4IMMA

The crystal structure of bamb from moraxella catarrhalis
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
348
structure length
331
Chain Sequence
b'VLTQVSSIRLDQDLQIAPLADGMIAASRSGIVSGYMGESIAWQYNAEDVITGGVGIDDQGSVAVIGTRSGKLIALDARTGAARWVVELASSSLAPALISGDKVIVITNSGTIFGLDINSGATVWQYATQVPNTSVRGMAKPLALDARTVLIGGADGRIHALDTMTGAPVWTRRVGLAMGSGEIDQLRDIDGTPTVVDHYLYAASYSGQLAGFDMTTGRTMFVSELSSTKKLTTLADAVIGSSTDGDVVAFNRMTGEKLWENHDLKYRGLTNPVTIGTYIAVGDADGVVHILNHQGQIISRANTKGALTNLTVINNRLYAQSADGVVTVWQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of translocation complex component BamB from Moraxella catarrhalis
rcsb
molecule keywords Outer membrane assembly lipoprotein YfgL
source organism Moraxella catarrhalis
molecule tags Chaperone
total genus 76
structure length 331
sequence length 348
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13360 PQQ_2 PQQ-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4immA00
2IWKA 5FQDA 3EMHA 2W18A 2Z2OA 2XU7A 3GFCA 2H6QA 3SHFA 1XKSA 2I0SA 3AH8B 4J8GA 5TEEA 4FHLA 2AH1A 2I3SA 2OVQB 1K32A 4FWWA 2GC4A 2H9LA 2AGWA 4ERQA 2Q7QA 4A0AB 1R5MA 1GP2B 4QRJA 2H13A 2P9NC 3I7HA 4K3JB 3NVQA 1P22A 5H14A 4XYIA 2HJBA 2OJYA 4J73A 3E0CA 4IA9A 4GM8A 3UKUC 4L9OA 5FKTA 3OKWA 3F3PA 2B5LA 5CXBB 3AL8A 3UKRC 5FLXg 5K19A 3I2NA 3V9FA 5EMJB 5A2Qg 3IIYA 1N6DA 3UVLA 4X63B 4GQ2P 3EI4B 4KFMB 4GQBB 5FKRA 3VGZA 4J79A 5EMLB 3EI3B 5HQGA 1RI6A 3I7NA 5THAA 5HE1B 4YVDA 4J81A 5TEFA 5B4WA 1N6EA 3SLED 3SVWD 4A08B 4A09B 4H5IA 3I8EA 2CN3A 4CY2A 3CIKB 3PVUB 2B5NA 2G9AA 1JOFA 3MZKA 4GGCA 2GC7A 1NR0A 2YBAA 4JSVC 2XYIA 5CXBA 2P9UC 2IUQA 2B5MA 2IUVA 5EALA 4GM3A 3SBRA 5EM2A 3RFHA 4GMBA 3I7KA 3J81g 2H6NA 2H9MA 3I7LA 1L0QA 1FWXA 2AH0A 2H68A 2YMUA 2CE8A 4K3ID 2PM9A 2XL3A 3JB9L 3V7DB 3N0DA 1VYHC 4JT5C 4CI8A 4L3GD 4FA9D 2GNQA 3U4YA 2PM6B 3UVKA 4A08A 3FGBA 4JT6C 2YNOA 4J78A 4LGNA 1N6FA 4UI9R 3EG6A 3FRXA 3DWLC 2OK6A 4PSXB 5HE2B 1U2VC 4AOWA 3AFCA 3RN0D 3SN6B 3SXTD 2OIZA 5IGQA 3DXMC 4PC0A 5EARA 4E54A 1K8KC 3RSEC 3PXSD 3RRMC 3PE7A 4A2LA 2H3XA 3ULEC 3VA6A 4A11A 3PVWB 3MMYA 4BUJC 1SQJA 1TYQC 5AFU3 5FA5B 5TDHB 2XL2A 4PBYA 3IJCA 4BL0A 4FA5D 2P9LC 3EI1A 5AJAA 1YFQA 2IURA 2YNPA 2Z2PA 2H9NA 5I5JA 3JAMg 4TZ4A 5EMKB 3DSMA 2YB8B 4FA4D 4ZOYA 4J87A 4MK0B 4HDJA 3EU7A 4CI3A 3PXWD 4QL1A 5GSAA 4AEZA 3OKYA 4JSNC 5EM2B 3CFSB 2H47A 3FM0A 4JSPC 3IKOA 2IWFA 3A0FA 4PBZA 1XHMA 4J8BA 4O45A 4JSXC 5JWZA 5FKSA 4CY3A 3HFQA 4ESGA 2I3TA 2J56H 3EWEA 4ZOXA 3C99A 3UVOA 2PM9B 2AGXA 4CY5A 2H9PA 5C9ZB 3GREA 2TRCB 4Y7RA 4J84A 3OKTA 5GXIA 4CC9A 1MG3A 5CXCA 2AGYA 3JROA 5FKQA 2BCJB 4GQ1A 3DM0A 3MKSB 5EAPA 2H6KA 4FAVD 4D6VA 3JZGA 3KRXB 2UZXB 4J0XA 3UR4A 2OK4A 2G99A 3UVMA 5SXMA 4JXMA 4GM9A 3EI2A 3ORVD 4E54B 4U1EI 3ODTA 3SBPA 4ZOZA 3RLMD 4X60B 5C2VB 4A11B 3JPXA 5IGOA 4GZ8A 2J57G 4A0BB 2QXVA 3OW8A 3AL9A 1A0RB 4J0WA 4ERYA 4FB1D 2IUPA 5GMKn 4ES0A 1B9YA 3PSCB 3SBQA 2CE9A 1MDAH 1JJUB 3I89A 3EI1B 4L1QD 3W15A 1JMXB 1JMZB 3VH0A 4J77A 3NVXA 3OKYB 3B7FA 3OTTA 5H17A 3RN1D 3F3GA 4CY1A 3JRPA 1GOTB 4GGDA 1OLZA 4GGAA 5I5IA 4EWRA 4I79A 4CI2A 1PGUA 1NEXB 4CZXA 4QT8A 5HE0B 3JZNA 1SHYB 2PM7B 5C2WB 3NVNA 5EAMA 1GG2B 4A0BA 1XIPA 5EMMB 5CXCB 4A2MA 3C5MA 4E5ZA 3BG1A 3I8CA 2B4EA 5IC7A 2CN2A 3N0EA 2P9IC 2HXCA 2AQ5A 1PI6A 1OMWB 5GXHA 5AMSA 3ZWLB 2AGLA 1SQ9A 4QQEA 3J80g 5IJ8E 3K27A 3EI2B 3IIWA 3K26A 4X61B 5CYKA 3UVNA 1ERJA 4XEIC 4CZYA 4OZUA 4BH6A 4ERZA 3BG0A 3IJ1A 3DXKC 2CNXA 4CZVA 5IT9g 2I0RA 5H1MA 3SJLD 3SWSD 2PBIB 