKDC 2MKLC 3KWWA 3O4LD 2BC4A 3HE6A 3QI9D 5EOQH 5CJXA 3CVHH 3VXRA 2H9GB 5K33A 1KPUB 2DD8L 2W65B 2Y36L 5FUCC 3H9SA 4U1MB 2AI0L 1NBZA 5DJZB 3SKOB 4ZOEA 4PJ5A 1DN0B 4B53A 3D39E 4WI8A 3BO8A 3T0AA 1Q72H 1SJHA 4LGRB 4P5TB 3K0WA 5E8NA 1FFNB 3FQTA 4XPFH 2Q6WB 2A6KB 1GPOH 5J56B 5EU4B 1KG0B 4JVUA 4ZG1A 1KG0A 1I8LC 3ZZ1A 3WFEL 4LSTL 4MLIA 4ESKA 2A1WH 4MA7H 4G8FA 4N9GA 1EIBA 4GLRI 1YN7B 2D7TL 3O3BA 5L7XL 1KSRA 5F1IA 5F9WC 1M05B 1PX3A 1JRHH 2R56L 3GIVB 3GSWA 3V7AE 1JMZA 3CFDA 4M3JA 3V0AC 4M1CD 4LSPH 1E6JH 3MRDA 3N85L 3SDDB 2YPLD 4XP4L 2X70A 2HJKB 3QG7L 3ARYA 5FYLE 2EDTA 3LDBB 5SWZB 1E6OL 4RGNE 1HXMB 1MCWM 1JGDB 5EBMB 1R0AL 4PB0H 1CIDA 1OAXL 3REWA 3V9FA 1PVHA 3OHXA 1CF8L 1F02I 2NY0C 4IRJC 1NDMB 1IQDB 4GAJH 4OCRH 2FJFA 2FIKB 1GJIA 1GGIH 4DUVA 4OJFL 4PLNC 3QHTC 5KS9B 5DMGD 3OB0H 4Z8FH 4CVZB 2BNRA 4MXWH 4JZJC 3SEPA 4DCQA 3HB3C 4YWGL 3KDMA 4XP6L 1T0MA 4XAKD 3DROA 4G7YL 2EKSA 4F9LA 4ELMF 3K7UA 4X5XB 4JY4B 3T1FA 5J11C 4FQ1H 4DN4H 4UB0H 1LO5B 4LVNC 4JKMA 4XNQA 3SBWA 4XVJL 4F15C 5IV2A 4XMPH 5CEYB 3B6SB 3TIDB 2CLRB 5KVEL 1S9YA 4OM0H 4ZQKB 5IT2H 5E99H 2KZWA 3CFBA 5GGVH 3L7EA 5DVNA 4UOW0 1MFBH 1JZ7A 3N1MC 1RURL 4KK5C 3UXFA 1GAFL 1A7OL 1DDHB 1YECL 3S96A 43CAA 1MUJA 4JKLA 3VXSB 2DQUL 4A6YB 1H3UA 5F88A 3VXTA 3PUCA 1F4HA 4AIZA 2UZIL 4A6YH 3F12B 2YK1H 3M1BB 5DMIL 2AXJA 2YN5A 3RVUC 3OB8A 5CHNB 1Q9LB 5IBTL 2FECI 2HFFB 5ESAA 1Z2KA 4CKVX 1ADQL 2AGJH 1CGYA 2WP3O 2VZSA 4OLXL 4TUKH 5I1IL 3EFFB 4J23A 2CRMA 1DN2A 1BVLB 4GKZB 1YY8A 4XBEL 1X4XA 2PTUA 5TQ2H 4MMZC 3BH8B 4IS6A 2DN7A 4UDTB 3KXFE 4YR6B 4DGYH 3IU4L 3ZYOA 5JUEH 1LO3H 4NCDA 1KOAA 4HULB 2F58H 4ODUA 1CXEA 4JPVH 2IFFH 1NLDH 5SWQB 1OW0A 4YHLH 5I18L 2D7PA 3G9VA 3F62A 2P47B 3GI9L 5D1QC 5TDNB 1MRFH 5I1AA 3F6LA 2X4PA 1O7SA 3QHFH 1AKJB 1RZ8A 3SN6N 2VXQL 2NNAB 3WNPA 4JPIA 4P4KC 2BOCA 4PB9H 1XZ0B 5E2VL 4EZMA 3DX9A 3QUMA 5JIKA 4PJHB 3BT2L 4FFYH 1OP5K 2GITB 1NCUA 2Y5TB 3KPRB 5I76A 1P7QD 3L3IB 4PLKD 3B3IB 2EH7L 2DLFH 3F7VA 5CSBA 4LKCA 5FUOL 3E3QC 1UKSA 3VXMA 1IGMH 4YXLL 1Y18B 3O4LA 1EXUB 1UM5L 4MDIB 1BQUA 1A21A 4X4ZA 1IC4L 3GHBL 2HLFD 3V4PH 1JF5A 3HKFA 3S3PA 3EO9L 2HTKD 4Q9QH 1ZHLB 2ZUVA 1S9WB 5CEZL 1KF9B 4I2XB 4G8FB 3CMOL 4N9GB 1ND0A 4M7ZB 4MJ6B 4ZFZA 2IPUG 4P99A 4BELD 4X0KA 1K4DA 3ULUD 5K93A 1T5WA 3QEQE 3VXPA 5IHZB 1ETZB 5IMMA 3OR6A 2RBLA 1DEEA 1NDGB 1ZGLP 1L0YA 4LPUA 2R39A 1OY3B 1TJHH 3MPCA 2PW1A 4XX1E 2VERN 4S1QL 4HD9A 2OSLA 4KQ4H 4P3DB 5FYKD 5AZ2H 4QF1B 1UJ3C 1NFIA 3A67H 3QYCA 4Z7OF 1HQRA 3UBXI 1SYSB 5L2KB 5C0CD 1ULVA 3O41B 1E28B 1NGYB 1B9ZA 3W39A 3OF6A 1F90H 4M48H 4ORGB 1A4KB 4Y4HC 1ZLSH 5L88H 1K8IA 3P77B 4L4TA 1ORSA 3C5JA 1LO2L 4NO0B 5D1ZC 2O61B 3UJTL 5SX4I 1CXHA 4HZLB 5D7SH 5T3XL 3SBWC 1T1WB 4LLYB 4XXCC 3TWCH 4K9EL 5I1KH 2NY4B 1UT9A 5D72L 1D5IL 2NY4C 3PL6B 1LHZA 2J88H 3QDMD 2NX5E 3NIDE 4KKCC 1EGJA 1H5BB 2HJKA 5IFHH 1NMBL 5JW3H 3MFFA 4WI3A 4HWBH 3MLSH 2HH0L 4RCAA 1R3JB 1U8MA 4UMGA 1PKQA 1RZJC 1WIOA 4NUJB 1S9YB 1YN7A 4TULH 4O4YL 2VLME 2CKBL 4PTUB 2NW2A 5HGHA 3OKNB 3GKWL 1II4E 5F72S 3QQ3B 3ME0A 1QRNA 2PYEE 3MLUL 3QCTH 5DJCA 5M94B 5D1XD 3VFSA 4ZPTA 5EU4A 3IRPX 2JB6B 1FIEA 2EDEA 2HVKB 4Y1AD 2CK2A 4U1HA 5MENE 3PWNB 2QQLL 4XNMA 4QCIA 3HZMA 5C07D 2AI0H 1MCPL 4ETQA 5K9JL 3SE4A 3LSOB 3HG1D 3PGCB 3PGCA 1KB9K 3BD3A 1OARL 2IAMB 1KJ3L 4ETQB 1IFHH 1RHHB 4OCWL 4BZ1H 2ED8A 1TVBB 2EE9A 2A73B 2HVKA 4XAWH 1VGKB 2Z8SA 4HT1H 4WWKD 4PRPA 3VFSB 4DGYL 1JGVH 3ZHKA 4QT5B 3WFEH 5HDQL 1OVZA 5LQBL 1MF2L 3LSOA 2Y5EA 4FXGA 1CR9L 1MI5E 3WN5C 4L8BA 3VGAB 4MD4B 5KOMC 2EE6A 5CILL 1HEZB 3V8CA 3KLAA 5GZOC 1JWUB 3JVGC 3VG9B 1D5ZB 1SMAA 1HHJB 4WCYL 3A6CH 1PEZA 1MFEH 1X5JA 1G7MA 1UXSA 2CGRH 1E6OH 2EDHA 3P4OA 3RU8L 3ULSA 3CLFH 4J6RL 4F7CB 3EFDH 2GJZA 1HCVA 5HSFA 2OMBA 3MNVA 3V6FB 4QXTB 1ZGLA 4AYFA 1DQML 4KUZL 1FG9C 2X4RA 3J8F7 2VDNH 1YUHA 5C3TA 3ILPA 3QXAB 3QJHB 3MX0A 3S88H 2X89A 3SO3C 1NANH 3GSOA 4NRXB 5E94B 3VFVB 4OLYH 1T22A 4WHTA 2FX7H 3H3KA 3QXVA 1MCCA 1ZTXH 5HI4D 1NCTA 3CCHB 3NCCB 4LGSB 4JPKH 3PF2A 2KL6A 5IMKA 1JBJA 4HIXL 3MGOA 2OSLB 4OCLC 5CWSB 5CUSH 2ADJB 3T8XB 5IFJB 3LPFA 1JNJA 2GCYB 2AJUL 3QWQB 4OIAA 5BXFA 4JJHA 3A6OA 1AGEA 4JZOA 5EU6B 2F74B 4FXLA 4KKAD 5LWYL 5C3LD 5FGCE 3U0PA 4G7VL 4N9OB 