4IMMA

The crystal structure of bamb from moraxella catarrhalis
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
348
structure length
331
Chain Sequence
VLTQVSSIRLDQDLQIAPLADGMIAASRSGIVSGYMGESIAWQYNAEDVITGGVGIDDQGSVAVIGTRSGKLIALDARTGAARWVVELASSSLAPALISGDKVIVITNSGTIFGLDINSGATVWQYATQVPNTSVRGMAKPLALDARTVLIGGADGRIHALDTMTGAPVWTRRVGLAMGSGEIDQLRDIDGTPTVVDHYLYAASYSGQLAGFDMTTGRTMFVSELSSTKKLTTLADAVIGSSTDGDVVAFNRMTGEKLWENHDLKYRGLTNPVTIGTYIAVGDADGVVHILNHQGQIISRANTKGALTNLTVINNRLYAQSADGVVTVWQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane assembly lipoprotein YfgL
publication title The crystal structure of translocation complex component BamB from Moraxella catarrhalis
rcsb
source organism Moraxella catarrhalis
molecule tags Chaperone
total genus 76
structure length 331
sequence length 348
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13360 PQQ_2 PQQ-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4immA00
3EWEA 5CYKA 5GXIA 4XYIA 2P9SC 2UZYB 2XYIA 3UVNA 5GMKn 3UKUC 1MDAH 4GM9A 3I8EA 2I3TA 2I3SA 1PGUA 3CFVA 3EI1A 3SJLD 5EAPA 4AOWA 4I79A 3UKRC 4U1EI 3IIWA 3SBRA 4FHLA 4CZYA 3MZLA 4IA9A 2AH0A 3FM0A 3ORVD 4K3ID 3GREA 3OL2B 4J81A 2H9LA 3CIKB 5IC7A 2YNNA 1U4CA 1GP2B 4O3TB 2OVQB 3IIYA 3IJ1A 5TF2A 1RI6A 2H6NA 4ZOZA 2I0RA 2HESX 5CXBB 5EMJB 3RLMD 2GC4A 3DWLC 5AMSA 1JJUB 4L3HD 4J77A 4J82A 2H14A 5HE1B 3RSEC 2HKRA 4FAND 3JB9L 3OL2A 3ODTA 2IUQA 4GZ8A 4QL1A 3IJCA 4JT6C 3RFHA 4FA9D 3EG6A 4LG9A 3SMRA 4H5IA 2PBIB 3ULEC 4FA4D 1K8KC 5GSAA 2J57G 5CXBA 3SLED 3FRXA 3UVOA 5FKSA 5EALA 3I7OA 2UZXB 4J73A 4JSVC 4A08B 4GM3A 1MG2A 4ZOXA 2B5LA 5FXYA 3NVXA 5JWZA 2Z2OA 1JMZB 3RFGA 2OIZA 5H17A 2OK6A 5EMMB 2HXCA 3MZKA 3PVUB 4A08A 1SQJA 1XHMA 4HDJA 4BH6A 1OMWB 4O1QD 5H14A 3BG0A 3I7LA 4J86A 4CI3A 3VH0A 1R5MA 1N6EA 5FKQA 3UR4A 4LG8A 4ESGA 3J80g 3DSMA 2IUVA 5KDOB 4KFMB 4J84A 2CO0A 2J55H 3EI3B 4XYHA 1NEXB 4LGNA 3AL9A 1JOFA 2HJBA 3P4FA 5HYNB 2XL3A 2I0SA 4CY5A 4X61B 5EM2B 3SBQA 5FLXg 2HJ4A 4GQ1A 1PI6A 1TBGA 2B4EA 4JSNC 3EI3A 3NVQA 4BL0A 1XKSA 4E5ZB 2P9LC 2OVRB 3K26A 3KRWB 2AGLA 3I8CA 4ERQA 3PXSD 4H5JA 4GGCA 4O45A 1JMXB 2P9UC 2QC5A 4FAVD 5EM2A 3UVLA 4Y7RA 3MKQA 4GGAA 2G99A 3C99A 3CFSB 4YVDA 3OKTA 4J0XA 2XU7A 5EARA 5A2Qg 4R7AB 5TEEA 3L4MD 4J87A 3KRXB 5FKRA 4D0KA 3VA6A 4E5ZA 4E54B 2AGWA 1QNIA 2O9KA 4JD2C 2P9NC 4O9DA 3SN6B 3B7FA 5B4WA 1B9XA 2H6QA 3C9CA 4N14A 4GGDA 3NVNA 4X3EA 3GFCA 2BBKH 3F3PA 2IWFA 3SVWD 1TYQC 2Q7QA 4JT5C 2XL2A 4E54A 5AJAA 2IURA 4AEZA 5IJ8E 2B5NA 1L0QA 3SBPA 2YBAA 2GNQA 4J78A 4U7AA 4CZXA 3V7DB 4X63B 3A0FA 2YMUA 2OVPB 3IJ0A 2TRCB 3EMHA 2AGYA 3V9FA 3SCYA 2CNXA 3SXTD 5GXHA 1PBYB 1VYHC 3JZNA 1FWXA 3N0DA 3E0CA 5IJ7E 5THAA 3JPXA 4A0BB 1MG3A 1N6FA 2MTAH 4JSPC 4OWRA 4A2LA 4PBYA 3PXTD 5IGQA 1GOTB 3JRPA 5C9ZB 3OTTA 3L4OD 3V5WB 3AH8B 4UI9R 1U2VC 3MMYA 4CZVA 3C5MA 4CI2A 2CO0C 5TEFA 3F3FA 1YFQA 5C2WB 4Y5RD 4JSXC 4GM8A 3EI4B 2PM6B 1NR0A 4IMMA 3EU7A 4A0BA 1Q47A 2CN3A 4A09B 3I2NA 4PNKB 2H6KA 1N6DA 4QRJA 3JAMg 3DM0A 2P9KC 5I5IA 1GG2B 5HE2B 4L3GD 2B5MA 4K3JB 2J56H 3VGZA 2H9NA 2Z2NA 3FGBA 3EI4A 3MKSB 4J0WA 4ERYA 2H3XA 3MXXA 5AFU3 1P22A 2GC7A 2QXVA 4L1QD 4A09A 3JROA 5C2VB 2H13A 4BUJC 3F3GA 4O3UB 3OKWA 1PEVA 2YNPA 4FWWA 5SXMA 3SFZA 1B9YA 2Z2PA 5FKTA 3PSLA 3JZHA 3SHFA 3I7KA 2OJYA 4D6VA 2CN2A 3U4YA 2H9PA 4ES0A 4QQEA 3OKYB 3DXMC 3J81g 4ERZA 4GMBA 1SQ9A 1A0RB 5IGOA 3AFCA 5I5MA 3PE7A 4JXMA 4A0AB 4J8GA 2AGXA 3C75H 4EWRA 3JZGA 1K32A 4PXWA 3PXWD 3BWSA 2HKMA 1XIPA 4PSXB 