2P9SC 2P9KC 1B9XA 1S4UX 2CO0C 3I7OA 2BBKH 2EBSA 3SMRA 3MZLA 3CFVA 5TF2A 4A7JA 1TBGA 4G56B 4O9DA 2CO0A 2UZYB 2YNNA 4ZOVA 3F3FA 4FA1D 1GXRA 2OVPB 2OVRB 3C75H 1U4CA 4J86A 3MKQA 1Q47A 4CI1A 4PSWB 4PNKB 5FXYA 4ZN4A 3L4MD 4A0AA 2H14A 5I5MA 2AGZA 4IMMA 3SFZA 1MG2A 3OL2B 2HYEA 2I0TA 3I7PA 4LG9A 5KDOB 2IAAA 3KRWB 3BWSA 5IJ7E 2MTAH 3P4FA 4O1QD 2O9KA 3C9CA 4L3HD 3V5WB 4E5ZB 3RFGA 4R7AB 2QC5A 5HYNB 1PBYB 3L4OD 4LG8A 4Y5RD 2HESX 1PEVA 3MXXA 3SCYA 4XYHA 3EI4A 5CYKB 4O3UB 4H5JA 3PSLA 2HKRA 4D0KA 3EI3A 4NSXA 4OWRA 4U7AA 4Z8LA 3RMZD 4JD2C 4FAND 5HE3B 2J55H 4J82A 3JZHA 4O3TB 4PXWA 2P9PC 4A09A 2Z2NA 3IJ0A 5K1CC 4N14A 1QNIA 3OL2A 2HKMA 3PXTD 2HJ4A 3AL8B 4X3EA
chains in the Genus database with same CATH superfamily
2IWKA 5FQDA 3EMHA 2W18A 2Z2OA 2XU7A 3GFCA 4DNUA 2H6QA 3SHFA 1XKSA 4MMZA 3ZE1A 4BP8A 2I0SA 3AH8B 4J8GA 5TEEA 4FHLA 2AH1A 2I3SA 2OVQB 1K32A 4FWWA 2GC4A 2H9LA 2AGWA 4ERQA 2Q7QA 4A0AB 1R5MA 1GP2B 4QRJA 2H13A 2EICA 1C9LA 2P9NC 3I7HA 4K3JB 3NVQA 1P22A 5H14A 4XYIA 3IUNA 2HJBA 2VDRA 3O4IA 2OJYA 5M61A 4J73A 3E0CA 4IA9A 4GM8A 3MUOA 3UKUC 2QZPA 4L9OA 5FKTA 3OKWA 3F3PA 2B5LA 5CXBB 3AL8A 2VZ3A 3ZDYA 3UKRC 4NC4A 5K19A 5FLXg 3I2NA 3O4JA 3V9FA 5EMJB 2BKLA 3IIYA 5A2Qg 1E5TA 1N6DA 3UVLA 4X63B 4GQ2P 3EI4B 4KFMB 4GQBB 3OF7A 1L5GA 5FKRA 3VGZA 4J79A 1U8CA 2WQ8A 1E8MA 3ZE0A 5EMLB 4Z7NA 3EI3B 5HQGA 1GOHA 1RI6A 3I7NA 5THAA 5HE1B 4YVDA 4J81A 5E6SA 5TEFA 5B4WA 1N6EA 2VC2A 3SLED 3SVWD 4A08B 4A09B 4H5IA 3I8EA 2CN3A 2VDMA 1VZ2A 4CY2A 3CIKB 3PVUB 2B5NA 4Z7QA 1GOGA 2G9AA 1JOFA 3MZKA 4GGCA 2GC7A 1NR0A 4G55A 2YBAA 4JSVC 2XYIA 1H2ZA 5CXBA 2P9UC 1H2XA 2IUQA 2B5MA 4AMZA 2IUVA 5EALA 4GM3A 3SBRA 5EM2A 3RFHA 4GMBA 3I7KA 3J81g 2H6NA 4BCCA 3IULA 3IVMA 2H9MA 3IURA 3I7LA 1L0QA 1FWXA 1K3IA 2AH0A 2H68A 2YMUA 2JKXA 2CE8A 4K3ID 2PM9A 2XL3A 3JB9L 4D9SA 3V7DB 3N0DA 1VYHC 4G1EA 4JT5C 4CI8A 4L3GD 4FA9D 2GNQA 3U4YA 2PM6B 3UVKA 4A08A 4UM8A 4DNVA 3FGBA 4JT6C 2YNOA 4J78A 4WK0A 4LGNA 1N6FA 2HU8A 3T3MA 4RE5A 2VZ1A 4UI9R 3EG6A 3FRXA 3O4HA 3DWLC 2OK6A 4PSXB 4QAMA 5HE2B 1U2VC 3DDUA 2EIEA 3AFCA 3RN0D 4AOWA 3SN6B 3SXTD 5M5UA 2OIZA 5IGQA 3DXMC 4JHPC 4PC0A 5EARA 4E54A 1K8KC 3RSEC 4MMXA 4RE6A 3PXSD 1E8NA 3RRMC 3PE7A 4A2LA 2H3XA 3ULEC 3VA6A 4A11A 3PVWB 3MMYA 4O2WA 2XDWA 4BUJC 1SQJA 2VDPA 1TYQC 1JV2A 5AFU3 5FA5B 5TDHB 2XL2A 4PBYA 4Z7OA 1BPOA 3IJCA 4BL0A 4FA5D 2P9LC 3EI1A 5AJAA 1YFQA 2IURA 2YNPA 2Z2PA 2H9NA 5I5JA 3JAMg 4TZ4A 5EMKB 3DSMA 2YB8B 4FA4D 4ZOYA 4J87A 4MK0B 3EQ9A 4HDJA 3EU7A 4CI3A 3PXWD 3NIFA 4QL1A 5GSAA 4AEZA 3OKYA 4JSNC 2HU5A 3VI3A 3CFSB 2H47A 5EM2B 3FM0A 4JSPC 3IKOA 3QI0A 3K71A 2IWFA 3A0FA 2XZGA 4PBZA 1XHMA 4J8BA 4O45A 4JSXC 5JWZA 5E6RA 5FKSA 4CY3A 3HFQA 3IJEA 4ESGA 2I3TA 1O6GA 2J56H 3EWEA 4ZOXA 3ZDXA 2VDLA 3C99A 2VDQA 3O4GA 2PM9B 3UVOA 2AGXA 4CY5A 2H9PA 5C9ZB 3GREA 2TRCB 5C92A 4Y7RA 4J84A 4G1MA 3OKTA 1QFSA 5GXIA 4CC9A 3FCSA 1MG3A 5CXCA 2AGYA 1O6FA 3JROA 5FKQA 2BCJB 4GQ1A 3DM0A 3MKSB 1M1XA 4AN0A 4BCBA 5EAPA 3IUMA 2H6KA 5M5RA 4FAVD 4D6VA 3JZGA 3NIDA 3KRXB 1YR2A 2UZXB 4J0XA 2OK4A 2G99A 3UR4A 3UVMA 4BCDA 5M5SA 5SXMA 4JXMA 4JHNA 4GM9A 3EI2A 3ORVD 3K6SA 4E54B 4U1EI 3ODTA 3SBPA 4WK2A 4ZOZA 3RLMD 4X60B 5C2VB 4A11B 1I2MB 1VE6A 3JPXA 5IGOA 5FFGA 4GZ8A 5M5TA 2J57G 4A0BB 2VDNA 1QFMA 2QXVA 3OW8A 3AL9A 1A0RB 4J0WA 4ERYA 4FB1D 3T3PA 2IUPA 5GMKn 4ES0A 1B9YA 3PSCB 3SBQA 2CE9A 1JJUB 1MDAH 2EIDA 3GC3B 3I89A 3EI1B 4L1QD 3W15A 1JMXB 1UTCA 1JMZB 3VH0A 4J77A 3NVXA 3OKYB 5E6UA 3B7FA 3ZE2A 3OTTA 5H17A 3RN1D 