3VWJD 3UTTB 3QI9C 5I75C 3ZTNL 3QJFA 3GKZA 4V1DD 1ZVHA 3WXWH 4EQ2A 4M8QA 2YN3A 1GAFH 3FOMA 3CMGA 3S36L 7FABL 3H6JA 3QDGD 2D0GA 3QWOA 3BHBA 3RI5F 1CLOL 5HYJB 2OBGA 2W9EH 1K8DA 1AE6L 2V5TA 2JJSA 4X7EC 4PLJD 3EIFA 3E6HB 5ACZA 4C4KT 1BFSA 4Z95L 2OJZL 4GG8A 2NQCA 3WCYA 4DZBA 3O4LB 4NQDB 3L1OH 3QQ9C 4P3CL 3MLPA 4Z78A 1H0DB 3B5HA 3L3JB 3OPZH 5DJYB 5I8EB 1UWGH 4WRLA 2QQKH 2H3NB 3C6SB 5IGXL 1BVKB 4O00A 2X4PB 4ODHH 1BHGA 1I9RL 2JJVA 5TJWK 3EJZC 4DZ8B 4NFCA 3T0EE 3AREB 4G8IB 1VCAA 1KPRB 4GQ9H 1QFUL 2DKMA 1I3VA 1Y6KR 2P7TA 4OIIL 3VRJB 1C1EH 5C09B 4RZCB 4GW5A 2AABH 2H3NA 3C6SA 1T0PB 3DYOA 1ZAGA 4H20L 4D8PB 1XF3A 5ECJE 3VXUB 3BZ4B 4F7EA 3U4EA 4LFHG 4JDZB 1CTOA 1MQ8A 2P5WA 2W60B 1ZT1B 5C08E 3NIFF 3NTCH 2C3VB 4LSUH 5C08A 1ES0B 3F58H 5FYKH 5KSAB 2Z4QB 3HLAB 4KJQC 2P8MB 2P5EB 1J8HE 1KC5H 4MZ3A 3RUGE 4ZFFA 3I6GB 5HVFB 1BOGA 3MRKB 1NBQA 4KK6D 3B2VL 4X6EA 1DUZB 2UZYB 1T6VN 3TFKD 3RY6C 3AAZB 3FQUB 4NO2B 4X6BA 3MJ8A 5DLML 1NMCC 1S3KL 2OMNA 4EI6B 5GGQH 3H7BB 3TIDA 1QSFB 1P6FA 3MXWL 4PJBF 4P9MH 3EYFB 3BRDA 1DBBH 5C0CA 3UJIL 1NFDF 3DVGA 2V2TB 3AS2A 3OAZH 2QADC 2J6EL 5GGVY 3L7FA 4NNYA 2EIDA 4I0PA 1WAAA 1K3IA 3UO1H 4LU5H 4KC3B 2AJXH 3ESUF 4MNQE 4NJ9H 5IVXE 3O6FB 4CU6A 2YBRB 5I1DA 5BV7H 4XNXH 5DC4B 3WL9A 4JFYB 3V8OA 4QNPF 3JV4B 2QHLA 4RFOH 5D6CB 3WO3B 3SO3B 4JO3L 4WIQA 1F90L 4M48L 5FK9B 2R0WL 5J12B 3TBYA 3QFJB 3TNNB 1JNHB 4HKXA 4YK4B 3QAZB 1QKZL 5CP3H 1CD8A 4LASL 4R3SA 4CMHC 5CEZD 3HUJF 1EEUA 5CZXD 3BRGC 2EZ0C 4KKLD 2UZXB 3IJSB 4NC1C 3ULUL 2F8VA 5KS9A 1IAKB 4HUVB 2BDNL 1D6VH 4XGZB 1S78C 4O58H 1EPFA 3GRWL 4HHAB 4LAQH 3VXNB 1EA9C 5A16A 3SDDA 1CG9A 4N0YH 5DRNB 4O9HH 3QZWG 4JO1L 4YPJA 2MCG1 3PL6C 3C8KB 4G7YH 3WUZA 5EZIH 4ONFH 3QEQD 4KDTA 3UBXG 2OXHA 4RAUA 2RGSA 1HILB 5HYQB 2A77L 2XQYK 4O4YH 4ELME 1BAFH 1RZFL 1ZEAH 3I6KA 3OKDA 5H2BA 4KQ4L 1TVBA 1I8IB 3QFJD 2VXVH 3GRWA 1P9MA 3DX8B 4GSDL 5LAXA 4IRSC 5ITFB 4BSVA 1QSZA 3Q5TA 4EN3B 3W5NA 4IIQC 2DWDA 1UJ3B 2UVEA 4P48A 5L88L 3NCYS 1IC1A 3ARVA 3ALXA 5F21B 5GQBA 4OCWH 3JWDH 2R29L 1A2YB 5FHBL 2EO1A 4BZ1L 3ARGB 25C8H 3RWGB 3VGHA 3HE7D 3E3QE 3OKDB 4JLRB 1AP2B 5CBAB 2ZJSH 3GBNL 5IB3B 2BSSB 1D5BB 3I75A 1P7QA 2FATH 3L95A 4M1CC 5FKAA 4CN1A 2FNBA 2VDPH 4R26L 1NBVH 3FRPG 3I6LD 4QWWC 5AEAA 3ZTJH 3O2VL 1E4WH 3ILQC 1FGNH 4TPRH 3PP4L 1DL7H 3U7YH 3BGFC 4U1LB 3TYGH 4OZFB 4XWOC 3MLSL 4WUUA 5JUEL 4POZC 2D31B 3G5VB 4HK0B 1SBSL 4XCFL 4YE4H 3U0WL 3QNYB 5IW1B 2H2PC 3B9VA 4QRSB 4PYGA 1DBMH 5GSVA 4BQCA 3L5HA 3R1GH 3RWCB 2PYED 4FQXD 1UVQB 4MJ2A 4DN3L 3DI3B 1BBDH 4K3EL 2YXMA 4DUXA 1A6VL 4L4TB 1OGAA 5DYOA 1MCLA 5B8CC 4QHUB 3H9HB 3ARTA 1NAKL 1FL5B 5DK2B 1T21B 5F89A 1CT8B 2VKWA 2YMXL 3IVKA 4WHCA 4QTIH 3WN5B 4HJ0D 4H5SA 5DJ8A 1KJ3H 4UOJA 2OYPA 5HHVL 4L4VA 1R5IA 2DTML 4G42B 1G7LB 5HYJE 1MIML 2CIKB 4N1HB 5EA0H 4FG6C 4NWTL 3QNZB 3F7YB 4JPKL 2J5LB 1R24B 2BHUA 1CD1B 2P5WD 4LDLB 4QWWD 2XT1B 3RNQB 4P0DA 1MQKL 4FQHB 2EDQA 2VDOH 3VGBA 4M1DH 4HWEH 1H8OA 1RK0B 5C0FA 1P5UA 1FC1A 4L8DA 2VJXA 3V4PL 4P2RE 4I1NB 2CKNA 1A1OB 4Z7UB 4JDTH 1PYWA 5F8RC 4PJBA 5TDPB 3BRFA 3LEXB 2GTZB 1AD0B 4M62L 3VD9A 3ZKQD 4W68A 5T3ZD 4MHHG 3ZHLA 3MJ9A 1JGLH 2VDKH 4M02A 3GUTA 4AMKL 2QHRH 1WAAF 1G1YA 1A1MA 4FZ8L 5CAYB 4HPOL 4HG4J 5IT2L 1QPXA 4M93B 1I85A 2R1XB 5GZNC 4LCYB 4LLQA 3SQBA 4UQ3A 2GTWA 3GSXA 8FABA 5JMOC 3FCTA 5JLZB 2DB8A 4R6UA 2R69H 3DGCR 3RBSA 4Y1AA 4GSDH 2AXFB 1T1XA 3A6BL 2W60A 2WW8A 1U8PA 4YPGA 2HT4C 4QXGH 5BMFH 2CLVA 2I24N 3HUJA 4H8WH 3RZCC 1YC7A 1GGIL 3M8OH 5C08B 3VGAC 3P0VL 5D7SL 3DGGB 5EUKB 2WUCL 4NPYA 5HI5C 1P9MC 2J6EA 2WIIB 4G9FE 3VRJA 5B4MD 4HF5H 3FFCB 1S7TB 4JQXC 1LGVA 3LKQB 3S6CA 5DJDB 1MLCB 1EEYA 3ZE1E 3QCUH 1G9NH 4PJXF 4MD0A 2B1AH 3ZE2E 5EC2A 5DJ0B 2OTPA 5F93C 3QUYC 4JRYD 2Q86A 4KK9D 3TVMA 2LU4A 1ODAA 3KPMB 3SDXA 1ACYH 3K8KA 3O6KH 3OZ9L 4PJAE 1K9TA 4LHUG 4ZUVB 4RFNC 5D7JD 4E41B 1KBGH 3L6FB 3R0NA 3KPTA 4NZUH 3C60D 3GMQA 4HT1L 1N8ZA 3GMOA 5ISZB 5E8PB 5AYQA 3TNMB 1U93B 4RMSA 3KPSB 1HXYB 4XX1G 3RGVA 2CDFA 3TYGL 4GRLC 4P2OB 5DFVC 3IAPA 1YEKH 5B8CA 4HUWA 3GNML 4LBEB 4NP4H 1WEJH 1P84J 1S5IL 4YHZL 3MBEC 3NN8B 3ARQA 1JF1A 4GKSB 1RZIA 4YFLI 5J1TC 4TNVK 3VFGL 4TNVF 5IVZA 3ZYZA 1AGBA 1JZ3A 3C2AH 4NQCB 1YNKL 3CGTA 