1GXRA 2AGZA 3OKYA 5EMLB 2H68A 3DXKC 2PM7B 3RRMC 4FA5D 4GQ2P 2P9IC 4A0AA 3RN1D 2BCJB 2HYEA 4TZ4A 4L9OA 5EAMA 3IKOA 4OZUA 2H47A 1OLZA 4XEIC 3W15A 1SHYB 5CXCB 3OW8A 5K19A 3N0EA 3EI2B 5TDHB 3K27A 4Z8LA 3BG1A 4ZOYA 4A11B 2AQ5A 3I7PA 2AH1A 1S4UX 4GQBB 2OK4A 3RN0D 3AL8B 1ERJA 3SWSD 4CY2A 4X60B 5IT9g 4CI8A 4J79A 4A7JA 5EMKB 4ZN4A 2H9MA 4CC9A 3PVWB 5CXCA 4FA1D 2IUPA 3I7NA 4PBZA 3EI2A 4PSWB 5K1CC 4CY3A 4CI1A 5FA5B 2PM9B 4G56B 2W18A 4A11A 4CY1A 2YB8B 3AL8A 5HE3B 4NSXA 4FB1D 2CE9A 4PC0A 2IAAA 5CYKB 2G9AA 3I7HA 2YNOA 2CE8A 2IWKA 5I5JA 3UVMA 3RMZD 4J8BA 3ZWLB 5FQDA 3UVKA 4A2MA 2P9PC 2I0TA 3HFQA 3EI1B 4MK0B 2PM9A 4ZOVA 5H1MA 2EBSA 5HE0B 3PSCB 5HQGA 4QT8A 3I89A
chains in the Genus database with same CATH superfamily
3EWEA 5CYKA 5GXIA 4XYIA 2P9SC 2UZYB 2XYIA 3UVNA 5GMKn 3UKUC 3IUQA 1MDAH 4GM9A 3I8EA 2I3TA 2I3SA 1PGUA 3CFVA 3ZDYA 3EI1A 3SJLD 5EAPA 4AOWA 1H2YA 4I79A 3UKRC 4U1EI 4Z7NA 3IUJA 2HU5A 3IIWA 3SBRA 4FHLA 1M1XA 4CZYA 3MZLA 4IA9A 2AH0A 3DDUA 3FM0A 3ORVD 4K3ID 3GREA 3OL2B 4J81A 2H9LA 3CIKB 5IC7A 4G1EA 2YNNA 1U4CA 1GP2B 4O3TB 2OVQB 3IIYA 3IJ1A 2HU8A 5TF2A 1RI6A 2H6NA 4ZOZA 2I0RA 2HESX 4O02A 5CXBB 5EMJB 1JV2A 2VDRA 3RLMD 4MMZA 2GC4A 3DWLC 5AMSA 1JJUB 4L3HD 4J77A 4J82A 2H14A 5HE1B 3RSEC 2HKRA 4FAND 3JB9L 3OL2A 3ODTA 1YR2A 2EIBA 2IUQA 4GZ8A 2QZPA 4QL1A 3IJCA 4JT6C 3RFHA 4FA9D 3EG6A 4LG9A 3SMRA 4H5IA 2PBIB 3ZDXA 3ULEC 4FA4D 1K8KC 2VC2A 5GSAA 2J57G 5CXBA 3SLED 3FRXA 3UVOA 5FKSA 5EALA 3I7OA 4AMZA 2UZXB 4DNVA 4J73A 1UOOA 4JSVC 5M61A 4A08B 4GM3A 1MG2A 1VZ2A 3O4JA 3K6SA 4ZOXA 2B5LA 5FXYA 3NVXA 3GD1I 2Z2OA 5JWZA 5E6UA 1O6GA 1JMZB 3RFGA 2OIZA 1BPOA 5H17A 1JTDB 2OK6A 5EMMB 3T3MA 4BP9A 2HXCA 3MZKA 3PVUB 2VDQA 4A08A 1SQJA 1XHMA 4HDJA 4RE5A 1E5TA 4BH6A 5M5TA 1OMWB 4O1QD 1C9LA 5H14A 2VDLA 5M5RA 4UM9A 3BG0A 3I7LA 4J86A 4CI3A 3VH0A 1R5MA 4WK2A 1N6EA 5FKQA 3UR4A 4LG8A 4ESGA 3J80g 3DSMA 2IUVA 5KDOB 4KFMB 4J84A 2EICA 5FFOA 2CO0A 2J55H 3EI3B 3T3PA 4XYHA 1NEXB 2VDMA 3AL9A 4LGNA 1JOFA 3IUMA 4G55A 2HJBA 3P4FA 5HYNB 2XL3A 2I0SA 4CY5A 4X61B 5EM2B 1GOFA 3SBQA 2VZ3A 5FLXg 2HJ4A 4GQ1A 1PI6A 1TBGA 2XE4A 4AX4A 2B4EA 4JSNC 3EI3A 3NVQA 4BL0A 1XKSA 4AN1A 4E5ZB 2P9LC 2OVRB 3K26A 3KRWB 4WJKA 2AGLA 3I8CA 4BCDA 3PXSD 4ERQA 4H5JA 4GGCA 4O45A 1JMXB 2P9UC 2QC5A 1I2MB 4G1MA 4FAVD 5E6RA 4L1MA 1QFSA 5EM2A 3UVLA 4BCCA 4Y7RA 3MKQA 4GGAA 1QFMA 2G99A 3C99A 3CFSB 4YVDA 3OKTA 3MUOA 4J0XA 2XU7A 5EARA 5A2Qg 3NIDA 4R7AB 3ZDZA 5TEEA 3L4MD 4J87A 3K72A 3KRXB 5FKRA 4D0KA 3VA6A 4E5ZA 4E54B 5E6SA 2AGWA 4RE6A 1QNIA 2O9KA 4JD2C 2P9NC 4O9DA 3SN6B 3B7FA 5B4WA 1B9XA 2H6QA 1T2XA 3C9CA 4N14A 4GGDA 3NVNA 3V4PA 4X3EA 3GFCA 2BBKH 1UOQA 3F3PA 2IWFA 3SVWD 1TYQC 2Q7QA 4JT5C 2XL2A 4E54A 5AJAA 2IURA 4BCBA 4AEZA 5IJ8E 2B5NA 1L0QA 3VI4A 3SBPA 3ZE1A 2YBAA 5C92A 2GNQA 2XDWA 4J78A 4U7AA 4CZXA 3V7DB 4O2WA 4X63B 3A0FA 2YMUA 2OVPB 3IJ0A 2TRCB 1H2ZA 3EMHA 3MUNA 2AGYA 3V9FA 3SCYA 2CNXA 3SXTD 5GXHA 1PBYB 1VYHC 4DNUA 3JZNA 1FWXA 3N0DA 3E0CA 5IJ7E 5THAA 3JPXA 4A0BB 1MG3A 1N6FA 2MTAH 4JSPC 4OWRA 4A2LA 1H2XA 4PBYA 3PXTD 5IGQA 1GOTB 3JRPA 5C9ZB 3QI0A 3OTTA 3L4OD 3V5WB 2JKXA 3AH8B 4UI9R 1UOPA 1U2VC 3MMYA 4CZVA 3VI3A 3C5MA 3FCSA 4CI2A 2CO0C 5TEFA 3F3FA 1YFQA 5C2WB 4Y5RD 4JSXC 3IUNA 4GM8A 3EI4B 2PM6B 1NR0A 4IMMA 1VZ3A 3EU7A 3EQ7A 4A0BA 1Q47A 2VDPA 3EQ9A 2CN3A 4A09B 3ZE0A 3I2NA 4NENA 4PNKB 2H6KA 1N6DA 4QRJA 3JAMg 2HU7A 3DM0A 2P9KC 5I5IA 3KCIA 1GG2B 5HE2B 4L3GD 2QR5A 3IJEA 2B5MA 4K3JB 1E8NA 2J56H 3VGZA 2H9NA 2VDOA 1O6FA 2Z2NA 