1UOQA 3F3GA 4CY1A 1VZ3A 1GOTB 3JRPA 3FCUA 4GGDA 1OLZA 4GGAA 5I5IA 4EWRA 4I79A 1VE7A 5M5VA 4CI2A 1PGUA 1NEXB 1H2WA 3EQ7A 4CZXA 3EQ8A 4UM9A 4QT8A 3IUQA 5HE0B 3JZNA 1SHYB 3IUJA 2QR5A 2PM7B 5C2WB 1UOOA 3NVNA 5EAMA 1GG2B 3GD1I 4A0BA 1XIPA 5EMMB 5CXCB 4A2MA 3C5MA 4NAAA 4E5ZA 3VI4A 3BG1A 3I8CA 2B4EA 5IC7A 1C9IA 2CN2A 3N0EA 2P9IC 2HXCA 2AQ5A 1PI6A 1OMWB 4O02A 4WJKA 5GXHA 5AMSA 3ZWLB 1TYEA 1GOFA 2AGLA 1SQ9A 1A12A 4QQEA 3J80g 5IJ8E 3K27A 4DNWA 3EI2B 3IIWA 3K26A 4X61B 5CYKA 3UVNA 1ERJA 2XE4A 2VDKA 4XEIC 4CZYA 2EIBA 4OZUA 4BH6A 4ERZA 3BG0A 3IJ1A 3DXKC 2CNXA 4CZVA 5IT9g 2I0RA 5H1MA 3SJLD 3SWSD 2PBIB 2P9SC 2P9KC 4NENA 3NIGA 1B9XA 1S4UX 2CO0C 4BP9A 4WK4A 3I7OA 2BBKH 2EBSA 3SMRA 3MZLA 3CFVA 5TF2A 4A7JA 1TBGA 4G56B 4O9DA 2CO0A 2UZYB 2YNNA 5HDBA 4ZOVA 3F3FA 4FA1D 1GXRA 2OVPB 2OVRB 3C75H 1U4CA 4J86A 3MKQA 1Q47A 4CI1A 4PSWB 4PNKB 3MVDK 5FXYA 4ZN4A 3L4MD 4A0AA 2H14A 1T2XA 3V4PA 5I5MA 2AGZA 4IMMA 3SFZA 1MG2A 3OL2B 2HYEA 4AX4A 2I0TA 3I7PA 4LG9A 5KDOB 2IAAA 3K72A 3KRWB 3BWSA 4MMYA 4IRZA 3QHYB 4AMYA 2HU7A 4L1MA 5IJ7E 2MTAH 3P4FA 4O1QD 2O9KA 3C9CA 4L3HD 3V5WB 4E5ZB 3RFGA 2VDOA 4R7AB 2QC5A 3ZDZA 5HYNB 1PBYB 3L4OD 4LG8A 4Y5RD 2HESX 1PEVA 3MXXA 3SCYA 4XYHA 3EI4A 5CYKB 5C86A 4O3UB 1JTDB 4H5JA 4AN1A 3PSLA 2HKRA 4D0KA 1UOPA 3EI3A 4NSXA 4OWRA 4U7AA 4Z8LA 3RMZD 5FFOA 4JD2C 3V4VA 3MUNA 4FAND 5HE3B 2J55H 4J82A 3JZHA 1H2YA 4O3TB 4PXWA 2P9PC 3KCIA 4A09A 2Z2NA 3IJ0A 5K1CC 4NBMA 4N14A 1QNIA 3OL2A 2HKMA 3PXTD 2HJ4A 3AL8B 4X3EA
chains in the Genus database with same CATH topology
2IWKA 5FQDA 3EMHA 2W18A 2Z2OA 2XU7A 3GFCA 2H6QA 3SHFA 1XKSA 2I0SA 3AH8B 4J8GA 5TEEA 4FHLA 2AH1A 2I3SA 2OVQB 1K32A 4FWWA 2GC4A 2H9LA 2AGWA 4ERQA 2Q7QA 4A0AB 1R5MA 1GP2B 4QRJA 2H13A 2P9NC 3I7HA 4K3JB 3NVQA 1P22A 5H14A 4XYIA 2HJBA 2OJYA 4J73A 3E0CA 4IA9A 4GM8A 3UKUC 4L9OA 5FKTA 3OKWA 3F3PA 2B5LA 5CXBB 3AL8A 3UKRC 5FLXg 5K19A 3I2NA 3V9FA 5EMJB 5A2Qg 3IIYA 1N6DA 3UVLA 4X63B 4GQ2P 3EI4B 4KFMB 4GQBB 5FKRA 3VGZA 4J79A 5EMLB 3EI3B 5HQGA 1RI6A 3I7NA 5THAA 5HE1B 4YVDA 4J81A 5TEFA 5B4WA 1N6EA 3SLED 3SVWD 4A08B 4A09B 4H5IA 3I8EA 2CN3A 4CY2A 3CIKB 3PVUB 2B5NA 2G9AA 1JOFA 3MZKA 4GGCA 2GC7A 1NR0A 2YBAA 4JSVC 2XYIA 5CXBA 2P9UC 2IUQA 2B5MA 2IUVA 5EALA 4GM3A 3SBRA 5EM2A 3RFHA 4GMBA 3I7KA 3J81g 2H6NA 2H9MA 3I7LA 1L0QA 1FWXA 2AH0A 2H68A 2YMUA 2CE8A 4K3ID 2PM9A 2XL3A 3JB9L 3V7DB 3N0DA 1VYHC 4JT5C 4CI8A 4L3GD 4FA9D 2GNQA 3U4YA 2PM6B 3UVKA 4A08A 3FGBA 4JT6C 2YNOA 4J78A 4LGNA 1N6FA 4UI9R 3EG6A 3FRXA 3DWLC 2OK6A 4PSXB 5HE2B 1U2VC 4AOWA 3AFCA 3RN0D 3SN6B 3SXTD 2OIZA 5IGQA 3DXMC 4PC0A 5EARA 4E54A 1K8KC 3RSEC 3PXSD 3RRMC 3PE7A 4A2LA 2H3XA 3ULEC 3VA6A 4A11A 3PVWB 3MMYA 4BUJC 1SQJA 1TYQC 5AFU3 5FA5B 5TDHB 2XL2A 4PBYA 3IJCA 4BL0A 4FA5D 2P9LC 3EI1A 5AJAA 1YFQA 2IURA 2YNPA 2Z2PA 2H9NA 5I5JA 3JAMg 4TZ4A 5EMKB 3DSMA 2YB8B 4FA4D 4ZOYA 4J87A 4MK0B 4HDJA 3EU7A 4CI3A 3PXWD 4QL1A 5GSAA 4AEZA 3OKYA 4JSNC 5EM2B 3CFSB 2H47A 3FM0A 4JSPC 3IKOA 2IWFA 3A0FA 4PBZA 1XHMA 4J8BA 4O45A 4JSXC 5JWZA 5FKSA 4CY3A 3HFQA 4ESGA 2I3TA 2J56H 3EWEA 4ZOXA 3C99A 3UVOA 2PM9B 2AGXA 4CY5A 2H9PA 5C9ZB 3GREA 2TRCB 4Y7RA 4J84A 3OKTA 5GXIA 4CC9A 1MG3A 5CXCA 2AGYA 3JROA 5FKQA 2BCJB 4GQ1A 3DM0A 3MKSB 5EAPA 2H6KA 4FAVD 4D6VA 3JZGA 3KRXB 2UZXB 4J0XA 3UR4A 2OK4A 2G99A 3UVMA 5SXMA 4JXMA 4GM9A 3EI2A 3ORVD 4E54B 4U1EI 3ODTA 3SBPA 4ZOZA 3RLMD 4X60B 5C2VB 4A11B 3JPXA 5IGOA 4GZ8A 2J57G 4A0BB 2QXVA 3OW8A 3AL9A 1A0RB 4J0WA 4ERYA 4FB1D 2IUPA 5GMKn 4ES0A 1B9YA 3PSCB 3SBQA 