5KSAC 2NX5B 3GMPA 2EDOA 1I9JL 1EFXA 4L29B 4NQSA 3OBAA 1S7VA 1CN4A 1UB6B 5C0AE 3W82A 3VRLF 1INDL 4XNZC 4QHKJ 1CGTA 2IQAA 1KB5L 4S1SH 4NRYB 3MSPA 2W0FA 1FNGB 4DKDC 4MA1B 2WWKO 5BW7A 5ESQA 1PD6A 1T4KA 2GJ6A 3ECBB 5E6IB 3U0TB 3S9DB 4Y4KB 1X5FA 3AS1A 3WFHB 4ETYA 2OR8A 1Q1JL 3GBLA 3M17A 2JJUA 5SWZA 4JN2B 5E5UB 4NIKB 3GEWB 4NZTL 5GRZA 5KG9A 1R5VA 3OQ3B 4X80H 4RGOL 3LN9A 2E6JA 2C7UB 5EC1B 2AJVL 2AV7A 3LQZB 3CFJB 3TA3C 3WIHH 2MJWA 3HAEH 2ITDB 3ULVE 2ZOLB 3RWCA 4Q6IA 2ZPKL 1VFOA 3HC0A 3V6ZA 3JV0A 2GSIB 1VEMA 3ET9F 2NXYB 3C6LC 2J6EH 3N1GC 5CZVL 4OZFA 1KIRB 5L0QB 3OJDA 4NO0D 1GZPB 4X6FB 5DS8A 5F9WB 5HHOA 2YRPA 3HI6H 4ERSH 3SY0A 5E2TL 1DFBH 3HAEA 3PHQB 2F8XC 5IROC 4G8EB 3CLEH 2XTJE 1A3LL 4MD5B 3L95B 4ZS7H 2F54D 2FBOJ 5DD0L 5CKAA 3ABZA 2ITCA 4JQXA 1F11B 3IDUA 4OFPA 4BM7A 3G6JB 5BVJB 1PLGH 1ZHBB 4H8WL 1G9MC 2ED7A 4MZ2A 3OJDB 3O6FC 3WBDA 1A2YA 2Y6SD 5DGRA 3STZB 3ZDXF 3RWHB 3SDAC 5GHWL 3TBWA 4U7KA 2X4TA 1GGYA 5MENB 2GSIA 3CUPA 3GMNB 1UYWH 3SQOL 2AK1L 1FLTX 4MA8H 1FO0L 4FQLH 3KJ4B 4MVBC 1UB5A 3C5SB 2MQ0A 3UC0L 4P5MB 4QRPE 2N7BA 1PZUB 1A7QL 1I9IL 4PJXA 4P57A 4ZFOB 1X5HA 1MLBB 5CLWA 1JV5A 5SWSB 3BPCA 4WUKL 4TSBL 2O61A 2BNQD 3HZKA 4YC2B 4GRLA 1CGSH 1RZKL 5DRXB 3SDXF 1BECA 5FO7A 5EU5A 4BK5A 4WWKB 2DQHL 5JXAL 1MCPH 1BZ9B 3BW9A 1E4XI 1F6AB 3BPLC 2DMBA 1JZ6A 3CXHJ 4QF1A 4GKNB 3NGBB 3HE7A 5E1HB 2GEEA 3ARUA 1FP5A 4ORGA 3GMMA 3MCLH 3JXAA 4KROB 5BZWA 4WI5A 2QSTA 1G7QA 2ADGA 1E28A 2CKBA 3MR9A 1BD2D 1CFVL 4I5BA 4AJ0A 1QQDB 5HBBA 4FXKA 1XF2A 5FUZH 3Q2CA 2BHYA 5D2NE 5KVFL 4JREB 4RRPG 2B7DT 4HJJL 3PP4H 4WV1C 3OMZA 5EU3B 3NN8A 4RNRB 1A1NB 2XY2A 1QYGH 5BW7C 4Q74A 4R8WL 1DBJL 4R7DB 3BI9X 4IRZH 4OZGE 1XIWA 5FYLH 1T5WB 4GXUM 1XGQA 4CVXA 2CDGB 3IS0X 1QFWI 5LGJB 3P9MA 2HVJA 3LCYA 1MOEA 3ULUF 3SKNA 2MSPA 3FJTA 3CFEB 4XP5L 3RIFF 1ZHLA 1YN6A 3C09B 2X5PA 3SJVB 3D6GA 3QUZB 3D0LA 3BKCL 4ENED 3VCLB 4ZNEA 3VDBA 2ZOKB 2DDQH 5BV7L 4D0CA 1CDUA 3DUSB 4YK4C 2R4RL 1EDQA 3QEHA 1UM4H 4ODVL 4D9RE 4JO3H 3RTQA 2UZIH 3TF7C 3DXAD 5J1AA 4KDWA 3LKNB 5GJSH 3MBXL 5J6GB 1U95A 2C3VA 4YDKL 3PQYB 4TVSa 1FSKB 4WO4A 2CJUH 4P2QD 5JW4N 3U7AA 1MCFA 3ULUH 5BZDA 3MJ9L 4QO1A 2L7JA 5CIPA 1OGTA 5CJ8A 4PYHA 1TITA 1KGCE 1MLCA 4FFZL 3VRLE 3H8NA 3ARFA 4JFPA 4S11A 4F2MA 4F2MB 5T3ZE 3BIBX 3Q1SH 1YQVL 3BEVA 4G9FB 1I7ZA 3RL1A 3D1MC 2ICEA 1QFWL 2QHRL 1NCDH 4F57L 5FF6B 1FL3A 1MFDL 4KRPD 1A3LH 4GO6B 4EI5A 4YDVA 2PKDA 5IB1B 4LFHD 3MCKA 1YEJL 3TO2B 4JO2H 1FDLH 3NFPA 1DQDL 1T2QL 3BMVA 3F12A 4KHXH 5HHPB 1KEGH 2NY1C 3P9WB 4UT7H 2VWEE 3T3PE 3TLRA 5E2UL 4IEFB 1A6ZA 4LSUL 2VO5A 3ULVF 1T3FB 5GJTH 3QUZA 1YEGL 1EO5A 5FGBC 2FWOA 3QEUA 1TTUA 4EUPH 4U6TA 3ZT5A 2QQQA 5F7UA 1QR1B 1P4BL 4EIZC 3AROA 5FYJE 4EI5D 3NCEB 4TVPH 1U92B 5D2LB 3EO9H 3P4NB 3NPSB 4K2UH 3ULVC 5DEZA 4QOKD 4OIIH 1SBSH 3D69B 4P9ML 1SVZA 5IOPB 2Q3ZA 3SKMB 5FM5M 5DZNA 4ZAKB 3S4SB 2VN4A 4AQ1B 3HCVA 5LGHH 5B22A 2O93L 3MA9L 3QUXC 3U46A 5IP4A 1W0VA 4R0LC 1A7RL 4Q6YA 4XCFH 1Q9KB 4JHAL 4F58H 1YYLH 1V7NL 2UWEA 4DW2L 4M00A 4IOFD 1G7LA 4R4BB 1MPAL 4KK5D 4XTRC 5DMKA 4UDUA 1T1ZB 3RWFB 4IOSD 4MNHA 5FO7B 1A6TA 1IL1A 3EFDL 6FABL 5E8DH 5AZEL 5F71A 3S34L 1FNSH 3ILPB 5CGYD 4AEHH 3FB7B 4LASH 3RKPA 1FN4A 4XC1L 5A43C 1TPXC 3PWJA 3WKNA 1A7NH 3MNVB 3D9AH 3KNBB 1AD9A 2AAVA 2FR4A 4GW4B 1SVCP 4Q6IB 2XTJC 4KKAC 1JYVA 3T04D 5DTFB 3IFPB 5JIIA 4JN1H 1S7QB 1YN6B 1CZ8H 5DFWH 3QUYB 3EDKA 5EWIL 4M7KH 5JXEA 2C1OB 3KXFA 5FYLL 1OAKL 3X3FH 4Y8DC 4YHOL 3MJ9H 5DD5L 5MEQB 1VFUA 4LL9A 3MLTB 5H37H 4JR9L 5DQJB 5MERB 4ODSH 1I1AD 5LBSL 3KLDA 2WBWB 3DMMA 4NQEE 4L5FH 1C7TA 1U3HA 2QJDA 1BAFL 4KZDL 3RL2B 1YEHL 4RMQA 1BD2A 3OR7A 5C0RL 2Z0BA 4K7PX 4XMLL 4ZUTA 1VKXB 4Y16A 3CLEL 1VACA 4WW2C 4ZODA 3MV8B 3TM6A 2UUDH 2Z9TA 1Z5LB 3RVWD 2NY2B 2BXYA 3G5XA 3DIFA 1N64H 4XB7A 3IKCB 4F7PB 5CP3A 5K9JH 3VXRD 2EH8L 3DTXA 1LILA 4LNRB 1QNZH 1F45A 5ABDE 5F3HB 5GS1A 2E6PA 3LRSA 25C8L 2O5YL 3GMLA 1INQA 3L3HA 4NKDB 1FYTB 3V6OC 1KPUA 3QWRA 3LPWA 3VGDA 3MUJA 3RVTC 2NY3C 4L3ED 4BQ6A 1VHPA 3TNMA 2HKFL 5ITBL 3MNZB 4OZ4B 3RIAK 4M1GL 2AJ3A 2FEEI 4MA7L 5HI3D 1MCRA 1U8MB 4L3CA 4Y5VB 3QIBB 1NEZG 2PCPB 4UTAH 3S98A 4N0CC 4MJ4A 1S7XB 4MQTB 5AYUH 1KYOJ 4MSWA 4HFWB 5GISL 2C9AA 2Q8BL 3JV4A 