4IN3A

Crystal structure of the chs5-bch1 exomer cargo adaptor complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
80
structure length
80
Chain Sequence
DPEFMSSVDVLLTVGKLDASLALLTTQDHHVIEFPTVLLPENVKAGSIIKMQVSQNLEEEKKQRNHFKSIQAKILEKYGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The exomer cargo adaptor features a flexible hinge domain.
pubmed doi rcsb
molecule keywords Chitin biosynthesis protein CHS5
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 16
structure length 80
sequence length 80
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16892 CHS5_N Chitin biosynthesis protein CHS5 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.890 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4in3A00
4IN3A 4WJWA
chains in the Genus database with same CATH superfamily
1T5EA 1EIHA 1KTKA 4A3DG 3NHHA 3S15H 1HJPA 4KK7A 1TWGH 4JI7L 2D62A 2V1CC 2IWHA 1OXSC 3GD7A 5ELCA 1UEAB 3EIVA 5KYLA 3GTOH 3QOLA 2B2TA 3OIQA 4IPDA 5CV7A 2ZTEA 3G6EA 3STBD 5CMDA 4QCLA 5IT9L 4X62Q 4M1UB 4DAPA 4BY1G 4HJAA 3R2TA 1L0XB 3TS0A 2RDHA 3D4RA 1ZXTA 3SK4A 1SYDA 2R92H 1R4QB 1EIYB 4KLKA 5IP7H 2EYHA 3FMCA 3MVVA 3FPPA 1VQDA 2IW3A 3TMEA 4O0AA 5I9PA 3QIAA 1I50H 1O80A 4A3FG 3HOYB 1HZBA 5CV9A 5LHY1 5H1SE 4ZKBB 3DLLA 2YU9H 3NP8A 3L2PA 2SOBA 4DV4Q 4JBKA 3RLOA 1EYDA 3LWUA 2EOTA 2NWGA 1B70B 4YHHQ 1AH9A 1A3UA 2F0OA 1TT2A 4FXGC 1YNJC 4FF1A 4UP8A 4A3BG 1KQSA 4KY7A 1D5MC 3W1GA 1KDCA 3F2BA 4UHVA 3R3OA 1O7YA 3KF6B 1EU4A 1HQRD 2B2WA 4YCUA 2XSCA 1N36L 2RDGA 3TRZA 4DN4M 2XRQD 4B3MQ 2IY5B 1Z7TA 5CBEE 2AQ1B 4CDFC 2JA8H 1OO9B 2FMMA 2N88A 1L1OB 4AYBB 1VQ6A 2AKWB 1HNXQ 2R7DA 3CCJA 2BDNA 2IX3A 2EDGA 3RLFA 2BA0A 4YWLA 1X9NA 4DV3L 4G7HC 1MKHA 3HOYH 1YI2A 3KLSX 1EY7A 2PNHA 3OMCA 1SEBD 2Q2IA 5C0XJ 1EIGA 4AH6A 2JP1A 3J80c 2B3GA 3GP7A 1YZ6A 2KOLA 4YCWA 1S5CD 1KLUD 4G4KA 4ZUIA 5M5WH 3S17H 4IUNA 5C0XI 3J81c 1JJ2A 4IN3A 3W3AA 2JA7H 1U4RA 5T1IA 4B9XA 4KHPL 1K8MA 1RIPA 4ZLTF 4ID6A 4WJ4A 2K5QA 1X56A 5J22A 3SVMA 3GV6A 3ER0A 4XXEA 2F3IA 3MEHA 4X3KA 1EIFA 2KECA 2XWJB 2JA5B 1XXGA 2K03A 3J81j 1JC7A 1A63A 1ASZA 3TEHB 4R1JA 2B2UA 3PCOB 2Q8IB 2EYLA 4DR3L 3H09A 1VF5C 4B3SQ 3VYUA 3GTPH 3MHBA 3WDNA 3S1NB 4Q0FA 4EVOA 2PI2A 2WB1B 1BKBA 1X3PA 2E76C 1SNOA 4Y7NB 4OO1I 4LFAL 4LF6Q 1QE6A 1SE3A 3RNUA 1G8ZD 3CMEA 4X66L 1HA5A 2ICEC 1HUMA 1Q7YC 4LUZA 5LMNL 1R9TH 2HDLA 2K5DA 4JV5L 4P74A 4NKLA 2AQ3B 4LFCQ 1HPCA 3MC0B 1EOTA 1Q1EA 3X3MA 5FLXL 3PUWA 2DY8A 4LWCA 3H0GG 2AHOB 4NXMQ 4DGZA 2QEJC 1Q90A 1I6HB 5GQOA 4A4IA 4YY3L 3ICEA 2DN8A 2XNAC 1VQNA 2OTJA 3OWEB 3NWTA 2JA5H 1N33L 3PO2B 4K0KQ 2E2JB 3HG9A 4R4CA 1VDZA 4DXFA 4JVZA 3OSOA 2YTXA 1MSHA 4BBSG 4JG2A 1ICFB 2SNMA 1DM0B 4DUZL 1STBA 2G9HD 4X64L 5IWAL 1FJGL 2Y0SE 3S1NH 1PZJD 4RHRA 1D1IA 4Y7NH 3VR4A 4IUVA 1WYDA 2DGYA 3S1QB 2XVSA 3PV0A 4DV5Q 3VYSA 4DNRB 5JEAJ 3HOXG 1Z9FA 2QILA 1ET6A 1EEFD 4DV1L 4OELB 4DR5Q 2BE5D 1YNJD 2PYKA 3CQZB 3V96A 3JAMi 2LMCB 3BS1A 1HR0Q 4XT1B 1EFID 4KY6A 3HRZC 5AFWA 3T16A 5M5XH 5CR3A 1KHIA 3I72A 5HURA 4DAVA 4LF9L 4JYAQ 2Q8TA 2NVYB 5EPLA 2UU9L 1DZ1A 1I6HH 3M4YA 1TY2A 2OWOA 1SMYC 2QCPX 2F0VA 2K01A 1EFWA 1VQ5A 3RMHA 4JBWA 4A93G 5TSSA 1MHWC 4OIKA 4DFAA 2E2JH 5ELFA 4HIKA 3E0JA 3I7FA 4BA1I 1KAAA 4DA2A 3T1YQ 1XMQQ 4A3GB 3DHQA 4GZYC 1EZ8A 4HSPA 2X6GA 1ENFA 5EJWA 1UEBA 4EQOA 1SRUA 3VA5A 2MPMA 4J1MA 2K28A 4YWMA 2PPBC 1DONA 2QDBA 3P20A 3IRBA 2Z0SA 3SE0A 4DR4L 4ME3A 3MXGA 3HGBA 1F9RA 1ICWA 4C1NI 1HH2P 1H9RA 4IJLA 1CKNB 1UNSA 3J7AV 4X3SA 1IYVA 4X3TA 4OWXB 2OTLA 3HOWB 4NMZA 3D8GA 3CQZH 3U58A 4FXKC 3A5UA 4GNXC 1PH3A 1TQOA 3NTIA 1S4ZA 1YNNC 2UXBL 1VQ9A 1UWVA 4JW0A 3UDGA 2NVYH 1KRTA 4DR2L 3AFQA 4LF4L 2H1EA 1PH4A 1H9MA 2I5LX 1JB3A 5IYBG 3GTQH 2R7ZB 4IFDJ 2EXZA 2PQEA 4B3RL 3Q6SA 2MNAA 5LL6X 5GAEC 4LF8Q 4JI5L 4DR7L 2L4NA 3Q24A 4K8IA 1T5XD 5IE8A 2SDFA 1E2WA 3V05A 3CCMA 4F88A 3T1HQ 3NELA 2A73B 1XYIA 3PIPA 1XWEA 1LACA 2EPBA 3IFDA 4PQXA 5ELOA 1AN8A 4GKJQ 3OW7A 4PV1C 1PYWD 2ES2A 4EQPA 3Q22A 4IZ8A 1CA6A 4JI6Q 2OCEA 1LTLA 1PFBA 3PSIA 2Z1CA 4C3HH 4RG1A 3AFPA 4J6HA 4R8IA 3FKIG 3VYTA 1XTCD 1JB7A 2JEBI 3NE5B 1WJJA 2L1BA 5IIFA 4N8FA 1S40A 2CQOA 1P8LA 3T53B 4C3JH 1N9WA 2EQSA 3SHLA 3PUXA 2A69D 5JJLA 1Y1WB 2R7ZH 3CD6A 4DAYA 2VUMG 2JE6I 3S14B 2RHSB 1VQPA 1RHPA 1SROA 1GUWA 4HN7A 2ATWA 4GS3A 4DV0Q 1OXXK 1YJWA 4Q5VA 3I2ZA 5BR8Q 5CC4A 5JJKA 2ZTDA 3FPUB 3MXNB 1B3QA 1O78A 3K6OA 4XDXA 2L12A 3TP8A 1QNKA 3HOZG 2NZOA 4LK1C 4KJOA 1VQ4A 5CYUA 4IALA 2CW0D 3EN2A 2OF1A 2ZJPA 1V1QA 1B9MA 2F0TA 3SXHA 3BJUA 4HJ9A 4ZRZA 1QVFA 5EGTA 1SDFA 4KHZA 4BY1B 4ME5A 1XMOL 4ULLA 3CKIB 2CKZB 3WOEA 4OL7A 3PIOA 1PH9A 2K5NA 1AZQA 2GVAA 5HGQA 2PZWA 5KEEA 1D2BA 3BZDB 4HCSA 1BCPC 1M4VA 2M00A 1SJED 4A3FB 1VQ8A 1RCVD 4EQ5A 2F0HA 2E2HB 1Y1WH 3PUYA 4G57A 5ELDA 4A3KH 1PRTB 1ILQA 2UUCQ 1JT8A 5C5LA 4KI0A 2R3ZA 5LMUL 1B8AA 1NTGA 2K04A 1PH7A 5M9OA 1KRSA 1QUQB 3KF8B 1L1OC 2O5JC 1VQ7A 4IUQA 2JJQA 1WTWA 4A3DH 1RL2A 3AB9A 2CVRA 1PDQA 4LUOA 1CK1A 2PZUA 2I07B 3ULLA 4B08A 1WTPA 1QZGA 1L2FA 1D8LA 3K7AB 2HHHQ 1IBLQ 1Q46A 4XIGS 4R4TA 5ISRA 4JI0Q 2ZJQA 1FNWA 2Y0SB 3CHBD 1UAPA 3O13A 2PQAA 2PZTA 1LABA 2Z8LA 3IAYA 4Y52H 2VB2X 4LUVA 4BY1H 1LTAD 2WAQB 1O7LA 4DV7L 2RBMA 5KRUA 4TKOB 3VDYA 2NZ1D 3BVZA 2PO4A 4DV2L 2ZTCA 4N9PA 3D3RA 3ERSX 2F0JA 4PMCA 5FOBB 2LXKA 4A3FH 3JAML 4OWWB 5M3FG 2F0NA 1BR9A 1I3QB 1SN8A 1U4MA 2M9VA 4OEMB 4RCOA 1FR3A 1HNZQ 1PXUA 4KTAA 3TP6A 5E4XA 1NMGA 2WB1E 1G2TA 3NK9A 3GTLB 4NB3A 2MUYA 4DR6Q 3J81i 1IBKL 1IW7C 4A3BH 4BBRG 4JCVE 2E5LQ 2IPKD 3NPPA 1RODA 1C0AA 2ALYB 4MZ9A 4OX9Q 1VQIA 2A6HC 3K7AH 1X3EA 1XPUA 1WCMG 2K33A 4NP5A 2WP8J 4DUYQ 4H0LC 4EX5A 4A3JB 1HCZA 1VQGA 4V0BA 1WI5A 4JK1C 2HIVA 1VQFA 1VS0A 3G4SA 4KKTA 4JI2L 3K0XA 3QO2A 1J8IA 2GN5A 1MSGA 1VQJA 3U9SA 4HIDA 3A0JA 2LXJA 5C44B 1EYCA 1JWUD 4FF2A 2PW7A 1LO5D 5BN5A 3IFTA 3OTOQ 2EJMA 5FJ8G 1LTSD 5IGGA 3UI2A 3RN2A 4FP5D 1K83H 5DLQE 1I3QH 5DNFA 3A55A 5NUCA 2HT1A 1VQCA 4HMIA 2VS1A 3GTOB 4R4IA 1IKMA 4QJFA 1PTOD 3ZJYC 1AE2A 4GLXA 3HKZG 1HZCA 3GTLH 4PZ7A 2MQHA 4L6TB 5C3XA 3H0GB 4NXNL 4RGMA 4X62L 2N49A 1IYJB 1QJOA 4IJHA 2VZAA 2WIIB 1I50B 3M7GA 1NNXA 3I91A 4JOIC 2P5ZX 1XX8A 1SYCA 1WVLA 2O4XA 4K6LA 4P72A 5IYDG 1D7QA 5C0XG 4DV4L 3M85A 1LT6D 5IT9c 5C44H 1JOKA 4DKAC 4LAAA 3ZYYX 1SR3A 1ZYRC 2DNCA 2KQ3A 4WORA 3H3VI 2KEDA 1II3A 3GQBA 4JI4Q 2ZJRA 4BS9A 1AZPA 4IUTA 1F9QA 3TBIB 1GUSA 1HNWQ 4BA2I 2UXCQ 4R4QA 3ITPA 1E2VA 4LFBQ 1BOSA 3W2DA 2VQFQ 1EYGA 3L9AX 2JA8B 3I4LA 4AQYQ 5E3FA 2CH4A 1EQVA 3H0GH 2L55A 4P71A 1YIJA 1PTOF 2F0QA 4CGYB 4OO1G 2D5DA 5EKIA 3JAME 3S2HB 5JOBA 3CU7A 1QVGA 4CJ2C 1I5FA 2UXDQ 3DMUA 1B50A 2KVMA 1JWMD 3RN5A 1N32L 4FF3A 3J7YW 1YBYA 1GHKA 1FNVA 2ZM6L 4R9WA 2EY5A 5AJ3Q 2CWPA 1IBML 1D6EC 2HQEA 2KCNA 1IKLA 4HAEA 2PNRC 5M5WB 3S17B 2IX0A 1W6KA 2AQ2B 1ENCA 5CV8A 2JA7B 4ILWA 2G9DA 2F4IA 2K6AA 4HTHA 2K50A 4LF7L 1Y69U 4BXXG 2A1AA 3HOVG 1BCPB 4JI1Q 4DXGA 3K5LA 3TREA 3HOXH 3UE1A 1RD9D 5JVG3 1GUGA 3D0FA 3KLRA 3QB3A 1J5EQ 1S5FD 4IUUA 1Q86C 2F03A 4FYDA 4A76A 1GUNA 1TWHB 2K7VA 3CP0A 4MHEA 2AUKA 3GTPB 2KJXA 4A3LG 3AYHB 5IP9G 4FDBA 3KYHC 3S2HH 3HOUG 5GAHC 3E9IA 2BCOA 4JI8Q 1A6XA 2BOSA 1WTOA 3A5ZB 2R61A 2OQKA 4LF6L 4GNXA 1C4QA 1R9TB 1MIUA 3KLWA 4N8X1 1JORA 1E24A 3GTKH 2UUBQ 2A68C 5JEAG 3I73A 4B9WA 3QR8A 4P75A 4LFCL 3KBGA 3CRLC 4NW2A 3WWVA 4V190 2L0CA 2EE1A 4HEDA 2WV6D 2Q2HA 1K3RA 1AEXA 2OXPA 3OOCA 5I4DA 4K2KA 1KL9A 4ZCKA 1WD1A 1Q3LA 4TVAB 3M4OH 4BY7G 2QW7A 3ONAB 2A19A 3OYYA 4QL5A 1LT5D 3SK8A 4U673 4K0KL 1BBWA 3FKIB 4GKKL 1TWHH 1STNA 2R6GA 4MTNA 5FLXc 4GLVB 1EZ6A 4XTCS 1K8GA 1EQRA 4ZYSA 4CKBA 2O5IC 4PG3A 2DJFC 2K52A 5IYBH 3F2CA 2NVXB 1E0BA 2VUMB 3BZKA 2ZXOA 1O7ZA 1JE4A 5KNBA 2N55A 4KKUA 1B7YB 5EQ0A 4A3IG 1ZYRD 3CAMA 1SNMA 1V9PA 5JJIA 3A54A 4DR5L 4U68A 2DJGC 4HJ8A 1HR0L 3U4ZA 5M5XB 4TRDA 1JOOA 3CRKC 3D31A 3FVQA 1EUJA 1EY8A 3HOZB 4JYAL 5JJZA 1ML0D 3ND8A 1OXTA 2HUGA 2EY1A 4X65Q 1PRTC 2F0EA 1A2TA 3PO3G 1T9HA 2B2YC 2HQLA 2R93G 4RMFA 1E7ZA 3DWAA 2IX1A 3K5NA 5DEHA 5IOCA 3FKIH 1DOLA 3K8AA 4IFDG 3A56A 5KYIA 3CCQA 3T1YL 3QWNA 2BA1A 5K36G 5IP7G 5LMNW 4QQBX 2NVTB 4DNIA 