2CE9A 1MDAH 1JJUB 3I89A 3EI1B 4L1QD 3W15A 1JMXB 1JMZB 3VH0A 4J77A 3NVXA 3OKYB 3B7FA 3OTTA 5H17A 3RN1D 3F3GA 4CY1A 3JRPA 1GOTB 4GGDA 1OLZA 4GGAA 5I5IA 4EWRA 4I79A 4CI2A 1PGUA 1NEXB 4CZXA 4QT8A 5HE0B 3JZNA 1SHYB 2PM7B 5C2WB 3NVNA 5EAMA 1GG2B 4A0BA 1XIPA 5EMMB 5CXCB 4A2MA 3C5MA 4E5ZA 3BG1A 3I8CA 2B4EA 5IC7A 2CN2A 3N0EA 2P9IC 2HXCA 2AQ5A 1PI6A 1OMWB 5GXHA 5AMSA 3ZWLB 2AGLA 1SQ9A 4QQEA 3J80g 5IJ8E 3K27A 3EI2B 3IIWA 3K26A 4X61B 5CYKA 3UVNA 1ERJA 4XEIC 4CZYA 4OZUA 4BH6A 4ERZA 3BG0A 3IJ1A 3DXKC 2CNXA 4CZVA 5IT9g 2I0RA 5H1MA 3SJLD 3SWSD 2PBIB 2P9SC 2P9KC 1B9XA 1S4UX 2CO0C 3I7OA 2BBKH 2EBSA 3SMRA 3MZLA 3CFVA 5TF2A 4A7JA 1TBGA 4G56B 4O9DA 2CO0A 2UZYB 2YNNA 4ZOVA 3F3FA 4FA1D 1GXRA 2OVPB 2OVRB 3C75H 1U4CA 4J86A 3MKQA 1Q47A 4CI1A 4PSWB 4PNKB 5FXYA 4ZN4A 3L4MD 4A0AA 2H14A 5I5MA 2AGZA 4IMMA 3SFZA 1MG2A 3OL2B 2HYEA 2I0TA 3I7PA 4LG9A 5KDOB 2IAAA 3KRWB 3BWSA 5IJ7E 2MTAH 3P4FA 4O1QD 2O9KA 3C9CA 4L3HD 3V5WB 4E5ZB 3RFGA 4R7AB 2QC5A 5HYNB 1PBYB 3L4OD 4LG8A 4Y5RD 2HESX 1PEVA 3MXXA 3SCYA 4XYHA 3EI4A 5CYKB 4O3UB 4H5JA 3PSLA 2HKRA 4D0KA 3EI3A 4NSXA 4OWRA 4U7AA 4Z8LA 3RMZD 4JD2C 4FAND 5HE3B 2J55H 4J82A 3JZHA 4O3TB 4PXWA 2P9PC 4A09A 2Z2NA 3IJ0A 5K1CC 4N14A 1QNIA 3OL2A 2HKMA 3PXTD 2HJ4A 3AL8B 4X3EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IWK A;  5FQD A;  3EMH A;  2W18 A;  2Z2O A;  2XU7 A;  3GFC A;  2H6Q A;  3SHF A;  1XKS A;  2I0S A;  3AH8 B;  4J8G A;  5TEE A;  4FHL A;  2AH1 A;  2I3S A;  2OVQ B;  1K32 A;  4FWW A;  2GC4 A;  2H9L A;  2AGW A;  4ERQ A;  2Q7Q A;  4A0A B;  1R5M A;  1GP2 B;  4QRJ A;  2H13 A;  2P9N C;  3I7H A;  4K3J B;  3NVQ A;  1P22 A;  5H14 A;  4XYI A;  2HJB A;  2OJY A;  4J73 A;  3E0C A;  4IA9 A;  4GM8 A;  3UKU C;  4L9O A;  5FKT A;  3OKW A;  3F3P A;  2B5L A;  5CXB B;  3AL8 A;  3UKR C;  5FLX g;  5K19 A;  3I2N A;  3V9F A;  5EMJ B;  5A2Q g;  3IIY A;  1N6D A;  3UVL A;  4X63 B;  4GQ2 P;  3EI4 B;  4KFM B;  4GQB B;  5FKR A;  3VGZ A;  4J79 A;  5EML B;  3EI3 B;  5HQG A;  1RI6 A;  3I7N A;  5THA A;  5HE1 B;  4YVD A;  4J81 A;  5TEF A;  5B4W A;  1N6E A;  3SLE D;  3SVW D;  4A08 B;  4A09 B;  4H5I A;  3I8E A;  2CN3 A;  4CY2 A;  3CIK B;  3PVU B;  2B5N A;  2G9A A;  1JOF A;  3MZK A;  4GGC A;  2GC7 A;  1NR0 A;  2YBA A;  4JSV C;  2XYI A;  5CXB A;  2P9U C;  2IUQ A;  2B5M A;  2IUV A;  5EAL A;  4GM3 A;  3SBR A;  5EM2 A;  3RFH A;  4GMB A;  3I7K A;  3J81 g;  2H6N A;  2H9M A;  3I7L A;  1L0Q A;  1FWX A;  2AH0 A;  2H68 A;  2YMU A;  2CE8 A;  4K3I D;  2PM9 A;  2XL3 A;  3JB9 L;  3V7D B;  3N0D A;  1VYH C;  4JT5 C;  4CI8 A;  4L3G D;  4FA9 D;  2GNQ A;  3U4Y A;  2PM6 B;  3UVK A;  4A08 A;  3FGB A;  4JT6 C;  2YNO A;  4J78 A;  4LGN A;  1N6F A;  4UI9 R;  3EG6 A;  3FRX A;  3DWL C;  2OK6 A;  4PSX B;  5HE2 B;  1U2V C;  4AOW A;  3AFC A;  3RN0 D;  3SN6 B;  3SXT D;  2OIZ A;  5IGQ A;  3DXM C;  4PC0 A;  5EAR A;  4E54 A;  1K8K C;  3RSE C;  3PXS D;  3RRM C;  3PE7 A;  4A2L A;  2H3X A;  3ULE C;  3VA6 A;  4A11 A;  3PVW B;  3MMY A;  4BUJ C;  1SQJ A;  1TYQ C;  5AFU 3;  5FA5 B;  5TDH B;  2XL2 A;  4PBY A;  3IJC A;  4BL0 A;  4FA5 D;  2P9L C;  3EI1 A;  5AJA A;  1YFQ A;  2IUR A;  2YNP A;  2Z2P A;  2H9N A;  5I5J A;  3JAM g;  4TZ4 A;  5EMK B;  3DSM A;  2YB8 B;  4FA4 D;  4ZOY A;  4J87 A;  4MK0 B;  4HDJ A;  3EU7 A;  4CI3 A;  3PXW D;  4QL1 A;  5GSA A;  4AEZ A;  3OKY A;  4JSN C;  5EM2 B;  3CFS B;  2H47 A;  3FM0 A;  4JSP C;  3IKO A;  2IWF A;  3A0F A;  4PBZ A;  1XHM A;  4J8B A;  4O45 A;  4JSX