5J3HC 5KTEH 2V5MA 1WC7A 1A0QL 1SY6L 3IDJA 1JGEB 3TT3H 43C9B 2QV2A 1TETL 1K6QL 4NNYB 1N4XH 5EC2B 3OKOB 4JFHD 2VDNL 1FZKA 4MNQB 1IGJA 4K7PL 1AGCA 2GJ6D 5E9DB 4ONHA 4MB4A 3BPOB 5GGTH 3DHMA 4R0LA 4W4NA 2EEBA 4OGAD 1FNSL 2B5IC 3AAZA 3FQUA 4YX2H 1ZGLM 1WISA 2AK1H 4NO3A 1IC5H 3CFIC 1GGCH 4QRQB 3EYOB 3SPVA 3TBVA 4F7MA 3IDIB 3HI1A 3L3KB 1GIGL 5T1LD 1BVZA 4H25A 1GZPA 5DS8B 2QR0A 4HPYL 2H41A 1MJ8H 3T3PF 4JHAH 1KJ2L 3CDGB 3CNKA 1HXYA 4ONOA 3T0EC 5LWYH 1V5JA 1HCFX 1DUZA 1MCNA 4UB0L 1U58B 2IANE 3VA6A 1JNLL 2XN9A 1X7QA 5FIEA 2BY0A 5I1JH 2ICEB 4H0GA 2DRUA 1RURH 2YD2A 4RDQF 5JXEC 1YECH 1F58L 1UZ8B 3O8XB 1J1PH 3ROLB 4JQVA 3BJLA 4JN2A 2P43B 3OKEA 4HAFA 4JQIL 1CL7I 1N6VA 3TN0C 5IMLB 5KSBF 4GG6B 4PLJC 4HIHB 3BKYH 3HFMH 4OZIF 3ULVH 4Y4KD 4UV4L 5EOTA 4OKDA 4POUB 1MNUH 2Y07L 4Z77B 1X4ZA 5I1AB 3HAEG 1NKRA 4OLZL 2X4OB 1RIUH 3NIGE 3OKKB 1UJTA 2BFVH 4ZPVB 3CZFA 1E27A 4N0CD 1HHKA 5IFHL 3CSYB 3ROLA 5ANMA 2OR9H 3W11D 3FQNA 2FDBP 4PGCA 1OPGL 1MAJA 3HPLB 2DJ4A 1HINL 5AYUL 5FKPA 3RVTD 4NT6A 2A74A 1PZ5A 4HZAA 4PGDB 3RWDA 1E4KA 4OF6A 5E9DD 4YJZL 2BSRA 1FGVL 5GSVB 4Y19A 1JTOA 5CD3A 3A6BH 4NT6B 1KTKE 3AY4A 1P7KA 5BS0E 1DQJA 4M4RA 1RUQH 4YDKH 4TNWF 4M7LT 5GHWH 3WUWA 1UWEL 3SE9L 4OCNC 3GI8L 4U1NB 4GW1B 1LP9A 1B6DA 3PV6A 4PRAB 2NW3A 2IGFL 1FVCB 3LEVL 3NZ8A 1PQZB 2XA8H 4P2RA 3W9DB 4QY8B 3FHQA 3D85D 1D7FA 5HGAB 3UROR 3HA0A 3GNMH 1ZLVK 3QB7C 1N2RA 3TZVA 1OM3L 3ULVD 5ADPH 1FO0H 2VITB 4F7PA 4X7CC 4XMKL 5L2JA 3FONA 5C0FB 5E2WH 2LVEA 4HUXA 1MCSA 3EDEA 2EICA 3X13A 3I50L 4M5ZH 4Y19D 3DO7B 5KVGL 4YHML 4XVUC 3C08H 5KOVC 4GRMB 3MMEA 4JM2F 4LU5L 5IEKA 4M61A 1ZHKA 1INEL 1TQCB 4YXHL 3ROOA 5HVGB 2IJ0C 2XTJD 3E1F1 2MQ3A 1R0AH 2FO4B 2CQVA 2NY7H 2DQHH 4RBPK 1DLHA 4XWGL 4XC1H 3Q5YA 4DVRL 1LO2H 3L9RA 2XFXA 1OAUH 1J1OH 3LD8B 4XPGL 3FCTB 4GAJL 3DXAA 4OCRL 5HVWA 2XY1A 3RVWC 5F44A 4M6NH 2RFXA 3SDCC 2A9MH 3KJ6H 4WY7L 2CMRL 3BD5A 5CJOH 4LSTH 4WENB 1RJLB 2AEPH 4Z7WB 5D7IB 3V5KB 2W07A 3G5ZB 5DRWB 1CD9B 5JR1L 2ZKHL 5LVEA 4X6CE 1DBJH 4LNRA 4X7SL 5J06A 3MA9H 3TN0A 5I74C 1AO7E 3S3SA 4NC2B 1LE9B 4HKXB 1JNHA 3F8UB 3X11A 1Q9OB 4QRPB 1GSMA 5LXGH 3P3YA 1BEYH 4ONHB 2QADD 3U9PL 4WUUE 4QHNB 3VD7A 1X5LA 5MEPA 2XXMB 2ERJB 3ZKND 1D9KD 1JFQL 3PQYE 4PJCA 1MCWW 1ZHNA 4X6CF 4I0PB 2WAHA 3VWKD 1HWHB 2UY6A 5CFHA 3ZKMD 5LAXB 3O2WL 1FNEB 1P1ZA 4UV4H 1WZ1H 4ZPTB 1VDGA 3GGWB 1DQQB 1WZLA 1U9KA 2FGWL 4FQJH 1JPST 5DK0B 4PJFE 5J1SC 1MCBA 1IGIL 1RUAL 3IXTA 4WI7A 4N1CA 2W0LA 3C5ZA 3ARBD 3JTSB 1NBVL 1T4KB 2NZIA 4KU1A 4TQEL 2EDLA 3ARDC 4X6EB 5HGBB 4ODHL 2ILLA 4M7JL 2ATKA 2OI9C 3CX2A 4WFFD 3D3VA 5C0DB 2R2BB 3D5OF 4KZDH 1YMMB 3LV3B 3A6CL 5F3BA 5T3ZL 1G7PA 3SGDI 2A6JB 3GB7A 1N6QL 1UH2A 1G9NC 1NGPH 1VADB 2IH3A 4EXPX 3LB6C 4HKBA 2X40A 2DQTL 4FMFA 5IVZB 1RK1B 1GGUA 3EOTL 3BX7C 1TETH 2BCKA 1C16A 3GZKA 5EIVA 3GM8A 4R2GD 1U2CA 1XCTB 3GFUA 4Q58C 4NJAL 3S4SA 3CSYA 5HHQB 4LEOB 4POZD 4LHQB 2R1WB 5IIEA 2Q7YB 1AJ7L 2QSQA 1R6VA 5ISZA 4ZSOA 3ES6B 4X99A 3QXTA 4QHMB 3FO9B 1U92A 3FO0L 5D2LA 2DOCA 4U1SB 2I07B 2AEIT 3ZKSD 5E8OA 1G0DA 1FH5H 4KRPB 4X4ME 4HJJH 3VFNA 2VDQH 5HGDA 2PXYB 3GHEL 4G3YL 4NQCE 2IPTL 4YHLL 2VH5H 4MVBD 4K94L 3KXFD 3UYRH 3EGSA 4BFGA 2HRPH 4QGYA 3REVA 1S5IH 2WUBH 3MBEB 4X9BA 2XG4A 1GGBL 4C4KO 3IAGC 2VDKL 1A02N 4JY6B 2XWJA 3SGDH 5LGHL 4NWUL 1A6ZB 5I1LB 3TO4A 1FBIH 1WBZA 5HHME 1ADQA 1BBJA 4LLWB 3UPAA 5B8CB 3ARZA 5D93B 3VGGA 5F6HJ 4FMKA 5CD5C 2D4FA 4YZFF 4WEUD 1I7TA 1FFOB 4XPTL 3FOLA 5K9QI 2OS7A 2H6PA 3KPSE 2KBGA 2AK4B 4JFFD 1G7HA 5I1HL 2VLRB 2OZ4A 5SWQA 5GRUL 1HH9A 1QA9B 3U36A 3OSKA 2EO9A 1TZHA 2I26N 5CBEB 4Y4KC 3GBMH 1SEBB 4B5EA 4I5BB 1I1YB 4MXWL 5T5NF 5JORA 1MNUL 5HHXH 2F8OA 1UCBL 4PJHE 1UWGL 3G6AA 4PFEA 3O8XD 5FYJU 1IT9H 2W0PA 2X1OA 2EYSB 4GRMA 3HE6C 2ARJA 4LCCA 4PJGE 3FQRA 1CICB 1WCBA 4N5UA 1YDPA 2BJMH 4ZAKD 1ED3B 4Q2ZA 4W6XB 4WHTB 3R8BB 4IRZL 1I1FB 1S5HB 4YHNB 1KTDA 4XMLH 2CRIA 4OZHB 4C54A 1NCDL 4F57H 5IQ7L 3U2SB 2IANA 4NOBA 3VWJC 1MVUB 2BVPA 5CSZB 3EYUH 3LPGA 4HKJA 4GAYA 5EIIA 5EO0B 3FFCE 3G6AB 4KPHL 2CKBH 2DBLH 4PJXB 4XP1H 2DDQL 3CC5A 4PJBB 1I1YA 3ARDA 4X6CA 2A0LC 3OKMA 3QIBC 4P5MA 3HG1B 2RIKA 1FPTL 5DZLA 2QQLH 1J88A 5I1KL 1T89A 3GGWA 2PCPA 3D48R 4G8GB 1Z3GH 3SOBL 4DGIH 