1G51A 2HDMA 5IGFA 4KY5A 1AE3A 1IYUA 2ENBA 4QIWB 1I4GA 2WAQE 2JA6G 2Q8RE 2J0TD 4DR3Q 1FGUA 1L0WA 1BO0A 2NVXH 2M2LA 3KDFB 4MTKA 5KNCA 2VUMH 4ZQ3A 1SAPA 5A2QE 2K05A 1BQQT 3Q23A 1GD7A 2Z6BA 1B53A 2EY6A 3D6CA 4LFAQ 1Y1VG 3KF6A 1NAPA 2G5DA 2AUJD 4IQZA 4OXPA 3CC4A 1W3SA 5C4XG 3ULPA 1GM5A 5LMNQ 2K5VA 4K14A 3X3NA 3HOZH 4P73A 4QUCA 4DV6L 1HFGA 2AWOA 1JJGA 1L1OA 2E75C 2X6LA 2F0LA 3GTQB 1G6PA 1NBWA 4CJ1B 1KD1C 3U50C 1NE3A 1ET9A 3EBEA 1F2ZA 1TS2A 5CV4A 5E7NA 4KHVA 4XQNA 1SNDA 2X69A 4YY3Q 1UE1A 1VQBA 1VQOA 4LJZC 2NVTH 3AMUA 1K3BC 4HJ7A 3P1HA 1V1PB 2EYPA 3K0YA 3T4AC 4WRDA 3PQIA 1VQAA 1PA6A 3C1EA 4GKJL 3K5OA 1F2YA 2EZVA 4A3MB 1YHBA 1KIXA 4C3HB 5JPNC 4JI6L 2Z6KC 3NBHB 5EAYA 1SE2A 2LS01 4BBRB 4A3CG 3ULJA 1EY5A 3K5MA 4DV1Q 3J80E 1FYCA 1TY0A 1N34Q 1WCMB 4GLAC 1KC8C 1CZWA 3PUZA 2IL8A 4C3JB 4RKBA 3GV3A 4CDDC 3J81E 3PIP3 2ASBA 3G7LA 3F2DA 3S24A 1ENAA 2JN4A 2NN6G 2EY2A 3KLSA 5J1ZA 3I56A 2UU9Q 3BYTB 1XPRA 3AU7A 4AYBG 1BBUA 1LT4D 3V2TA 2B8FA 4P2CB 3RZDH 1HFNA 2F0FA 3VR3A 2WINB 1HZ9A 1TWFH 4PNYA 3H3VH 3F2UA 4IFDI 2NTSA 4J8QA 3AEVA 1L0YB 4DV0L 5BR8L 1Q12A 3TS2A 3RLNA 1V1OA 1I4HA 1XNQQ 3I4MB 4KMUC 1STAA 1KDBA 1MBYA 4N9TA 2KENA 1X3FA 1WTQA 4A3MH 4JI3L 2MP1A 3HKZB 2RHQB 1U4PA 1X55A 4DR4Q 1LUZA 1MJEA 1IZ6A 3KJPA 5C4ZA 1GHJA 4BBRH 1QB5D 4HR7B 2L11A 1RJTA 5ELEA 2EYJA 3CCRA 1ONLA 4DR1Q 1WCMH 1WTVA 2AWNA 2RDFA 3U9OA 4DAMA 1ZEQX 1C9OA 2JXMB 1XJVA 2K75A 3FDTA 2VQEL 3K58A 3TN2A 4A3KB 5GAGC 4IOCA 1CHQD 2NUCA 1K0SA 4DR2Q 4LF5Q 3SEBA 3CCEA 3FRPB 3S1MB 1NJIC 1I4QA 2D0OA 2WB1G 4A3DB 4JOIA 4B3RQ 5FJ8H 1GOZA 1SXTA 5J39A 4DR7Q 3H91A 2SNSA 2VXWA 4WJ3M 3NQIA 1I94Q 1SNCA 3PIO3 1PZID 5EBDA 3I4MH 1Z47A 2HHHL 1Z6HA 4ZAIA 1UE6A 1K9MC 2PW5A 1VQHA 4HIOA 4L8JA 3UDIA 1PH8A 1SMYD 1E3PA 1SYEA 3H15A 2Z4IA 1SYGA 3CCSA 1QILA 3RR5A 3VA7A 2VY3A 1A3VA 5IGBA 3PO2G 4HSVA 1P16A 1TU2B 2PMZE 4WJWA 5IYDH 3A8KE 1LT3D 2NN6I 2QKIC 2K5WA 5C0XH 1QZHA 1HNZL 4X3UA 1K8AC 1J6QA 2A6EC 3S1MH 1STEA 4QGUA 1DXMA 1EY0A 4A3BB 5CORA 2N3SA 1CKNA 2HIXA 3I4NG 4KN7C 3HOVB 4Z9CB 4YCVA 1M90C 3SK5A 1HHVA 2F52A 3VR6A 3FHWA 4OX9L 5FO9B 1TWCH 4QMGA 1ESRA 1KNAA 5IGEA 1RKNA 3DWQA 4JC0A 4CDEC 1YNND 2J4XA 1DOKA 5D3IB 1DD2A 2KUMA 1KXLA 4J15A 4L5QA 2DY7A 4M8AA 1EL0A 2LSSA 2I0QA 1PH6A 1STYA 1OXUA 1H95A 2V4DA 4OO1H 4XYOA 3LGJA 3NUCA 3HOUB 1FGBD 3R2IA 4PMBA 1I6VC 1HQMC 1NY4A 1D5XC 3W1BA 1K83B 3OTOL 3JC66 2B63G 1AP0A 4A3GG 2N8NA 4DK1A 4RH6A 3J80i 1F77A 2K4KA 2F4VQ 2QA4A 4B3TQ 2FINB 1XNRQ 1SNPA 1U0LA 1V43A 3I90A 2VW9A 4BXXH 5E4WC 4XYQA 4C1NK 3HOVH 1LTID 4RKLA 5FKAC 1EOVA 4CBVA 3VR5A 4TQUS 4DU9A 2CCZA 1PH5A 3HOWG 3C2PA 4BY7B 3DEPA 4QUFA 5CBAE 3S2DB 1VQKA 1U9RA 3CMAA 2UUAL 3EVQA 4KKSA 1EQQA 4XQJA 2E74C 3BVGA 1GVPA 3TSSA 4GOPB 4A3LH 1FVIA 2F3WA 5L37A 4LMQD 2BH8A 2VL6A 3HOUH 5EKKA 2XTIA 1X3GA 2F0UA 3NTKA 2IHEA 2VNUD 4JI4L 1C7YA 1GO3E 4BWGB 5COYA 4RWSC 5G3LD 3K7UC 4K6DA 1I4RA 3BU2A 2QDLA 3MXNA 4C3IG 1MI2A 1HNWL 3MAQA 2KCTA 4A3IB 1X54A 5JEAH 3MTSA 4UAIA 1K8OA 3GO5A 2C9OA 1F2MA 3BDLA 4QIWE 1HZAA 4I65A 4AQYL 1WTRA 3M4PA 1S3OA 2B2VC 1HUNA 2RCNA 3CC7A 3J7AF 1UE7A 4PZ6A 3MZ5A 1I4PA 2KHJA 4CKCA 3TZUA 2UXDL 3DM1A 1CKMA 4BY7H 4E6IA 3S2DH 1EU3A 1TVXA 2JK8A 1CUKA 4BBSB 1N8RC 5HGTA 3D6WA 4JPBW 5AJ3L 1NSNS 3EJIA 1BCPD 5F2DA 1PVOA 1AFPA 3CF5A 1BVSA 4YHHL 2F0PA 3B6YA 1CQVA 1G6ZA 2EXDA 2B2YA 4JI2Q 3S1RB 3BDOA 2LY7A 3VR2A 3I70A 3HOXB 4KV6A 1QUQA 3KF8A 4JI1L 3SK6A 1YHQA 4A3IH 5FLMG 1CSQA 1Y1VB 4B3ML 2CFMA 4CJ0B 3CC2A 5G3LF 1J5EL 1YHAA 3H3VC 1VF7A 1YJNA 5C4XB 1X32A 5EKLA 2EIFA 1GUTA 3LX0A 4IOAA 1U4LA 3Q0AA 2XRSD 1YNXA 4DPGA 1HNXL 1SYFA 1B3AA 3M4QA 1ILPA 2C5CA 3Q8DA 4A93B 1PFMA 1D1KA 3DEOA 4ABNA 4NXNQ 3PO3H 4JI8L 2R93H 1A8VA 1MD2D 1OXVA 2QF7A 3TZDA 3F1ZA 2HCCA 1EY4A 3GTKB 4BBSH 2J7ZA 1DGSA 2RF4A 1DCZA 1PTOB 4RFBA 3G48A 3SDZA 4IFDH 1QVCA 2UUBL 5K36H 5M3MG 4RCNA 1RTOA 3OPOA 2KA7A 4UPAA 2ID0A 4PMWA 3IL8A 4FXDA 1H9KA 3H94A 2RQXA 3S1RH 1TKWB 1E1OA 5GROA 2JA6H 1BCPF 4QY7A 2ICIA 2VB3X 3A7LA 4YIJA 1YVCA 1A2UA 4YWKA 1JQYD 2BH2A 3M4OB 4DK0A 1IW7D 2YTYA 2B8GA 2BE5C 3DWPA 1Y1VH 5A2QL 3N52A 3M9BA 3RUZA 3E9HA 2A6HD 1HTPA 4OGQC 4JI7Q 4KD4A 5C4XH 4IPHA 3URYA 1EYAA 2PMZB 1H9SB 2JQOA 1B2TA 1GKHA 2IHFA 4B3SL 2MHVA 2I5HA 3J7A5 5C3EG 1B44D 3HKZE 5A35A 1IXRA 1WTHA 2Y0SG 3MXUA 1SLJA 3TP7A 1TS5A 4GOPA 1ASYA 4A93H 3OHXC 5M5YB 2Z6KA 4KD3A 1K73C 4CHTB 1W2BA 2B29A 5IODA 4LW1A 2CH4W 4DK6C 3EFXD 4HJ5A 2DUDA 2WAQG 2K1BA 3CCLA 2K14A 4F7XA 1PTOH 1GJXA 1BBXC 1N32Q 5C4JB 2D9UA 3J7ZC 2BDOA 5I9OA 3UDFA 2ZM6Q 5IYCG 1TXYA 4A3EG 1IBMQ 2Q2UA 2OT2A 4FNFA 4NXML 2D2CC 3CXCA 4LNQA 3CCUA 1H9JA 4X65L 4LF7Q 5C3WA 3F8TA 1O7IA 4C56C 3T51B 1X3QA 4POFA 4DNTB 1F9PA 4MN3A 4A3CH 1N36Q 4O42A 2RA4A 2WKDA 1JE5A 4L5SA 4RHSA 4A3JG 3J80L 1Q81C 2TMPA 1LTRD 4NPSA 3MFYA 1LLRD 2D0PA 3IKJA 4IURA 1WTXA 3KK7A 2NBFA 5M5YH 4H7BA 2NN6H 1YEZA 5ELBA 3J81L 4DV5L 5C44G 3WOFA 2YV5A 2MO1A 3M7NA 3R8BA 4DV3Q 3QJYA 1EY9A 3LNNA 2OQ0A 5C4JH 3EROA 5K5PA 3HS0C 1DOMA 3K81C 1LTBD 1LM0A 5I6YA 1E2ZA 1TR5A 1DYQA 2RVLA 4EGVA 2NTTA 2E2IB 4QF4A 5IT9E 3T56B 4A75A 2RSOA 3QOJA 3PF5A 3TDQA 4KHPQ 3MEFA 3SGIA 2EJGC 3FP9A 4RAUC 2R92G 1XMQL 2LFNA 2NYZD 4O1NA 2EYFA 3BYYB 4ZUJA 4F8MA 5FK9C 2XGTA 1UUPA 1Q1BA 2EYMA 4O2DA 1WD0A 1SE4A 4GKKQ 2A69C 1HR0W 2MFIA 1PHJA 3K57A 2WFWA 3CPWA 2B2TC 2B39A 3QG1A 5C5MA 4DAYB 2L5TA 3R93A 3DM3A 2F3VA 3HEJA 3L3OC 4CDCC 2GVBA 4X66Q 1TIID 3M3YB 3T13A 2E8GA 3I4NB 1CFMA 2GA4B 4JV5Q 1EWCA 5DM63 4RA8A 1S5DD 2ZT9C 2FJ2A 2KCMA 1WFQA 5JVH3 1N34L 2E2IH 3A8IE 3OW2A 4EQNA 3NSWA 2RKSA 1H9SA 2CW0C 4IO9A 1IL2A 3A74A 2JA8G 3N6RA 3L0OA 1CZGA 2KEEA 1Y8PB 4XQQA 3S16B 3TQYA 3OMGA 1D5ZC 3RZDB 4H44C 5KIXA 4LF8L 2XN9C 1Y8NB 3NXWA 1TWFB 1PYSB 2MGSA 3CPFA 3PUVA 1G2SA 2HCIA 3CCVA 2L9HA 3KJOA 1PYBA 3T1HL 5D3DA 1HTLD 1N33Q 2Z4HA 1FL0A 1A62A 4C2MB 3HOYG 5M3FB 5BN4A 3PO2H 2B63B 2A68D 4DUZQ 2JEAI 4K5VA 4MIUA 4X64Q 4UP7A 5IWAQ 1FJGQ 1XNQL 2B2WC 1G291 3HZXA 4X6AH 1IL8A 2KBNA 4JBJA 4GOPC 2JA7G 3MFGA 4APVA 4UDUC 3M3YH 1KNEA 3S1QH 3I4NH 1VQEA 3A7AB 2FMCA 4DR1L 1I4XA 1CTMA 4H02A 5C4HA 1STHA 4IUPA 3OIPA 1CI3M 1MGSA 3MXPA 2R7FA 4LF9Q 1B9NA 3I3CA 1CA5A 3C46A 1ZKOA 3KUPA 4K5XA 3S16H 5LL6S 2PQAB 1J9OA 4DV6Q 3E3XA 5IGCA 1SYBA 4TSSA 4LF5L 1VQLA 1C8CA 5CV5A 2FXQA 5J3BA 2Q2TA 4C2MH 2QGQA 5D14A 5M3FH 2B63H 2O2LD 5JAVA 2PCFB 4AIMA 3C1FA 1Q82C 4A3GH 2XWBB 5FLXE 4C3IB 1I94L 1PFNA 1VQMA 5FO7B 2NZHA 4IPGA 2PI2E 1BNZA 1SE8A 2HD3A 2I5MX 4NDXA 2B2UC 1LV9A 3E5SA 2F0IA 5EBCA 2H5XA 3HFZB 1LTTD 1PRTD 3D4DA 1S5BD 3FEWX 2WACA 1VCIA 4DF7A 2NB0A 2JA5G 3HOWH 3P75A 5BN3A 1TWAB 2JA9A 4KN4C 2UXBQ 1JOQA 2SEBD 4RGTA 4HCEA 1EWHA 2JSOA 1M8AA 3K59A 2B2VA 1V8QA 3GTMB 4LF4Q 2UUCL 3OWFA 2XIWA 4FF4A 4POGA 2F0DA 2IT1A 3RD4A 3KDFA 3I55A 3NTHA 3W5OA 1QWYA 1YITA 1UE5A 1CKOA 4JI5Q 2JYOA 5ELNA 4OWTB 3GTGB 3HP3A 2A8VA 1TWCB 1IBLL 3S9WA 2EYOA 3PMFA 4C3IH 1K28A 4JI0L 1Q8KA 4KJNA 4L5RC 1PMRA 3I4OA 3NQTA 1EY6A 1PTOC 1F9SA 3LWEA 3NWSA 1KAWA 4I7AA 1RF2D 2N78A 2C35B 4I7ZC 1IHZA 1A3TA 2LKVA 4DK3C 1BF4A 1S5ED 1X6OA 1SFOB 3G6JB 5E1FA 1CT1D 1F2LA 4G7ZC 3H6MA 1KDAA 4JI3Q 4MNOA 2F0GA 3E6ZX 3NENA 5I6WA 4ODGA 4L63B 2KHSA 1MJCA 3BDCA 4H13C 3UE0A 4K5WA 4OIJA 2ZXRA 3E0EA 1TS4A 1TWAH 3I8ZA 1PRTF 1BDOA 2QEXA 5DAUA 5KNDA 1PZKD 1V1PA 3GTMH 3PF4A 3A8JE 4OHJA 4RGNA 5M3MB 2EVBA 2F4VL 1R4PB 4B3TL 5CGKA 2I46A 2VQEQ 1S72A 1XNRL 2H4OA 2OEOA 1YJ9A 1X65A 1M1KC 4DR6L 3C3LA 1ESFA 4R4OA 4AYBE 2E5LL 5D65A 1PH2A 5CV6A 2YYZA 3U4VA 3S14H 3JAMc 1JCKB 3GTGH 3KBXA 3NBHA 1WOCA 3SR1A 4S3SA 2MJ8A 3MA2B 5I2YA 3NEMA 2F0SA 4FO2A 4DUYL 1BXTA 1KABA 1C48A 1G91A 5FLMH 2K5HA 1QG7A 3BZCA 3KOJA 3GTJB 3STBC 1PH1A 3UDXA 4OONA 3ERQA 2FFKB 2F0KA 1Y14B 1JJCB 4F87A 1SFOH 1EEID 3VYRA 3RZOB 5C3EB 5IY0A 1GXDC 2K32A 5T1GA 4GN4B 3EA6A 5JPMC 4FVMA 1XMOQ 1SJHD 1HRJA 2NVQB 1VMCA 1BUVT 2FHTA 2CQAA 3EQLC 2L15A 1Q8IA 3BVMA 1A15A 3AQQA 1NCVA 2KCCA 5M3MH 4ALPA 4L5TA 2MO0A 1K0RA 1JWSD 5GADC 4GN3B 1LYLA 1FNUA 1NR2A 1E22A 1VMPA 4A3EB 1NR4A 5DM73 5LMUQ 2YTVA 2A5HA 2E2HH 2WKCA 1SNQA 1CHPD 1FD7D 4A3MG 3D4WA 3GDEA 1CM9A 4UY8C 1E1TA 1PFSA 4C3HG 4CKEA 5IGDA 4ZK9B 2F0MA 4RGOS 1GUOA 3GTJH 1QCBD 4HMJA 3P7JA 1LTGD 1SMXA 1TS3A 5HY6A 4XT3B 5IP9H 1SSOA 3RZOH 4WFN3 1B4OA 4C3JG 5C3EH 1AW7A 3K80C 3DXJC 1RDPD 4HIMA 2RCFA 1DJRD 1PV4A 1EQTA 1RTNA 2R7ZG 4DV7Q 2KHIA 2NVQH 1HA6A 1CQFA 1STGA 1JR0D 4DV2Q 1PLFA 4R8NA 2UXCL 4GNXB 2TSSA 4LFBL 5EPJA 1EWIA 2ZXPA 4K8JA 2DNEA 5KGUA 3ND9A 2VQFL 3S15B 1SBBB 2F1MA 1TWGB 4ZKCB 5IYCH 2RSNA 4A3EH 1JICA 2AMCB 3CW2C 4IPCA 3I4MG 1CSPA 5C6AA 2EJFC 1IBKQ 3PO3B 2R93B 1W6JA 3KFUA 3PGZA 2A74C 2CWAA 3MWYW 1QOHA 2E2DC 3HKSA 2R92B 5I2XA 1NMFA 1Y8OB 2IJ0A 4QB4A 1KLGD 4K2LA 3NBIA 5EPKA 2CHBD 3TP5A 1B1ZA 4A3JH 1HXYD 1JMCA 2UUAQ 4GN5A 2YU9B 2JA6B 3G71A 1Y1WG 4A3KG 1OTCA 1XTDA 4UP9A 2F0WA 1NUCA 5FO8B 4PZ8A 1XPOA 4G7OC 2A6ED 3BG3A 1U5KA 1A0IA 3L7ZC 3DUZA 2Z9HA 4JBMA 1QNUA