3FGBA 3EI4A 1L5GA 3MKSB 4J0WA 4ERYA 1VE7A 2EIEA 2H3XA 1GOHA 3MXXA 5AFU3 3FCUA 1P22A 2GC7A 2QXVA 4L1QD 4A09A 4JHNA 3JROA 1C9IA 2VZ1A 5C2VB 2H13A 4BUJC 3F3GA 4DNWA 4MMXA 4O3UB 3OKWA 1PEVA 3MVDK 1UTCA 2YNPA 4FWWA 5SXMA 3SFZA 1B9YA 2Z2PA 5FKTA 3PSLA 5FFGA 3JZHA 3SHFA 3I7KA 2OJYA 4D6VA 2CN2A 3U4YA 2H9PA 1E8MA 4ES0A 4NC4A 3O4IA 4QQEA 3OKYB 3DXMC 3ZE2A 3J81g 3NIGA 4ERZA 4GMBA 4NAAA 1SQ9A 4WK4A 3O4HA 1A0RB 4JHPC 5IGOA 3AFCA 5I5MA 3PE7A 1H2WA 4JXMA 4A0AB 4J8GA 4QAMA 1TYEA 2AGXA 3C75H 4EWRA 3JZGA 1K32A 4PXWA 3PXWD 1GOGA 3BWSA 4IRZA 2HKMA 1XIPA 4AN0A 4PSXB 4BP8A 1GXRA 2AGZA 3OKYA 5EMLB 4NBMA 4Z7OA 1K3IA 2H68A 3DXKC 2PM7B 3RRMC 1A12A 4FA5D 4GQ2P 2P9IC 4Z7QA 4A0AA 3RN1D 2BCJB 2HYEA 2EIDA 4TZ4A 5HDBA 4L9OA 5EAMA 3IKOA 4OZUA 5M5VA 2H47A 1OLZA 4XEIC 3W15A 4UM8A 1SHYB 5CXCB 4D9SA 3OW8A 5K19A 3V4VA 3N0EA 3EI2B 5TDHB 3K27A 3IULA 3QHYB 4Z8LA 3BG1A 4ZOYA 3EQ8A 2AQ5A 3I7PA 4A11B 4WK0A 2AH1A 1S4UX 4GQBB 2OK4A 3OF7A 3AL8B 1ERJA 3RN0D 4MMYA 3SWSD 4CY2A 4X60B 5IT9g 4CI8A 4J79A 4A7JA 1U8CA 5EMKB 4ZN4A 2H9MA 3IVMA 4CC9A 3O4GA 3PVWB 5CXCA 4FA1D 2IUPA 3I7NA 4PBZA 2VDKA 3EI2A 5C86A 4PSWB 5K1CC 4CY3A 4CI1A 5M5SA 5FA5B 2PM9B 4G56B 2W18A 4A11A 4CY1A 2YB8B 3AL8A 5HE3B 4NSXA 3NIFA 2WQ8A 4FB1D 2CE9A 4AMYA 4PC0A 2IAAA 3GC3B 5CYKB 2G9AA 3I7HA 3K71A 2YNOA 2VDNA 2CE8A 2IWKA 2XZGA 5I5JA 3UVMA 3RMZD 3IURA 4J8BA 3ZWLB 5M5UA 5FQDA 3UVKA 4A2MA 2P9PC 2I0TA 3HFQA 3EI1B 4MK0B 2PM9A 4ZOVA 2BKLA 5H1MA 2EBSA 5HE0B 3PSCB 5HQGA 4QT8A 3I89A 1VE6A
chains in the Genus database with same CATH topology
3EWEA 5CYKA 5GXIA 4XYIA 2P9SC 2UZYB 2XYIA 3UVNA 5GMKn 3UKUC 1MDAH 4GM9A 3I8EA 2I3TA 2I3SA 1PGUA 3CFVA 3EI1A 3SJLD 5EAPA 4AOWA 4I79A 3UKRC 4U1EI 3IIWA 3SBRA 4FHLA 4CZYA 3MZLA 4IA9A 2AH0A 3FM0A 3ORVD 4K3ID 3GREA 3OL2B 4J81A 2H9LA 3CIKB 5IC7A 2YNNA 1U4CA 1GP2B 4O3TB 2OVQB 3IIYA 3IJ1A 5TF2A 1RI6A 2H6NA 4ZOZA 2I0RA 2HESX 5CXBB 5EMJB 3RLMD 2GC4A 3DWLC 5AMSA 1JJUB 4L3HD 4J77A 4J82A 2H14A 5HE1B 3RSEC 2HKRA 4FAND 3JB9L 3OL2A 3ODTA 2IUQA 4GZ8A 4QL1A 3IJCA 4JT6C 3RFHA 4FA9D 3EG6A 4LG9A 3SMRA 4H5IA 2PBIB 3ULEC 4FA4D 1K8KC 5GSAA 2J57G 5CXBA 3SLED 3FRXA 3UVOA 5FKSA 5EALA 3I7OA 2UZXB 4J73A 4JSVC 4A08B 4GM3A 1MG2A 4ZOXA 2B5LA 5FXYA 3NVXA 5JWZA 2Z2OA 1JMZB 3RFGA 2OIZA 5H17A 2OK6A 5EMMB 2HXCA 3MZKA 3PVUB 4A08A 1SQJA 1XHMA 4HDJA 4BH6A 1OMWB 4O1QD 5H14A 3BG0A 3I7LA 4J86A 4CI3A 3VH0A 1R5MA 1N6EA 5FKQA 3UR4A 4LG8A 4ESGA 3J80g 3DSMA 2IUVA 5KDOB 4KFMB 4J84A 2CO0A 2J55H 3EI3B 4XYHA 1NEXB 4LGNA 3AL9A 1JOFA 2HJBA 3P4FA 5HYNB 2XL3A 2I0SA 4CY5A 4X61B 5EM2B 3SBQA 5FLXg 2HJ4A 4GQ1A 1PI6A 1TBGA 2B4EA 4JSNC 3EI3A 3NVQA 4BL0A 1XKSA 4E5ZB 2P9LC 2OVRB 3K26A 3KRWB 2AGLA 3I8CA 4ERQA 3PXSD 4H5JA 4GGCA 4O45A 1JMXB 2P9UC 2QC5A 4FAVD 5EM2A 3UVLA 4Y7RA 3MKQA 4GGAA 2G99A 3C99A 3CFSB 4YVDA 3OKTA 4J0XA 2XU7A 5EARA 5A2Qg 4R7AB 5TEEA 3L4MD 4J87A 3KRXB 5FKRA 4D0KA 3VA6A 4E5ZA 4E54B 2AGWA 1QNIA 2O9KA 4JD2C 2P9NC 4O9DA 3SN6B 3B7FA 5B4WA 1B9XA 2H6QA 3C9CA 4N14A 4GGDA 3NVNA 4X3EA 3GFCA 2BBKH 3F3PA 2IWFA 3SVWD 1TYQC 2Q7QA 4JT5C 2XL2A 4E54A 5AJAA 2IURA 4AEZA 5IJ8E 2B5NA 1L0QA 3SBPA 2YBAA 2GNQA 4J78A 4U7AA 4CZXA 3V7DB 4X63B 3A0FA 2YMUA 2OVPB 3IJ0A 2TRCB 3EMHA 2AGYA 3V9FA 3SCYA 2CNXA 3SXTD 5GXHA 1PBYB 1VYHC 3JZNA 1FWXA 3N0DA 3E0CA 5IJ7E 5THAA 3JPXA 4A0BB 1MG3A 1N6FA 2MTAH 4JSPC 4OWRA 4A2LA 4PBYA 3PXTD 5IGQA 1GOTB 3JRPA 5C9ZB 3OTTA 3L4OD 3V5WB 3AH8B 4UI9R 1U2VC 3MMYA 4CZVA 3C5MA 4CI2A 2CO0C 5TEFA 3F3FA 1YFQA 5C2WB 4Y5RD 4JSXC 4GM8A 3EI4B 