C;  5JWZ A;  5FKS A;  4CY3 A;  3HFQ A;  4ESG A;  2I3T A;  2J56 H;  3EWE A;  4ZOX A;  3C99 A;  3UVO A;  2PM9 B;  2AGX A;  4CY5 A;  2H9P A;  5C9Z B;  3GRE A;  2TRC B;  4Y7R A;  4J84 A;  3OKT A;  5GXI A;  4CC9 A;  1MG3 A;  5CXC A;  2AGY A;  3JRO A;  5FKQ A;  2BCJ B;  4GQ1 A;  3DM0 A;  3MKS B;  5EAP A;  2H6K A;  4FAV D;  4D6V A;  3JZG A;  3KRX B;  2UZX B;  4J0X A;  3UR4 A;  2OK4 A;  2G99 A;  3UVM A;  5SXM A;  4JXM A;  4GM9 A;  3EI2 A;  3ORV D;  4E54 B;  4U1E I;  3ODT A;  3SBP A;  4ZOZ A;  3RLM D;  4X60 B;  5C2V B;  4A11 B;  3JPX A;  5IGO A;  4GZ8 A;  2J57 G;  4A0B B;  2QXV A;  3OW8 A;  3AL9 A;  1A0R B;  4J0W A;  4ERY A;  4FB1 D;  2IUP A;  5GMK n;  4ES0 A;  1B9Y A;  3PSC B;  3SBQ A;  2CE9 A;  1MDA H;  1JJU B;  3I89 A;  3EI1 B;  4L1Q D;  3W15 A;  1JMX B;  1JMZ B;  3VH0 A;  4J77 A;  3NVX A;  3OKY B;  3B7F A;  3OTT A;  5H17 A;  3RN1 D;  3F3G A;  4CY1 A;  3JRP A;  1GOT B;  4GGD A;  1OLZ A;  4GGA A;  5I5I A;  4EWR A;  4I79 A;  4CI2 A;  1PGU A;  1NEX B;  4CZX A;  4QT8 A;  5HE0 B;  3JZN A;  1SHY B;  2PM7 B;  5C2W B;  3NVN A;  5EAM A;  1GG2 B;  4A0B A;  1XIP A;  5EMM B;  5CXC B;  4A2M A;  3C5M A;  4E5Z A;  3BG1 A;  3I8C A;  2B4E A;  5IC7 A;  2CN2 A;  3N0E A;  2P9I C;  2HXC A;  2AQ5 A;  1PI6 A;  1OMW B;  5GXH A;  5AMS A;  3ZWL B;  2AGL A;  1SQ9 A;  4QQE A;  3J80 g;  5IJ8 E;  3K27 A;  3EI2 B;  3IIW A;  3K26 A;  4X61 B;  5CYK A;  3UVN A;  1ERJ A;  4XEI C;  4CZY A;  4OZU A;  4BH6 A;  4ERZ A;  3BG0 A;  3IJ1 A;  3DXK C;  2CNX A;  4CZV A;  5IT9 g;  2I0R A;  5H1M A;  3SJL D;  3SWS D;  2PBI B;  2P9S C;  2P9K C;  1B9X A;  1S4U X;  2CO0 C;  3I7O A;  2BBK H;  2EBS A;  3SMR A;  3MZL A;  3CFV A;  5TF2 A;  4A7J A;  1TBG A;  4G56 B;  4O9D A;  2CO0 A;  2UZY B;  2YNN A;  4ZOV A;  3F3F A;  4FA1 D;  1GXR A;  2OVP B;  2OVR B;  3C75 H;  1U4C A;  4J86 A;  3MKQ A;  1Q47 A;  4CI1 A;  4PSW B;  4PNK B;  5FXY A;  4ZN4 A;  3L4M D;  4A0A A;  2H14 A;  5I5M A;  2AGZ A;  4IMM A;  3SFZ A;  1MG2 A;  3OL2 B;  2HYE A;  2I0T A;  3I7P A;  4LG9 A;  5KDO B;  2IAA A;  3KRW B;  3BWS A;  5IJ7 E;  2MTA H;  3P4F A;  4O1Q D;  2O9K A;  3C9C A;  4L3H D;  3V5W B;  4E5Z B;  3RFG A;  4R7A B;  2QC5 A;  5HYN B;  1PBY B;  3L4O D;  4LG8 A;  4Y5R D;  2HES X;  1PEV A;  3MXX A;  3SCY A;  4XYH A;  3EI4 A;  5CYK B;  4O3U B;  4H5J A;  3PSL A;  2HKR A;  4D0K A;  3EI3 A;  4NSX A;  4OWR A;  4U7A A;  4Z8L A;  3RMZ D;  4JD2 C;  4FAN D;  5HE3 B;  2J55 H;  4J82 A;  3JZH A;  4O3T B;  4PXW A;  2P9P C;  4A09 A;  2Z2N A;  3IJ0 A;  5K1C C;  4N14 A;  1QNI A;  3OL2 A;  2HKM A;  3PXT D;  2HJ4 A;  3AL8 B;  4X3E A; 
#chains in the Genus database with same CATH topology
 2IWK A;  5FQD A;  3EMH A;  2W18 A;  2Z2O A;  2XU7 A;  3GFC A;  4DNU A;  2H6Q A;  3SHF A;  1XKS A;  4MMZ A;  3ZE1 A;  4BP8 A;  2I0S A;  3AH8 B;  4J8G A;  5TEE A;  4FHL A;  2AH1 A;  2I3S A;  2OVQ B;  1K32 A;  4FWW A;  2GC4 A;  2H9L A;  2AGW A;  4ERQ A;  2Q7Q A;  4A0A B;  1R5M A;  1GP2 B;  4QRJ A;  2H13 A;  2EIC A;  1C9L A;  2P9N C;  3I7H A;  4K3J B;  3NVQ A;  1P22 A;  5H14 A;  4XYI A;  3IUN A;  2HJB A;  2VDR A;  3O4I A;  2OJY A;  5M61 A;  4J73 A;  3E0C A;  4IA9 A;  4GM8 A;  3MUO A;  3UKU C;  2QZP A;  4L9O A;  5FKT A;  3OKW A;  3F3P A;  2B5L A;  5CXB B;  3AL8 A;  2VZ3 A;  3ZDY A;  3UKR C;  4NC4 A;  5K19 A;  5FLX g;  3I2N A;  3O4J A;  3V9F A;  5EMJ B;  2BKL A;  3IIY A;  5A2Q g;  1E5T A;  1N6D A;  3UVL A;  4X63 B;  4GQ2 P;  3EI4 B;  4KFM B;  4GQB