4IN3A

Crystal structure of the chs5-bch1 exomer cargo adaptor complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
80
structure length
80
Chain Sequence
DPEFMSSVDVLLTVGKLDASLALLTTQDHHVIEFPTVLLPENVKAGSIIKMQVSQNLEEEKKQRNHFKSIQAKILEKYGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitin biosynthesis protein CHS5
publication title The exomer cargo adaptor features a flexible hinge domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 16
structure length 80
sequence length 80
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16892 CHS5_N Chitin biosynthesis protein CHS5 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.890 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4in3A00
4IN3A 4WJWA
chains in the Genus database with same CATH superfamily
4IFDI 1SNMA 4DA2A 4NP5A 1IXRA 1W3SA 1EL0A 3D4WA 2I07B 1EZ6A 4JI6Q 4MNOA 4F88A 4C3HB 1E1OA 1X55A 1TWHB 4RFBA 1WFQA 4IPHA 4DR3L 3NP8A 2F0TA 2Q8TA 3EA6A 3WOFA 1KIXA 1V1OA 1B4OA 3PUZA 1FNVA 4CKEA 1HNWL 4IN3A 3AFQA 4EGVA 2V4DA 5C44G 5T1IA 1ZXTA 1PA6A 2B8FA 5FLMG 4ME3A 1I3QB 4HN7A 4N8X1 3KOJA 2MNAA 1STBA 1MD2D 5IYBH 3DUZA 2FXQA 1EOVA 5FO7B 5IGGA 1L0YB 4A3DG 4B3SL 4L6TB 4LFAQ 5CV7A 3GV3A 3K5MA 1J5EQ 4DXGA 1PZKD 4GOPA 4HSPA 2EY1A 3DM3A 2RSOA 1E2WA 4JI3L 4LNQA 2HQLA 4LF4Q 4OX9L 1WD1A 3P75A 1XTDA 3HOXG 3P1HA 4X3TA 5JJZA 1BCPB 5I9OA 2DY7A 3NWTA 1HA6A 3LX0A 1VQFA 2J0TD 1STGA 3OWFA 1I4GA 3CXCA 1CSQA 5C5LA 2UUBL 4A3IB 1Q1EA 2L4NA 3GD7A 5EQ0A 2UXCQ 2EXDA 2B2YA 4CHTB 4H13C 2ZJPA 2I46A 3A7LA 2OTLA 1WTVA 1U5KA 1KD1C 4HIMA 1FVIA 4G7HC 1M90C 1VQ5A 4M8AA 3CF5A 3HEJA 2QA4A 2Z0SA 2IJ0A 5DAUA 2ENBA 2VUMH 1N36Q 4G57A 3VR3A 4POGA 4BY7G 3IL8A 1GHJA 4HJ8A 5C4XB 2NN6H 3NQTA 5IYDG 4A3LG 2K33A 4IUTA 1KC8C 4DV1Q 1N9WA 1Q7YC 2N49A 4LF7L 4CKCA 3RLNA 4OXPA 1W2BA 1R9TH 1ICFB 1Q8IA 5M3MH 2ATWA 4A3BB 3HOWG 1I4PA 1X9NA 5CGKA 2VQEL 1K8AC 4L5RC 3C1FA 3OW7A 3GTLH 1UWVA 3H15A 2R7DA 3OIQA 1B50A 3L3OC 1EIHA 2Q2HA 2LS01 3KLRA 4CDCC 4FF3A 2JP1A 1M1KC 4OO1H 5CV6A 2DUDA 1X3PA 4WJ3M 1YHAA 3E9IA 1A15A 1L1OA 2IWHA 2FMCA 2A68D 3D6CA 5IP9G 4KN4C 2KCMA 3DMUA 4N9TA 1B1ZA 4K6DA 2F52A 2FJ2A 3QWNA 2HUGA 5BN4A 5IGEA 1JWSD 3C2PA 2JA8G 3NXWA 4DR5L 4H7BA 3ZYYX 3ULLA 4DUYQ 1EYDA 4XYOA 5AJ3L 2ZJRA 5BN3A 2RHQB 4EX5A 1PDQA 2SDFA 2VY3A 4A3GB 2EVBA 1WCMG 3FKIG 4DAMA 5CBEE 3PO2G 1Q90A 5DM63 4LF7Q 1LV9A 2F4VL 3R2TA 2FFKB 1TXYA 3BVMA 4HJAA 3H91A 2HD3A 4HIDA 4WORA 5EGTA 2C5CA 3WDNA 3GTJH 2D2CC 4XQNA 1WTHA 1EY0A 3HKSA 3HOZG 3JAMc 2H5XA 2B8GA 4JI1Q 2A1AA 3R3OA 1R4QB 2VB3X 1NR2A 2BA0A 1JOOA 4FO2A 1AW7A 2WV6D 4KJOA 1PXUA 1JOQA 1XNRL 4JYAL 1OTCA 1PH7A 4EQPA 1N8RC 4YHHL 5CC4A 4DV2Q 3X3MA 3CC2A 2JQOA 4FP5D 5LL6X 5CV9A 3I2ZA 4QIWE 1EQQA 1HNXL 4P75A 2EY2A 4QL5A 1SFOB 3KFUA 2R92G 2EZVA 1V43A 2VZAA 1B3QA 2XRQD 1PTOF 3M7GA 4ZUIA 3TREA 3L0OA 2BH8A 2BE5C 4RG1A 1IKMA 3HKZB 2K28A 1C8CA 1QVCA 4LFBL 4R8IA 1N32L 4O1NA 2SNMA 2EXZA 3KBGA 1EIFA 3U50C 2ID0A 4DF7A 1Y1VG 2E2DC 4JW0A 1MJEA 4MTKA 1SR3A 3NENA 3I8ZA 4Q5VA 1I6HB 2M9VA 2K7VA 