chains in the Genus database with same CATH topology
1T5EA 1EIHA 1KTKA 3NHHA 4KK7A 2D62A 2IWHA 1OXSC 3GD7A 5ELCA 1UEAB 5KYLA 3QOLA 2B2TA 3OIQA 5CV7A 5CMDA 4QCLA 5IT9L 4M1UB 4DAPA 3R2TA 1L0XB 2RDHA 3D4RA 1ZXTA 3SK4A 1SYDA 1R4QB 2EYHA 3FMCA 3MVVA 3FPPA 2IW3A 3TMEA 5I9PA 3QIAA 1O80A 3HOYB 5CV9A 5LHY1 4ZKBB 3NP8A 2SOBA 1EYDA 3LWUA 2EOTA 2NWGA 1A3UA 2F0OA 1TT2A 4FXGC 1YNJC 4FF1A 4KY7A 1D5MC 1KDCA 3R3OA 1O7YA 1EU4A 1HQRD 2B2WA 2XSCA 2RDGA 4DN4M 2XRQD 1Z7TA 5CBEE 2AQ1B 1OO9B 2FMMA 2N88A 4AYBB 2BDNA 2IX3A 2EDGA 3RLFA 2BA0A 4G7HC 3KLSX 1EY7A 3OMCA 1SEBD 5C0XJ 1EIGA 2JP1A 3GP7A 2KOLA 1S5CD 1KLUD 4G4KA 4ZUIA 4IUNA 5C0XI 4IN3A 3W3AA 1U4RA 5T1IA 4B9XA 1K8MA 4ZLTF 4ID6A 2K5QA 5J22A 3SVMA 3GV6A 4XXEA 3MEHA 4X3KA 2KECA 2XWJB 2JA5B 1XXGA 2K03A 1JC7A 2B2UA 2Q8IB 2EYLA 3H09A 1VF5C 3VYUA 3MHBA 3WDNA 3S1NB 4Q0FA 4EVOA 2WB1B 1X3PA 2E76C 1SNOA 4Y7NB 4OO1I 1QE6A 1SE3A 1G8ZD 1HA5A 2ICEC 1HUMA 2HDLA 2K5DA 4NKLA 2AQ3B 1HPCA 3MC0B 1EOTA 1Q1EA 3X3MA 5FLXL 3PUWA 2DY8A 4DGZA 2QEJC 1Q90A 1I6HB 2DN8A 2XNAC 3OWEB 3NWTA 2E2JB 3PO2B 3HG9A 1VDZA 4DXFA 3OSOA 1MSHA 2SNMA 1DM0B 1STBA 2G9HD 1PZJD 4RHRA 1D1IA 3VR4A 4IUVA 3S1QB 2XVSA 3PV0A 3VYSA 4DNRB 5JEAJ 2QILA 1ET6A 1EEFD 2BE5D 1YNJD 2PYKA 3CQZB 3V96A 2LMCB 3BS1A 4XT1B 1EFID 4KY6A 3HRZC 5AFWA 3T16A 5CR3A 3I72A 5HURA 4DAVA 2Q8TA 2NVYB 5EPLA 1DZ1A 3M4YA 1TY2A 1SMYC 2QCPX 2F0VA 2K01A 3RMHA 4JBWA 5TSSA 4OIKA 4DFAA 5ELFA 3E0JA 4BA1I 4DA2A 1KAAA 4A3GB 3DHQA 4GZYC 1EZ8A 4HSPA 2X6GA 1ENFA 5EJWA 4EQOA 3VA5A 2MPMA 4J1MA 2K28A 2PPBC 1DONA 2QDBA 3P20A 3SE0A 3MXGA 3HGBA 1F9RA 1ICWA 4C1NI 1H9RA 3J7AV 1UNSA 4X3SA 1IYVA 4X3TA 3HOWB 4NMZA 3D8GA 4FXKC 1TQOA 3NTIA 1S4ZA 1YNNC 2H1EA 1H9MA 1JB3A 2R7ZB 4IFDJ 2EXZA 2PQEA 3Q6SA 5LL6X 2L4NA 3Q24A 4K8IA 1T5XD 2SDFA 1E2WA 3V05A 4F88A 2A73B 1XYIA 1XWEA 1LACA 2EPBA 3IFDA 4PQXA 1AN8A 3OW7A 4PV1C 1PYWD 4EQPA 3Q22A 4IZ8A 1CA6A 1PFBA 2Z1CA 4J6HA 4R8IA 3VYTA 1XTCD 2JEBI 3NE5B 2L1BA 5IIFA 3T53B 3SHLA 3PUXA 2A69D 1Y1WB 4DAYA 2JE6I 3S14B 1RHPA 1GUWA 4HN7A 1OXXK 4Q5VA 5CC4A 3FPUB 1O78A 3K6OA 4XDXA 2L12A 3TP8A 1QNKA 4LK1C 4KJOA 5CYUA 4IALA 2CW0D 2OF1A 1B9MA 2F0TA 3SXHA 4ZRZA 5EGTA 1SDFA 4KHZA 4BY1B 4ME5A 4ULLA 3CKIB 3WOEA 4OL7A 1AZQA 2PZWA 5KEEA 1D2BA 3BZDB 4HCSA 1BCPC 1M4VA 2M00A 1SJED 4A3FB 1RCVD 2F0HA 2E2HB 3PUYA 4G57A 5ELDA 1PRTB 1ILQA 5C5LA 4KI0A 2R3ZA 2K04A 5M9OA 2O5JC 4IUQA 1WTWA 3AB9A 2CVRA 1PDQA 1CK1A 2PZUA 2I07B 4B08A 1WTPA 3K7AB 4XIGS 5ISRA 1FNWA 2Y0SB 3CHBD 1UAPA 3O13A 2PZTA 1LABA 2Z8LA 3IAYA 2VB2X 1LTAD 2WAQB 1O7LA 2RBMA 5KRUA 4TKOB 2NZ1D 3BVZA 2PO4A 4N9PA 3D3RA 2F0JA 4PMCA 5FOBB 3JAML 2F0NA 1BR9A 1I3QB 1U4MA 2M9VA 4RCOA 1FR3A 1PXUA 4KTAA 3TP6A 5E4XA 1G2TA 3NK9A 3GTLB 2MUYA 1IW7C 2IPKD 3NPPA 1RODA 2A6HC 2K33A 4NP5A 2WP8J 4H0LC 4A3JB 1HCZA 4V0BA 4JK1C 4KKTA 3QO2A 1J8IA 1MSGA 3U9SA 5C44B 1EYCA 1JWUD 4FF2A 2PW7A 1LO5D 5BN5A 3IFTA 2EJMA 1LTSD 5IGGA 3UI2A 4FP5D 5NUCA 5DNFA 3A55A 4HMIA 3GTOB 1IKMA 1PTOD 4L6TB 5C3XA 3H0GB 4RGMA 1QJOA 2WIIB 1I50B 3M7GA 3I91A 1XX8A 1SYCA 1WVLA 2O4XA 4K6LA 5C0XG 3M85A 1LT6D 1JOKA 4LAAA 3ZYYX 1ZYRC 2DNCA 2KQ3A 4WORA 2KEDA 1II3A 3GQBA 4BS9A 1AZPA 4IUTA 1F9QA 3TBIB 1GUSA 4BA2I 3ITPA 1E2VA 1BOSA 3W2DA 3L9AX 2JA8B 3I4LA 5E3FA 1EQVA 2L55A 1PTOF 2F0QA 4CGYB 4OO1G 2D5DA 5EKIA 3JAME 3S2HB 5JOBA 3CU7A 4CJ2C 3DMUA 1B50A 2KVMA 1JWMD 4FF3A 3J7YW 1GHKA 1FNVA 4R9WA 2EY5A 1D6EC 2HQEA 2KCNA 1IKLA 4HAEA 2PNRC 5M5WB 3S17B 2IX0A 1W6KA 2AQ2B 1ENCA 5CV8A 2JA7B 4ILWA 2G9DA 2F4IA 2K6AA 4HTHA 1Y69U 1BCPB 4DXGA 3K5LA 1RD9D 5JVG3 1GUGA 3KLRA 3QB3A 1S5FD 4IUUA 2F03A 4FYDA 1GUNA 1TWHB 2K7VA 4MHEA 2AUKA 3GTPB 2KJXA 2BCOA 1A6XA 2BOSA 1WTOA 2R61A 1C4QA 1R9TB 1JORA 2A68C 5JEAG 3I73A 4B9WA 3KBGA 3CRLC 4NW2A 4V190 2L0CA 2EE1A 4HEDA 2WV6D 1AEXA 2OXPA 3OOCA 5I4DA 4K2KA 1WD1A 1Q3LA 3ONAB 3SK8A 1LT5D 4U673 3FKIB 1STNA 2R6GA 4XTCS 1EZ6A 4ZYSA 4CKBA 2O5IC 2NVXB 1E0BA 2VUMB 2ZXOA 1O7ZA 1JE4A 5KNBA 2N55A 4KKUA 5EQ0A 1ZYRD 1SNMA 3A54A 4U68A 5M5XB 4TRDA 1JOOA 3CRKC 3D31A 3FVQA 1EY8A 3HOZB 5JJZA 1ML0D 3ND8A 1OXTA 2HUGA 2EY1A 1PRTC 2F0EA 1A2TA 2B2YC 3DWAA 2IX1A 3K5NA 5DEHA 5IOCA 1DOLA 4IFDG 3A56A 5KYIA 3QWNA 2BA1A 5K36G 2NVTB 2HDMA 5IGFA 4KY5A 1IYUA 2ENBA 4QIWB 1I4GA 2Q8RE 2J0TD 1BO0A 2M2LA 5KNCA 4ZQ3A 1SAPA 5A2QE 2K05A 1BQQT 3Q23A 1B53A 2EY6A 3D6CA 1NAPA 2AUJD 4IQZA 4K14A 3X3NA 4QUCA 1HFGA 2AWOA 2E75C 2X6LA 2F0LA 3GTQB 4CJ1B 1ET9A 1F2ZA 1TS2A 5CV4A 4KHVA 4XQNA 1SNDA 2X69A 4LJZC 3AMUA 3P1HA 1V1PB 2EYPA 3K0YA 3T4AC 4WRDA 3C1EA 3K5OA 1F2YA 2EZVA 4A3MB 4C3HB 5JPNC 1SE2A 2LS01 4BBRB 1EY5A 3K5MA 3J80E 1FYCA 1TY0A 1WCMB 1CZWA 3PUZA 4C3JB 2IL8A 4RKBA 3GV3A 3J81E 3PIP3 3G7LA 1ENAA 2NN6G 3KLSA 2EY2A 5J1ZA 3BYTB 3AU7A 1LT4D 3V2TA 2B8FA 4P2CB 1HFNA 2F0FA 3VR3A 2WINB 4PNYA 4IFDI 3F2UA 2NTSA 4J8QA 1L0YB 1Q12A 1V1OA 1I4HA 3I4MB 4KMUC 1STAA 1KDBA 1MBYA 4N9TA 1WTQA 2MP1A 3HKZB 1U4PA 5C4ZA 1GHJA 1QB5D 4HR7B 2L11A 1RJTA 5ELEA 2EYJA 1ONLA 1WTVA 2AWNA 2RDFA 3U9OA 1ZEQX 2JXMB 3FDTA 3K58A 3TN2A 4A3KB 1CHQD 2NUCA 3SEBA 3FRPB 3S1MB 1I4QA 4A3DB 1GOZA 1SXTA 5J39A 3H91A 2SNSA 2VXWA 3NQIA 1SNCA 3PIO3 1PZID 5EBDA 1Z47A 1Z6HA 4ZAIA 2PW5A 4L8JA 1SMYD 1SYEA 2Z4IA 1SYGA 1QILA 3VA7A 1A3VA 5IGBA 4HSVA 1TU2B 4WJWA 3A8KE 1LT3D 2NN6I 2QKIC 2K5WA 5C0XH 4X3UA 2A6EC 1STEA 1DXMA 1EY0A 4A3BB 5CORA 4KN7C 3HOVB 4Z9CB 3SK5A 1HHVA 3VR6A 5FO9B 4QMGA 1ESRA 1KNAA 5IGEA 1RKNA 3DWQA 1YNND 2J4XA 1DOKA 5D3IB 1DD2A 2KUMA 2DY7A 4M8AA 1EL0A 1STYA 1OXUA 2V4DA 4OO1H 4XYOA 3NUCA 3HOUB 1FGBD 3R2IA 4PMBA 1I6VC 1HQMC 1D5XC 1K83B 1AP0A 4DK1A 4RH6A 1F77A 2FINB 1SNPA 1V43A 3I90A 5E4WC 4XYQA 4C1NK 1LTID 4RKLA 5FKAC 4CBVA 3VR5A 4TQUS 4DU9A 3C2PA 4BY7B 3DEPA 4QUFA 5CBAE 3S2DB 1U9RA 3EVQA 4KKSA 4XQJA 2E74C 3BVGA 3TSSA 2F3WA 4LMQD 5EKKA 2F0UA 3NTKA 2VNUD 4BWGB 5COYA 4RWSC 5G3LD 4K6DA 1I4RA 3MXNA 4C3IG 1MI2A 3MAQA 4A3IB 5JEAH 3MTSA 4UAIA 1K8OA 3GO5A 2C9OA 1F2MA 3BDLA 4I65A 1WTRA 2B2VC 1HUNA 3J7AF 3MZ5A 1I4PA 4CKCA 3TZUA 3DM1A 4E6IA 1EU3A 1TVXA 4BBSB 5HGTA 3D6WA 1NSNS 3EJIA 1BCPD 5F2DA 1AFPA 2F0PA 1CQVA 1G6ZA 2B2YA 3S1RB 3BDOA 2LY7A 3VR2A 3I70A 3HOXB 4KV6A 3KF8A 3SK6A 1Y1VB 4CJ0B 5G3LF 5C4XB 3H3VC 1VF7A 1X32A 5EKLA 1GUTA 3LX0A 1U4LA 3Q0AA 2XRSD 1SYFA 1B3AA 1ILPA 2C5CA 4A93B 1PFMA 1D1KA 3DEOA 4ABNA 2QF7A 1MD2D 1OXVA 3TZDA 3GTKB 2HCCA 1EY4A 2J7ZA 1DCZA 1PTOB 4RFBA 3SDZA 4IFDH 5K36H 4RCNA 1RTOA 3OPOA 2KA7A 2ID0A 4PMWA 3IL8A 4FXDA 1H9KA 3H94A 2RQXA 1TKWB 1BCPF 2ICIA 2VB3X 3A7LA 4YIJA 1A2UA 1JQYD 3M4OB 4DK0A 1IW7D 2B8GA 2BE5C 3DWPA 5A2QL 3N52A 3RUZA 4OGQC 2A6HD 1HTPA 4KD4A 3URYA 1EYAA 2PMZB 1H9SB 1B2TA 2MHVA 1B44D 5A35A 3MXUA 3TP7A 1TS5A 3OHXC 5M5YB 4KD3A 4CHTB 5IODA 3EFXD 2K1BA 4F7XA 1PTOH 1GJXA 1BBXC 5C4JB 2D9UA 2BDOA 5I9OA 2OT2A 4FNFA 2D2CC 1H9JA 5C3WA 4C56C 3T51B 1X3QA 4DNTB 1F9PA 4MN3A 4O42A 2RA4A 2WKDA 4RHSA 3J80L 2TMPA 1LTRD 3MFYA 1LLRD 4IURA 3IKJA 1WTXA 3KK7A 2NBFA 4H7BA 2NN6H 5ELBA 3J81L 3WOFA 3M7NA 3R8BA 3QJYA 1EY9A 3LNNA 3EROA 5K5PA 3HS0C 1DOMA 1LTBD 5I6YA 1E2ZA 1TR5A 1DYQA 2RVLA 4EGVA 2NTTA 2E2IB 4QF4A 5IT9E 3T56B 2RSOA 3QOJA 3TDQA 2EJGC 4RAUC 2LFNA 2NYZD 4O1NA 2EYFA 3BYYB 4ZUJA 4F8MA 5FK9C 1UUPA 1Q1BA 2EYMA 1WD0A 1SE4A 2A69C 3K57A 2B2TC 2B39A 3QG1A 5C5MA 2L5TA 3R93A 3HEJA 2F3VA 3L3OC 1TIID 3M3YB 3T13A 3I4NB 1CFMA 2GA4B 1EWCA 