B;  3OF7 A;  1L5G A;  5FKR A;  3VGZ A;  4J79 A;  1U8C A;  2WQ8 A;  1E8M A;  3ZE0 A;  5EML B;  4Z7N A;  3EI3 B;  5HQG A;  1GOH A;  1RI6 A;  3I7N A;  5THA A;  5HE1 B;  4YVD A;  4J81 A;  5E6S A;  5TEF A;  5B4W A;  1N6E A;  2VC2 A;  3SLE D;  3SVW D;  4A08 B;  4A09 B;  4H5I A;  3I8E A;  2CN3 A;  2VDM A;  1VZ2 A;  4CY2 A;  3CIK B;  3PVU B;  2B5N A;  4Z7Q A;  1GOG A;  2G9A A;  1JOF A;  3MZK A;  4GGC A;  2GC7 A;  1NR0 A;  4G55 A;  2YBA A;  4JSV C;  2XYI A;  1H2Z A;  5CXB A;  2P9U C;  1H2X A;  2IUQ A;  2B5M A;  4AMZ A;  2IUV A;  5EAL A;  4GM3 A;  3SBR A;  5EM2 A;  3RFH A;  4GMB A;  3I7K A;  3J81 g;  2H6N A;  4BCC A;  3IUL A;  3IVM A;  2H9M A;  3IUR A;  3I7L A;  1L0Q A;  1FWX A;  1K3I A;  2AH0 A;  2H68 A;  2YMU A;  2JKX A;  2CE8 A;  4K3I D;  2PM9 A;  2XL3 A;  3JB9 L;  4D9S A;  3V7D B;  3N0D A;  1VYH C;  4G1E A;  4JT5 C;  4CI8 A;  4L3G D;  4FA9 D;  2GNQ A;  3U4Y A;  2PM6 B;  3UVK A;  4A08 A;  4UM8 A;  4DNV A;  3FGB A;  4JT6 C;  2YNO A;  4J78 A;  4WK0 A;  4LGN A;  1N6F A;  2HU8 A;  3T3M A;  4RE5 A;  2VZ1 A;  4UI9 R;  3EG6 A;  3FRX A;  3O4H A;  3DWL C;  2OK6 A;  4PSX B;  4QAM A;  5HE2 B;  1U2V C;  3DDU A;  2EIE A;  3AFC A;  3RN0 D;  4AOW A;  3SN6 B;  3SXT D;  5M5U A;  2OIZ A;  5IGQ A;  3DXM C;  4JHP C;  4PC0 A;  5EAR A;  4E54 A;  1K8K C;  3RSE C;  4MMX A;  4RE6 A;  3PXS D;  1E8N A;  3RRM C;  3PE7 A;  4A2L A;  2H3X A;  3ULE C;  3VA6 A;  4A11 A;  3PVW B;  3MMY A;  4O2W A;  2XDW A;  4BUJ C;  1SQJ A;  2VDP A;  1TYQ C;  1JV2 A;  5AFU 3;  5FA5 B;  5TDH B;  2XL2 A;  4PBY A;  4Z7O A;  1BPO A;  3IJC A;  4BL0 A;  4FA5 D;  2P9L C;  3EI1 A;  5AJA A;  1YFQ A;  2IUR A;  2YNP A;  2Z2P A;  2H9N A;  5I5J A;  3JAM g;  4TZ4 A;  5EMK B;  3DSM A;  2YB8 B;  4FA4 D;  4ZOY A;  4J87 A;  4MK0 B;  3EQ9 A;  4HDJ A;  3EU7 A;  4CI3 A;  3PXW D;  3NIF A;  4QL1 A;  5GSA A;  4AEZ A;  3OKY A;  4JSN C;  2HU5 A;  3VI3 A;  3CFS B;  2H47 A;  5EM2 B;  3FM0 A;  4JSP C;  3IKO A;  3QI0 A;  3K71 A;  2IWF A;  3A0F A;  2XZG A;  4PBZ A;  1XHM A;  4J8B A;  4O45 A;  4JSX C;  5JWZ A;  5E6R A;  5FKS A;  4CY3 A;  3HFQ A;  3IJE A;  4ESG A;  2I3T A;  1O6G A;  2J56 H;  3EWE A;  4ZOX A;  3ZDX A;  2VDL A;  3C99 A;  2VDQ A;  3O4G A;  2PM9 B;  3UVO A;  2AGX A;  4CY5 A;  2H9P A;  5C9Z B;  3GRE A;  2TRC B;  5C92 A;  4Y7R A;  4J84 A;  4G1M A;  3OKT A;  1QFS A;  5GXI A;  4CC9 A;  3FCS A;  1MG3 A;  5CXC A;  2AGY A;  1O6F A;  3JRO A;  5FKQ A;  2BCJ B;  4GQ1 A;  3DM0 A;  3MKS B;  1M1X A;  4AN0 A;  4BCB A;  5EAP A;  3IUM A;  2H6K A;  5M5R A;  4FAV D;  4D6V A;  3JZG A;  3NID A;  3KRX B;  1YR2 A;  2UZX B;  4J0X A;  2OK4 A;  2G99 A;  3UR4 A;  3UVM A;  4BCD A;  5M5S A;  5SXM A;  4JXM A;  4JHN A;  4GM9 A;  3EI2 A;  3ORV D;  3K6S A;  4E54 B;  4U1E I;  3ODT A;  3SBP A;  4WK2 A;  4ZOZ A;  3RLM D;  4X60 B;  5C2V B;  4A11 B;  1I2M B;  1VE6 A;  3JPX A;  5IGO A;  5FFG A;  4GZ8 A;  5M5T A;  2J57 G;  4A0B B;  2VDN A;  1QFM A;  2QXV A;  3OW8 A;  3AL9 A;  1A0R B;  4J0W A;  4ERY A;  4FB1 D;  3T3P A;  2IUP A;  5GMK n;  4ES0 A;  1B9Y A;  3PSC B;  3SBQ A;  2CE9 A;  1JJU B;  1MDA H;  2EID A;  3GC3 B;  3I89 A;  3EI1 B;  4L1Q D;  3W15 A;  1JMX B;  1UTC A;  1JMZ B;  3VH0 A;  4J77 A;  3NVX A;  3OKY B;  5E6U A;  3B7F A;  3ZE2 A;  3OTT A;  5H17 A;  3RN1 D;  1UOQ A;  3F3G A;  4CY1 A;  1VZ3 A;  1GOT B;  3JRP A;  3FCU A;  4GGD A;  1OLZ A;  4GGA A;  5I5I A;  4EWR A;  4I79 A;  1VE7 A;  5M5V A;  4CI2 A;  1PGU A;  1NEX B;  1H2W A;  