3GTLB 1K83B 1D5ZC 5IIFA 3RLFA 4BXXG 2XSCA 1WTRA 2K5DA 3J80i 4BBSH 1V9PA 5CV8A 3PQIA 1UUPA 4PZ8A 3RMHA 4DR1Q 3KJPA 4DV0L 1PYBA 3MA2B 3HOVB 2OQKA 1KNEA 3EIVA 5EBDA 5M5XH 1X3GA 1E2VA 2WB1G 3SK5A 2A8VA 2K01A 4DNRB 3BZDB 1IBMQ 5HGQA 2AUJD 3VYUA 1SNPA 3I91A 3CCJA 2GA4B 3TEHB 2F0JA 1HQRD 1B9MA 1MGSA 2HIXA 4YHHQ 1AN8A 1HTPA 2B39A 3KF8A 2B2UC 4QCLA 1K3BC 1G51A 1KDBA 4KHZA 2XGTA 1U4MA 4AIMA 4A3EG 2GVBA 1RJTA 5JJLA 5IT9E 1DZ1A 1HR0Q 4K5WA 3BJUA 4YY3L 3JC66 2UU9L 1XPUA 3HOYH 1TT2A 1QNKA 1EY9A 1Z6HA 1PH1A 5EPLA 2A69C 4DK6C 1LTID 4FF2A 1MJCA 1XYIA 4RGMA 3TMEA 3BZCA 1D7QA 3E6ZX 3CC4A 3GTJB 3CRLC 3S1NH 4JI4L 2F0NA 4DGZA 1VQ4A 1QUQA 2UUCQ 2A6ED 3QOJA 1YNNC 1V1QA 2NN6G 2UUAQ 2K5VA 5J22A 3M3YH 3VYRA 1PH5A 1SYGA 4NXNQ 1SNQA 2L0CA 4LF5L 2WKDA 3H0GB 4UY8C 4RCOA 3NBHA 4B3MQ 5IP7G 4S3SA 2MFIA 4L8JA 2Z6BA 2L11A 2K32A 2RSNA 2CCZA 1TWCB 1FR3A 1NUCA 1C0AA 2JA5G 3PUYA 1YHQA 3PUVA 2NVYH 1LO5D 2M2LA 4BY1B 5IGDA 3SEBA 2MGSA 5M3FH 2AKWB 3UI2A 1WVLA 1X3EA 1D8LA 3BU2A 1P8LA 2R7ZH 4UDUC 4JCVE 3S2HH 2DJGC 1AEXA 4P74A 2KEDA 2A5HA 1S3OA 2GVAA 5KYIA 4NXML 4AYBB 4MN3A 1YVCA 2UU9Q 3CCVA 4HAEA 1X54A 4A93H 3DLLA 3HOUH 1XMOQ 5D3IB 1JQYD 1BBUA 1AE3A 2Z1CA 3ERQA 2RQXA 1BUVT 4DV3L 1CI3M 1UEBA 3PO3H 3R2IA 2GN5A 1FJGL 3T13A 5M5XB 2E2IH 1X65A 5EPKA 2VW9A 2SEBD 2F3IA 1LT3D 3U9SA 1SBBB 1FYCA 5EBCA 3DWPA 2OT2A 2WAQB 2DNEA 1A3UA 5G3LF 4LF5Q 1H9JA 3C1EA 3ULPA 2YTYA 1O80A 2A19A 2OEOA 1IHZA 1F77A 3K57A 2EYFA 1ASZA 3PF5A 2VQFQ 2KOLA 4KTAA 1LTBD 3J81L 4HJ5A 1WTPA 4GKKQ 4DV5Q 1D1KA 1QOHA 1BVSA 1EWCA 3CAMA 2EIFA 1J9OA 4DV7L 1EFID 1NNXA 5I9PA 1TKWB 4J15A 2Y0SB 3T4AC 5IYCH 5HY6A 1LLRD 1F2LA 4PZ6A 4B3RL 2ES2A 1QCBD 1XJVA 3AEVA 1XPRA 1PRTD 3MEHA 1S5CD 4TKOB 5AFWA 5C0XG 1TU2B 3FP9A 3HP3A 1ET6A 3S1NB 2NVXH 1R4PB 2JA7G 5H1SE 1HUMA 1CZWA 4QJFA 3S16B 3TZDA 4A3JH 4ABNA 4CJ1B 3I4OA 5FKAC 3D0FA 2QEJC 4E6IA 1H9RA 5D3DA 3DWQA 1IBKL 2Q2UA 1HRJA 1ZKOA 5GAEC 1QILA 2KVMA 3A5UA 4DR7Q 5M9OA 2DY8A 2MJ8A 3K5NA 4QB4A 1ILPA 1V8QA 4X64Q 4IZ8A 2E2JB 1DOLA 4KHPQ 2VS1A 3MVVA 1X32A 1TS2A 3DEOA 4HIOA 2E5LL 5ELNA 5M3FB 4DNTB 3D4DA 1B53A 5ELFA 5E7NA 5KIXA 1NMGA 4LWCA 4NDXA 1HZAA 1JOKA 4JI8L 2UXDQ 2FMMA 2R7ZB 3I3CA 3IFTA 1MIUA 4OIJA 3SDZA 1EU4A 5IY0A 1CK1A 1SJED 1XWEA 1KL9A 2PMZE 2RDGA 4HJ7A 3IKJA 4IPGA 4DN4M 4RHSA 4BS9A 3T1HL 2B3GA 5DM73 1B9NA 1IBLL 3L2PA 1DXMA 4O42A 3HOUB 4CJ0B 2IW3A 4X65L 2KHSA 5KNDA 4GKJL 4R4OA 2RHSB 3EVQA 5FK9C 3RUZA 3U4ZA 3PUWA 2MO1A 2CHBD 2OCEA 2MO0A 3Q6SA 1I3QH 3SR1A 3F1ZA 5JEAG 2R6GA 3KDFA 2NWGA 4V0BA 1CKNA 3JAML 4ALPA 4O2DA 4IQZA 3TBIB 3BVGA 1QG7A 4R4IA 2JE6I 4DR6Q 4CKBA 3H09A 1Y14B 4JI6L 1FD7D 3M7NA 4BA2I 1YNJC 2Q2TA 4IO9A 1GD7A 1RKNA 3C3LA 5C6AA 4A75A 1EEID 1ONLA 3N52A 4R1JA 4GN3B 3IAYA 2F0VA 4YCWA 4R4QA 1YNXA 3L9AX 5A2QE 1U4LA 2F0UA 3A74A 3GV6A 3I90A 5C3EG 2NVXB 4A3IH 3STBC 1SYCA 1SAPA 3VR2A 2F0QA 3M85A 2WACA 3NE5B 1LTSD 1RTNA 1II3A 2C35B 4A3JB 2K04A 1EWIA 2Z4HA 3W3AA 1E0BA 2IHEA 3KLSA 4R4TA 2B63G 1GUNA 1LACA 4LFAL 3H94A 1J5EL 2B29A 4R9WA 2N55A 3G71A 4CDEC 2XNAC 