5DM63 4RA8A 1S5DD 2ZT9C 2FJ2A 5JVH3 3A8IE 4EQNA 3NSWA 2RKSA 1H9SA 2CW0C 3N6RA 1CZGA 2KEEA 1Y8PB 4XQQA 3S16B 3OMGA 1D5ZC 3RZDB 4H44C 5KIXA 2XN9C 1Y8NB 3NXWA 1TWFB 2MGSA 3PUVA 1G2SA 2HCIA 2L9HA 5D3DA 1HTLD 2Z4HA 4C2MB 5M3FB 5BN4A 2B63B 2A68D 2JEAI 4K5VA 4MIUA 2B2WC 1G291 3HZXA 1IL8A 3MFGA 4UDUC 1KNEA 3A7AB 2FMCA 1I4XA 1CTMA 5C4HA 1STHA 4IUPA 3OIPA 1CI3M 1MGSA 3MXPA 1B9NA 3I3CA 1CA5A 3C46A 1ZKOA 3KUPA 4K5XA 5LL6S 1J9OA 5IGCA 1SYBA 4TSSA 1C8CA 5CV5A 5D14A 2O2LD 5JAVA 2PCFB 3C1FA 2XWBB 5FLXE 4C3IB 1PFNA 5FO7B 1BNZA 4NDXA 2B2UC 1LV9A 3E5SA 2F0IA 5EBCA 1LTTD 1PRTD 3D4DA 1S5BD 3FEWX 2WACA 1VCIA 4DF7A 2NB0A 3P75A 5BN3A 1TWAB 4KN4C 1JOQA 2SEBD 4RGTA 4HCEA 1EWHA 2JSOA 1M8AA 3K59A 2B2VA 1V8QA 3GTMB 3OWFA 2XIWA 4FF4A 2F0DA 2IT1A 3RD4A 3NTHA 1QWYA 2JYOA 3GTGB 3HP3A 1TWCB 3S9WA 2EYOA 3PMFA 4KJNA 1PMRA 3NQTA 1EY6A 1PTOC 1F9SA 3LWEA 3NWSA 4I7ZC 1RF2D 1IHZA 1A3TA 2LKVA 1BF4A 1S5ED 1SFOB 3G6JB 5E1FA 1CT1D 1F2LA 4G7ZC 3H6MA 1KDAA 2F0GA 3E6ZX 5I6WA 4ODGA 4L63B 2KHSA 3BDCA 4H13C 4K5WA 4OIJA 2ZXRA 1TS4A 3I8ZA 1PRTF 1BDOA 5DAUA 5KNDA 1PZKD 1V1PA 3A8JE 4OHJA 4RGNA 5M3MB 2EVBA 1R4PB 5CGKA 2I46A 2H4OA 2OEOA 3C3LA 1ESFA 5D65A 5CV6A 2YYZA 1JCKB 3KBXA 3NBHA 3SR1A 4S3SA 2MJ8A 3MA2B 5I2YA 2F0SA 4FO2A 1BXTA 1KABA 1C48A 1G91A 1QG7A 3GTJB 3ERQA 2FFKB 2F0KA 4F87A 1EEID 3VYRA 3RZOB 5C3EB 1GXDC 2K32A 5T1GA 3EA6A 5JPMC 4FVMA 1SJHD 1HRJA 2NVQB 1VMCA 1BUVT 2FHTA 2CQAA 3EQLC 1Q8IA 3BVMA 1A15A 1NCVA 2KCCA 1JWSD 1FNUA 1NR2A 1VMPA 4A3EB 1NR4A 5DM73 2A5HA 2WKCA 1SNQA 1CHPD 1FD7D 3D4WA 1CM9A 4C3HG 4CKEA 5IGDA 4ZK9B 2F0MA 4RGOS 1GUOA 1QCBD 4HMJA 3P7JA 1LTGD 1TS3A 4XT3B 1SSOA 4WFN3 1B4OA 4C3JG 1AW7A 1RDPD 3DXJC 1DJRD 1EQTA 1RTNA 1HA6A 1CQFA 1STGA 1JR0D 1PLFA 4R8NA 2TSSA 5EPJA 2ZXPA 4K8JA 2DNEA 5KGUA 3ND9A 3S15B 1SBBB 2F1MA 1TWGB 4ZKCB 2RSNA 1JICA 5C6AA 2EJFC 3PO3B 2R93B 1W6JA 2A74C 3MWYW 1QOHA 2E2DC 2R92B 5I2XA 1Y8OB 2IJ0A 4QB4A 1KLGD 4K2LA 3NBIA 5EPKA 2CHBD 3TP5A 1B1ZA 1HXYD 2YU9B 2JA6B 2F0WA 1NUCA 5FO8B 4G7OC 2A6ED 3BG3A 3L7ZC 3DUZA 1QNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IN3 A;  4WJW A; 
#chains in the Genus database with same CATH topology
 1T5E A;  1EIH A;  1KTK A;  4A3D G;  3NHH A;  3S15 H;  1HJP A;  4KK7 A;  1TWG H;  4JI7 L;  2D62 A;  2V1C C;  2IWH A;  1OXS C;  3GD7 A;  5ELC A;  1UEA B;  3EIV A;  5KYL A;  3GTO H;  3QOL A;  2B2T A;  3OIQ A;  4IPD A;  5CV7 A;  2ZTE A;  3G6E A;  3STB D;  5CMD A;  4QCL A;  5IT9 L;  4X62 Q;  4M1U B;  4DAP A;  4BY1 G;  4HJA A;  3R2T A;  1L0X B;  3TS0 A;  2RDH A;  3D4R A;  1ZXT A;  3SK4 A;  1SYD A;  2R92 H;  1R4Q B;  1EIY B;  4KLK A;  5IP7 H;  2EYH A;  3FMC A;  3MVV A;  3FPP A;  1VQD A;  2IW3 A;  3TME A;  4O0A A;  5I9P A;  3QIA A;  1I50 H;  1O80 A;  4A3F G;  3HOY B;  1HZB A;  5CV9 A;  5LHY 1;  5H1S E;  4ZKB B;  3DLL A;  2YU9 H;  3NP8 A;  3L2P A;  2SOB A;  4DV4 Q;  4JBK A;  3RLO A;  1EYD A;  3LWU A;  2EOT A;  2NWG A;  1B70 B;  4YHH Q;  1AH9 A;  1A3U A;  2F0O A;  1TT2 A;  4FXG C;  1YNJ C;  4FF1 A;  4UP8 A;  4A3B G;  1KQS A;  4KY7 A;  1D5M C;  3W1G A;  1KDC A;  3F2B A;  4UHV A;  3R3O A;  1O7Y A;  3KF6 B;  1EU4 A;  1HQR D;  2B2W A;  4YCU A;  2XSC A;  1N36 L;  2RDG A;  3TRZ A;  4DN4 M;  2XRQ D;  4B3M Q;  2IY5 B;  1Z7T A;  5CBE E;  2AQ1 B;  4CDF C;  2JA8 H;  1OO9 B;  2FMM A;  2N88 A;  1L1O B;  4AYB B;  1VQ6 A;  2AKW B;  1HNX Q;  2R7D A;  3CCJ A;  2BDN A;  2IX3 A;  2EDG A;  3RLF A;  2BA0 A;  4YWL A;  1X9N A;  4DV3 L;  4G7H C;  1MKH A;  3HOY H;  1YI2 A;  3KLS X;  1EY7 A;  2PNH A;  3OMC A;  1SEB D;  2Q2I A;  5C0X J;  1EIG A;  4AH6 A;  2JP1 A;  3J80 c;  2B3G A;  3GP7 A;  1YZ6 A;  2KOL A;  4YCW A;  1S5C D;  1KLU D;  4G4K A;  4ZUI A;  5M5W H;  3S17 H;  4IUN A;  5C0X I;  3J81 c;  1JJ2 A;  4IN3 A;  3W3A A;  2JA7 H;  1U4R A;  5T1I A;  4B9X A;  4KHP L;  1K8M A;  1RIP A;  4ZLT F;  4ID6 A;  4WJ4 A;  2K5Q A;  1X56 A;  5J22 A;  3SVM A;  3GV6 A;  3ER0 A;  4XXE A;  2F3I A;  3MEH A;  4X3K A;  1EIF A;  2KEC A;  2XWJ B;  2JA5 B;  1XXG A;  2K03 A;  3J81 j;  1JC7 A;  1A63 A;  1ASZ A;  3TEH B;  4R1J A;  2B2U A;  3PCO B;  2Q8I B;  2EYL A;  4DR3 L;  3H09 A;  1VF5 C;  4B3S Q;  3VYU A;  3GTP H;  3MHB A;  3WDN A;  3S1N B;  4Q0F A;  4EVO A;  2PI2 A;  2WB1 B;  1BKB A;  1X3P A;  2E76 C;  1SNO A;  4Y7N B;  4OO1 I;  4LFA L;  4LF6 Q;  1QE6 A;  1SE3 A;  3RNU A;  1G8Z D;  3CME A;  4X66 L;  1HA5 A;  2ICE C;  1HUM A;  1Q7Y C;  4LUZ A;  5LMN L;  1R9T H;  2HDL A;  2K5D A;  4JV5 L;  4P74 A;  4NKL A;  2AQ3 B;  4LFC Q;  1HPC A;  3MC0 B;  1EOT A;  1Q1E A;  3X3M A;  5FLX L;  3PUW A;  2DY8 A;  4LWC A;  3H0G G;  2AHO B;  4NXM Q;  4DGZ A;  2QEJ C;  1Q90 A;  1I6H B;  5GQO A;  4A4I A;  4YY3 L;  3ICE A;  2DN8 A;  2XNA C;  1VQN A;  2OTJ A;  3OWE B;  3NWT A;  2JA5 H;  1N33 L;  3PO2 B;  4K0K Q;  2E2J B;  3HG9 A;  4R4C A;  1VDZ A;  4DXF A;  4JVZ A;  3OSO A;  2YTX A;  1MSH A;  4BBS G;  4JG2 A;  1ICF B;  2SNM A;  1DM0 B;  4DUZ L;  1STB A;  2G9H D;  4X64 L;  5IWA L;  1FJG L;  2Y0S E;  3S1N H;  1PZJ D;  4RHR A;  1D1I A;  4Y7N H;  3VR4 A;  4IUV A;  1WYD A;  2DGY A;  3S1Q B;  2XVS A;  3PV0 A;  4DV5 Q;  3VYS A;  4DNR B;  5JEA J;  3HOX G;  1Z9F A;  2QIL A;  1ET6 A;  1EEF D;  4DV1 L;  4OEL B;  4DR5 Q;  2BE5 D;  1YNJ D;  2PYK A;  3CQZ B;  3V96 A;  3JAM i;  2LMC B;  3BS1 A;  1HR0 Q;  4XT1 B;  1EFI D;  4KY6 A;  3HRZ C;  5AFW A;  3T16 A;  5M5X H;  5CR3 A;  1KHI A;  3I72 A;  5HUR A;  4DAV A;  4LF9 L;  4JYA Q;  2Q8T A;  2NVY B;  5EPL A;  2UU9 L;  1DZ1 A;  1I6H H;  3M4Y A;  1TY2 A;  2OWO A;  1SMY C;  2QCP X;  2F0V A;  2K01 A;  1EFW A;  1VQ5 A;  3RMH A;  4JBW A;  4A93 G;  5TSS A;  1MHW C;  4OIK A;  4DFA A;  2E2J H;  5ELF A;  4HIK A;  3E0J A;  3I7F A;  4BA1 I;  1KAA A;  4DA2 A;  3T1Y Q;  1XMQ Q;  4A3G B;  3DHQ A;  4GZY C;  1EZ8 A;  4HSP A;  2X6G A;  1ENF A;  5EJW A;  1UEB A;  4EQO A;  1SRU A;  3VA5 A;  2MPM A;  4J1M A;  2K28 A;  4YWM A;  2PPB C;  1DON A;  2QDB A;  3P20 A;  3IRB A;  2Z0S A;  3SE0 A;  4DR4 L;  4ME3 A;  3MXG A;  3HGB A;  1F9R A;  1ICW A;  4C1N I;  1HH2 P;  1H9R A;  4IJL A;  1CKN B;  1UNS A;  3J7A V;  4X3S A;  1IYV A;  4X3T A;  4OWX B;  2OTL A;  3HOW B;  4NMZ A;  3D8G A;  3CQZ H;  3U58 A;  4FXK C;  3A5U A;  4GNX C;  1PH3 A;  1TQO A;  3NTI A;  1S4Z A;  1YNN C;  2UXB L;  1VQ9 A;  1UWV A;  4JW0 A;  3UDG A;  2NVY H;  1KRT A;  4DR2 L;  3AFQ A;  4LF4 L;  2H1E A;  1PH4 A;  1H9M A;  2I5L X;  1JB3 A;  5IYB G;  3GTQ H;  2R7Z B;  4IFD J;  2EXZ A;  2PQE A;  4B3R L;  3Q6S A;  2MNA A;  5LL6 X;  5GAE C;  4LF8 Q;  4JI5 L;  4DR7 L;  2L4N A;  3Q24 A;  4K8I A;  1T5X D;  5IE8 A;  2SDF A;  1E2W A;  3V05 A;  3CCM A;  4F88 A;  3T1H Q;  3NEL A;  2A73 B;  1XYI A;  3PIP A;  1XWE A;  1LAC A;  2EPB A;  3IFD A;  4PQX A;  5ELO A;  1AN8 A;  4GKJ Q;  3OW7 A;  4PV1 C;  1PYW D;  2ES2 A;  4EQP A;  3Q22 A;  4IZ8 A;  1CA6 A;  4JI6 Q;  2OCE A;  1LTL A;  1PFB A;  3PSI A;  2Z1C A;  4C3H H;  4RG1 A;  3AFP A;  4J6H A;  4R8I A;  3FKI G;  3VYT A;  1XTC D;  1JB7 A;  2JEB I;  3NE5 B;  1WJJ A;  2L1B A;  5IIF A;  4N8F A;  1S40 A;  2CQO A;  1P8L A;  3T53 B;  4C3J H;  1N9W A;  2EQS A;  3SHL A;  3PUX A;  2A69 D;  5JJL A;  1Y1W B;  2R7Z H;  3CD6 A;  4DAY A;  2VUM G;  2JE6 I;  3S14 B;  2RHS B;  1VQP A;  1RHP A;  1SRO A;  1GUW A;  4HN7 A;  2ATW A;  4GS3 A;  4DV0 Q;  1OXX K;  1YJW A;  4Q5V A;  3I2Z A;  5BR8 Q;  5CC4 A;  5JJK A;  2ZTD A;  3FPU B;  3MXN B;  1B3Q A;  1O78 A;  3K6O A;  4XDX A;  2L12 A;  3TP8 A;  1QNK A;  3HOZ G;  2NZO A;  4LK1 C;  4KJO A;  1VQ4 A;  5CYU A;  4IAL A;  2CW0 D;  3EN2 A;  2OF1 A;  2ZJP A;  1V1Q A;  1B9M A;  2F0T A;  3SXH A;  3BJU A;  4HJ9 A;  4ZRZ A;  1QVF A;  5EGT A;  1SDF A;  4KHZ A;  4BY1 B;  4ME5 A;  1XMO L;  4ULL A;  3CKI B;  2CKZ B;  3WOE A;  4OL7 A;  3PIO A;  1PH9 A;  2K5N A;  1AZQ A;  2GVA A;  5HGQ A;  2PZW A;  5KEE A;  1D2B A;  3BZD B;  4HCS A;  1BCP C;  1M4V A;  2M00 A;  1SJE D;  4A3F B;  1VQ8 A;  1RCV D;  4EQ5 A;  2F0H A;  2E2H B;  1Y1W H;  3PUY A;  4G57 A;  5ELD A;  4A3K