1AKJD 3BJ91 2PUQT 1KFAL 5IBUG 1D5IH 3FHAA 1KCVH 3TCLB 2VQUA 1WFNA 5KSAD 3BXNB 3MLRL 3MRBA 3W0WE 1BP3B 5AD0A 3V4UH 4NQUA 1YJDC 2C3GA 4I9WD 1Y0LB 5D5MF 1F4WL 3NFSL 4JM2B 1TJGL 2E7HA 1P5VA 2BCKB 4IRJA 4NKMB 5A2KH 4J8RB 3T77A 2GW5A 1UQSB 4MQSB 2XPGA 2HFEB 5F1OB 3DURA 3RWJA 3TH4T 4MJIB 5JMRA 1IGTB 5IF0A 4UBDC 1VEOA 3W9EB 3PWUA 4I3SH 1OTSC 2DQTH 4DW2H 1JP5A 3C5ZD 3UO1L 1RU9L 2JB6A 3QDHA 5F6IB 2FJFB 4OIBA 1MCOL 3U7WH 4XNXL 4N90D 3MACH 1VACB 1HSBB 1MHHA 3CDYA 5D1XA 4K7PH 3T2NH 1JV5B 3QT2A 3NCMA 5IVXA 5KW9H 3C5ZB 3HMXA 3INUH 3DO3A 3LQAL 2XKNB 4JFQB 3ZE0E 3LEYL 1UWEH 3OKYA 5ICZB 1UZ8A 3Q6FB 3O8XA 2R4SL 3P11H 1C5BH 1OT2A 4QLRA 1LWRA 3TBTA 1RK1A 1S7RA 5CJXC 1EHLH 4NDMB 1RY7B 1HE7A 1KUMA 2VQ1A 1QBLL 3ARXA 5ESVB 1J8KA 5GRJH 1ZKAA 1MJ8L 5GRVL 4HC1L 4Z0XA 3LN4A 5D7JA 2A9NH 2JTDA 4HCRA 3UTTD 4PBWD 2AJUH 4PRPB 3VD3A 4XXDA 5TE7H 5EPMA 1KJVB 3EOAB 4X9IA 4HLJA 3CZJA 1F4YH 5A2LH 3FN0L 1DLFL 1ZHBA 5KN5B 5AZ2L 3KYMA 3WIHA 5FYKE 2DQDH 3A67L 3RJQB 4F7MB 5HY9B 1PY9A 4HXBH 2M1KA 3BZFB 1J1PL 1XGRA 2VSCA 4PJ9A 5FA3A 5FA3B 3LN5B 1J05A 1KCLA 3KPRD 4R2GC 5CLTA 5F7EH 3RFZC 1N5YL 1NFKA 4AM0B 3GJEA 4J3TA 2NY4D 1G6RH 1JPSL 2CR6A 3IXAB 3QJHA 1EMTL 4HDIA 3ULVL 1QD0A 6CGTA 1KJVA 1IAKA 5BJTB 5FDWB 3SE3A 4XNYL 5IOPA 4HW6A 3LN4B 5C8JB 2D7OA 2HMIC 2OXGA 3QG6A 3B8YA 2R0LH 3ZDZE 1X5YA 2WUCH 2L7UA 4CGTA 4O9HL 3TNNA 4OB5L 4XPBH 4MA1C 5C0JB 5TDOB 3C87A 5DEGA 2NXZB 1UWXK 4ELMA 4ELMB 2R15A 2BRRL 2W92A 4FQQA 4M1GH 5C0JA 3B3IA 3LS4H 3QULA 1ZEAL 1N0LA 4LMQI 1JI1A 2FJGB 5L6YH 1T7XA 3MRFB 5JOPE 3BQUC 4B41A 1D6EA 4UZGA 3S36H 4JZJA 1FFPB 4MAUH 4DWHA 2DKUA 3U6RB 1NAMB 4HUKB 1VGEH 4V1DE 3EOBB 1U8HB 5C0BE 2YD8A 3PQYD 3MLVL 1UGNA 3ZO0A 3I02A 1ED3A 4Q2ZB 3QDMA 1RU9H 4APQD 3WIFB 2WANA 4UT6H 3BZFA 1I8KA 3LZFH 4JKWA 4UIKH 2V17L 1K5NB 4I8DA 4IRJB 5K9KA 3KPNB 5GGTL 3STBA 3P30H 1YNTA 3SY0B 1FVEA 4RMTA 1U6AL 5ALCL 3PGFH 4LOUC 1ETZA 4ZFGH 4JFEE 3W2DL 3FO1A 1Y0LA 1MWAB 4MNGA 3RUGF 2G5BB 1ZLWH 2YPVH 4LLUB 3T08A 3D39A 1AFVL 4M1DL 4KAQH 5DD3H 4H0IA 4WW2B 1VERA 1CDJA 3DO7A 2AEQH 2AK4A 4HUNB 1J0IA 4HUXB 1H5BC 5GGQL 3C08L 3IRZA 5D1ZA 3T4AA 1JGLL 1SJEB 1MWAA 1J1XH 2X1XR 3C8HA 3UJIH 2M8XA 1BBJB 4LLWA 4HPOH 5GS2D 4L1HA 3MACL 1HZHH 3NTCL 3ZKXC 5CEXA 5IEHB 3WXVL 4F37F 3OF6D 5I2IA 4FP8H 1U8KB 3MRQB 5MEOA 5IVXF 4L4TD 3U2SA 5TDPA 3S35H 5EZOH 1FN4B 1TVHA 4P2QB 5GGTA 1EEZB 3MV7A 4GRWE 1N0XH 2CUMA 5HDOA 2Y7QA 3ZDXE 1KC5L 1FJ1B 3DPBA 1J8HD 4OD2A 3PWVA 3LKQA 4GKOA 4I77H 3C8DA 4JG1H 2GHWB 1X5ZA 4WU7B 4MJIA 2DWEA 4DK6A 1M71B 4P4KA 4M43H 2Z31A 3KYOB 4F3FB 4IHOA 4LMQE 3VXUE 5FHAH 1HWGB 2QSCH 2NW3B 1PW3A 4JN1L 1GRWA 2YA0A 4UQ2A 3E8UL 5TE7L 3HZYA 3MRPA 4HH9B 1DEEB 1AC6A 3IU3A 5HPOA 3GSNH 3QO1B 4XPHH 4NNXA 4PJGA 4L9DA 1ZA6B 4L9LB 4JM2D 4NWUH 2GYSA 3SE3C 2AJZB 5FM5O 1S9WA 3U9PH 1NGZB 5KAQF 2DTSA 1Z6JT 4XRCB 4Y5YB 1ZSDB 1MJUL 5CHNA 3MV7B 5MI0B 1N5YH 4ZUVA 4X4XB 3I9GH 1AE6H 1HH6A 3CSBA 3UEZA 3QEHB 2VE6A 2Z35B 4UQ2B 1QKZH 3OKMB 4ZS7L 1IQWH 4FTVE 4RISL 4WGWB 3UTSD 4FQCL 1OT1A 3HNVL 3V4VL 5JQHC 1KCVL 5C1MB 2NTFB 4LLDB 5ALBH 2PO6A 4WI6A 4S0TD 4DGVL 3GSUA 3L3DB 5JZ7D 4OFVA 4WDIA 3NIDF 4CVXB 5JPMA 4JO1H 2K3TA 1IGJB 2ATPA 4MQ7B 4Q0XH 4GG6F 2J88L 3KAAA 4OZGB 2VIRA 3FO9A 4MA8L 3V6FA 4FQIH 1X5XA 2EYRB 4ZFOL 1KN4L 4IJ3C 4FS0A 5EORL 4G6KH 3U7YL 1KULA 1JZ2A 2DIBA 1KXVC 5C6PB 2W38A 4FTVA 4AM0A 1I8IA 1I8MA 5JOFA 1DZBA 3GSRA 4NQVB 4E5XB 2ADJA 4BKLB 3MO1B 4EUPA 4GUPB 3QG7H 4HKBB 4GKZA 5FYLD 2VZVA 4R96A 1LEIA 2AQ2A 3WNNA 4ONGH 5J7CC 1T22B 1N59A 1PGRB 1I3UA 3PXHA 2AJYH 1RIHH 5KN5A 4FFYL 2H1PL 3IFOA 4PJ8D 2VAAB 1CVRA 1DBKH 5LCVL 1CLZL 3ARWA 4XXDB 1EVUA 3S35L 1DANT 3BKML 4DKEL 3W11C 1WBZB 3O9WD 4R26H 3STLB 1NGWA 2R23A 3L3KA 2VQ1B 2VAJA 5ESVA 3NZHL 5KSUA 3OX8B 3GSVB 1SJXA 4NDMA 3NFSH 4KJWD 4WI9A 1FH5L 5DUML 4WJ5B 3G04A 5FOBB 5GS0L 2HN7A 2BVTA 4JLRA 3VFGH 2YUZA 3WIIH 3OAUL 2AW2A 1G7IB 4KVCH 3VFNB 1Q9KA 3MYJB 1U8HA 4OSUH 2AXGB 3OTTA 3WFHA 1QSEE 2I07A 5DVOA 4YE4L 1IZKA 1YEHH 3RVVD 2NY5H 1U8OA 5E4EC 3EDDA 3T4YA 1F2XK 4RX4D 4LLUA 5E2TH 3RJDA 2HG5B 1AY1H 1JNLH 4YFDB 2EDRA 3WN5A 4XP5H 3R8QA 3MYJA 5E08L 4GMTL 3H9SB 5F7KC 4Q9BA 3CU1A 3THMH 1Q0YL 2E7MA 4U6YB 2OL3H 1N0XL 4LCWE 3JVGA 1A9BA 4NRZB 