3FDTA 4C3IH 5C4XH 4A3MH 1B44D 2OXPA 1PTOD 4CBVA 4DR2Q 2F0KA 3RNUA 1C9OA 4JBWA 3RR5A 4KV6A 4LF4L 4BBRG 5GAGC 3PIO3 1BOSA 1U4PA 4WJ4A 2B2UA 4C2MB 1CZGA 4V190 2N8NA 2QEXA 3B6YA 3AFPA 4XXEA 3PO3G 1CT1D 1EYCA 1QZGA 5T1GA 1Q1BA 5ELOA 1K0SA 4Q0FA 5FOBB 1YITA 2HHHL 2UXCL 2JN4A 5GROA 4C3JG 2EOTA 1A3TA 4PG3A 4F7XA 2F3WA 1U9RA 3TP5A 4A3KG 2LMCB 3A54A 5LMUQ 4ZK9B 2WKCA 1N36L 2KUMA 2HCIA 2EQSA 4BY7B 5JPMC 1Y1WG 3CPWA 1SLJA 4FXKC 2YTXA 2NVTB 1G6ZA 4DV1L 1N34L 1YZ6A 4WFN3 4EQ5A 2EPBA 2IX3A 5IYCG 2K14A 4DFAA 3CPFA 3MFYA 5IWAQ 1DYQA 2ZTCA 5GQOA 3BDOA 3CHBD 5NUCA 1K9MC 2DGYA 4X6AH 1VQJA 4X3KA 2CW0C 4A3GH 4ZYSA 4G4KA 4G7ZC 5M5WB 1BCPC 4A3FG 1GUSA 1LABA 1MHWC 2F0HA 3ERSX 1M8AA 2AQ1B 5E3FA 2JA6H 2EJMA 4AH6A 5C0XI 4H44C 2IY5B 2ZTDA 2H1EA 1UEAB 2HHHQ 3K58A 4X3SA 1YHBA 2D62A 4LMQD 3J81c 5LMNQ 2E2HH 3Q24A 1SRUA 2R93H 2CQAA 4RA8A 3S2DB 4DUYL 1A8VA 2WFWA 3V96A 1A3VA 4K8IA 1N33Q 2K75A 2PW5A 2B2WC 3S9WA 3A8JE 2F0IA 4MZ9A 4C3HG 3D4RA 4P73A 3FKIB 3TP6A 4C3IB 1SFOH 4C1NK 4A3MB 2Z6KC 5IGBA 1N34Q 5KNBA 1HJPA 5FLXL 4NPSA 1UE5A 2LY7A 1K3RA 1O7YA 4PMWA 1S72A 3PMFA 3K80C 1EU3A 3NBIA 3S1QB 3NHHA 3OOCA 1JJ2A 2QW7A 4KY5A 5K5PA 2F0GA 4HR7B 1L2FA 1VQHA 4LJZC 1LT6D 3KK7A 3ND8A 1I6HH 4JI1L 3T1YQ 3I4NB 1K83H 2A73B 1HQMC 3I55A 3MAQA 3F2BA 1NAPA 1VQ6A 1F9RA 2A6HC 1PFSA 5ISRA 2ZXRA 3TS0A 1T9HA 4RH6A 2XVSA 1Q8KA 3HOVH 3A0JA 4DV2L 3CP0A 3KJOA 4PZ7A 4KKSA 1F2ZA 5BN5A 3D8GA 1SYFA 1PH3A 1X56A 5G3LD 3GTGB 3DHQA 4NMZA 4LK1C 2NTSA 4QY7A 2F0OA 1UNSA 4FXGC 3FPPA 1YJ9A 3PIP3 4IFDH 4N9PA 1Y1VB 3A56A 2A68C 3MZ5A 4A3IG 4JBJA 4LW1A 2AWOA 1IL2A 1G2TA 2IL8A 3K0YA 1F2MA 4ODGA 4LF8Q 1OXUA 5COYA 1S5BD 5D65A 3OTOQ 4DAPA 2JA6B 3P7JA 1EY4A 4DR1L 2TMPA 4KKUA 4KY6A 3GTMB 1QVFA 2CWPA 3UE1A 3F2CA 2SNSA 3CW2C 2I5LX 1RF2D 3I4MB 2WB1B 4ID6A 2OF1A 2E2HB 2R93B 5FJ8G 4KY7A 1IBML 4RKLA 3H0GH 1S5FD 2L55A 2BCOA 4QUFA 5LHY1 4A3BG 1Q3LA 1RD9D 3NELA 5EJWA 1S5ED 1PH9A 3T51B 1Z7TA 4JI5Q 1TWCH 3KF6B 4A3EB 3MXNB 4K14A 3D3RA 3AB9A 3K6OA 4GZYC 5J1ZA 1HR0L 4BY1H 1DCZA 2Z4IA 5C4JH 5TSSA 2FINB 2BE5D 1H9SB 2RA4A 1VQDA 2UXBQ 3RN5A 2ZM6Q 3EJIA 5JJIA 1KHIA 1SE2A 3MWYW 3CCQA 1Z47A 1SNOA 5FO9B 2YYZA 1HTLD 1SNCA 1AZPA 2R61A 1PVOA 3IRBA 1U0LA 3G4SA 3VR6A 2UUCL 1W6KA 2B2TA 3AMUA 3CD6A 2K05A 3TN2A 2UUAL 5C3XA 4EVOA 1L0XB 2HCCA 5IYBG 1GUOA 3TS2A 2PQEA 1JR0D 1CUKA 4NXNL 1IYVA 2IX1A 5I6WA 4A4IA 1WTXA 1GHKA 1BDOA 4B3ML 3G7LA 1BXTA 2RCNA 3KLWA 3TQYA 3PV0A 1GO3E 1ET9A 1OO9B 2PQAA 4HCEA 3LGJA 5KNCA 1K8GA 3QJYA 1EIGA 4NB3A 3QIAA 3L7ZC 1D5XC 4YCVA 1BNZA 1YEZA 1SN8A 1Y8OB 2VL6A 3VYTA 3H3VI 3GTKB 2X6GA 4B3TQ 2KQ3A 4A3CH 1XMQQ 1DJRD 3A8KE 1K28A 3E0JA 3PGZA 3SHLA 3OYYA 1OXXK 2A74C 1KTKA 1B8AA 4JPBW 1E24A 2RDHA 2F0EA 1BCPF 4H02A 1LM0A 2R3ZA 1XMOL 2A69D 1V1PB 4JI7Q 1L0WA 2VUMG 2CVRA 5IGCA 2HT1A 1A63A 1Q82C 3F8TA 4IFDJ 3F2UA 1VS0A 1YNND 1C7YA 1BKBA 1TY0A 3RZOH 4OWTB 3S16H 2E74C 1EQTA 4MTNA 1NBWA 1OXTA 3J81j 3CMAA 2VXWA 3HKZG 2AWNA 3E5SA 2WIIB 5JPNC 5M3MG 4GLAC 3S14H 4KMUC 3FVQA 2VQFL 4LF6Q 1SYDA 4X62Q 2KHIA 1NY4A 4IUVA 