H;  1PRT B;  1ILQ A;  2UUC Q;  1JT8 A;  5C5L A;  4KI0 A;  2R3Z A;  5LMU L;  1B8A A;  1NTG A;  2K04 A;  1PH7 A;  5M9O A;  1KRS A;  1QUQ B;  3KF8 B;  1L1O C;  2O5J C;  1VQ7 A;  4IUQ A;  2JJQ A;  1WTW A;  4A3D H;  1RL2 A;  3AB9 A;  2CVR A;  1PDQ A;  4LUO A;  1CK1 A;  2PZU A;  2I07 B;  3ULL A;  4B08 A;  1WTP A;  1QZG A;  1L2F A;  1D8L A;  3K7A B;  2HHH Q;  1IBL Q;  1Q46 A;  4XIG S;  4R4T A;  5ISR A;  4JI0 Q;  2ZJQ A;  1FNW A;  2Y0S B;  3CHB D;  1UAP A;  3O13 A;  2PQA A;  2PZT A;  1LAB A;  2Z8L A;  3IAY A;  4Y52 H;  2VB2 X;  4LUV A;  4BY1 H;  1LTA D;  2WAQ B;  1O7L A;  4DV7 L;  2RBM A;  5KRU A;  4TKO B;  3VDY A;  2NZ1 D;  3BVZ A;  2PO4 A;  4DV2 L;  2ZTC A;  4N9P A;  3D3R A;  3ERS X;  2F0J A;  4PMC A;  5FOB B;  2LXK A;  4A3F H;  3JAM L;  4OWW B;  5M3F G;  2F0N A;  1BR9 A;  1I3Q B;  1SN8 A;  1U4M A;  2M9V A;  4OEM B;  4RCO A;  1FR3 A;  1HNZ Q;  1PXU A;  4KTA A;  3TP6 A;  5E4X A;  1NMG A;  2WB1 E;  1G2T A;  3NK9 A;  3GTL B;  4NB3 A;  2MUY A;  4DR6 Q;  3J81 i;  1IBK L;  1IW7 C;  4A3B H;  4BBR G;  4JCV E;  2E5L Q;  2IPK D;  3NPP A;  1ROD A;  1C0A A;  2ALY B;  4MZ9 A;  4OX9 Q;  1VQI A;  2A6H C;  3K7A H;  1X3E A;  1XPU A;  1WCM G;  2K33 A;  4NP5 A;  2WP8 J;  4DUY Q;  4H0L C;  4EX5 A;  4A3J B;  1HCZ A;  1VQG A;  4V0B A;  1WI5 A;  4JK1 C;  2HIV A;  1VQF A;  1VS0 A;  3G4S A;  4KKT A;  4JI2 L;  3K0X A;  3QO2 A;  1J8I A;  2GN5 A;  1MSG A;  1VQJ A;  3U9S A;  4HID A;  3A0J A;  2LXJ A;  5C44 B;  1EYC A;  1JWU D;  4FF2 A;  2PW7 A;  1LO5 D;  5BN5 A;  3IFT A;  3OTO Q;  2EJM A;  5FJ8 G;  1LTS D;  5IGG A;  3UI2 A;  3RN2 A;  4FP5 D;  1K83 H;  5DLQ E;  1I3Q H;  5DNF A;  3A55 A;  5NUC A;  2HT1 A;  1VQC A;  4HMI A;  2VS1 A;  3GTO B;  4R4I A;  1IKM A;  4QJF A;  1PTO D;  3ZJY C;  1AE2 A;  4GLX A;  3HKZ G;  1HZC A;  3GTL H;  4PZ7 A;  2MQH A;  4L6T B;  5C3X A;  3H0G B;  4NXN L;  4RGM A;  4X62 L;  2N49 A;  1IYJ B;  1QJO A;  4IJH A;  2VZA A;  2WII B;  1I50 B;  3M7G A;  1NNX A;  3I91 A;  4JOI C;  2P5Z X;  1XX8 A;  1SYC A;  1WVL A;  2O4X A;  4K6L A;  4P72 A;  5IYD G;  1D7Q A;  5C0X G;  4DV4 L;  3M85 A;  1LT6 D;  5IT9 c;  5C44 H;  1JOK A;  4DKA C;  4LAA A;  3ZYY X;  1SR3 A;  1ZYR C;  2DNC A;  2KQ3 A;  4WOR A;  3H3V I;  2KED A;  1II3 A;  3GQB A;  4JI4 Q;  2ZJR A;  4BS9 A;  1AZP A;  4IUT A;  1F9Q A;  3TBI B;  1GUS A;  1HNW Q;  4BA2 I;  2UXC Q;  4R4Q A;  3ITP A;  1E2V A;  4LFB Q;  1BOS A;  3W2D A;  2VQF Q;  1EYG A;  3L9A X;  2JA8 B;  3I4L A;  4AQY Q;  5E3F A;  2CH4 A;  1EQV A;  3H0G H;  2L55 A;  4P71 A;  1YIJ A;  1PTO F;  2F0Q A;  4CGY B;  4OO1 G;  2D5D A;  5EKI A;  3JAM E;  3S2H B;  5JOB A;  3CU7 A;  1QVG A;  4CJ2 C;  1I5F A;  2UXD Q;  3DMU A;  1B50 A;  2KVM A;  1JWM D;  3RN5 A;  1N32 L;  4FF3 A;  3J7Y W;  1YBY A;  1GHK A;  1FNV A;  2ZM6 L;  4R9W A;  2EY5 A;  5AJ3 Q;  2CWP A;  1IBM L;  1D6E C;  2HQE A;  2KCN A;  1IKL A;  4HAE A;  2PNR C;  5M5W B;  3S17 B;  2IX0 A;  1W6K A;  2AQ2 B;  1ENC A;  5CV8 A;  2JA7 B;  4ILW A;  2G9D A;  2F4I A;  2K6A A;  4HTH A;  2K50 A;  4LF7 L;  1Y69 U;  4BXX G;  2A1A A;  3HOV G;  1BCP B;  4JI1 Q;  4DXG A;  3K5L A;  3TRE A;  3HOX H;  3UE1 A;  1RD9 D;  5JVG 3;  1GUG A;  3D0F A;  3KLR A;  3QB3 A;  1J5E Q;  1S5F D;  4IUU A;  1Q86 C;  2F03 A;  4FYD A;  4A76 A;  1GUN A;  1TWH B;  2K7V A;  3CP0 A;  4MHE A;  2AUK A;  3GTP B;  2KJX A;  4A3L G;  3AYH B;  5IP9 G;  4FDB A;  3KYH C;  3S2H H;  3HOU G;  5GAH C;  3E9I A;  2BCO A;  4JI8 Q;  1A6X A;  2BOS A;  1WTO A;  3A5Z B;  2R61 A;  2OQK A;  4LF6 L;  4GNX A;  1C4Q A;  1R9T B;  1MIU A;  3KLW A;  4N8X 1;  1JOR A;  1E24 A;  3GTK H;  2UUB Q;  2A68 C;  5JEA G;  3I73 A;  4B9W A;  3QR8 A;  4P75 A;  4LFC L;  3KBG A;  3CRL C;  4NW2 A;  3WWV A;  4V19 0;  2L0C A;  2EE1 A;  4HED A;  2WV6 D;  2Q2H A;  1K3R A;  1AEX A;  2OXP A;  3OOC A;  5I4D A;  4K2K A;  1KL9 A;  4ZCK A;  1WD1 A;  1Q3L A;  4TVA B;  3M4O H;  4BY7 G;  2QW7 A;  3ONA B;  2A19 A;  3OYY A;  4QL5 A;  1LT5 D;  3SK8 A;  4U67 3;  4K0K L;  1BBW A;  3FKI B;  4GKK L;  1TWH H;  1STN A;  2R6G A;  4MTN A;  5FLX c;  4GLV B;  1EZ6 A;  4XTC S;  1K8G A;  1EQR A;  4ZYS A;  4CKB A;  2O5I C;  4PG3 A;  2DJF C;  2K52 A;  5IYB H;  3F2C A;  2NVX B;  1E0B A;  2VUM B;  3BZK A;  2ZXO A;  1O7Z A;  1JE4 A;  5KNB A;  2N55 A;  4KKU A;  1B7Y B;  5EQ0 A;  4A3I G;  1ZYR D;  3CAM A;  1SNM A;  1V9P A;  5JJI A;  3A54 A;  4DR5 L;  4U68 A;  2DJG C;  4HJ8 A;  1HR0 L;  3U4Z A;  5M5X B;  4TRD A;  1JOO A;  3CRK C;  3D31 A;  3FVQ A;  1EUJ A;  1EY8 A;  3HOZ B;  4JYA L;  5JJZ A;  1ML0 D;  3ND8 A;  1OXT A;  2HUG A;  2EY1 A;  4X65 Q;  1PRT C;  2F0E A;  1A2T A;  3PO3 G;  1T9H A;  2B2Y C;  2HQL A;  2R93 G;  4RMF A;  1E7Z A;  3DWA A;  2IX1 A;  3K5N A;  5DEH A;  5IOC A;  3FKI H;  1DOL A;  3K8A A;  4IFD G;  3A56 A;  5KYI A;  3CCQ A;  3T1Y L;  3QWN A;  2BA1 A;  5K36 G;  5IP7 G;  5LMN W;  4QQB X;  2NVT B;  4DNI A;  1G51 A;  2HDM A;  5IGF A;  4KY5 A;  1AE3 A;  1IYU A;  2ENB A;  4QIW B;  1I4G A;  2WAQ E;  2JA6 G;  2Q8R E;  2J0T D;  4DR3 Q;  1FGU A;  1L0W A;  1BO0 A;  2NVX H;  2M2L A;  3KDF B;  4MTK A;  5KNC A;  2VUM H;  4ZQ3 A;  1SAP A;  5A2Q E;  2K05 A;  1BQQ T;  3Q23 A;  1GD7 A;  2Z6B A;  1B53 A;  2EY6 A;  3D6C A;  4LFA Q;  1Y1V G;  3KF6 A;  1NAP A;  2G5D A;  2AUJ D;  4IQZ A;  4OXP A;  3CC4 A;  1W3S A;  5C4X G;  3ULP A;  1GM5 A;  5LMN Q;  2K5V A;  4K14 A;  3X3N A;  3HOZ H;  4P73 A;  4QUC A;  4DV6 L;  1HFG A;  2AWO A;  1JJG A;  1L1O A;  2E75 C;  2X6L A;  2F0L A;  3GTQ B;  1G6P A;  1NBW A;  4CJ1 B;  1KD1 C;  3U50 C;  1NE3 A;  1ET9 A;  3EBE A;  1F2Z A;  1TS2 A;  5CV4 A;  5E7N A;  4KHV A;  4XQN A;  1SND A;  2X69 A;  4YY3 Q;  1UE1 A;  1VQB A;  1VQO A;  4LJZ C;  2NVT H;  3AMU A;  1K3B C;  4HJ7 A;  3P1H A;  1V1P B;  2EYP A;  3K0Y A;  3T4A C;  4WRD A;  3PQI A;  1VQA A;  1PA6 A;  3C1E A;  4GKJ L;  3K5O A;  1F2Y A;  2EZV A;  4A3M B;  1YHB A;  1KIX A;  4C3H B;  5JPN C;  4JI6 L;  2Z6K C;  3NBH B;  5EAY A;  1SE2 A;  2LS0 1;  4BBR B;  4A3C G;  3ULJ A;  1EY5 A;  3K5M A;  4DV1 Q;  3J80 E;  1FYC A;  1TY0 A;  1N34 Q;  1WCM B;  4GLA C;  1KC8 C;  1CZW A;  3PUZ A;  2IL8 A;  4C3J B;  4RKB A;  3GV3 A;  4CDD C;  3J81 E;  3PIP 3;  2ASB A;  3G7L A;  3F2D A;  3S24 A;  1ENA A;  2JN4 A;  2NN6 G;  2EY2 A;  3KLS A;  5J1Z A;  3I56 A;  2UU9 Q;  3BYT B;  1XPR A;  3AU7 A;  4AYB G;  1BBU A;  1LT4 D;  3V2T A;  2B8F A;  4P2C B;  3RZD H;  1HFN A;  2F0F A;  3VR3 A;  2WIN B;  1HZ9 A;  1TWF H;  4PNY A;  3H3V H;  3F2U A;  4IFD I;  2NTS A;  4J8Q A;  3AEV A;  1L0Y B;  4DV0 L;  5BR8 L;  1Q12 A;  3TS2 A;  3RLN A;  1V1O A;  1I4H A;  1XNQ Q;  3I4M B;  4KMU C;  1STA A;  1KDB A;  1MBY A;  4N9T A;  2KEN A;  1X3F A;  1WTQ A;  4A3M H;  4JI3 L;  2MP1 A;  3HKZ B;  2RHQ B;  1U4P A;  1X55 A;  4DR4 Q;  1LUZ A;  1MJE A;  1IZ6 A;  3KJP A;  5C4Z A;  1GHJ A;  4BBR H;  1QB5 D;  4HR7 B;  2L11 A;  1RJT A;  5ELE A;  2EYJ A;  3CCR A;  1ONL A;  4DR1 Q;  1WCM H;  1WTV A;  2AWN A;  2RDF A;  3U9O A;  4DAM A;  1ZEQ X;  1C9O A;  2JXM B;  1XJV A;  2K75 A;  3FDT A;  2VQE L;  3K58 A;  3TN2 A;  4A3K B;  5GAG C;  4IOC A;  1CHQ D;  2NUC A;  1K0S A;  4DR2 Q;  4LF5 Q;  3SEB A;  3CCE A;  3FRP B;  3S1M B;  1NJI C;  1I4Q A;  2D0O A;  2WB1 G;  4A3D B;  4JOI A;  4B3R Q;  5FJ8 H;  1GOZ A;  1SXT A;  5J39 A;  4DR7 Q;  3H91 A;  2SNS A;  2VXW A;  4WJ3 M;  3NQI A;  1I94 Q;  1SNC A;  3PIO 3;  1PZI D;  5EBD A;  3I4M H;  1Z47 A;  2HHH L;  1Z6H A;  4ZAI A;  1UE6 A;  1K9M C;  2PW5 A;  1VQH A;  4HIO A;  4L8J A;  3UDI A;  1PH8 A;  1SMY D;  1E3P A;  1SYE A;  3H15 A;  2Z4I A;  1SYG A;  3CCS A;  1QIL A;  3RR5 A;  3VA7 A;  2VY3 A;  1A3V A;  5IGB A;  3PO2 G;  4HSV A;  1P16 A;  1TU2 B;  2PMZ E;  4WJW A;  5IYD H;  3A8K E;  1LT3 D;  2NN6 I;  2QKI C;  2K5W A;  5C0X H;  1QZH A;  1HNZ L;  4X3U A;  1K8A C;  1J6Q A;  2A6E C;  3S1M H;  1STE A;  4QGU A;  1DXM A;  1EY0 A;  4A3B B;  5COR A;  2N3S A;  1CKN A;  2HIX A;  3I4N G;  4KN7 C;  3HOV B;  4Z9C B;  4YCV A;  1M90 C;  3SK5 A;  1HHV A;  