3EQ7 A;  4CZX A;  3EQ8 A;  4UM9 A;  4QT8 A;  3IUQ A;  5HE0 B;  3JZN A;  1SHY B;  3IUJ A;  2QR5 A;  2PM7 B;  5C2W B;  1UOO A;  3NVN A;  5EAM A;  1GG2 B;  3GD1 I;  4A0B A;  1XIP A;  5EMM B;  5CXC B;  4A2M A;  3C5M A;  4NAA A;  4E5Z A;  3VI4 A;  3BG1 A;  3I8C A;  2B4E A;  5IC7 A;  1C9I A;  2CN2 A;  3N0E A;  2P9I C;  2HXC A;  2AQ5 A;  1PI6 A;  1OMW B;  4O02 A;  4WJK A;  5GXH A;  5AMS A;  3ZWL B;  1TYE A;  1GOF A;  2AGL A;  1SQ9 A;  1A12 A;  4QQE A;  3J80 g;  5IJ8 E;  3K27 A;  4DNW A;  3EI2 B;  3IIW A;  3K26 A;  4X61 B;  5CYK A;  3UVN A;  1ERJ A;  2XE4 A;  2VDK A;  4XEI C;  4CZY A;  2EIB A;  4OZU A;  4BH6 A;  4ERZ A;  3BG0 A;  3IJ1 A;  3DXK C;  2CNX A;  4CZV A;  5IT9 g;  2I0R A;  5H1M A;  3SJL D;  3SWS D;  2PBI B;  2P9S C;  2P9K C;  4NEN A;  3NIG A;  1B9X A;  1S4U X;  2CO0 C;  4BP9 A;  4WK4 A;  3I7O A;  2BBK H;  2EBS A;  3SMR A;  3MZL A;  3CFV A;  5TF2 A;  4A7J A;  1TBG A;  4G56 B;  4O9D A;  2CO0 A;  2UZY B;  2YNN A;  5HDB A;  4ZOV A;  3F3F A;  4FA1 D;  1GXR A;  2OVP B;  2OVR B;  3C75 H;  1U4C A;  4J86 A;  3MKQ A;  1Q47 A;  4CI1 A;  4PSW B;  4PNK B;  3MVD K;  5FXY A;  4ZN4 A;  3L4M D;  4A0A A;  2H14 A;  1T2X A;  3V4P A;  5I5M A;  2AGZ A;  4IMM A;  3SFZ A;  1MG2 A;  3OL2 B;  2HYE A;  4AX4 A;  2I0T A;  3I7P A;  4LG9 A;  5KDO B;  2IAA A;  3K72 A;  3KRW B;  3BWS A;  4MMY A;  4IRZ A;  3QHY B;  4AMY A;  2HU7 A;  4L1M A;  5IJ7 E;  2MTA H;  3P4F A;  4O1Q D;  2O9K A;  3C9C A;  4L3H D;  3V5W B;  4E5Z B;  3RFG A;  2VDO A;  4R7A B;  2QC5 A;  3ZDZ A;  5HYN B;  1PBY B;  3L4O D;  4LG8 A;  4Y5R D;  2HES X;  1PEV A;  3MXX A;  3SCY A;  4XYH A;  3EI4 A;  5CYK B;  5C86 A;  4O3U B;  1JTD B;  4H5J A;  4AN1 A;  3PSL A;  2HKR A;  4D0K A;  1UOP A;  3EI3 A;  4NSX A;  4OWR A;  4U7A A;  4Z8L A;  3RMZ D;  5FFO A;  4JD2 C;  3V4V A;  3MUN A;  4FAN D;  5HE3 B;  2J55 H;  4J82 A;  3JZH A;  1H2Y A;  4O3T B;  4PXW A;  2P9P C;  3KCI A;  4A09 A;  2Z2N A;  3IJ0 A;  5K1C C;  4NBM A;  4N14 A;  1QNI A;  3OL2 A;  2HKM A;  3PXT D;  2HJ4 A;  3AL8 B;  4X3E A; 
#chains in the Genus database with same CATH homology
 2IWK A;  5FQD A;  3EMH A;  2W18 A;  2Z2O A;  2XU7 A;  3GFC A;  2H6Q A;  3SHF A;  1XKS A;  2I0S A;  3AH8 B;  4J8G A;  5TEE A;  4FHL A;  2AH1 A;  2I3S A;  2OVQ B;  1K32 A;  4FWW A;  2GC4 A;  2H9L A;  2AGW A;  4ERQ A;  2Q7Q A;  4A0A B;  1R5M A;  1GP2 B;  4QRJ A;  2H13 A;  2P9N C;  3I7H A;  4K3J B;  3NVQ A;  1P22 A;  5H14 A;  4XYI A;  2HJB A;  2OJY A;  4J73 A;  3E0C A;  4IA9 A;  4GM8 A;  3UKU C;  4L9O A;  5FKT A;  3OKW A;  3F3P A;  2B5L A;  5CXB B;  3AL8 A;  3UKR C;  5FLX g;  5K19 A;  3I2N A;  3V9F A;  5EMJ B;  5A2Q g;  3IIY A;  1N6D A;  3UVL A;  4X63 B;  4GQ2 P;  3EI4 B;  4KFM B;  4GQB B;  5FKR A;  3VGZ A;  4J79 A;  5EML B;  3EI3 B;  5HQG A;  1RI6 A;  3I7N A;  5THA A;  5HE1 B;  4YVD A;  4J81 A;  5TEF A;  5B4W A;  1N6E A;  3SLE D;  3SVW D;  4A08 B;  4A09 B;  4H5I A;  3I8E A;  2CN3 A;  4CY2 A;  3CIK B;  3PVU B;  2B5N A;  2G9A A;  1JOF A;  3MZK A;  4GGC A;  2GC7 A;  1NR0 A;  2YBA A;  4JSV C;  2XYI A;  5CXB A;  2P9U C;  2IUQ A;  2B5M A;  2IUV A;  5EAL A;  4GM3 A;  3SBR A;  5EM2 A;  3RFH A;  4GMB A;  3I7K A;  3J81 g;  2H6N A;  2H9M A;  3I7L A;  1L0Q A;  1FWX A;  2AH0 A;  2H68 A;  2YMU A;  2CE8 A;  4K3I D;  2PM9 A;  2XL3 A;  3JB9 L;  3V7D B;  3N0D A;  1VYH C;  4JT5 C;  4CI8 A;  4L3G D;  4FA9 D;  2GNQ A;  3U4Y A;  2PM6 B;  3UVK A;  4A08 A;  3FGB A;  4JT6 C;  2YNO A;  4J78 