4GKKL 5E4WC 5J39A 4DV5L 2E2JH 2PO4A 1OXSC 4HSVA 4UP7A 4OO1G 1ENAA 2D0PA 5C4JB 4CDFC 1KDAA 2O5JC 3FPUB 3W1BA 3M9BA 1UAPA 5KGUA 1U4RA 1TVXA 4GNXC 1WD0A 4BWGB 1LTLA 5JVG3 1QVGA 1KQSA 3CCEA 2JA7B 1E3PA 5ELCA 3BDLA 3OHXC 1SE4A 4GNXB 1PH6A 4XYQA 5BR8Q 1I6VC 4YWLA 4GOPB 1PZID 1STAA 1S5DD 1EQVA 2AMCB 5FLXc 4A76A 3U9OA 2L15A 4DR7L 2O4XA 5IE8A 1P16A 4ULLA 1ILQA 3W2DA 1K73C 4IFDG 2YU9B 3TSSA 2QGQA 3MXUA 4X64L 1FNUA 1CM9A 4KLKA 4KHPL 1BBXC 2ALYB 1KLGD 4K5VA 3CU7A 2NVQB 3S15H 5J3BA 3G6EA 2B2WA 3A8IE 3EN2A 3S1MH 2UXDL 1VF7A 4KJNA 4NW2A 3J7A5 3HZXA 1Y8NB 3N6RA 3DM1A 1HZCA 2Z6KA 4G7OC 3HKZE 5C4HA 4LFCQ 2EY6A 1GUGA 2B2VC 4AQYQ 1Q86C 3MFGA 1EY7A 3A5ZB 4JI0Q 3IFDA 4IUNA 5IOCA 3M4OB 4H0LC 1NCVA 1WI5A 1QE6A 4ZKCB 4OIKA 1WJJA 2ASBA 1PMRA 1KAWA 1SMYC 4BA1I 3H6MA 2ZJQA 3BYTB 5I4DA 3J81E 2MPMA 4GLXA 5FLMH 3A55A 3OWEB 3RZOB 4I65A 5FO8B 1SMXA 1LYLA 2HDMA 2RBMA 4A3DH 4TSSA 1S40A 1CA5A 3S14B 4JOIC 1D2BA 1SSOA 1G2SA 1ICWA 4DR6L 4LF9Q 1HHVA 4TRDA 1PRTB 3I4LA 3M4PA 1TWGH 1ZYRC 3FHWA 4ZKBB 2PW7A 2NZ1D 4X66Q 1A2UA 4DPGA 1UE6A 4C2MH 4BBSG 1F2YA 1HPCA 2YTVA 2I5MX 5LL6S 4DV6L 5C3EB 1GXDC 2C9OA 1XXGA 3V2TA 3TDQA 5L37A 1QJOA 3E3XA 4RGTA 2IHFA 1H95A 3E9HA 4RAUC 2WAQG 1HR0W 1VQAA 1I94Q 3ICEA 2EYMA 1XX8A 4R8NA 1NMFA 4IUUA 2OWOA 1KRTA 4RGOS 4DK1A 1IW7C 1MI2A 3GO5A 3J7ZC 4BY7H 1TS5A 1MSGA 4A3LH 4U68A 2NVTH 4DR2L 3P20A 3UE0A 4OHJA 1Q46A 2Z8LA 3HOYG 1FNWA 2LFNA 3MXNA 3MXGA 2BDOA 1PFBA 2H4OA 1A62A 3S15B 3HOWH 1PH8A 4DV4L 1DGSA 2IT1A 2Q2IA 3S1MB 1PZJD 3MHBA 3UDFA 4L5TA 2PYKA 4O0AA 1QB5D 3U4VA 4ZUJA 1IYUA 1YNJD 4MIUA 4DU9A 1DONA 1VQPA 1VDZA 4C3JB 5M5WH 4DUZL 3RZDB 4ME5A 4OWXB 1BQQT 1JICA 5EAYA 1MSHA 3JAME 2BA1A 4A3KB 2QILA 3S1RH 1AP0A 1D1IA 4AYBE 3LWEA 3MC0B 5LMUL 2LXKA 1EYAA 5C44B 4DV6Q 4RHRA 2NN6I 5CMDA 1HFGA 3G6JB 2PZUA 4JBMA 1G291 3STBD 4R4CA 5IP9H 4QF4A 2K50A 2O5IC 1SDFA 3OPOA 2JA8H 5JJKA 5M3FG 5IT9c 3S2DH 2PZTA 4A3DB 2AQ2B 2K5NA 2ICEC 3URYA 1O7ZA 3W1GA 5GADC 5IWAL 4EQNA 3O13A 2R7ZG 2JXMB 3OSOA 2WAQE 3CMEA 3J80L 3FKIH 4Y7NB 2YV5A 5KEEA 4OO1I 1TWGB 3RLOA 1RIPA 3MXPA 5IGFA 1EY8A 4U673 2EDGA 4A93G 3HOXB 3HOUG 1G6PA 2CFMA 2WINB 4DV4Q 2L12A 3SK4A 3AQQA 4PV1C 3S1QH 2CH4W 3QO2A 3BVZA 1EWHA 1Z9FA 3DXJC 2Y0SE 4XTCS 3HOZH 3V05A 1E7ZA 2MUYA 5CBAE 3E0EA 3I4NH 4J8QA 1ASYA 1V1PA 3UDIA 4DUZQ 4IPDA 5JVH3 3KF8B 5LMNL 3RD4A 3G48A 4JI2L 1ESFA 3OIPA 3GP7A 1GUWA 2JJQA 5HGTA 4LUVA 1XNQQ 1N33L 1Q81C 3U58A 1X3FA 1AZQA 4IJHA 2P5ZX 1RCVD 3HS0C 2EE1A 2R92H 1J8IA 2EJFC 3EQLC 2NTTA 2RCFA 3GTGH 4OELB 3OW2A 1EFWA 2PNRC 5K36H 4UPAA 1QUQB 3QOLA 3T56B 3AYHB 3DEPA 5CORA 3HOWB 2JK8A 1VQEA 4KD4A 1JB3A 4KN7C 1VQIA 1GKHA 1SROA 1Y1VH 2D0OA 2RKSA 2CW0D 5C5MA 5M5YB 4ZAIA 3NBHB 1PH4A 1HNZQ 3T1YL 1BCPD 4A3JG 3TRZA 4DAVA 4BXXH 3ITPA 1VQOA 3NTIA 3BDCA 4QIWB 2F0LA 3J7YW 4L5SA 4K0KQ 4GNXA 4DR4Q 3S1RB 2K4KA 2X69A 1TQOA 2BDNA 4IOAA 3T16A 3GTMH 5C4ZA 1UE7A 4KKTA 3R8BA 3HG9A 3NK9A 2MHVA 1J6QA 3CQZH 4N8FA 3I4MH 1LTRD 5F2DA 4JI2Q 3S24A 2N78A 1LTGD 2JA8B 1VQNA 1CSPA 5ELBA 2AUKA 1JE5A 4XIGS 2OQ0A 4HJ9A 