2F52 A;  3VR6 A;  3FHW A;  4OX9 L;  5FO9 B;  1TWC H;  4QMG A;  1ESR A;  1KNA A;  5IGE A;  1RKN A;  3DWQ A;  4JC0 A;  4CDE C;  1YNN D;  2J4X A;  1DOK A;  5D3I B;  1DD2 A;  2KUM A;  1KXL A;  4J15 A;  4L5Q A;  2DY7 A;  4M8A A;  1EL0 A;  2LSS A;  2I0Q A;  1PH6 A;  1STY A;  1OXU A;  1H95 A;  2V4D A;  4OO1 H;  4XYO A;  3LGJ A;  3NUC A;  3HOU B;  1FGB D;  3R2I A;  4PMB A;  1I6V C;  1HQM C;  1NY4 A;  1D5X C;  3W1B A;  1K83 B;  3OTO L;  3JC6 6;  2B63 G;  1AP0 A;  4A3G G;  2N8N A;  4DK1 A;  4RH6 A;  3J80 i;  1F77 A;  2K4K A;  2F4V Q;  2QA4 A;  4B3T Q;  2FIN B;  1XNR Q;  1SNP A;  1U0L A;  1V43 A;  3I90 A;  2VW9 A;  4BXX H;  5E4W C;  4XYQ A;  4C1N K;  3HOV H;  1LTI D;  4RKL A;  5FKA C;  1EOV A;  4CBV A;  3VR5 A;  4TQU S;  4DU9 A;  2CCZ A;  1PH5 A;  3HOW G;  3C2P A;  4BY7 B;  3DEP A;  4QUF A;  5CBA E;  3S2D B;  1VQK A;  1U9R A;  3CMA A;  2UUA L;  3EVQ A;  4KKS A;  1EQQ A;  4XQJ A;  2E74 C;  3BVG A;  1GVP A;  3TSS A;  4GOP B;  4A3L H;  1FVI A;  2F3W A;  5L37 A;  4LMQ D;  2BH8 A;  2VL6 A;  3HOU H;  5EKK A;  2XTI A;  1X3G A;  2F0U A;  3NTK A;  2IHE A;  2VNU D;  4JI4 L;  1C7Y A;  1GO3 E;  4BWG B;  5COY A;  4RWS C;  5G3L D;  3K7U C;  4K6D A;  1I4R A;  3BU2 A;  2QDL A;  3MXN A;  4C3I G;  1MI2 A;  1HNW L;  3MAQ A;  2KCT A;  4A3I B;  1X54 A;  5JEA H;  3MTS A;  4UAI A;  1K8O A;  3GO5 A;  2C9O A;  1F2M A;  3BDL A;  4QIW E;  1HZA A;  4I65 A;  4AQY L;  1WTR A;  3M4P A;  1S3O A;  2B2V C;  1HUN A;  2RCN A;  3CC7 A;  3J7A F;  1UE7 A;  4PZ6 A;  3MZ5 A;  1I4P A;  2KHJ A;  4CKC A;  3TZU A;  2UXD L;  3DM1 A;  1CKM A;  4BY7 H;  4E6I A;  3S2D H;  1EU3 A;  1TVX A;  2JK8 A;  1CUK A;  4BBS B;  1N8R C;  5HGT A;  3D6W A;  4JPB W;  5AJ3 L;  1NSN S;  3EJI A;  1BCP D;  5F2D A;  1PVO A;  1AFP A;  3CF5 A;  1BVS A;  4YHH L;  2F0P A;  3B6Y A;  1CQV A;  1G6Z A;  2EXD A;  2B2Y A;  4JI2 Q;  3S1R B;  3BDO A;  2LY7 A;  3VR2 A;  3I70 A;  3HOX B;  4KV6 A;  1QUQ A;  3KF8 A;  4JI1 L;  3SK6 A;  1YHQ A;  4A3I H;  5FLM G;  1CSQ A;  1Y1V B;  4B3M L;  2CFM A;  4CJ0 B;  3CC2 A;  5G3L F;  1J5E L;  1YHA A;  3H3V C;  1VF7 A;  1YJN A;  5C4X B;  1X32 A;  5EKL A;  2EIF A;  1GUT A;  3LX0 A;  4IOA A;  1U4L A;  3Q0A A;  2XRS D;  1YNX A;  4DPG A;  1HNX L;  1SYF A;  1B3A A;  3M4Q A;  1ILP A;  2C5C A;  3Q8D A;  4A93 B;  1PFM A;  1D1K A;  3DEO A;  4ABN A;  4NXN Q;  3PO3 H;  4JI8 L;  2R93 H;  1A8V A;  1MD2 D;  1OXV A;  2QF7 A;  3TZD A;  3F1Z A;  2HCC A;  1EY4 A;  3GTK B;  4BBS H;  2J7Z A;  1DGS A;  2RF4 A;  1DCZ A;  1PTO B;  4RFB A;  3G48 A;  3SDZ A;  4IFD H;  1QVC A;  2UUB L;  5K36 H;  5M3M G;  4RCN A;  1RTO A;  3OPO A;  2KA7 A;  4UPA A;  2ID0 A;  4PMW A;  3IL8 A;  4FXD A;  1H9K A;  3H94 A;  2RQX A;  3S1R H;  1TKW B;  1E1O A;  5GRO A;  2JA6 H;  1BCP F;  4QY7 A;  2ICI A;  2VB3 X;  3A7L A;  4YIJ A;  1YVC A;  1A2U A;  4YWK A;  1JQY D;  2BH2 A;  3M4O B;  4DK0 A;  1IW7 D;  2YTY A;  2B8G A;  2BE5 C;  3DWP A;  1Y1V H;  5A2Q L;  3N52 A;  3M9B A;  3RUZ A;  3E9H A;  2A6H D;  1HTP A;  4OGQ C;  4JI7 Q;  4KD4 A;  5C4X H;  4IPH A;  3URY A;  1EYA A;  2PMZ B;  1H9S B;  2JQO A;  1B2T A;  1GKH A;  2IHF A;  4B3S L;  2MHV A;  2I5H A;  3J7A 5;  5C3E G;  1B44 D;  3HKZ E;  5A35 A;  1IXR A;  1WTH A;  2Y0S G;  3MXU A;  1SLJ A;  3TP7 A;  1TS5 A;  4GOP A;  1ASY A;  4A93 H;  3OHX C;  5M5Y B;  2Z6K A;  4KD3 A;  1K73 C;  4CHT B;  1W2B A;  2B29 A;  5IOD A;  4LW1 A;  2CH4 W;  4DK6 C;  3EFX D;  4HJ5 A;  2DUD A;  2WAQ G;  2K1B A;  3CCL A;  2K14 A;  4F7X A;  1PTO H;  1GJX A;  1BBX C;  1N32 Q;  5C4J B;  2D9U A;  3J7Z C;  2BDO A;  5I9O A;  3UDF A;  2ZM6 Q;  5IYC G;  1TXY A;  4A3E G;  1IBM Q;  2Q2U A;  2OT2 A;  4FNF A;  4NXM L;  2D2C C;  3CXC A;  4LNQ A;  3CCU A;  1H9J A;  4X65 L;  4LF7 Q;  5C3W A;  3F8T A;  1O7I A;  4C56 C;  3T51 B;  1X3Q A;  4POF A;  4DNT B;  1F9P A;  4MN3 A;  4A3C H;  1N36 Q;  4O42 A;  2RA4 A;  2WKD A;  1JE5 A;  4L5S A;  4RHS A;  4A3J G;  3J80 L;  1Q81 C;  2TMP A;  1LTR D;  4NPS A;  3MFY A;  1LLR D;  2D0P A;  3IKJ A;  4IUR A;  1WTX A;  3KK7 A;  2NBF A;  5M5Y H;  4H7B A;  2NN6 H;  1YEZ A;  5ELB A;  3J81 L;  4DV5 L;  5C44 G;  3WOF A;  2YV5 A;  2MO1 A;  3M7N A;  3R8B A;  4DV3 Q;  3QJY A;  1EY9 A;  3LNN A;  2OQ0 A;  5C4J H;  3ERO A;  5K5P A;  3HS0 C;  1DOM A;  3K81 C;  1LTB D;  1LM0 A;  5I6Y A;  1E2Z A;  1TR5 A;  1DYQ A;  2RVL A;  4EGV A;  2NTT A;  2E2I B;  4QF4 A;  5IT9 E;  3T56 B;  4A75 A;  2RSO A;  3QOJ A;  3PF5 A;  3TDQ A;  4KHP Q;  3MEF A;  3SGI A;  2EJG C;  3FP9 A;  4RAU C;  2R92 G;  1XMQ L;  2LFN A;  2NYZ D;  4O1N A;  2EYF A;  3BYY B;  4ZUJ A;  4F8M A;  5FK9 C;  2XGT A;  1UUP A;  1Q1B A;  2EYM A;  4O2D A;  1WD0 A;  1SE4 A;  4GKK Q;  2A69 C;  1HR0 W;  2MFI A;  1PHJ A;  3K57 A;  2WFW A;  3CPW A;  2B2T C;  2B39 A;  3QG1 A;  5C5M A;  4DAY B;  2L5T A;  3R93 A;  3DM3 A;  2F3V A;  3HEJ A;  3L3O C;  4CDC C;  2GVB A;  4X66 Q;  1TII D;  3M3Y B;  3T13 A;  2E8G A;  3I4N B;  1CFM A;  2GA4 B;  4JV5 Q;  1EWC A;  5DM6 3;  4RA8 A;  1S5D D;  2ZT9 C;  2FJ2 A;  2KCM A;  1WFQ A;  5JVH 3;  1N34 L;  2E2I H;  3A8I E;  3OW2 A;  4EQN A;  3NSW A;  2RKS A;  1H9S A;  2CW0 C;  4IO9 A;  1IL2 A;  3A74 A;  2JA8 G;  3N6R A;  3L0O A;  1CZG A;  2KEE A;  1Y8P B;  4XQQ A;  3S16 B;  3TQY A;  3OMG A;  1D5Z C;  3RZD B;  4H44 C;  5KIX A;  4LF8 L;  2XN9 C;  1Y8N B;  3NXW A;  1TWF B;  1PYS B;  2MGS A;  3CPF A;  3PUV A;  1G2S A;  2HCI A;  3CCV A;  2L9H A;  3KJO A;  1PYB A;  3T1H L;  5D3D A;  1HTL D;  1N33 Q;  2Z4H A;  1FL0 A;  1A62 A;  4C2M B;  3HOY G;  5M3F B;  5BN4 A;  3PO2 H;  2B63 B;  2A68 D;  4DUZ Q;  2JEA I;  4K5V A;  4MIU A;  4X64 Q;  4UP7 A;  5IWA Q;  1FJG Q;  1XNQ L;  2B2W C;  1G29 1;  3HZX A;  4X6A H;  1IL8 A;  2KBN A;  4JBJ A;  4GOP C;  2JA7 G;  3MFG A;  4APV A;  4UDU C;  3M3Y H;  1KNE A;  3S1Q H;  3I4N H;  1VQE A;  3A7A B;  2FMC A;  4DR1 L;  1I4X A;  1CTM A;  4H02 A;  5C4H A;  1STH A;  4IUP A;  3OIP A;  1CI3 M;  1MGS A;  3MXP A;  2R7F A;  4LF9 Q;  1B9N A;  3I3C A;  1CA5 A;  3C46 A;  1ZKO A;  3KUP A;  4K5X A;  3S16 H;  5LL6 S;  2PQA B;  1J9O A;  4DV6 Q;  3E3X A;  5IGC A;  1SYB A;  4TSS A;  4LF5 L;  1VQL A;  1C8C A;  5CV5 A;  2FXQ A;  5J3B A;  2Q2T A;  4C2M H;  2QGQ A;  5D14 A;  5M3F H;  2B63 H;  2O2L D;  5JAV A;  2PCF B;  4AIM A;  3C1F A;  1Q82 C;  4A3G H;  2XWB B;  5FLX E;  4C3I B;  1I94 L;  1PFN A;  1VQM A;  5FO7 B;  2NZH A;  4IPG A;  2PI2 E;  1BNZ A;  1SE8 A;  2HD3 A;  2I5M X;  4NDX A;  2B2U C;  1LV9 A;  3E5S A;  2F0I A;  5EBC A;  2H5X A;  3HFZ B;  1LTT D;  1PRT D;  3D4D A;  1S5B D;  3FEW X;  2WAC A;  1VCI A;  4DF7 A;  2NB0 A;  2JA5 G;  3HOW H;  3P75 A;  5BN3 A;  1TWA B;  2JA9 A;  4KN4 C;  2UXB Q;  1JOQ A;  2SEB D;  4RGT A;  4HCE A;  1EWH A;  2JSO A;  1M8A A;  3K59 A;  2B2V A;  1V8Q A;  3GTM B;  4LF4 Q;  2UUC L;  3OWF A;  2XIW A;  4FF4 A;  4POG A;  2F0D A;  2IT1 A;  3RD4 A;  3KDF A;  3I55 A;  3NTH A;  3W5O A;  1QWY A;  1YIT A;  1UE5 A;  1CKO A;  4JI5 Q;  2JYO A;  5ELN A;  4OWT B;  3GTG B;  3HP3 A;  2A8V A;  1TWC B;  1IBL L;  3S9W A;  2EYO A;  3PMF A;  4C3I H;  1K28 A;  4JI0 L;  1Q8K A;  4KJN A;  4L5R C;  1PMR A;  3I4O A;  3NQT A;  1EY6 A;  1PTO C;  1F9S A;  3LWE A;  3NWS A;  1KAW A;  4I7A A;  1RF2 D;  2N78 A;  2C35 B;  4I7Z C;  1IHZ A;  1A3T A;  2LKV A;  4DK3 C;  1BF4 A;  1S5E D;  1X6O A;  1SFO B;  3G6J B;  5E1F A;  1CT1 D;  1F2L A;  4G7Z C;  3H6M A;  1KDA A;  4JI3 Q;  4MNO A;  2F0G A;  3E6Z X;  3NEN A;  5I6W A;  4ODG A;  4L63 B;  2KHS A;  1MJC A;  3BDC A;  4H13 C;  3UE0 A;  4K5W A;  4OIJ A;  2ZXR A;  3E0E A;  1TS4 A;  1TWA H;  3I8Z A;  1PRT F;  1BDO A;  2QEX A;  5DAU A;  5KND A;  1PZK D;  1V1P A;  3GTM H;  3PF4 A;  3A8J E;  4OHJ A;  4RGN A;  5M3M B;  2EVB A;  2F4V L;  1R4P B;  4B3T L;  5CGK A;  2I46 A;  2VQE Q;  1S72 A;  1XNR L;  2H4O A;  2OEO A;  1YJ9 A;  1X65 A;  1M1K C;  4DR6 L;  3C3L A;  1ESF A;  4R4O A;  4AYB E;  2E5L L;  5D65 A;  1PH2 A;  5CV6 A;  2YYZ A;  3U4V A;  3S14 H;  3JAM c;  1JCK B;  3GTG H;  