2PM6B 1NR0A 4IMMA 3EU7A 4A0BA 1Q47A 2CN3A 4A09B 3I2NA 4PNKB 2H6KA 1N6DA 4QRJA 3JAMg 3DM0A 2P9KC 5I5IA 1GG2B 5HE2B 4L3GD 2B5MA 4K3JB 2J56H 3VGZA 2H9NA 2Z2NA 3FGBA 3EI4A 3MKSB 4J0WA 4ERYA 2H3XA 3MXXA 5AFU3 1P22A 2GC7A 2QXVA 4L1QD 4A09A 3JROA 5C2VB 2H13A 4BUJC 3F3GA 4O3UB 3OKWA 1PEVA 2YNPA 4FWWA 5SXMA 3SFZA 1B9YA 2Z2PA 5FKTA 3PSLA 3JZHA 3SHFA 3I7KA 2OJYA 4D6VA 2CN2A 3U4YA 2H9PA 4ES0A 4QQEA 3OKYB 3DXMC 3J81g 4ERZA 4GMBA 1SQ9A 1A0RB 5IGOA 3AFCA 5I5MA 3PE7A 4JXMA 4A0AB 4J8GA 2AGXA 3C75H 4EWRA 3JZGA 1K32A 4PXWA 3PXWD 3BWSA 2HKMA 1XIPA 4PSXB 1GXRA 2AGZA 3OKYA 5EMLB 2H68A 3DXKC 2PM7B 3RRMC 4FA5D 4GQ2P 2P9IC 4A0AA 3RN1D 2BCJB 2HYEA 4TZ4A 4L9OA 5EAMA 3IKOA 4OZUA 2H47A 1OLZA 4XEIC 3W15A 1SHYB 5CXCB 3OW8A 5K19A 3N0EA 3EI2B 5TDHB 3K27A 4Z8LA 3BG1A 4ZOYA 4A11B 2AQ5A 3I7PA 2AH1A 1S4UX 4GQBB 2OK4A 3RN0D 3AL8B 1ERJA 3SWSD 4CY2A 4X60B 5IT9g 4CI8A 4J79A 4A7JA 5EMKB 4ZN4A 2H9MA 4CC9A 3PVWB 5CXCA 4FA1D 2IUPA 3I7NA 4PBZA 3EI2A 4PSWB 5K1CC 4CY3A 4CI1A 5FA5B 2PM9B 4G56B 2W18A 4A11A 4CY1A 2YB8B 3AL8A 5HE3B 4NSXA 4FB1D 2CE9A 4PC0A 2IAAA 5CYKB 2G9AA 3I7HA 2YNOA 2CE8A 2IWKA 5I5JA 3UVMA 3RMZD 4J8BA 3ZWLB 5FQDA 3UVKA 4A2MA 2P9PC 2I0TA 3HFQA 3EI1B 4MK0B 2PM9A 4ZOVA 5H1MA 2EBSA 5HE0B 3PSCB 5HQGA 4QT8A 3I89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EWE A;  5CYK A;  5GXI A;  4XYI A;  2P9S C;  2UZY B;  2XYI A;  3UVN A;  5GMK n;  3UKU C;  1MDA H;  4GM9 A;  3I8E A;  2I3T A;  2I3S A;  1PGU A;  3CFV A;  3EI1 A;  3SJL D;  5EAP A;  4AOW A;  4I79 A;  3UKR C;  4U1E I;  3IIW A;  3SBR A;  4FHL A;  4CZY A;  3MZL A;  4IA9 A;  2AH0 A;  3FM0 A;  3ORV D;  4K3I D;  3GRE A;  3OL2 B;  4J81 A;  2H9L A;  3CIK B;  5IC7 A;  2YNN A;  1U4C A;  1GP2 B;  4O3T B;  2OVQ B;  3IIY A;  3IJ1 A;  5TF2 A;  1RI6 A;  2H6N A;  4ZOZ A;  2I0R A;  2HES X;  5CXB B;  5EMJ B;  3RLM D;  2GC4 A;  3DWL C;  5AMS A;  1JJU B;  4L3H D;  4J77 A;  4J82 A;  2H14 A;  5HE1 B;  3RSE C;  2HKR A;  4FAN D;  3JB9 L;  3OL2 A;  3ODT A;  2IUQ A;  4GZ8 A;  4QL1 A;  3IJC A;  4JT6 C;  3RFH A;  4FA9 D;  3EG6 A;  4LG9 A;  3SMR A;  4H5I A;  2PBI B;  3ULE C;  4FA4 D;  1K8K C;  5GSA A;  2J57 G;  5CXB A;  3SLE D;  3FRX A;  3UVO A;  5FKS A;  5EAL A;  3I7O A;  2UZX B;  4J73 A;  4JSV C;  4A08 B;  4GM3 A;  1MG2 A;  4ZOX A;  2B5L A;  5FXY A;  3NVX A;  5JWZ A;  2Z2O A;  1JMZ B;  3RFG A;  2OIZ A;  5H17 A;  2OK6 A;  5EMM B;  2HXC A;  3MZK A;  3PVU B;  4A08 A;  1SQJ A;  1XHM A;  4HDJ A;  4BH6 A;  1OMW B;  4O1Q D;  5H14 A;  3BG0 A;  3I7L A;  4J86 A;  4CI3 A;  3VH0 A;  1R5M A;  1N6E A;  5FKQ A;  3UR4 A;  4LG8 A;  4ESG A;  3J80 g;  3DSM A;  2IUV A;  5KDO B;  4KFM B;  4J84 A;  2CO0 A;  2J55 H;  3EI3 B;  4XYH A;  1NEX B;  4LGN A;  3AL9 A;  1JOF A;  2HJB A;  3P4F A;  5HYN B;  2XL3 A;  2I0S A;  4CY5 A;  4X61 B;  5EM2 B;  3SBQ A;  5FLX g;  2HJ4 A;  4GQ1 A;  1PI6 A;  1TBG A;  2B4E A;  4JSN C;  3EI3 A;  3NVQ A;  4BL0 A;  1XKS A;  4E5Z B;  2P9L C;  2OVR B;  3K26 A;  3KRW B;  2AGL A;  3I8C A;  4ERQ A;  3PXS D;  4H5J A;  4GGC A;  4O45 A;  1JMX B;  2P9U C;  2QC5 A;  4FAV D;  5EM2 A;  3UVL A;  4Y7R A;  3MKQ A;  4GGA A;  2G99 A;  3C99 A;  3CFS B;  4YVD A;  3OKT A;  4J0X A;  2XU7 A;  5EAR A;  5A2Q g;  4R7A B;  5TEE A;  3L4M D;  4J87 A;  3KRX B;  5FKR A;  4D0K A;  3VA6 A;  4E5Z A;  4E54 B;  2AGW A;  1QNI A;  2O9K A;  4JD2 C;  2P9N C;  4O9D A;  3SN6 B;  3B7F A;  5B4W A;  1B9X A;  2H6Q A;  3C9C A;  4N14 A;  4GGD A;  3NVN A;  4X3E A;  3GFC A;  