1EZ8A 1NTGA 1CTMA 5GAHC 2J7ZA 3BYYB 2F0PA 3SGIA 1CHQD 5EPJA 2KCNA 3PIPA 1PRTF 1PYSB 4Z9CB 4A3EH 1Y8PB 1WCMB 2KEEA 4LUOA 2KCTA 2EYLA 3GTOB 3PO2B 3VR4A 4FNFA 4DR3Q 4LF8L 3ONAB 3J81i 2K1BA 1LT4D 2QDLA 3TP7A 4C1NI 1YJWA 3OTOL 1HNWQ 3KYHC 2F4IA 1VMCA 5CV5A 4XQJA 4I7AA 3FEWX 1KDCA 2Z9HA 2F03A 3HOZB 2B2VA 1VQBA 5DEHA 1YJNA 1SE8A 4FYDA 3TP8A 3S17H 4K8JA 4JBKA 1SXTA 5EKLA 1I50B 1Q12A 1KAAA 5FLXE 1UE1A 4UHVA 5CYUA 2A6HD 2I0QA 3GTPB 4B3SQ 5IP7H 1GJXA 2VB2X 3OMCA 4WRDA 2D9UA 1KABA 2HIVA 4F8MA 3PUXA 1SE3A 4JI5L 1F9PA 1HZBA 4HCSA 4RWSC 2JA5H 2R92B 4L63B 3D31A 1PV4A 4JI3Q 1FGUA 4IUPA 4OX9Q 4K2KA 1SYBA 1TR5A 2F0DA 4JOIA 2J4XA 1X3QA 2UXBL 2NZOA 3GTKH 2ZM6L 2I5HA 1IZ6A 1JC7A 1SYEA 3WOEA 2ZXOA 2UUBQ 2N88A 4PMBA 2K5QA 5CV4A 4ZRZA 3K7UC 2M00A 3VA7A 1VQ9A 2BOSA 3K7AH 4HMJA 1VQLA 1KXLA 1NR4A 1W6JA 5DNFA 4DNIA 4LAAA 2IX0A 1STHA 1RDPD 1JWMD 1TWFH 4EQOA 1CQVA 3BG3A 3VR5A 4C3IG 5IODA 1E1TA 5C4XG 4A3MG 2F0FA 3CQZB 4XDXA 3UDGA 1YI2A 2RF4A 4C56C 1VQKA 3I7FA 3OMGA 3FMCA 2JEBI 2F0MA 1RHPA 2VQEQ 4PMCA 1WTQA 1JWUD 3K8AA 1ZEQX 2XIWA 2K52A 4UAIA 4YWMA 3ULJA 1CA6A 4B3TL 4M1UB 2KENA 1CKOA 3J7AF 1A6XA 1DM0B 1XMQL 3JAMi 2OTJA 3Q8DA 3I4NG 3SVMA 2F3VA 2ZT9C 5JAVA 1JT8A 1WTOA 4JVZA 2G9DA 1C4QA 3A7AB 2L5TA 2KCCA 5I2XA 3CCMA 1AH9A 1G8ZD 3NSWA 5EKKA 3KDFB 4JI7L 5C0XH 2VUMB 1KNAA 2QCPX 1STYA 1CKNB 1H9KA 2JA7H 4OEMB 3M4QA 1O7LA 3D6WA 3S17B 4IURA 4RKBA 4DK3C 1WTWA 1TS4A 3NPPA 2SOBA 3I72A 3K5OA 3J80c 4DR5Q 5K36G 3W5OA 4P71A 5AJ3Q 5M3MB 1R9TB 4HMIA 1K8MA 1T5EA 1QNUA 4PNYA 4LF6L 4JK1C 2AQ3B 4X62L 3WWVA 3RN2A 1PFNA 2YU9H 4A3GG 1QZHA 4XQQA 4DAYB 4QMGA 4XT1B 2JA5B 2EY5A 2F4VQ 4GS3A 4K5XA 4CGYB 1PH2A 2KHJA 4TVAB 4F87A 5LMNW 2NVQH 1RTOA 1EY5A 4K6LA 1EQRA 2JA6G 1TIID 4KD3A 5CR3A 2KA7A 2NZHA 1ENCA 3NUCA 3T53B 3GTQH 1VQ8A 1YBYA 3HGBA 5IT9L 2RVLA 1LTAD 1JJGA 4GN4B 1HCZA 3I4MG 1JB7A 4J1MA 3GDEA 4DXFA 3QB3A 5BR8L 2R93G 3SK6A 1CKMA 5C3WA 3M4OH 1VMPA 1XNRQ 4JYAQ 2NBFA 1D5MC 1SNDA 3K7AB 4UP9A 5E4XA 3TZUA 1CFMA 1QWYA 3I56A 3CC7A 1VQGA 1TWFB 1VF5C 1PYWD 3VYSA 1HNXQ 1C48A 2WP8J 4RCNA 5JEAH 4XT3B 2O2LD 3NTKA 3PF4A 1CHPD 3NTHA 3Q23A 1RODA 1MBYA 3NEMA 4APVA 2ICIA 2PI2E 2PMZB 3K0XA 4LFBQ 1N32Q 1I4RA 1EIYB 1DOMA 5KRUA 4FDBA 1GM5A 3QR8A 3MEFA 4HEDA 2QDBA 2A6EC 2ZTEA 2V1CC 4LFCL 2L1BA 1EOTA 2N3SA 2EYJA 4OWWB 4B9WA 4POFA 4AQYL 1JJCB 1E2ZA 1B7YB 4JI0L 1A0IA 3I70A 3X3NA 1IL8A 4DV0Q 3C46A 1DD2A 1HH2P 2LSSA 3HOVG 4OL7A 1PFMA 4X3UA 1FL0A 1HZ9A 5C3EH 5ELDA 3MTSA 4CJ2C 2EYPA 2MP1A 4GOPC 4IOCA 4HTHA 2BH2A 1T5XD 3EBEA 1F9QA 3Q0AA 3VDYA 2TSSA 2AHOB 2B63H 1FGBD 2WB1E 2JYOA 4JV5L 1M4VA 1VQ7A 4DKAC 4YWKA 5C0XJ 1TWAH 4B08A 3SXHA 4LF9L 4QQBX 4B9XA 1VQMA 3CCUA 1S4ZA 2D5DA 4YY3Q 1KLUD 2FHTA 2KECA 1DOKA 2B2YC 4BBRH 4X66L 4IALA 1EYGA 4RMFA 4FXDA 1GVPA 4BBSB 3CCRA 2PNHA 4HIKA 2E76C 3GTQB 4JI4Q 1A2TA 1HUNA 1AFPA 1NSNS 2CQOA 4P2CB 4PQXA 2NB0A 4C3JH 3RZDH 2HDLA 2HQEA 2X6LA 2XRSD 1JCKB 1YIJA 2JEAI 1JMCA 1I94L 1HXYD 4J6HA 3H0GG 3DWAA 2K5HA 4ZLTF 4A3KH 3AU7A 3J7AV 4UP8A 1SMYD 5C44H 4OONA 3QG1A 4TQUS 