3KBX A;  3NBH A;  1WOC A;  3SR1 A;  4S3S A;  2MJ8 A;  3MA2 B;  5I2Y A;  3NEM A;  2F0S A;  4FO2 A;  4DUY L;  1BXT A;  1KAB A;  1C48 A;  1G91 A;  5FLM H;  2K5H A;  1QG7 A;  3BZC A;  3KOJ A;  3GTJ B;  3STB C;  1PH1 A;  3UDX A;  4OON A;  3ERQ A;  2FFK B;  2F0K A;  1Y14 B;  1JJC B;  4F87 A;  1SFO H;  1EEI D;  3VYR A;  3RZO B;  5C3E B;  5IY0 A;  1GXD C;  2K32 A;  5T1G A;  4GN4 B;  3EA6 A;  5JPM C;  4FVM A;  1XMO Q;  1SJH D;  1HRJ A;  2NVQ B;  1VMC A;  1BUV T;  2FHT A;  2CQA A;  3EQL C;  2L15 A;  1Q8I A;  3BVM A;  1A15 A;  3AQQ A;  1NCV A;  2KCC A;  5M3M H;  4ALP A;  4L5T A;  2MO0 A;  1K0R A;  1JWS D;  5GAD C;  4GN3 B;  1LYL A;  1FNU A;  1NR2 A;  1E22 A;  1VMP A;  4A3E B;  1NR4 A;  5DM7 3;  5LMU Q;  2YTV A;  2A5H A;  2E2H H;  2WKC A;  1SNQ A;  1CHP D;  1FD7 D;  4A3M G;  3D4W A;  3GDE A;  1CM9 A;  4UY8 C;  1E1T A;  1PFS A;  4C3H G;  4CKE A;  5IGD A;  4ZK9 B;  2F0M A;  4RGO S;  1GUO A;  3GTJ H;  1QCB D;  4HMJ A;  3P7J A;  1LTG D;  1SMX A;  1TS3 A;  5HY6 A;  4XT3 B;  5IP9 H;  1SSO A;  3RZO H;  4WFN 3;  1B4O A;  4C3J G;  5C3E H;  1AW7 A;  3K80 C;  3DXJ C;  1RDP D;  4HIM A;  2RCF A;  1DJR D;  1PV4 A;  1EQT A;  1RTN A;  2R7Z G;  4DV7 Q;  2KHI A;  2NVQ H;  1HA6 A;  1CQF A;  1STG A;  1JR0 D;  4DV2 Q;  1PLF A;  4R8N A;  2UXC L;  4GNX B;  2TSS A;  4LFB L;  5EPJ A;  1EWI A;  2ZXP A;  4K8J A;  2DNE A;  5KGU A;  3ND9 A;  2VQF L;  3S15 B;  1SBB B;  2F1M A;  1TWG B;  4ZKC B;  5IYC H;  2RSN A;  4A3E H;  1JIC A;  2AMC B;  3CW2 C;  4IPC A;  3I4M G;  1CSP A;  5C6A A;  2EJF C;  1IBK Q;  3PO3 B;  2R93 B;  1W6J A;  3KFU A;  3PGZ A;  2A74 C;  2CWA A;  3MWY W;  1QOH A;  2E2D C;  3HKS A;  2R92 B;  5I2X A;  1NMF A;  1Y8O B;  2IJ0 A;  4QB4 A;  1KLG D;  4K2L A;  3NBI A;  5EPK A;  2CHB D;  3TP5 A;  1B1Z A;  4A3J H;  1HXY D;  1JMC A;  2UUA Q;  4GN5 A;  2YU9 B;  2JA6 B;  3G71 A;  1Y1W G;  4A3K G;  1OTC A;  1XTD A;  4UP9 A;  2F0W A;  1NUC A;  5FO8 B;  4PZ8 A;  1XPO A;  4G7O C;  2A6E D;  3BG3 A;  1U5K A;  1A0I A;  3L7Z C;  3DUZ A;  2Z9H A;  4JBM A;  1QNU A; 
#chains in the Genus database with same CATH homology
 1T5E A;  1EIH A;  1KTK A;  3NHH A;  4KK7 A;  2D62 A;  2IWH A;  1OXS C;  3GD7 A;  5ELC A;  1UEA B;  5KYL A;  3QOL A;  2B2T A;  3OIQ A;  5CV7 A;  5CMD A;  4QCL A;  5IT9 L;  4M1U B;  4DAP A;  3R2T A;  1L0X B;  2RDH A;  3D4R A;  1ZXT A;  3SK4 A;  1SYD A;  1R4Q B;  2EYH A;  3FMC A;  3MVV A;  3FPP A;  2IW3 A;  3TME A;  5I9P A;  3QIA A;  1O80 A;  3HOY B;  5CV9 A;  5LHY 1;  4ZKB B;  3NP8 A;  2SOB A;  1EYD A;  3LWU A;  2EOT A;  2NWG A;  1A3U A;  2F0O A;  1TT2 A;  4FXG C;  1YNJ C;  4FF1 A;  4KY7 A;  1D5M C;  1KDC A;  3R3O A;  1O7Y A;  1EU4 A;  1HQR D;  2B2W A;  2XSC A;  2RDG A;  4DN4 M;  2XRQ D;  1Z7T A;  5CBE E;  2AQ1 B;  1OO9 B;  2FMM A;  2N88 A;  4AYB B;  2BDN A;  2IX3 A;  2EDG A;  3RLF A;  2BA0 A;  4G7H C;  3KLS X;  1EY7 A;  3OMC A;  1SEB D;  5C0X J;  1EIG A;  2JP1 A;  3GP7 A;  2KOL A;  1S5C D;  1KLU D;  4G4K A;  4ZUI A;  4IUN A;  5C0X I;  4IN3 A;  3W3A A;  1U4R A;  5T1I A;  4B9X A;  1K8M A;  4ZLT F;  4ID6 A;  2K5Q A;  5J22 A;  3SVM A;  3GV6 A;  4XXE A;  3MEH A;  4X3K A;  2KEC A;  2XWJ B;  2JA5 B;  1XXG A;  2K03 A;  1JC7 A;  2B2U A;  2Q8I B;  2EYL A;  3H09 A;  1VF5 C;  3VYU A;  3MHB A;  3WDN A;  3S1N B;  4Q0F A;  4EVO A;  2WB1 B;  1X3P A;  2E76 C;  1SNO A;  4Y7N B;  4OO1 I;  1QE6 A;  1SE3 A;  1G8Z D;  1HA5 A;  2ICE C;  1HUM A;  2HDL A;  2K5D A;  4NKL A;  2AQ3 B;  1HPC A;  3MC0 B;  1EOT A;  1Q1E A;  3X3M A;  5FLX L;  3PUW A;  2DY8 A;  4DGZ A;  2QEJ C;  1Q90 A;  1I6H B;  2DN8 A;  2XNA C;  3OWE B;  3NWT A;  2E2J B;  3PO2 B;  3HG9 A;  1VDZ A;  4DXF A;  3OSO A;  1MSH A;  2SNM A;  1DM0 B;  1STB A;  2G9H D;  1PZJ D;  4RHR A;  1D1I A;  3VR4 A;  4IUV A;  3S1Q B;  2XVS A;  3PV0 A;  3VYS A;  4DNR B;  5JEA J;  2QIL A;  1ET6 A;  1EEF D;  2BE5 D;  1YNJ D;  2PYK A;  3CQZ B;  3V96 A;  2LMC B;  3BS1 A;  4XT1 B;  1EFI D;  4KY6 A;  3HRZ C;  5AFW A;  3T16 A;  5CR3 A;  3I72 A;  5HUR A;  4DAV A;  2Q8T A;  2NVY B;  5EPL A;  1DZ1 A;  3M4Y A;  1TY2 A;  1SMY C;  2QCP X;  2F0V A;  2K01 A;  3RMH A;  4JBW A;  5TSS A;  4OIK A;  4DFA A;  5ELF A;  3E0J A;  4BA1 I;  4DA2 A;  1KAA A;  4A3G B;  3DHQ A;  4GZY C;  1EZ8 A;  4HSP A;  2X6G A;  1ENF A;  5EJW A;  4EQO A;  3VA5 A;  2MPM A;  4J1M A;  2K28 A;  2PPB C;  1DON A;  2QDB A;  3P20 A;  3SE0 A;  3MXG A;  3HGB A;  1F9R A;  1ICW A;  4C1N I;  1H9R A;  3J7A V;  1UNS A;  4X3S A;  1IYV A;  4X3T A;  3HOW B;  4NMZ A;  3D8G A;  4FXK C;  1TQO A;  3NTI A;  1S4Z A;  1YNN C;  2H1E A;  1H9M A;  1JB3 A;  2R7Z B;  4IFD J;  2EXZ A;  2PQE A;  3Q6S A;  5LL6 X;  2L4N A;  3Q24 A;  4K8I A;  1T5X D;  2SDF A;  1E2W A;  3V05 A;  4F88 A;  2A73 B;  1XYI A;  1XWE A;  1LAC A;  2EPB A;  3IFD A;  4PQX A;  1AN8 A;  3OW7 A;  4PV1 C;  1PYW D;  4EQP A;  3Q22 A;  4IZ8 A;  1CA6 A;  1PFB A;  2Z1C A;  4J6H A;  4R8I A;  3VYT A;  1XTC D;  2JEB I;  3NE5 B;  2L1B A;  5IIF A;  3T53 B;  3SHL A;  3PUX A;  2A69 D;  1Y1W B;  4DAY A;  2JE6 I;  3S14 B;  1RHP A;  1GUW A;  4HN7 A;  1OXX K;  4Q5V A;  5CC4 A;  3FPU B;  1O78 A;  3K6O A;  4XDX A;  2L12 A;  3TP8 A;  1QNK A;  4LK1 C;  4KJO A;  5CYU A;  4IAL A;  2CW0 D;  2OF1 A;  1B9M A;  2F0T A;  3SXH A;  4ZRZ A;  5EGT A;  1SDF A;  4KHZ A;  4BY1 B;  4ME5 A;  4ULL A;  3CKI B;  3WOE A;  4OL7 A;  1AZQ A;  2PZW A;  5KEE A;  1D2B A;  3BZD B;  4HCS A;  1BCP C;  1M4V A;  2M00 A;  1SJE D;  4A3F B;  1RCV D;  2F0H A;  2E2H B;  3PUY A;  4G57 A;  5ELD A;  1PRT B;  1ILQ A;  5C5L A;  4KI0 A;  2R3Z A;  2K04 A;  5M9O A;  2O5J C;  4IUQ A;  1WTW A;  3AB9 A;  2CVR A;  1PDQ A;  1CK1 A;  2PZU A;  2I07 B;  4B08 A;  1WTP A;  3K7A B;  4XIG S;  5ISR A;  1FNW A;  2Y0S B;  3CHB D;  1UAP A;  3O13 A;  2PZT A;  1LAB A;  2Z8L A;  3IAY A;  2VB2 X;  1LTA D;  2WAQ B;  1O7L A;  2RBM A;  5KRU A;  4TKO B;  2NZ1 D;  3BVZ A;  2PO4 A;  4N9P A;  3D3R A;  2F0J A;  4PMC A;  5FOB B;  3JAM L;  2F0N A;  1BR9 A;  1I3Q B;  1U4M A;  2M9V A;  4RCO A;  1FR3 A;  1PXU A;  4KTA A;  3TP6 A;  5E4X A;  1G2T A;  3NK9 A;  3GTL B;  2MUY A;  1IW7 C;  2IPK D;  3NPP A;  1ROD A;  2A6H C;  2K33 A;  4NP5 A;  2WP8 J;  4H0L C;  4A3J B;  1HCZ A;  4V0B A;  4JK1 C;  4KKT A;  3QO2 A;  1J8I A;  1MSG A;  3U9S A;  5C44 B;  1EYC A;  1JWU D;  4FF2 A;  2PW7 A;  1LO5 D;  5BN5 A;  3IFT A;  2EJM A;  1LTS D;  5IGG A;  3UI2 A;  4FP5 D;  5NUC A;  5DNF A;  3A55 A;  4HMI A;  3GTO B;  1IKM A;  1PTO D;  4L6T B;  5C3X A;  3H0G B;  4RGM A;  1QJO A;  2WII B;  1I50 B;  3M7G A;  3I91 A;  1XX8 A;  1SYC A;  1WVL A;  2O4X A;  4K6L A;  5C0X G;  3M85 A;  1LT6 D;  1JOK A;  4LAA A;  3ZYY X;  1ZYR C;  2DNC A;  2KQ3 A;  4WOR A;  2KED A;  1II3 A;  3GQB A;  4BS9 A;  1AZP A;  4IUT A;  1F9Q A;  3TBI B;  1GUS A;  4BA2 I;  3ITP A;  1E2V A;  1BOS A;  3W2D A;  3L9A X;  2JA8 B;  3I4L A;  5E3F A;  1EQV A;  2L55 A;  1PTO F;  2F0Q A;  4CGY B;  4OO1 G;  2D5D A;  5EKI A;  3JAM E;  3S2H B;  5JOB A;  3CU7 A;  4CJ2 C;  3DMU A;  1B50 A;  2KVM A;  1JWM D;  4FF3 A;  3J7Y W;  1GHK A;  1FNV A;  4R9W A;  2EY5 A;  1D6E C;  2HQE A;  2KCN A;  1IKL A;  4HAE A;  2PNR C;  5M5W B;  3S17 B;  2IX0 A;  1W6K A;  2AQ2 B;  1ENC A;  5CV8 A;  2JA7 B;  4ILW A;  2G9D A;  2F4I A;  2K6A A;  4HTH A;  1Y69 U;  1BCP B;  4DXG A;  3K5L A;  1RD9 D;  5JVG 3;  1GUG A;  3KLR A;  3QB3 A;  1S5F D;  4IUU A;  2F03 A;  4FYD A;  1GUN A;  1TWH B;  2K7V A;  4MHE A;  2AUK A;  3GTP B;  2KJX A;  2BCO A;  1A6X A;  2BOS A;  1WTO A;  2R61 A;  1C4Q A;  1R9T B;  1JOR A;  2A68 C;  5JEA G;  3I73 A;  4B9W A;  3KBG A;  3CRL C;  4NW2 A;  4V19 0;  2L0C A;  2EE1 A;  4HED A;  2WV6 D;  1AEX A;  2OXP A;  3OOC A;  5I4D A;  4K2K A;  1WD1 A;  1Q3L A;  3ONA B;  3SK8 A;  1LT5 D;  4U67 3;  3FKI B;  1STN A;  2R6G A;  4XTC S;  1EZ6 A;  4ZYS A;  4CKB A;  2O5I C;  2NVX B;  1E0B A;  2VUM B;  2ZXO A;  1O7Z A;  1JE4 A;  5KNB A;  2N55 A;  4KKU A;  5EQ0 A;  1ZYR D;  1SNM A;  3A54 A;  4U68 A;  5M5X B;  4TRD A;  