3AGVA 4NBXB 3TZVB 5I15H 1WQVT 1UM4L 5CEZE 3QXDA 1OLZA 5EU7C 1QO3A 3QG6B 2R0ZH 2ORBL 1U41A 3T0WA 4KY1L 5C09D 2ZCKH 2ZUQC 3NACL 3JUZA 4LF3A 2WMPA 3KPQB 3GJEB 1YMMD 4K8RH 5CJOL 4G6FB 3T3ME 5C0NC 2FHFA 3BPCB 2IPKA 2J4WL 1M6OA 1NLBH 5HHMB 1FC2D 3FQRB 4PJGF 1U8NB 3DMMB 3X14A 4E9LA 3PDGA 3L9RB 4DVBB 1OCWH 5LGKA 4YBLB 4AMKH 5D71L 2CDEA 3C5SA 2C1OA 4B7LA 5JORB 3R0MA 1XF3B 1WV7T 3ARDB 3MJ7B 1N5AA 4X6CB 5IBLD 2O5XL 1Z5LA 2WBJC 1BQHG 1OPGH 4GW5B 1A9EA 3PNWB 4JFDD 4YH6A 2Z91B 3K81A 4WHYH 1WSST 1E27B 5EO0A 1CGSL 4NNPL 1KEGL 3LS5H 3KPSD 5GS0C 4HX1A 3G08B 1MREL 3LIZL 1U95B 5EOQL 4UBDD 3B2UC 1NBZB 1Z0NA 1EO8L 2J5LC 1DVFC 3UDWA 4EEEA 2QLVB 4Y2OA 2PO6B 4P2QA 3PWUB 2NLJA 1TCRA 1G6VK 1F11A 1UKQA 4WTZG 3L3IA 4EJ1C 2F5AL 4NN5C 1ZWIA 2IGFH 3BKMH 3IFNH 2N7AA 4NKMA 3O0RH 2LE9A 2E9IA 4DAGL 5JDJA 4L4VE 3I3DA 3SKUD 3RNKA 3QEQB 3RPKA 4PY8I 4TRPH 4K55A 4GW1A 4X4XA 2CDFB 4KMTL 2J3SA 3D18B 4PJFF 1I7UA 3HRPA 2RFXB 4YHKL 4G43A 4WUKH 5I71C 2P46B 3R4DA 4U1JA 5DEFB 4YPGB 4Y2DC 4HUMB 3CVIL 3NA9L 4F8TA 4K3EH 3O9WC 4M03A 5IF0B 1ZS8B 4E42A 1DEDA 4U1JB 4RBPH 1F3RB 4X8JA 1A5FH 5F1NA 5GS3A 3N85H 3QO1A 3NCJH 4OTXH 2EDFA 5DHVH 1ZA3B 1Q94A 3OGOE 3D18A 3KG5A 4NKOB 4FQ2H 1XCTA 3ZYIA 4D8PA 4PJEA 5LCVH 2SEBB 3WS3A 2YEZB 3B9DA 4R7NA 9CGTA 3TN0D 2FX9L 4KDTC 4PJEE 5I1DB 3TVMB 1XR8B 5HYJD 4OJFH 4MNGE 4N8PA 4PREB 5JA8B 2DWEB 4ODTH 4DVRH 4D0DA 2P5WE 1LK3H 3P9LB 4W70A 4Z7QE 4G8GA 4FQXB 4FQXA 1F3DH 2FHBA 2WBJD 5IB4B 2E8YA 1D3CA 5E70A 4BA8A 5C0DA 3L3DA 2AV1B 1MI5A 3GHEH 1QBML 4X83A 5C9KA 3BDXA 4WY7H 5DJXB 3S96B 2IQ9L 1NC4A 4V2CB 1NFDA 4OZFH 5E95B 2A9NL 1CK0L 1XGTB 2L4OA 4PP2B 5I1EH 1C5CL 4OZHF 1FG2B 3IETB 5I1GL 4S1SL 3WS3B 4FQQB 5D7LA 2VLMD 1P2CA 4OGXL 1CLCA 5BZDB 3BGMA 5C0AD 4K3JH 1ZT7A 4GAFB 2JJTC 2P48B 1CLOH 3V0VA 2XWBB 2W9LA 3MREB 1U93A 3K3QA 1FLRL 3L5JA 4RFNB 1MCQA 5I15L 4P9HL 5L0QC 2DM3A 5F3BB 5J6GA 2XKSA 3MV8D 1H3PH 1TZIA 5IW1A 4CN4A 3ARBC 4XNYH 3VMNA 1AGEB 3B4NA 3GJFB 4EN3D 2V9RA 2QR0B 4A6YA 1WZKA 2BSTB 3EYSL 4Z76A 5HHXL 3HE6D 3MGOB 4KTEL 2V2WB 2R0KH 3MCG1 2AGJL 3VXUD 2J4WH 2OL3A 3LEXA 5FKAB 2IADB 5HYEA 4RWYH 3IDMB 2CRZA 3QDMB 4FQ1L 4N8CL 4JRXE 1UZ6E 5E24E 5I19H 2WINA 3E6FB 4C83B 5IB4A 3WHE0 3BUYA 3KYKH 2ZNWA 4HX1B 3UDWC 1CXFA 2X4RB 3JTTA 4MHHI 2GQHA 4UOW1 5E00B 4H0HB 5A1AA 5FYJL 5L6YL 5MEOB 1L9NA 1VGEL 3BIKA 4JZJB 5FCSH 2BY3A 4EN3A 2H32A 5IMLA 4MAUL 1B4RA 4MMXC 3BWAB 1EUTA 1OAQL 3QULB 4HIEB 1CLYL 5B3NA 1RZJL 5EC1A 1A7PH 4PR5A 4H26A 4QHUA 2AJSL 5EOCL 3NCJL 4OTXL 3DYPA 4M9PA 4P59L 1U6AH 4YLQT 1VPOH 1AC0A 2NY2D 4DGIL 1M6OB 5FFLA 4WFGE 4MS8D 4O2FB 4UQ3B 2I27N 4YXLH 3TBSA 1DN0A 2EE2A 5FDWA 2EH7H 1LO3L 1JK8B 2ZG3A 32C2B 2FGZA 3JSSA 2D0FA 5LQBH 2H32H 3H7LA 5L2JB 4HWUA 1YNTB 5IFJA 4PJFA 3O41A 4R90H 1A4JB 1AR2A 4P57B 5F70A 2B4CH 2DM2A 2HRPL 1U3JA 1QBMH 1PG7L 2JE8A 4HJ0C 4R4BA 3WEXA 1PYWB 2B20A 1KLGA 4PRBA 4Z7VA 5HD8C 1BJ1H 5FXCH 1G84A 1GC1C 1UM6H 2LU3A 3LHPL 3G08A 1T0NA 2D9CA 4KXZI 4XP9H 2EIBA 3AM8C 4X0KB 4ODWA 1S7SB 1R3IH 2Q76A 5JIHA 1VKXA 2VABB 2AXHA 1G6RB 1NAKH 2VL5A 2YS4A 3JWOH 5EN2A 2FL5A 5D7KE 2EC9T 4TVPE 3KYNB 5IQ9B 2R0ZL 2ATPB 3C09C 4KJPC 4Y4FB 3KGRA 3QRFM 3G6DL 3ALPA 1QBAA 4MJ5B 2FECL 5D4QA 2CDEB 1BQLL 1CDCA 4GRWF 3QUYA 4NKIL 4GMSL 1RUAH 4Y4FA 4OKVB 1CIUA 3JWDC 3SCMB 3T65B 2X4UB 3QNXA 4OFKA 4K8RL 3BAEL 2Y5TA 4P2YA 5DUMH 4MD4A 1IAIM 2JB5H 4NQEA 1GOGA 2DQFA 1I1CA 4Z7WA 2WSKA 3TPKA 2P8LB 5CUSL 4CMHB 3AMKA 5D72H 4DJMA 2HJFA 12E8H 3PWLA 4CL7A 5GRVK 3O3AB 3CVHB 4OZHA 2ZSVA 3LD8C 1OAZH 1W2KT 2DQGH 3TA3D 1ERNA 3DV6A 1FYTA 2X7LA 2XICA 3U30B 1NGZA 4NQEB 3A0OA 1IGTA 3ZTNH 5ICXA 1MFDH 3FB5B 1BWMA 1G9ML 1RZIB 4GKSA 4XBPA 5DWUH 2X44D 5D6DA 3FB8A 2DL2A 4MWFA 4LVOC 4LCWA 1IVLA 4LRNH 3QEGL 3LIZH 4X98A 4LP4A 3WO4B 1HOCB 1K3ZA 3EOAA 1G6RL 1JPSH 4XVUD 3G9AB 1FGVH 1A7PL 3BP7B 3MV8A 3HI5H 4IRSB 2EYRA 3N9GL 3AB0B 2Z93A 3CSPA 4HGMA 2LV4A 1OARH 4APQC 2CJUL 4NRYA 4EN3C 2R0LL 1MWAL 1HYRC 3IF1A 2AXGA 3NOIA 1S7VB 4WDIB 4TPRL 5J13B 4QRPA 5JPMB 3KYKL 3FZUD 5F88B 3QEQA 1A7QH 1I9IH 2LAGB 4NO2A 4RGMC 1OP3H 5I30H 1N7ML 3QWRD 1GGBH 4PRHE 3U0WH 3ZDZF 3OKEB 1F97A 3CFBB 2NY1B 3DI2B 4XCCL 1UA6L 1GXEA 4NC0B 5DJXA 2BNQE 3IYLW 5T5FL 3NCBB 1MFEL 2A6DB 1LK2B 