1Y1WH 1XTCD 2CWAA 1GOZA 1RL2A 3PCOB 4K2LA 4YCUA 3EROA 4GLVB 4BY1G 4DK0A 2KBNA 2G9HD 5I2YA 3HOYB 2PI2A 1WOCA 3K5LA 1B3AA 5DLQE 1PRTC 4JV5Q 2RDFA 5KYLA 3H3VH 3I73A 3LNNA 1L1OC 3K59A 4NXMQ 4Y7NH 4AYBG 1ZYRD 2XWJB 2PPBC 3F2DA 1EY6A 5JEAJ 4A3FH 3M3YB 1L1OB 1LUZA 1SEBD 4YIJA 1AE2A 2K5WA 3HOXH 2ZXPA 1ESRA 3K81C 4L5QA 4IUQA 1PLFA 2LKVA 1JORA 4IJLA 3NWSA 4DV3Q 2CH4A 5ELEA 1FJGQ 3R93A 4ZCKA 1WYDA 4ILWA 2R7FA 2VNUD 1OXVA 3PSIA 3KBXA 1STNA 2NVYB 5D14A 4JG2A 1NE3A 1NJIC 1IYJB 4QUCA 1PTOH 4P72A 3SE0A 2B63B 3ND9A 3NQIA 2LXJA 3S2HB 1ML0D 1IW7D 2XTIA 2F0WA 2NYZD 1TWAB 4A3CG 1K0RA 2Q8RE 4C3HH 5IYDH 4DV7Q 1K8OA 2IPKD 1TWHH 2EJGC 2EYHA 1BF4A 1JE4A 3CKIB 4BBRB 2Y0SG 3KF6A 5HURA 4A93B 1O78A 1B70B 4B3RQ 3PIOA 1TY2A 3ZJYC 4CDDC 4WJWA 2CKZB 2G5DA 3UDXA 2K6AA 3KLSX 3PO3B 5EKIA 3BZKA 1H9SA 1E22A 5M5YH 1IKLA 4FF4A 2E2IB 3CRKC 4I7ZC 2QKIC 2K03A 2PZWA 5I6YA 1BO0A 1CQFA 3M4YA 4KK7A 1D6EC 3BS1A 4Y52H 4KHVA 1O7IA 1IBKQ 4KI0A 5A2QL 1I4QA 3GQBA 1LTTD 1VCIA 1XNQL 1F9SA 2DJFC 1EUJA 4GN5A 2PCFB 1SJHD 2XN9C 3ER0A 1H9MA 1Y1WB 2E8GA 1STEA 2L9HA 3EFXD 2F1MA 2B2TC 1B2TA 2E5LQ 1EEFD 1BBWA 3FRPB 4IPCA 4OGQC 3HFZB 4DAYA 1LT5D 3H3VC 4JI8Q 1GUTA 1X6OA 1I4XA 1PHJA 1I4HA 2JSOA 1VQCA 4FVMA 4MHEA 1WCMH 3T1HQ 3GTOH 2DNCA 1HA5A 3CCLA 1HNZL 2F0SA 2QF7A 3PO2H 4FF1A 4A3FB 1IBLQ 2E75C 1HFNA 2JA9A 4X65Q 2XWBB 2NUCA 4GKJQ 2PQAB 3VA5A 4QGUA 4JC0A 4RGNA 5A35A 4K0KL 4DR4L 1Y69U 3HRZC 3LWUA 1BR9A 5E1FA 4ZQ3A 1KRSA 3KUPA 4LUZA 1TS3A 3Q22A 3J80E 2Q8IB 1PTOC 2DN8A 2MQHA 3CCSA 1I50H 1XPOA 2EYOA 5FJ8H 1G91A 1I5FA 1ENFA 1MKHA 5JOBA 4NKLA 1PTOB 3SK8A 3GTPH 4A3BH 2KJXA
chains in the Genus database with same CATH topology
4IFDI 1SNMA 4DA2A 4NP5A 1EL0A 3D4WA 2I07B 1EZ6A 4F88A 4C3HB 1TWHB 4RFBA 3NP8A 2F0TA 2Q8TA 3EA6A 3WOFA 1V1OA 1B4OA 3PUZA 1FNVA 4CKEA 4IN3A 4EGVA 2V4DA 5T1IA 1ZXTA 2B8FA 1I3QB 4HN7A 1STBA 1MD2D 3DUZA 5FO7B 5IGGA 1L0YB 4L6TB 5CV7A 3GV3A 3K5MA 4DXGA 1PZKD 4HSPA 2EY1A 2RSOA 1E2WA 1WD1A 3P75A 3P1HA 4X3TA 5JJZA 1BCPB 5I9OA 2DY7A 3NWTA 1HA6A 3LX0A 2J0TD 1STGA 3OWFA 1I4GA 5C5LA 4A3IB 1Q1EA 2L4NA 3GD7A 5EQ0A 2B2YA 4CHTB 4H13C 2I46A 3A7LA 1WTVA 4G7HC 4M8AA 3HEJA 2IJ0A 5DAUA 2ENBA 4G57A 3VR3A 3IL8A 1GHJA 5C4XB 2NN6H 3NQTA 2K33A 4IUTA 4CKCA 4A3BB 1Q8IA 1I4PA 5CGKA 3C1FA 3OW7A 3OIQA 1B50A 3L3OC 1EIHA 2LS01 3KLRA 4FF3A 2JP1A 4OO1H 5CV6A 1X3PA 1A15A 2IWHA 2FMCA 2A68D 3D6CA 4KN4C 3DMUA 4N9TA 1B1ZA 4K6DA 2FJ2A 3QWNA 2HUGA 5BN4A 5IGEA 1JWSD 3C2PA 3NXWA 4H7BA 3ZYYX 1EYDA 4XYOA 5BN3A 1PDQA 2SDFA 4A3GB 2EVBA 5CBEE 1Q90A 5DM63 1LV9A 3R2TA 2FFKB 3BVMA 3H91A 4WORA 5EGTA 2C5CA 3WDNA 2D2CC 4XQNA 1EY0A 2B8GA 3R3OA 1R4QB 2VB3X 1NR2A 2BA0A 1JOOA 4FO2A 1AW7A 4KJOA 2WV6D 1PXUA 1JOQA 4EQPA 5CC4A 3X3MA 4FP5D 5LL6X 5CV9A 1SFOB 2EY2A 2EZVA 1V43A 2XRQD 1PTOF 3M7GA 4ZUIA 2BE5C 1IKMA 3HKZB 2K28A 1C8CA 4R8IA 4O1NA 2SNMA 2EXZA 3KBGA 4DF7A 2ID0A 2E2DC 3I8ZA 4Q5VA 1I6HB 2M9VA 2K7VA 3GTLB 1K83B 1D5ZC 5IIFA 3RLFA 2XSCA 1WTRA 2K5DA 5CV8A 1UUPA 3RMHA 3MA2B 3HOVB 1KNEA 5EBDA 1E2VA 3SK5A 2K01A 4DNRB 3BZDB 