2BBK H;  3F3P A;  2IWF A;  3SVW D;  1TYQ C;  2Q7Q A;  4JT5 C;  2XL2 A;  4E54 A;  5AJA A;  2IUR A;  4AEZ A;  5IJ8 E;  2B5N A;  1L0Q A;  3SBP A;  2YBA A;  2GNQ A;  4J78 A;  4U7A A;  4CZX A;  3V7D B;  4X63 B;  3A0F A;  2YMU A;  2OVP B;  3IJ0 A;  2TRC B;  3EMH A;  2AGY A;  3V9F A;  3SCY A;  2CNX A;  3SXT D;  5GXH A;  1PBY B;  1VYH C;  3JZN A;  1FWX A;  3N0D A;  3E0C A;  5IJ7 E;  5THA A;  3JPX A;  4A0B B;  1MG3 A;  1N6F A;  2MTA H;  4JSP C;  4OWR A;  4A2L A;  4PBY A;  3PXT D;  5IGQ A;  1GOT B;  3JRP A;  5C9Z B;  3OTT A;  3L4O D;  3V5W B;  3AH8 B;  4UI9 R;  1U2V C;  3MMY A;  4CZV A;  3C5M A;  4CI2 A;  2CO0 C;  5TEF A;  3F3F A;  1YFQ A;  5C2W B;  4Y5R D;  4JSX C;  4GM8 A;  3EI4 B;  2PM6 B;  1NR0 A;  4IMM A;  3EU7 A;  4A0B A;  1Q47 A;  2CN3 A;  4A09 B;  3I2N A;  4PNK B;  2H6K A;  1N6D A;  4QRJ A;  3JAM g;  3DM0 A;  2P9K C;  5I5I A;  1GG2 B;  5HE2 B;  4L3G D;  2B5M A;  4K3J B;  2J56 H;  3VGZ A;  2H9N A;  2Z2N A;  3FGB A;  3EI4 A;  3MKS B;  4J0W A;  4ERY A;  2H3X A;  3MXX A;  5AFU 3;  1P22 A;  2GC7 A;  2QXV A;  4L1Q D;  4A09 A;  3JRO A;  5C2V B;  2H13 A;  4BUJ C;  3F3G A;  4O3U B;  3OKW A;  1PEV A;  2YNP A;  4FWW A;  5SXM A;  3SFZ A;  1B9Y A;  2Z2P A;  5FKT A;  3PSL A;  3JZH A;  3SHF A;  3I7K A;  2OJY A;  4D6V A;  2CN2 A;  3U4Y A;  2H9P A;  4ES0 A;  4QQE A;  3OKY B;  3DXM C;  3J81 g;  4ERZ A;  4GMB A;  1SQ9 A;  1A0R B;  5IGO A;  3AFC A;  5I5M A;  3PE7 A;  4JXM A;  4A0A B;  4J8G A;  2AGX A;  3C75 H;  4EWR A;  3JZG A;  1K32 A;  4PXW A;  3PXW D;  3BWS A;  2HKM A;  1XIP A;  4PSX B;  1GXR A;  2AGZ A;  3OKY A;  5EML B;  2H68 A;  3DXK C;  2PM7 B;  3RRM C;  4FA5 D;  4GQ2 P;  2P9I C;  4A0A A;  3RN1 D;  2BCJ B;  2HYE A;  4TZ4 A;  4L9O A;  5EAM A;  3IKO A;  4OZU A;  2H47 A;  1OLZ A;  4XEI C;  3W15 A;  1SHY B;  5CXC B;  3OW8 A;  5K19 A;  3N0E A;  3EI2 B;  5TDH B;  3K27 A;  4Z8L A;  3BG1 A;  4ZOY A;  4A11 B;  2AQ5 A;  3I7P A;  2AH1 A;  1S4U X;  4GQB B;  2OK4 A;  3RN0 D;  3AL8 B;  1ERJ A;  3SWS D;  4CY2 A;  4X60 B;  5IT9 g;  4CI8 A;  4J79 A;  4A7J A;  5EMK B;  4ZN4 A;  2H9M A;  4CC9 A;  3PVW B;  5CXC A;  4FA1 D;  2IUP A;  3I7N A;  4PBZ A;  3EI2 A;  4PSW B;  5K1C C;  4CY3 A;  4CI1 A;  5FA5 B;  2PM9 B;  4G56 B;  2W18 A;  4A11 A;  4CY1 A;  2YB8 B;  3AL8 A;  5HE3 B;  4NSX A;  4FB1 D;  2CE9 A;  4PC0 A;  2IAA A;  5CYK B;  2G9A A;  3I7H A;  2YNO A;  2CE8 A;  2IWK A;  5I5J A;  3UVM A;  3RMZ D;  4J8B A;  3ZWL B;  5FQD A;  3UVK A;  4A2M A;  2P9P C;  2I0T A;  3HFQ A;  3EI1 B;  4MK0 B;  2PM9 A;  4ZOV A;  5H1M A;  2EBS A;  5HE0 B;  3PSC B;  5HQG A;  4QT8 A;  3I89 A; 
#chains in the Genus database with same CATH topology
 3EWE A;  5CYK A;  5GXI A;  4XYI A;  2P9S C;  2UZY B;  2XYI A;  3UVN A;  5GMK n;  3UKU C;  3IUQ A;  1MDA H;  4GM9 A;  3I8E A;  2I3T A;  2I3S A;  1PGU A;  3CFV A;  3ZDY A;  3EI1 A;  3SJL D;  5EAP A;  4AOW A;  1H2Y A;  4I79 A;  3UKR C;  4U1E I;  4Z7N A;  3IUJ A;  2HU5 A;  3IIW A;  3SBR A;  4FHL A;  1M1X A;  4CZY A;  3MZL A;  4IA9 A;  2AH0 A;  3DDU A;  3FM0 A;  3ORV D;  4K3I D;  3GRE A;  3OL2 B;  4J81 A;  2H9L A;  3CIK B;  5IC7 A;  4G1E A;  2YNN A;  1U4C A;  1GP2 B;  4O3T B;  2OVQ B;  3IIY A;  3IJ1 A;  2HU8 A;  5TF2 A;  1RI6 A;  2H6N A;  4ZOZ A;  2I0R A;  2HES X;  4O02 A;  5CXB B;  5EMJ B;  1JV2 A;  2VDR A;  3RLM D;  4MMZ A;  2GC4 A;  3DWL C;  5AMS A;  1JJU B;  4L3H D;  4J77 A;  4J82 A;  2H14 A;  5HE1 B;  3RSE C;  2HKR A;  4FAN D;  3JB9 L;  3OL2 