1JOO A;  3CRK C;  3D31 A;  3FVQ A;  1EY8 A;  3HOZ B;  5JJZ A;  1ML0 D;  3ND8 A;  1OXT A;  2HUG A;  2EY1 A;  1PRT C;  2F0E A;  1A2T A;  2B2Y C;  3DWA A;  2IX1 A;  3K5N A;  5DEH A;  5IOC A;  1DOL A;  4IFD G;  3A56 A;  5KYI A;  3QWN A;  2BA1 A;  5K36 G;  2NVT B;  2HDM A;  5IGF A;  4KY5 A;  1IYU A;  2ENB A;  4QIW B;  1I4G A;  2Q8R E;  2J0T D;  1BO0 A;  2M2L A;  5KNC A;  4ZQ3 A;  1SAP A;  5A2Q E;  2K05 A;  1BQQ T;  3Q23 A;  1B53 A;  2EY6 A;  3D6C A;  1NAP A;  2AUJ D;  4IQZ A;  4K14 A;  3X3N A;  4QUC A;  1HFG A;  2AWO A;  2E75 C;  2X6L A;  2F0L A;  3GTQ B;  4CJ1 B;  1ET9 A;  1F2Z A;  1TS2 A;  5CV4 A;  4KHV A;  4XQN A;  1SND A;  2X69 A;  4LJZ C;  3AMU A;  3P1H A;  1V1P B;  2EYP A;  3K0Y A;  3T4A C;  4WRD A;  3C1E A;  3K5O A;  1F2Y A;  2EZV A;  4A3M B;  4C3H B;  5JPN C;  1SE2 A;  2LS0 1;  4BBR B;  1EY5 A;  3K5M A;  3J80 E;  1FYC A;  1TY0 A;  1WCM B;  1CZW A;  3PUZ A;  4C3J B;  2IL8 A;  4RKB A;  3GV3 A;  3J81 E;  3PIP 3;  3G7L A;  1ENA A;  2NN6 G;  3KLS A;  2EY2 A;  5J1Z A;  3BYT B;  3AU7 A;  1LT4 D;  3V2T A;  2B8F A;  4P2C B;  1HFN A;  2F0F A;  3VR3 A;  2WIN B;  4PNY A;  4IFD I;  3F2U A;  2NTS A;  4J8Q A;  1L0Y B;  1Q12 A;  1V1O A;  1I4H A;  3I4M B;  4KMU C;  1STA A;  1KDB A;  1MBY A;  4N9T A;  1WTQ A;  2MP1 A;  3HKZ B;  1U4P A;  5C4Z A;  1GHJ A;  1QB5 D;  4HR7 B;  2L11 A;  1RJT A;  5ELE A;  2EYJ A;  1ONL A;  1WTV A;  2AWN A;  2RDF A;  3U9O A;  1ZEQ X;  2JXM B;  3FDT A;  3K58 A;  3TN2 A;  4A3K B;  1CHQ D;  2NUC A;  3SEB A;  3FRP B;  3S1M B;  1I4Q A;  4A3D B;  1GOZ A;  1SXT A;  5J39 A;  3H91 A;  2SNS A;  2VXW A;  3NQI A;  1SNC A;  3PIO 3;  1PZI D;  5EBD A;  1Z47 A;  1Z6H A;  4ZAI A;  2PW5 A;  4L8J A;  1SMY D;  1SYE A;  2Z4I A;  1SYG A;  1QIL A;  3VA7 A;  1A3V A;  5IGB A;  4HSV A;  1TU2 B;  4WJW A;  3A8K E;  1LT3 D;  2NN6 I;  2QKI C;  2K5W A;  5C0X H;  4X3U A;  2A6E C;  1STE A;  1DXM A;  1EY0 A;  4A3B B;  5COR A;  4KN7 C;  3HOV B;  4Z9C B;  3SK5 A;  1HHV A;  3VR6 A;  5FO9 B;  4QMG A;  1ESR A;  1KNA A;  5IGE A;  1RKN A;  3DWQ A;  1YNN D;  2J4X A;  1DOK A;  5D3I B;  1DD2 A;  2KUM A;  2DY7 A;  4M8A A;  1EL0 A;  1STY A;  1OXU A;  2V4D A;  4OO1 H;  4XYO A;  3NUC A;  3HOU B;  1FGB D;  3R2I A;  4PMB A;  1I6V C;  1HQM C;  1D5X C;  1K83 B;  1AP0 A;  4DK1 A;  4RH6 A;  1F77 A;  2FIN B;  1SNP A;  1V43 A;  3I90 A;  5E4W C;  4XYQ A;  4C1N K;  1LTI D;  4RKL A;  5FKA C;  4CBV A;  3VR5 A;  4TQU S;  4DU9 A;  3C2P A;  4BY7 B;  3DEP A;  4QUF A;  5CBA E;  3S2D B;  1U9R A;  3EVQ A;  4KKS A;  4XQJ A;  2E74 C;  3BVG A;  3TSS A;  2F3W A;  4LMQ D;  5EKK A;  2F0U A;  3NTK A;  2VNU D;  4BWG B;  5COY A;  4RWS C;  5G3L D;  4K6D A;  1I4R A;  3MXN A;  4C3I G;  1MI2 A;  3MAQ A;  4A3I B;  5JEA H;  3MTS A;  4UAI A;  1K8O A;  3GO5 A;  2C9O A;  1F2M A;  3BDL A;  4I65 A;  1WTR A;  2B2V C;  1HUN A;  3J7A F;  3MZ5 A;  1I4P A;  4CKC A;  3TZU A;  3DM1 A;  4E6I A;  1EU3 A;  1TVX A;  4BBS B;  5HGT A;  3D6W A;  1NSN S;  3EJI A;  1BCP D;  5F2D A;  1AFP A;  2F0P A;  1CQV A;  1G6Z A;  2B2Y A;  3S1R B;  3BDO A;  2LY7 A;  3VR2 A;  3I70 A;  3HOX B;  4KV6 A;  3KF8 A;  3SK6 A;  1Y1V B;  4CJ0 B;  5G3L F;  5C4X B;  3H3V C;  1VF7 A;  1X32 A;  5EKL A;  1GUT A;  3LX0 A;  1U4L A;  3Q0A A;  2XRS D;  1SYF A;  1B3A A;  1ILP A;  2C5C A;  4A93 B;  1PFM A;  1D1K A;  3DEO A;  4ABN A;  2QF7 A;  1MD2 D;  1OXV A;  3TZD A;  3GTK B;  2HCC A;  1EY4 A;  2J7Z A;  1DCZ A;  1PTO B;  4RFB A;  3SDZ A;  4IFD H;  5K36 H;  4RCN A;  1RTO A;  3OPO A;  2KA7 A;  2ID0 A;  4PMW A;  3IL8 A;  4FXD A;  1H9K A;  3H94 A;  2RQX A;  1TKW B;  1BCP F;  2ICI A;  2VB3 X;  3A7L A;  4YIJ A;  1A2U A;  1JQY D;  3M4O B;  4DK0 A;  1IW7 D;  2B8G A;  2BE5 C;  3DWP A;  5A2Q L;  3N52 A;  3RUZ A;  4OGQ C;  2A6H D;  1HTP A;  4KD4 A;  3URY A;  1EYA A;  2PMZ B;  1H9S B;  1B2T A;  2MHV A;  1B44 D;  5A35 A;  3MXU A;  3TP7 A;  1TS5 A;  3OHX C;  5M5Y B;  4KD3 A;  4CHT B;  5IOD A;  3EFX D;  2K1B A;  4F7X A;  1PTO H;  1GJX A;  1BBX C;  5C4J B;  2D9U A;  2BDO A;  5I9O A;  2OT2 A;  4FNF A;  2D2C C;  1H9J A;  5C3W A;  4C56 C;  3T51 B;  1X3Q A;  4DNT B;  1F9P A;  4MN3 A;  4O42 A;  2RA4 A;  2WKD A;  4RHS A;  3J80 L;  2TMP A;  1LTR D;  3MFY A;  1LLR D;  4IUR A;  3IKJ A;  1WTX A;  3KK7 A;  2NBF A;  4H7B A;  2NN6 H;  5ELB A;  3J81 L;  3WOF A;  3M7N A;  3R8B A;  3QJY A;  1EY9 A;  3LNN A;  3ERO A;  5K5P A;  3HS0 C;  1DOM A;  1LTB D;  5I6Y A;  1E2Z A;  1TR5 A;  1DYQ A;  2RVL A;  4EGV A;  2NTT A;  2E2I B;  4QF4 A;  5IT9 E;  3T56 B;  2RSO A;  3QOJ A;  3TDQ A;  2EJG C;  4RAU C;  2LFN A;  2NYZ D;  4O1N A;  2EYF A;  3BYY B;  4ZUJ A;  4F8M A;  5FK9 C;  1UUP A;  1Q1B A;  2EYM A;  1WD0 A;  1SE4 A;  2A69 C;  3K57 A;  2B2T C;  2B39 A;  3QG1 A;  5C5M A;  2L5T A;  3R93 A;  3HEJ A;  2F3V A;  3L3O C;  1TII D;  3M3Y B;  3T13 A;  3I4N B;  1CFM A;  2GA4 B;  1EWC A;  5DM6 3;  4RA8 A;  1S5D D;  2ZT9 C;  2FJ2 A;  5JVH 3;  3A8I E;  4EQN A;  3NSW A;  2RKS A;  1H9S A;  2CW0 C;  3N6R A;  1CZG A;  2KEE A;  1Y8P B;  4XQQ A;  3S16 B;  3OMG A;  1D5Z C;  3RZD B;  4H44 C;  5KIX A;  2XN9 C;  1Y8N B;  3NXW A;  1TWF B;  2MGS A;  3PUV A;  1G2S A;  2HCI A;  2L9H A;  5D3D A;  1HTL D;  2Z4H A;  4C2M B;  5M3F B;  5BN4 A;  2B63 B;  2A68 D;  2JEA I;  4K5V A;  4MIU A;  2B2W C;  1G29 1;  3HZX A;  1IL8 A;  3MFG A;  4UDU C;  1KNE A;  3A7A B;  2FMC A;  1I4X A;  1CTM A;  5C4H A;  1STH A;  4IUP A;  3OIP A;  1CI3 M;  1MGS A;  3MXP A;  1B9N A;  3I3C A;  1CA5 A;  3C46 A;  1ZKO A;  3KUP A;  4K5X A;  5LL6 S;  1J9O A;  5IGC A;  1SYB A;  4TSS A;  1C8C A;  5CV5 A;  5D14 A;  2O2L D;  5JAV A;  2PCF B;  3C1F A;  2XWB B;  5FLX E;  4C3I B;  1PFN A;  5FO7 B;  1BNZ A;  4NDX A;  2B2U C;  1LV9 A;  3E5S A;  2F0I A;  5EBC A;  1LTT D;  1PRT D;  3D4D A;  1S5B D;  3FEW X;  2WAC A;  1VCI A;  4DF7 A;  2NB0 A;  3P75 A;  5BN3 A;  1TWA B;  4KN4 C;  1JOQ A;  2SEB D;  4RGT A;  4HCE A;  1EWH A;  2JSO A;  1M8A A;  3K59 A;  2B2V A;  1V8Q A;  3GTM B;  3OWF A;  2XIW A;  4FF4 A;  2F0D A;  2IT1 A;  3RD4 A;  3NTH A;  1QWY A;  2JYO A;  3GTG B;  3HP3 A;  1TWC B;  3S9W A;  2EYO A;  3PMF A;  4KJN A;  1PMR A;  3NQT A;  1EY6 A;  1PTO C;  1F9S A;  3LWE A;  3NWS A;  4I7Z C;  1RF2 D;  1IHZ A;  1A3T A;  2LKV A;  1BF4 A;  1S5E D;  1SFO B;  3G6J B;  5E1F A;  1CT1 D;  1F2L A;  4G7Z C;  3H6M A;  1KDA A;  2F0G A;  3E6Z X;  5I6W A;  4ODG A;  4L63 B;  2KHS A;  3BDC A;  4H13 C;  4K5W A;  4OIJ A;  2ZXR A;  1TS4 A;  3I8Z A;  1PRT F;  1BDO A;  5DAU A;  5KND A;  1PZK D;  1V1P A;  3A8J E;  4OHJ A;  4RGN A;  5M3M B;  2EVB A;  1R4P B;  5CGK A;  2I46 A;  2H4O A;  2OEO A;  3C3L A;  1ESF A;  5D65 A;  5CV6 A;  2YYZ A;  1JCK B;  3KBX A;  3NBH A;  3SR1 A;  4S3S A;  2MJ8 A;  3MA2 B;  5I2Y A;  2F0S A;  4FO2 A;  1BXT A;  1KAB A;  1C48 A;  1G91 A;  1QG7 A;  3GTJ B;  3ERQ A;  2FFK B;  2F0K A;  4F87 A;  1EEI D;  3VYR A;  3RZO B;  5C3E B;  1GXD C;  2K32 A;  5T1G A;  3EA6 A;  5JPM C;  4FVM A;  1SJH D;  1HRJ A;  2NVQ B;  1VMC A;  1BUV T;  2FHT A;  2CQA A;  3EQL C;  1Q8I A;  3BVM A;  1A15 A;  1NCV A;  2KCC A;  1JWS D;  1FNU A;  1NR2 A;  1VMP A;  4A3E B;  1NR4 A;  5DM7 3;  2A5H A;  2WKC A;  1SNQ A;  1CHP D;  1FD7 D;  3D4W A;  1CM9 A;  4C3H G;  4CKE A;  5IGD A;  4ZK9 B;  2F0M A;  4RGO S;  1GUO A;  1QCB D;  4HMJ A;  3P7J A;  1LTG D;  1TS3 A;  4XT3 B;  1SSO A;  4WFN 3;  1B4O A;  4C3J G;  1AW7 A;  1RDP D;  3DXJ C;  1DJR D;  1EQT A;  1RTN A;  1HA6 A;  1CQF A;  1STG A;  1JR0 D;  1PLF A;  4R8N A;  2TSS A;  5EPJ A;  2ZXP A;  4K8J A;  2DNE A;  5KGU A;  3ND9 A;  3S15 B;  1SBB B;  2F1M A;  1TWG B;  4ZKC B;  2RSN A;  1JIC A;  5C6A A;  2EJF C;  3PO3 B;  2R93 B;  1W6J A;  2A74 C;  3MWY W;  1QOH A;  2E2D C;  2R92 B;  5I2X A;  1Y8O B;  2IJ0 A;  4QB4 A;  1KLG D;  4K2L A;  3NBI A;  5EPK A;  2CHB D;  3TP5 A;  1B1Z A;  1HXY D;  2YU9 B;  2JA6 B;  2F0W A;  1NUC A;  5FO8 B;  4G7O C;  2A6E D;  3BG3 A;  3L7Z C;  3DUZ A;  1QNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...