2AUJD 3VYUA 1SNPA 3I91A 2GA4B 2F0JA 1HQRD 1B9MA 1MGSA 1AN8A 1HTPA 2B39A 3KF8A 2B2UC 4QCLA 1KDBA 4KHZA 1U4MA 1RJTA 5IT9E 1DZ1A 4K5WA 1TT2A 1QNKA 1EY9A 1Z6HA 5EPLA 2A69C 1LTID 4FF2A 1XYIA 4RGMA 3TMEA 3E6ZX 3GTJB 3CRLC 2F0NA 4DGZA 2A6ED 3QOJA 1YNNC 2NN6G 5J22A 3VYRA 1SYGA 1SNQA 2L0CA 2WKDA 3H0GB 4RCOA 3NBHA 4S3SA 4L8JA 2L11A 2K32A 2RSNA 1TWCB 1FR3A 1NUCA 3PUYA 3PUVA 1LO5D 2M2LA 4BY1B 5IGDA 3SEBA 2MGSA 3UI2A 1WVLA 4UDUC 1AEXA 2KEDA 2A5HA 5KYIA 4AYBB 4MN3A 4HAEA 5D3IB 1JQYD 2Z1CA 3ERQA 2RQXA 1BUVT 1CI3M 3R2IA 3T13A 5M5XB 5EPKA 2SEBD 1LT3D 3U9SA 1SBBB 1FYCA 5EBCA 3DWPA 2OT2A 2WAQB 2DNEA 1A3UA 5G3LF 1H9JA 3C1EA 1O80A 2OEOA 1IHZA 1F77A 3K57A 2EYFA 2KOLA 4KTAA 1LTBD 3J81L 1WTPA 1D1KA 1QOHA 1EWCA 1J9OA 1EFID 5I9PA 1TKWB 2Y0SB 3T4AC 1LLRD 1F2LA 1QCBD 1PRTD 3MEHA 1S5CD 4TKOB 5AFWA 5C0XG 1TU2B 3HP3A 1ET6A 3S1NB 1R4PB 1HUMA 1CZWA 3S16B 3TZDA 4ABNA 4CJ1B 5FKAC 2QEJC 4E6IA 5D3DA 1H9RA 3DWQA 1HRJA 1ZKOA 1QILA 2KVMA 5M9OA 2DY8A 2MJ8A 3K5NA 4QB4A 1ILPA 1V8QA 4IZ8A 2E2JB 1DOLA 3MVVA 1X32A 1TS2A 3DEOA 5M3FB 4DNTB 3D4DA 1B53A 5ELFA 5KIXA 4NDXA 1JOKA 2FMMA 2R7ZB 3I3CA 3IFTA 4OIJA 3SDZA 1EU4A 1CK1A 1SJED 1XWEA 2RDGA 3IKJA 4DN4M 4RHSA 4BS9A 5DM73 1B9NA 1DXMA 4O42A 3HOUB 4CJ0B 2IW3A 2KHSA 5KNDA 3EVQA 5FK9C 3RUZA 3PUWA 2CHBD 3Q6SA 3SR1A 5JEAG 2R6GA 2NWGA 4V0BA 3JAML 4IQZA 3TBIB 3BVGA 1QG7A 2JE6I 4CKBA 3H09A 1FD7D 3M7NA 4BA2I 1YNJC 1RKNA 3C3LA 5C6AA 1EEID 1ONLA 3N52A 3IAYA 2F0VA 3L9AX 5A2QE 1U4LA 2F0UA 3GV6A 3I90A 2NVXB 1SYCA 1SAPA 3VR2A 2F0QA 3M85A 2WACA 3NE5B 1LTSD 1RTNA 1II3A 4A3JB 2K04A 2Z4HA 3W3AA 1E0BA 3KLSA 1GUNA 1LACA 3H94A 4R9WA 2N55A 2XNAC 3FDTA 1B44D 2OXPA 1PTOD 4CBVA 2F0KA 4JBWA 4KV6A 3PIO3 1BOSA 1U4PA 2B2UA 4C2MB 1CZGA 4V190 4XXEA 1CT1D 1EYCA 5T1GA 1Q1BA 4Q0FA 5FOBB 4C3JG 2EOTA 1A3TA 4F7XA 2F3WA 1U9RA 3TP5A 2LMCB 3A54A 4ZK9B 2WKCA 2KUMA 2HCIA 4BY7B 5JPMC 4FXKC 2NVTB 1G6ZA 4WFN3 2EPBA 2IX3A 4DFAA 3MFYA 1DYQA 3BDOA 3CHBD 5NUCA 4X3KA 2CW0C 4ZYSA 4G4KA 4G7ZC 5M5WB 1BCPC 1GUSA 1LABA 2F0HA 1M8AA 2AQ1B 5E3FA 2EJMA 5C0XI 4H44C 2H1EA 1UEAB 3K58A 4X3SA 2D62A 4LMQD 3Q24A 2CQAA 4RA8A 3S2DB 3V96A 1A3VA 4K8IA 2PW5A 2B2WC 3S9WA 3A8JE 2F0IA 4C3HG 3D4RA 3FKIB 3TP6A 4C3IB 4C1NK 4A3MB 5IGBA 5KNBA 5FLXL 2LY7A 1O7YA 4PMWA 3PMFA 1EU3A 3NBIA 3S1QB 3NHHA 3OOCA 4KY5A 5K5PA 2F0GA 4HR7B 4LJZC 1LT6D 3KK7A 3ND8A 3I4NB 2A73B 1HQMC 3MAQA 1NAPA 1F9RA 2A6HC 5ISRA 2ZXRA 4RH6A 2XVSA 4KKSA 1F2ZA 5BN5A 3D8GA 1SYFA 5G3LD 3GTGB 3DHQA 4NMZA 4LK1C 2NTSA 2F0OA 1UNSA 4FXGC 3FPPA 3PIP3 4IFDH 4N9PA 1Y1VB 3A56A 2A68C 3MZ5A 2AWOA 1G2TA 2IL8A 3K0YA 1F2MA 4ODGA 1OXUA 5COYA 1S5BD 5D65A 4DAPA 2JA6B 3P7JA 1EY4A 2TMPA 4KKUA 4KY6A 3GTMB 2SNSA 1RF2D 3I4MB 2WB1B 4ID6A 2OF1A 2E2HB 2R93B 4KY7A 4RKLA 1S5FD 2L55A 2BCOA 4QUFA 5LHY1 1Q3LA 1RD9D 5EJWA 1S5ED 3T51B 1Z7TA 4A3EB 4K14A 3D3RA 3AB9A 3K6OA 4GZYC 5J1ZA 1DCZA 2Z4IA 5TSSA 2FINB 2BE5D 1H9SB 2RA4A 3EJIA 1SE2A 3MWYW 1Z47A 5FO9B 1SNOA 2YYZA 1HTLD 1SNCA 1AZPA 2R61A 3VR6A 1W6KA 2B2TA 3AMUA 2K05A 3TN2A 5C3XA 4EVOA 1L0XB 2HCCA 