A;  3ODT A;  1YR2 A;  2EIB A;  2IUQ A;  4GZ8 A;  2QZP A;  4QL1 A;  3IJC A;  4JT6 C;  3RFH A;  4FA9 D;  3EG6 A;  4LG9 A;  3SMR A;  4H5I A;  2PBI B;  3ZDX A;  3ULE C;  4FA4 D;  1K8K C;  2VC2 A;  5GSA A;  2J57 G;  5CXB A;  3SLE D;  3FRX A;  3UVO A;  5FKS A;  5EAL A;  3I7O A;  4AMZ A;  2UZX B;  4DNV A;  4J73 A;  1UOO A;  4JSV C;  5M61 A;  4A08 B;  4GM3 A;  1MG2 A;  1VZ2 A;  3O4J A;  3K6S A;  4ZOX A;  2B5L A;  5FXY A;  3NVX A;  3GD1 I;  2Z2O A;  5JWZ A;  5E6U A;  1O6G A;  1JMZ B;  3RFG A;  2OIZ A;  1BPO A;  5H17 A;  1JTD B;  2OK6 A;  5EMM B;  3T3M A;  4BP9 A;  2HXC A;  3MZK A;  3PVU B;  2VDQ A;  4A08 A;  1SQJ A;  1XHM A;  4HDJ A;  4RE5 A;  1E5T A;  4BH6 A;  5M5T A;  1OMW B;  4O1Q D;  1C9L A;  5H14 A;  2VDL A;  5M5R A;  4UM9 A;  3BG0 A;  3I7L A;  4J86 A;  4CI3 A;  3VH0 A;  1R5M A;  4WK2 A;  1N6E A;  5FKQ A;  3UR4 A;  4LG8 A;  4ESG A;  3J80 g;  3DSM A;  2IUV A;  5KDO B;  4KFM B;  4J84 A;  2EIC A;  5FFO A;  2CO0 A;  2J55 H;  3EI3 B;  3T3P A;  4XYH A;  1NEX B;  2VDM A;  3AL9 A;  4LGN A;  1JOF A;  3IUM A;  4G55 A;  2HJB A;  3P4F A;  5HYN B;  2XL3 A;  2I0S A;  4CY5 A;  4X61 B;  5EM2 B;  1GOF A;  3SBQ A;  2VZ3 A;  5FLX g;  2HJ4 A;  4GQ1 A;  1PI6 A;  1TBG A;  2XE4 A;  4AX4 A;  2B4E A;  4JSN C;  3EI3 A;  3NVQ A;  4BL0 A;  1XKS A;  4AN1 A;  4E5Z B;  2P9L C;  2OVR B;  3K26 A;  3KRW B;  4WJK A;  2AGL A;  3I8C A;  4BCD A;  3PXS D;  4ERQ A;  4H5J A;  4GGC A;  4O45 A;  1JMX B;  2P9U C;  2QC5 A;  1I2M B;  4G1M A;  4FAV D;  5E6R A;  4L1M A;  1QFS A;  5EM2 A;  3UVL A;  4BCC A;  4Y7R A;  3MKQ A;  4GGA A;  1QFM A;  2G99 A;  3C99 A;  3CFS B;  4YVD A;  3OKT A;  3MUO A;  4J0X A;  2XU7 A;  5EAR A;  5A2Q g;  3NID A;  4R7A B;  3ZDZ A;  5TEE A;  3L4M D;  4J87 A;  3K72 A;  3KRX B;  5FKR A;  4D0K A;  3VA6 A;  4E5Z A;  4E54 B;  5E6S A;  2AGW A;  4RE6 A;  1QNI A;  2O9K A;  4JD2 C;  2P9N C;  4O9D A;  3SN6 B;  3B7F A;  5B4W A;  1B9X A;  2H6Q A;  1T2X A;  3C9C A;  4N14 A;  4GGD A;  3NVN A;  3V4P A;  4X3E A;  3GFC A;  2BBK H;  1UOQ A;  3F3P A;  2IWF A;  3SVW D;  1TYQ C;  2Q7Q A;  4JT5 C;  2XL2 A;  4E54 A;  5AJA A;  2IUR A;  4BCB A;  4AEZ A;  5IJ8 E;  2B5N A;  1L0Q A;  3VI4 A;  3SBP A;  3ZE1 A;  2YBA A;  5C92 A;  2GNQ A;  2XDW A;  4J78 A;  4U7A A;  4CZX A;  3V7D B;  4O2W A;  4X63 B;  3A0F A;  2YMU A;  2OVP B;  3IJ0 A;  2TRC B;  1H2Z A;  3EMH A;  3MUN A;  2AGY A;  3V9F A;  3SCY A;  2CNX A;  3SXT D;  5GXH A;  1PBY B;  1VYH C;  4DNU A;  3JZN A;  1FWX A;  3N0D A;  3E0C A;  5IJ7 E;  5THA A;  3JPX A;  4A0B B;  1MG3 A;  1N6F A;  2MTA H;  4JSP C;  4OWR A;  4A2L A;  1H2X A;  4PBY A;  3PXT D;  5IGQ A;  1GOT B;  3JRP A;  5C9Z B;  3QI0 A;  3OTT A;  3L4O D;  3V5W B;  2JKX A;  3AH8 B;  4UI9 R;  1UOP A;  1U2V C;  3MMY A;  4CZV A;  3VI3 A;  3C5M A;  3FCS A;  4CI2 A;  2CO0 C;  5TEF A;  3F3F A;  1YFQ A;  5C2W B;  4Y5R D;  4JSX C;  3IUN A;  4GM8 A;  3EI4 B;  2PM6 B;  1NR0 A;  4IMM A;  1VZ3 A;  3EU7 A;  3EQ7 A;  4A0B A;  1Q47 A;  2VDP A;  3EQ9 A;  2CN3 A;  4A09 B;  3ZE0 A;  3I2N A;  4NEN A;  4PNK B;  2H6K A;  1N6D A;  4QRJ A;  3JAM g;  2HU7 A;  3DM0 A;  2P9K C;  5I5I A;  3KCI A;  1GG2 B;  5HE2 B;  4L3G D;  2QR5 A;  3IJE A;  2B5M A;  4K3J B;  1E8N A;  2J56 H;  3VGZ A;  2H9N A;  2VDO A;  1O6F A;  2Z2N A;  3FGB A;  3EI4 A;  1L5G A;  3MKS B;  4J0W A;  4ERY A;  1VE7 A;  2EIE A;  2H3X A;  1GOH A;  3MXX A;  5AFU 3;  3FCU A;  1P22 A;  2GC7 A;  2QXV A;  4L1Q D;  4A09 A;  4JHN A;  3JRO A;  