A;  4LGN A;  1N6F A;  4UI9 R;  3EG6 A;  3FRX A;  3DWL C;  2OK6 A;  4PSX B;  5HE2 B;  1U2V C;  4AOW A;  3AFC A;  3RN0 D;  3SN6 B;  3SXT D;  2OIZ A;  5IGQ A;  3DXM C;  4PC0 A;  5EAR A;  4E54 A;  1K8K C;  3RSE C;  3PXS D;  3RRM C;  3PE7 A;  4A2L A;  2H3X A;  3ULE C;  3VA6 A;  4A11 A;  3PVW B;  3MMY A;  4BUJ C;  1SQJ A;  1TYQ C;  5AFU 3;  5FA5 B;  5TDH B;  2XL2 A;  4PBY A;  3IJC A;  4BL0 A;  4FA5 D;  2P9L C;  3EI1 A;  5AJA A;  1YFQ A;  2IUR A;  2YNP A;  2Z2P A;  2H9N A;  5I5J A;  3JAM g;  4TZ4 A;  5EMK B;  3DSM A;  2YB8 B;  4FA4 D;  4ZOY A;  4J87 A;  4MK0 B;  4HDJ A;  3EU7 A;  4CI3 A;  3PXW D;  4QL1 A;  5GSA A;  4AEZ A;  3OKY A;  4JSN C;  5EM2 B;  3CFS B;  2H47 A;  3FM0 A;  4JSP C;  3IKO A;  2IWF A;  3A0F A;  4PBZ A;  1XHM A;  4J8B A;  4O45 A;  4JSX C;  5JWZ A;  5FKS A;  4CY3 A;  3HFQ A;  4ESG A;  2I3T A;  2J56 H;  3EWE A;  4ZOX A;  3C99 A;  3UVO A;  2PM9 B;  2AGX A;  4CY5 A;  2H9P A;  5C9Z B;  3GRE A;  2TRC B;  4Y7R A;  4J84 A;  3OKT A;  5GXI A;  4CC9 A;  1MG3 A;  5CXC A;  2AGY A;  3JRO A;  5FKQ A;  2BCJ B;  4GQ1 A;  3DM0 A;  3MKS B;  5EAP A;  2H6K A;  4FAV D;  4D6V A;  3JZG A;  3KRX B;  2UZX B;  4J0X A;  3UR4 A;  2OK4 A;  2G99 A;  3UVM A;  5SXM A;  4JXM A;  4GM9 A;  3EI2 A;  3ORV D;  4E54 B;  4U1E I;  3ODT A;  3SBP A;  4ZOZ A;  3RLM D;  4X60 B;  5C2V B;  4A11 B;  3JPX A;  5IGO A;  4GZ8 A;  2J57 G;  4A0B B;  2QXV A;  3OW8 A;  3AL9 A;  1A0R B;  4J0W A;  4ERY A;  4FB1 D;  2IUP A;  5GMK n;  4ES0 A;  1B9Y A;  3PSC B;  3SBQ A;  2CE9 A;  1MDA H;  1JJU B;  3I89 A;  3EI1 B;  4L1Q D;  3W15 A;  1JMX B;  1JMZ B;  3VH0 A;  4J77 A;  3NVX A;  3OKY B;  3B7F A;  3OTT A;  5H17 A;  3RN1 D;  3F3G A;  4CY1 A;  3JRP A;  1GOT B;  4GGD A;  1OLZ A;  4GGA A;  5I5I A;  4EWR A;  4I79 A;  4CI2 A;  1PGU A;  1NEX B;  4CZX A;  4QT8 A;  5HE0 B;  3JZN A;  1SHY B;  2PM7 B;  5C2W B;  3NVN A;  5EAM A;  1GG2 B;  4A0B A;  1XIP A;  5EMM B;  5CXC B;  4A2M A;  3C5M A;  4E5Z A;  3BG1 A;  3I8C A;  2B4E A;  5IC7 A;  2CN2 A;  3N0E A;  2P9I C;  2HXC A;  2AQ5 A;  1PI6 A;  1OMW B;  5GXH A;  5AMS A;  3ZWL B;  2AGL A;  1SQ9 A;  4QQE A;  3J80 g;  5IJ8 E;  3K27 A;  3EI2 B;  3IIW A;  3K26 A;  4X61 B;  5CYK A;  3UVN A;  1ERJ A;  4XEI C;  4CZY A;  4OZU A;  4BH6 A;  4ERZ A;  3BG0 A;  3IJ1 A;  3DXK C;  2CNX A;  4CZV A;  5IT9 g;  2I0R A;  5H1M A;  3SJL D;  3SWS D;  2PBI B;  2P9S C;  2P9K C;  1B9X A;  1S4U X;  2CO0 C;  3I7O A;  2BBK H;  2EBS A;  3SMR A;  3MZL A;  3CFV A;  5TF2 A;  4A7J A;  1TBG A;  4G56 B;  4O9D A;  2CO0 A;  2UZY B;  2YNN A;  4ZOV A;  3F3F A;  4FA1 D;  1GXR A;  2OVP B;  2OVR B;  3C75 H;  1U4C A;  4J86 A;  3MKQ A;  1Q47 A;  4CI1 A;  4PSW B;  4PNK B;  5FXY A;  4ZN4 A;  3L4M D;  4A0A A;  2H14 A;  5I5M A;  2AGZ A;  4IMM A;  3SFZ A;  1MG2 A;  3OL2 B;  2HYE A;  2I0T A;  3I7P A;  4LG9 A;  5KDO B;  2IAA A;  3KRW B;  3BWS A;  5IJ7 E;  2MTA H;  3P4F A;  4O1Q D;  2O9K A;  3C9C A;  4L3H D;  3V5W B;  4E5Z B;  3RFG A;  4R7A B;  2QC5 A;  5HYN B;  1PBY B;  3L4O D;  4LG8 A;  4Y5R D;  2HES X;  1PEV A;  3MXX A;  3SCY A;  4XYH A;  3EI4 A;  5CYK B;  4O3U B;  4H5J A;  3PSL A;  2HKR A;  4D0K A;  3EI3 A;  4NSX A;  4OWR A;  4U7A A;  4Z8L A;  3RMZ D;  4JD2 C;  4FAN D;  5HE3 B;  2J55 H;  4J82 A;  3JZH A;  4O3T B;  4PXW A;  2P9P C;  4A09 A;  2Z2N A;  3IJ0 A;  5K1C C;  4N14 A;  1QNI A;  3OL2 A;  2HKM A;  3PXT D;  2HJ4 A;  3AL8 B;  4X3E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...