1MHEA 3Q0HA 4NHUA 1BJ1J 4FQ2L 4Q6IC 5E4IA 2ZUSA 4L29A 4Y5YA 2JCCB 3RU8H 1GGTA 4DOHE 5DT1L 5I8KL 5KZCB 1AQKL 1SHMA 1T1ZA 3E0GA 5FF6A 4HQQH 2V9TA 1R3IL 3NH7H 3WLBB 4D9LH 1JGEA 4Q7DA 5IB5B 1FAIH 5JOFB 4JY5L 4X98B 3TVMC 2R9HC 2EC8A 5BXFB 2CRYA 4YZFE 4LBEA 3AVEA 4KI5C 5JPNB 1JI2A 1PDKA 5IROA 2ZNXA 2E3VA 5I0DA 1CFTB 3CZFB 4DTGH 1TZHB 1U8QB 2D3VA 4D9QE 1SY6A 3CCHA 3KLSA 4B7IA 2NY2C 5ESAB 2GT9A 3T1WA 4OF3A 3WFDH 4LSPL 1W72H 5F7FA 2X09A 4J4PD 1YY9C 4PS4L 4UU9B 4G7VH 1FYHB 5IB2A 4Z7VF 4POYA 1YNKH 2A6IA 3P73B 5I8OH 4HGWB 4U1LA 2H2SC 4OGXH 4ZYKB 3GMRA 5J11B 3SGKA 3BP4B 3EYVB 4I0KA 2YSSA 1EH9A 2NZ9D 2YSSB 2V2WA 3QFJE 1WFUA 3UZVB 3V7MA 5KVEH 1CI5A 3NIFE 3MBEA 4YDIH 1P7QB 1AH1A 2BVPB 1R3LA 4XB8A 2HMID 3GJFK 2EDKA 2YRZA 4JQIH 5HYJA 1FNAA 5EZLA 3DVNB 1RUPH 5AZEH 5D1ZB 3RIAF 3FOMB 4JDVA 3HFML 4PJ7B 3RAJH 4KK9C 3F7YA 4Y1AB 4NSKA 3O2WH 5E7FA 4X6DE 3WLWC 5F7YC 4PLOB 2Y07H 4X7DC 3SGEI 5DVLA 4LCCB 1LK3L 2XWBA 3MREA 4I48A 4ZUUB 1Q0XL 4K9EH 3X3FL 2EEDA 3KPQA 4YHYC 2Z91A 5KANG 4F7EB 4IOIA 4MJIE 2D4DA 4HCRL 3FO1B 3GSNA 1E4WL 4KJYB 4H1LH 5HDBF 4CN6A 1OCWL 2H9GA 2JCCF 5E2WL 3MNWB 3MV9E 4HAGA 3KWWB 5EUOB 2VMFA 4AH2B 3B9AA 2HT3C 1AD9B 3BFOA 2FR4B 1LD9B 5HYSG 2X4NB 5IKCA 3BKJL 4WWKA 2QKIA 2OX5A 1HKFA 1JHTA 3U4AA 4XVTL 2X4QB 1AGCB 5E6ID 1I7UB 1P4LA 1FRGH 5T3ZH 4QNPE 2G75A 4HS3A 2HKHH 4U0QB 4WTZA 4GAGL 4WV1A 1PY4A 1L4IA 3LH2L 1KTRL 5JDSB 2OJZH 3K2UH 4KHTH 3VH8A 1YEGH 2PTTB 3DXAB 3KYAA 3C6LA 2YRLA 4OUUA 3GUTB 3LS5L 1A64A 3KVQA 1K6QH 1ZLWK 5F1IB 4OKVA 1KJ2B 3HG1E 5F89B 4OLVL 5CD5D 2PF6A 2WIMA 1KIQB 1KLUA 4LAJH 2EDYA 4NRZA 3VXME 5E0QA 1I9EA 4JFDA 1UB5B 1V7MH 5I0ZA 4NWTH 4HIEA 5E9DA 5JNYA 2A6KA 4L3CB 4Y5VA 2FL5B 3IU4H 4RWYL 4YHPA 3O6FA 4GW4A 1QBLH 2DQJH 4U1GC 4QOKE 1LO0H 2X6MA 4Y5YC 3VRIB 5MENA 3W81A 1GOFA 4P23D 4OSUL 4FABH 2IPUK 1A9EB 1KN4H 3FO2A 4L3EA 2G9HA 2G75B 1A6UL 1MFCH 3I84A 4LLVA 3CVIH 3NA9H 4HPYH 3MTRA 2I5YL 3ZT7A 35C8H 5IMOA 2E7LA 1LE9A 2VITA 3LRSB 3R1GL 1Q9OA 5F1KC 1DJSA 4AT6B 4JCMA 4NQCA 1F2QA 1F6AA 5F7HA 4PJFB 3RBGA 2KKQA 4JFDE 4AT6A 4NZRL 4OD3H 4Y88A 2EEAA 4HQQL 4U2YA 5I1JL 3G5ZA 4KI5D 3WD5H 1EJOL 2WQ8A 5EZOL 1TJIL 3PWLB 4IIQB 4LLVB 5I17B 4XCEA 4XPGH 2FX8H 3DOSA 4PRNA 3OJVC 2ADIB 4L8SB 1IJ9A 4AQOA 2VIRB 4C56D 2AJVH 5D1ZD 3SGKC 4JEGB 2V6HA 1KCSH 1UH3A 5E6IC 2X4UA 3QNXB 3B9KD 4XPBL 1FZJB 4ZNEE 4HIXH 5L8KB 5JTWA 1EVTC 1YPZA 3E8UH 2BJML 2FIRT 4N0YL 1XGTA 3PDDA 4XC3H 3K4AA 4P2OD 1E6JL 2DM7A 2ADIA 4L8SA 1C5CH 5T1KA 4G5ZL 4IMLB 4LVNB 2X89D 4JE4B 3HC4L 4H1LA 4LIQE 2EXWD 4U05A 4Z7NF 3NFPB 5INCA 1XIWC 2DBLL 3DVNA 3TVMD 4NQSB 3X11B 1BQSA 3VXRE 4J1UB 4LSSH 1N26A 1MREH 3IDMA 4CMMB 4A2MA 5SWSE 4RISH 3VFPB 2Y72A 2VKXA 2ORBH 3U82B 4JFEA 4KUCD 5TE4H 4X6FA 4TSCL 1MWAH 1XF1A 4LRIA 2VLRD 2FATL 3S37H 3OG4B 5JIPA 1TPXB 4ZAKA 4UU9A 1L6XA 3UTPE 3MRLA 5EUOF 5ID0B 2JCCA 1EHNA 1UKTA 2J1KA 4K94H 2P5WB 1ZT7B 3U0PB 3CFJA 4PJ7A 3TGXA 3V0VB 1RV6X 1DL7L 4CADB 4BKLA 4JHBA 2YD9A 2ZSWA 1I8MB 5IHBA 2F9BT 1FVEB 5GGVL 2GITA 4U1KB 3LKRB 4U6HB 4PP2A 1CBVL 5IG7B 5LG1A 1CFQA 2PO6D 2F15A 3KNBA 3QPQC 2H32B 4NOFA 1K5NA 4YAQB 1AGDB 4CBPA 3BP4A 4FP8L 4QTHB 1A1OA 4MAYC 4KRPC 2ERJC 1RIVH 1B2WH 2PYEB 3ULUC 1J0ZA 1YUHB 5DURD 1I1FA 3MOQA 1CICA 1WCBB 3FMGL 5D7IF 4PJHF 1S8DB 3NFNB 4WW2A 4I18B 3MC0A 1J18A 3PV7A 4L4VB 1J0HA 1CFQB 1NSNH 3BPLB 4ZFOA 4BQBA 2LTQB 1N5AB 2FSEA 2X2YA 5FGBA 4KDVA 2F58L 1PKOA 3VXPB 3OAUH 4HC1H 5K9KB 1BLNA 3S7GA 3BP6B 4MJ6A 1KPRA 2P7TB 1PX4A 3D2UD 4YHMH 3C2AL 1V3MA 3U4BL 2IPKB 5T5FH 2DIAA 2VC2H 3HC3H 5HHNB 5DRXA 1EXUA 4HIIB 4BQ9A 2ZSVB 1DQMH 3BP7A 3MJ6A 5EZLB 1U2HA 3LHPH 4H1LG 3WSQL 1BFOA 5T3XE 1R3LB 5DA0B 4HIJA 3SCMD 1QFWM 3LY6A 3G6JA 5BVJA 2EDBA 3GBML 3UBXA 3CFDB 2W9EL 3I2CL 4NYLB 2MKWA 1E4XH 3T65A 4PP1C 1C5DB 3KJ4C 4XNMB 1LO5A 2APWA 3WS6C 3DV6B 1XIWB 3L1OL 3EKCA 4YO0A 3BP5B 1TZGH 4XRCA 5JZ7C 2G9HB 4NM8H 4ZO9A 1CD0A 1XGPA 3MV01 4U33A 2VABA 2Y06H 3DUSA 4WU5B 1C08B 4NNXB 3DECA 4QRPD 1IGFL 4HGKC 4LLMA 3TT1H 4ZTPL 5C0GA 4KZEH 4QHNA 4GQ9L 4Q97A 2YEZA 2YZ1A 4R7NB 1BWWA 1A3RL 3K80A 3QCUL 5H2BB 1HINH 5GIRB 4LRIC 5CZKA 3PABB 3KYOA 4F3FA 3QPQD 2FJHB 3CH1B 3EW3B 2BK8A 4C55A 1U42A 4X6DB 5GGSY 3HHRB 3OXRB 5DC9B 4KQ3L 4LK4A 2Z92B 3MGTB 