1C9I A;  2VZ1 A;  5C2V B;  2H13 A;  4BUJ C;  3F3G A;  4DNW A;  4MMX A;  4O3U B;  3OKW A;  1PEV A;  3MVD K;  1UTC A;  2YNP A;  4FWW A;  5SXM A;  3SFZ A;  1B9Y A;  2Z2P A;  5FKT A;  3PSL A;  5FFG A;  3JZH A;  3SHF A;  3I7K A;  2OJY A;  4D6V A;  2CN2 A;  3U4Y A;  2H9P A;  1E8M A;  4ES0 A;  4NC4 A;  3O4I A;  4QQE A;  3OKY B;  3DXM C;  3ZE2 A;  3J81 g;  3NIG A;  4ERZ A;  4GMB A;  4NAA A;  1SQ9 A;  4WK4 A;  3O4H A;  1A0R B;  4JHP C;  5IGO A;  3AFC A;  5I5M A;  3PE7 A;  1H2W A;  4JXM A;  4A0A B;  4J8G A;  4QAM A;  1TYE A;  2AGX A;  3C75 H;  4EWR A;  3JZG A;  1K32 A;  4PXW A;  3PXW D;  1GOG A;  3BWS A;  4IRZ A;  2HKM A;  1XIP A;  4AN0 A;  4PSX B;  4BP8 A;  1GXR A;  2AGZ A;  3OKY A;  5EML B;  4NBM A;  4Z7O A;  1K3I A;  2H68 A;  3DXK C;  2PM7 B;  3RRM C;  1A12 A;  4FA5 D;  4GQ2 P;  2P9I C;  4Z7Q A;  4A0A A;  3RN1 D;  2BCJ B;  2HYE A;  2EID A;  4TZ4 A;  5HDB A;  4L9O A;  5EAM A;  3IKO A;  4OZU A;  5M5V A;  2H47 A;  1OLZ A;  4XEI C;  3W15 A;  4UM8 A;  1SHY B;  5CXC B;  4D9S A;  3OW8 A;  5K19 A;  3V4V A;  3N0E A;  3EI2 B;  5TDH B;  3K27 A;  3IUL A;  3QHY B;  4Z8L A;  3BG1 A;  4ZOY A;  3EQ8 A;  2AQ5 A;  3I7P A;  4A11 B;  4WK0 A;  2AH1 A;  1S4U X;  4GQB B;  2OK4 A;  3OF7 A;  3AL8 B;  1ERJ A;  3RN0 D;  4MMY A;  3SWS D;  4CY2 A;  4X60 B;  5IT9 g;  4CI8 A;  4J79 A;  4A7J A;  1U8C A;  5EMK B;  4ZN4 A;  2H9M A;  3IVM A;  4CC9 A;  3O4G A;  3PVW B;  5CXC A;  4FA1 D;  2IUP A;  3I7N A;  4PBZ A;  2VDK A;  3EI2 A;  5C86 A;  4PSW B;  5K1C C;  4CY3 A;  4CI1 A;  5M5S A;  5FA5 B;  2PM9 B;  4G56 B;  2W18 A;  4A11 A;  4CY1 A;  2YB8 B;  3AL8 A;  5HE3 B;  4NSX A;  3NIF A;  2WQ8 A;  4FB1 D;  2CE9 A;  4AMY A;  4PC0 A;  2IAA A;  3GC3 B;  5CYK B;  2G9A A;  3I7H A;  3K71 A;  2YNO A;  2VDN A;  2CE8 A;  2IWK A;  2XZG A;  5I5J A;  3UVM A;  3RMZ D;  3IUR A;  4J8B A;  3ZWL B;  5M5U A;  5FQD A;  3UVK A;  4A2M A;  2P9P C;  2I0T A;  3HFQ A;  3EI1 B;  4MK0 B;  2PM9 A;  4ZOV A;  2BKL A;  5H1M A;  2EBS A;  5HE0 B;  3PSC B;  5HQG A;  4QT8 A;  3I89 A;  1VE6 A; 
#chains in the Genus database with same CATH homology
 3EWE A;  5CYK A;  5GXI A;  4XYI A;  2P9S C;  2UZY B;  2XYI A;  3UVN A;  5GMK n;  3UKU C;  1MDA H;  4GM9 A;  3I8E A;  2I3T A;  2I3S A;  1PGU A;  3CFV A;  3EI1 A;  3SJL D;  5EAP A;  4AOW A;  4I79 A;  3UKR C;  4U1E I;  3IIW A;  3SBR A;  4FHL A;  4CZY A;  3MZL A;  4IA9 A;  2AH0 A;  3FM0 A;  3ORV D;  4K3I D;  3GRE A;  3OL2 B;  4J81 A;  2H9L A;  3CIK B;  5IC7 A;  2YNN A;  1U4C A;  1GP2 B;  4O3T B;  2OVQ B;  3IIY A;  3IJ1 A;  5TF2 A;  1RI6 A;  2H6N A;  4ZOZ A;  2I0R A;  2HES X;  5CXB B;  5EMJ B;  3RLM D;  2GC4 A;  3DWL C;  5AMS A;  1JJU B;  4L3H D;  4J77 A;  4J82 A;  2H14 A;  5HE1 B;  3RSE C;  2HKR A;  4FAN D;  3JB9 L;  3OL2 A;  3ODT A;  2IUQ A;  4GZ8 A;  4QL1 A;  3IJC A;  4JT6 C;  3RFH A;  4FA9 D;  3EG6 A;  4LG9 A;  3SMR A;  4H5I A;  2PBI B;  3ULE C;  4FA4 D;  1K8K C;  5GSA A;  2J57 G;  5CXB A;  3SLE D;  3FRX A;  3UVO A;  5FKS A;  5EAL A;  3I7O A;  2UZX B;  4J73 A;  4JSV C;  4A08 B;  4GM3 A;  1MG2 A;  4ZOX A;  2B5L A;  5FXY A;  3NVX A;  5JWZ A;  2Z2O A;  1JMZ B;  3RFG A;  2OIZ A;  5H17 A;  2OK6 A;  5EMM B;  2HXC A;  3MZK A;  3PVU B;  4A08 A;  1SQJ A;  1XHM A;  4HDJ A;  4BH6 A;  1OMW B;  4O1Q D;  5H14 A;  3BG0 A;  3I7L A;  4J86 A;  4CI3 A;  3VH0 A;  1R5M A;  1N6E A;  5FKQ A;  3UR4 A;  4LG8 A;  4ESG A;  3J80 g;  3DSM A;  2IUV A;  5KDO B;  4KFM B;  4J84 A;  2CO0 A;  2J55 H;  3EI3 B;  4XYH A;  1NEX B;  4LGN A;  3AL9 A;  1JOF A;  2HJB A;  3P4F A;  5HYN B;  2XL3 A;  2I0S A;  4CY5 A;  4X61 B;  5EM2 B;  3SBQ A;  5FLX g;  2HJ4 A;  4GQ1 A;  1PI6 A;  1TBG A;  2B4E A;  4JSN C;  3EI3 A;  3NVQ A;  4BL0 A;  1XKS A;  4E5Z B;  2P9L C;  2OVR B;  3K26 A;  3KRW B;  2AGL A;  3I8C A;  4ERQ A;  3PXS D;  4H5J A;  4GGC A;  4O45 A;  1JMX B;  2P9U C;  2QC5 A;  4FAV D;  5EM2 A;  3UVL A;  4Y7R A;  3MKQ A;  4GGA A;  2G99 A;  3C99 A;  3CFS B;  4YVD A;  3OKT A;  4J0X A;  2XU7 A;  5EAR A;  5A2Q g;  4R7A B;  5TEE A;  3L4M D;  4J87 A;  3KRX B;  5FKR A;  4D0K A;  3VA6 A;  4E5Z A;  4E54 B;  2AGW A;  1QNI A;  2O9K A;  4JD2 C;  2P9N C;  4O9D A;  3SN6 B;  3B7F A;  5B4W A;  1B9X A;  2H6Q A;  3C9C A;  4N14 A;  4GGD A;  3NVN A;  4X3E A;  3GFC A;  2BBK H;  3F3P A;  2IWF A;  3SVW D;  1TYQ C;  2Q7Q A;  4JT5 C;  2XL2 A;  4E54 A;  5AJA A;  2IUR A;  4AEZ A;  5IJ8 E;  2B5N A;  1L0Q A;  3SBP A;  2YBA A;  2GNQ A;  4J78 A;  4U7A A;  4CZX A;  3V7D B;  4X63 B;  3A0F A;  2YMU A;  2OVP B;  3IJ0 A;  2TRC B;  3EMH A;  2AGY A;  3V9F A;  3SCY A;  2CNX A;  3SXT D;  5GXH A;  1PBY B;  1VYH C;  3JZN A;  1FWX A;  3N0D A;  3E0C A;  5IJ7 E;  5THA A;  3JPX A;  4A0B B;  1MG3 A;  1N6F A;  2MTA H;  4JSP C;  4OWR A;  4A2L A;  4PBY A;  3PXT D;  5IGQ A;  1GOT B;  3JRP A;  5C9Z B;  3OTT A;  3L4O D;  3V5W B;  3AH8 B;  4UI9 R;  1U2V C;  3MMY A;  4CZV A;  3C5M A;  4CI2 A;  2CO0 C;  5TEF A;  3F3F A;  1YFQ A;  5C2W B;  4Y5R D;  4JSX C;  4GM8 A;  3EI4 B;  2PM6 B;  1NR0 A;  4IMM A;  3EU7 A;  4A0B A;  1Q47 A;  2CN3 A;  4A09 B;  3I2N A;  4PNK B;  2H6K A;  1N6D A;  4QRJ A;  3JAM g;  3DM0 A;  2P9K C;  5I5I A;  1GG2 B;  5HE2 B;  4L3G D;  2B5M A;  4K3J B;  2J56 H;  3VGZ A;  2H9N A;  2Z2N A;  3FGB A;  3EI4 A;  3MKS B;  4J0W A;  4ERY A;  2H3X A;  3MXX A;  5AFU 3;  1P22 A;  2GC7 A;  2QXV A;  4L1Q D;  4A09 A;  3JRO A;  5C2V B;  2H13 A;  4BUJ C;  3F3G A;  4O3U B;  3OKW A;  1PEV A;  2YNP A;  4FWW A;  5SXM A;  3SFZ A;  1B9Y A;  2Z2P A;  5FKT A;  3PSL A;  3JZH A;  3SHF A;  3I7K A;  2OJY A;  4D6V A;  2CN2 A;  3U4Y A;  2H9P A;  4ES0 A;  4QQE A;  3OKY B;  3DXM C;  3J81 g;  4ERZ A;  4GMB A;  1SQ9 A;  1A0R B;  5IGO A;  3AFC A;  5I5M A;  3PE7 A;  4JXM A;  4A0A B;  4J8G A;  2AGX A;  3C75 H;  4EWR A;  3JZG A;  1K32 A;  4PXW A;  3PXW D;  3BWS A;  2HKM A;  1XIP A;  4PSX B;  1GXR A;  2AGZ A;  3OKY A;  5EML B;  2H68 A;  3DXK C;  2PM7 B;  3RRM C;  4FA5 D;  4GQ2 P;  2P9I C;  4A0A A;  3RN1 D;  2BCJ B;  2HYE A;  4TZ4 A;  4L9O A;  5EAM A;  3IKO A;  4OZU A;  2H47 A;  1OLZ A;  4XEI C;  3W15 A;  1SHY B;  5CXC B;  3OW8 A;  5K19 A;  3N0E A;  3EI2 B;  5TDH B;  3K27 A;  4Z8L A;  3BG1 A;  4ZOY A;  4A11 B;  2AQ5 A;  3I7P A;  2AH1 A;  1S4U X;  4GQB B;  2OK4 A;  3RN0 D;  3AL8 B;  1ERJ A;  3SWS D;  4CY2 A;  4X60 B;  5IT9 g;  4CI8 A;  4J79 A;  4A7J A;  5EMK B;  4ZN4 A;  2H9M A;  4CC9 A;  3PVW B;  5CXC A;  4FA1 D;  2IUP A;  3I7N A;  4PBZ A;  3EI2 A;  4PSW B;  5K1C C;  4CY3 A;  4CI1 A;  5FA5 B;  2PM9 B;  4G56 B;  2W18 A;  4A11 A;  4CY1 A;  2YB8 B;  3AL8 A;  5HE3 B;  4NSX A;  4FB1 D;  2CE9 A;  4PC0 A;  2IAA A;  5CYK B;  2G9A A;  3I7H A;  2YNO A;  2CE8 A;  2IWK A;  5I5J A;  3UVM A;  3RMZ D;  4J8B A;  3ZWL B;  5FQD A;  3UVK A;  4A2M A;  2P9P C;  2I0T A;  3HFQ A;  3EI1 B;  4MK0 B;  2PM9 A;  4ZOV A;  5H1M A;  2EBS A;  5HE0 B;  3PSC B;  5HQG A;  4QT8 A;  3I89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...