4NNPH 4WO4D 1KNOA 2WK2A 1JF6A 1ORQA 1KNOB 4NN6C 3QP3A 2X4QA 2V17H 4DKEH 4WUUB 4H25B 5HGBA 2VL4A 2ZCLL 3VG0H 1I9RH 5JOEA 4LARL 5DZOA 2IAMA 2XFXB 2VDLH 2AEWA 2GUOA 4NO3B 4QRQA 4LSQH 5DA4A 1LO0L 3T77B 3N06B 4AG4L 3PWNA 3VFVA 3B9KB 4O2EB 1OOAA 3EZJB 1QSEA 1D5ZA 2D7TH 1FQ9C 4PJ7F 4XAKE 5D6CA 4MAYA 1DQQA 2NY3D 1DQTA 2Z8WC 3BD4A 4C56B 2OTUA 4P46A 2AEQL 4OI8A 2P42B 2NZ9C 4TULL 1FFPA 3U6RA 4U7SA 2B39A 4EUPG 3QRGL 1XIWD 5I73B 4MNQD 4GRWB 4KTYA 5ITFA 4HJGB 3P4OB 3IDYB 3EOTH 2YR3A 3SDYH 1Z9LA 1UXSB 1A6VH 3E6FA 4C83A 2BXZA 3HC3L 4MSWB 3B9KA 4P2OC 2VDRL 3UPRA 1MCIA 1FFQA 4PRDB 5E4EB 3FMGH 2IH3B 4FQPA 3PHQA 3HR6A 1IFHL 4YGAB 5KSUB 3DXAE 1BFVH 4PJHA 3NZ8B 4D9LL 4Y89A 2B8OT 5F8QC 5HHVH 4ZYKA 1G0XA 4X7FC 3HB3D 4DOHB 5HHOD 1ZT4A 5FO9B 2ICWJ 4OQ1A 2D31A 4HK0A 5A3IC 2XZQL 4PJDE 4HUVA 1REIA 2VDQL 4LOUD 1A6TB 1D6VL 3MODL 2VLLB 3QQ4A 1YEIH 2C5DC 4EQ3A 4EBQH 5CZVH 1A9BB 1D5BA 4OCXL 1CFTA 1K4CA 2C7UA 4LCUA 3RA7H 4JVWA 5JPNA 5H8DA 1PG7X 1JCKA 2JIXD 3RWGA 1DFBL 5ANMB 4B50A 1A3RH 4M9OA 1RUKL 3ALWA 1Q9WA 1QRND 4PUBH 3D69A 3TZVC 4X7TB 4I48B 4ZUUA 1ND0B 4OV5B 4HKJB 4YDIL 3BN9C 3T0EA 3BPOC 4NO5B 2VLJA 1QNZL 4V1DB 5M95B 2GTWB 1FJ1A 3VU2A 1K8IB 3P77A 4ZTOL 3C6LD 8FABB 5JNYB 1FV1A 2AV7B 1FCCA 4LEXH 2C26A 4OZIA 4BFEA 4Z7VB 4GT7A 1DQLL 4JDVB 4OGYL 5DJDA 2CUIA 1J05B 4X6BB 3HNSH 3BN9D 3JWNC 4EI6A 1S7QA 2X42A 2XWJB 3O6ML 2Y06L 2OL3B 1HQ4B 3QI9A 3DX9B 4R4FL 3AXLB 3OV6A 4K7PY 1T20A 3SHSA 3VH8B 3PWJB 4UAOB 5IVNA 2VZ3A 12E8L 1CGVA 2LABA 2PXYA 5I9QB 4DUWA 1ORSB 4D3CL 2JJSC 1TJGH 2HRLA 1RK0A 1HYSC 3HUJB 3UC0H 4CADA 3ULUE 5B38G 1QZ1A 4J3SA 1B0RA 1FFRA 4XNZB 1T03H 1HHHB 4RFEA 1ZSDA 1LD9A 2GT9B 3UYPA 5TPWL 3V6ZB 2NY3B 4JKPL 3RWDB 5I1CH 1HQRB 4GXVL 3DX6B 5EU3A 3V0WH 5C0ND 3DURB 3RWJB 2B2XL 1DLHB 4ZNCD 3D39B 5EU6A 3QFJA 1BLNB 2YKLL 4K23H 3KLHC 3V5HA 5BRZD 1A14H 4AEFA 2XYCA 3PJSB 3WDHA 1OTSD 4QRUA 4JO4L 1URLA 4QRUB 3OR6B 2FSEB 1AQKH 3ARRA 3O6KL 2WZPD 5DD6A 1IAII 5J6HB 3T2NL 1Z3GL 3SOBH 2H8PA 4TTGA 1RUQL 3O6LL 5ILTL 1LP9F 5GS0D 3BXNA 1HH9B 3RHWF 5ADOL 5F7LB 2VDLL 4BH8A 3PWVB 2BMKB 1AXSB 5B4MC 1Y18A 4M6MH 3RTQB 2BNUA 1OL0A 3O3AA 1RMFL 4ZD3H 2ZP0T 3AY4C 5I16B 3C60C 2WUBL 1LO4L 4JFOB 3KPRA 5I76B 4NP4L 2DQFB 4QXTA 3QRGH 3WIIL 3AXLA 35C8L 1NQBA 3RZCD 5I18H 2F5BL 3G5YA 5IJVA 4JM2A 1HZHL 4CU7A 1LNUA 1MRFL 3CLFL 1M7IA 1Q94B 4JY4A 5JXAH 1U91B 3C5ZC 4CUCA 5A3ID 1AQDA 1IRAY 1YA5A 3QPXH 5EOCJ 4WEBL 5TGBB 1AY1L 3GMOB 2AJZA 4CJ1A 2YD4A 3U79A 4FZEL 5E8NB 3HNTL 4YUEL 4QRRA 2E5EA 1YMMA 2NR6D 1K2DB 2K9UA 3N1PC 4UTBH 5MEPB 4XCEB 4ENEC 5DSCB 4Z8FL 2OI9B 2BNRB 3MBXH 1R3HB 3MLYL 4NZJA 2ATKB 2LFGA 1H3GA 2DYPA 3UTSB 1QSFE 4U3CA 2XNAA 2YUXA 3QFDB 2IF7A 1T04A 1NFDB 3S97C 2MHAA 2Q86B 1YEFH 2GY7B 1S3KH 2CMRH 2DBJA 4Q9CA 1NUDA 3HAEB 4MQXD 4ACPA 1U8IB 1A6WH 2UY7A 3BYTA 3KYMB 3QHZH 5CBAA 1RJYA 4FQIL 3V6BR 2DQDL 1KELH 5DJAA 4RX4A 2BVUA 3DNKA 4HEME 1DLFH 3FN0H 2BY2A 5L8JB 2J8UE 5ELIA 4D0CB 4IMLA 4U0RB 1JPFB 5B38A 2NW2B 4DZBB 4CW1A 4P49A 4PY8J 1TNNA 4OM1H 5DR5L 2FJGA 3L7EB 2APXA 1OGAE 3DSNA 1CT8A 4YEEA 1UZ6F 3QCVL 4IRJD 4DKFH 4OLUL 2R0WH 1I1RA 5ENWA 5DK0A 1ZA3A 2AJYL 5I74B 4WJ5A 5T1DL 2PXYC 2H2PD 2R2CA 1KFAH 3VWKA 3SE8L 2RAMA 3NMEA 2XN9B 3KLAB 2GJ6E 3D25B 5C8JA 3O3EB 5T1MB 3QQ4B 2VLLA 3DROB 3QDGB 4IBLT 3QNYA 4QHLA 1JPFA 5B38B 4XBEH 4XPFL 3RRQA 5DGQA 4C56E 2NY1D 1DR9A 3OGCA 4M7LH 1AHWC 1BZ7B 3TO4B 3O0RL 4PRBB 4JPVL 3F7RA 1IL1B 1OQXA 2F54A 4EIGB 2W59A 4HWBL 4N8VG 3RDTA 2NYYC 4BH7A 3RWFA 1RHFA 1DSFH 2BSSA 1UVQA 1T7YA 1Q38A 4K3DL 1NGWB 5E94A 4OZHE 4UT9L 2IH1A 1BZ7A 3EOBA 3O4OC 3HTLX 1UA6H 4HBCH 4F58L 5C0IB 1N3NB 5DI8B 2Q87A 2HG5A 4GMTH 4LCCC 3BYYA 3FFDA 4G8GD 5FYKL 2LVCA 2DQIH 4Z7UF 3LRGA 3HC0B 1V8HA 4PJ8C 3MRIB 2XKUA 2HT2C 5DQJA 5MERA 1LEKB 1NUFA 5FV2A 5D2LF 2XZAH 4NGHH 1IGML 3ZMRA 4P4KD 4PR5B 2EKJA 5DYOB 2HN7B 2V7HB 5TE6H 2VLRE 3MLZL 1JZ4A 4GBXD 2Z8VC 5GRJL 5C0GB 2AJ3B 5EWIH 2VDMH 4MCZA 1X5GA 5KAQG 3PV6B 5CSZA 5ICYB 3W0WB 4OI7A 3QA3B 5JDSA 2P5EA 4JHWL 2IQ9H 5D2LE 3ZKMC 1KN2H 2YUVA 1ZLVH 2P8PB 1J87A 5F9AC 5J4MA 3GJFH 2P45B 4P5KB 4PS4H 4I0CC 2QL1A 1FO0A 1H0DA 1EBAA 3EOYG 4HXBL 4EOWL 1SYSA 5L2KA 2VC2L 1OSZA 1X9QA 4EDWH 4HS8L 1EK3A 5I6XC 1MVFA 4XPTH 3DIFB