1GUOA 2PQEA 1JR0D 1IYVA 2IX1A 5I6WA 1WTXA 1GHKA 1BDOA 3G7LA 1BXTA 3PV0A 1ET9A 1OO9B 4HCEA 5KNCA 3QJYA 1EIGA 3QIAA 3L7ZC 1D5XC 1BNZA 1Y8OB 3VYTA 3GTKB 2X6GA 2KQ3A 1DJRD 3A8KE 3E0JA 3SHLA 1OXXK 2A74C 1KTKA 2RDHA 2F0EA 1BCPF 2R3ZA 2A69D 1V1PB 2CVRA 5IGCA 4IFDJ 3F2UA 1YNND 1TY0A 2E74C 1EQTA 1OXTA 2VXWA 2AWNA 3E5SA 2WIIB 5JPNC 4KMUC 3FVQA 1SYDA 4IUVA 5E4WC 5J39A 2PO4A 1OXSC 4HSVA 4OO1G 1ENAA 5C4JB 1KDAA 2O5JC 3FPUB 1UAPA 5KGUA 1U4RA 1TVXA 1WD0A 4BWGB 5JVG3 2JA7B 5ELCA 3BDLA 3OHXC 1SE4A 4XYQA 1I6VC 1PZID 1STAA 1S5DD 1EQVA 3U9OA 2O4XA 4IFDG 4ULLA 1ILQA 3W2DA 2YU9B 3TSSA 3MXUA 1FNUA 1CM9A 1BBXC 1KLGD 4K5VA 3CU7A 2NVQB 2B2WA 3A8IE 1VF7A 4KJNA 4NW2A 3HZXA 1Y8NB 3N6RA 3DM1A 4G7OC 5C4HA 2EY6A 1GUGA 2B2VC 3MFGA 1EY7A 3IFDA 4IUNA 5IOCA 3M4OB 4H0LC 1NCVA 1QE6A 4ZKCB 4OIKA 1PMRA 1SMYC 4BA1I 3H6MA 3BYTB 5I4DA 3J81E 2MPMA 3A55A 3OWEB 3RZOB 4I65A 5FO8B 2HDMA 2RBMA 4TSSA 1CA5A 3S14B 1D2BA 1SSOA 1G2SA 1ICWA 1HHVA 4TRDA 1PRTB 3I4LA 1ZYRC 4ZKBB 2PW7A 2NZ1D 1A2UA 1F2YA 1HPCA 5LL6S 5C3EB 1GXDC 2C9OA 1XXGA 3V2TA 3TDQA 1QJOA 4RGTA 4RAUC 2EYMA 1XX8A 4R8NA 4IUUA 4RGOS 4DK1A 1IW7C 1MI2A 3GO5A 1TS5A 1MSGA 4U68A 3P20A 4OHJA 2Z8LA 1FNWA 2LFNA 3MXNA 3MXGA 2BDOA 1PFBA 2H4OA 3S15B 2IT1A 3S1MB 1PZJD 3MHBA 2PYKA 1QB5D 4ZUJA 1IYUA 1YNJD 4MIUA 4DU9A 1DONA 1VDZA 4C3JB 3RZDB 4ME5A 1BQQT 1JICA 1MSHA 3JAME 2BA1A 4A3KB 2QILA 1AP0A 1D1IA 3LWEA 3MC0B 5C44B 1EYAA 4RHRA 2NN6I 5CMDA 1HFGA 3G6JB 2PZUA 1G291 4QF4A 2O5IC 1SDFA 3OPOA 2PZTA 4A3DB 2AQ2B 2ICEC 3URYA 1O7ZA 4EQNA 3O13A 2JXMB 3OSOA 3J80L 4Y7NB 5KEEA 4OO1I 1TWGB 3MXPA 5IGFA 1EY8A 4U673 2EDGA 3HOXB 2WINB 2L12A 3SK4A 4PV1C 3QO2A 3BVZA 1EWHA 3DXJC 4XTCS 3V05A 2MUYA 5CBAE 4J8QA 1V1PA 5JVH3 3RD4A 1ESFA 3OIPA 3GP7A 1GUWA 5HGTA 1AZQA 1RCVD 2EE1A 3HS0C 1J8IA 2EJFC 3EQLC 2NTTA 2PNRC 5K36H 3QOLA 3T56B 3DEPA 5CORA 3HOWB 4KD4A 1JB3A 4KN7C 2RKSA 5C5MA 2CW0D 5M5YB 4ZAIA 1BCPD 4DAVA 3ITPA 3NTIA 3BDCA 4QIWB 2F0LA 3J7YW 3S1RB 2X69A 1TQOA 2BDNA 3T16A 5C4ZA 4KKTA 3R8BA 3HG9A 3NK9A 2MHVA 1LTRD 5F2DA 1LTGD 2JA8B 5ELBA 2AUKA 4XIGS 1EZ8A 1CTMA 2J7ZA 3BYYB 2F0PA 1CHQD 5EPJA 2KCNA 1PRTF 4Z9CB 1Y8PB 1WCMB 2KEEA 2EYLA 3GTOB 3PO2B 3VR4A 4FNFA 3ONAB 2K1BA 1LT4D 3TP7A 4C1NI 2F4IA 1VMCA 5CV5A 4XQJA 3FEWX 1KDCA 2F03A 3HOZB 2B2VA 5DEHA 4FYDA 3TP8A 4K8JA 1SXTA 5EKLA 1I50B 1Q12A 1KAAA 5FLXE 5CYUA 2A6HD 3GTPB 1GJXA 2VB2X 3OMCA 4WRDA 2D9UA 1KABA 4F8MA 3PUXA 1SE3A 1F9PA 4HCSA 4RWSC 2R92B 4L63B 3D31A 4IUPA 4K2KA 1SYBA 1TR5A 2F0DA 2J4XA 1X3QA 1JC7A 1SYEA 3WOEA 2ZXOA 2N88A 4PMBA 2K5QA 5CV4A 4ZRZA 2M00A 3VA7A 2BOSA 4HMJA 1NR4A 1W6JA 5DNFA 4LAAA 2IX0A 1STHA 1RDPD 1JWMD 4EQOA 1CQVA 3BG3A 3VR5A 4C3IG 5IODA 2F0FA 3CQZB 4XDXA 4C56C 3OMGA 3FMCA 2JEBI 2F0MA 1RHPA 4PMCA 1WTQA 1JWUD 1ZEQX 2XIWA 4UAIA 1CA6A 4M1UB 3J7AF 1A6XA 1DM0B 3SVMA 2F3VA 2ZT9C 5JAVA 1WTOA 2G9DA 1C4QA 3A7AB 2L5TA 2KCCA 5I2XA 1G8ZD 3NSWA 5EKKA 5C0XH 2VUMB 1KNAA 2QCPX 1STYA 1H9KA 1O7LA 3D6WA 3S17B 4IURA 4RKBA 1WTWA 1TS4A 3NPPA 2SOBA 3I72A 3K5OA 5K36G 1R9TB 5M3MB 4HMIA 1K8MA 1T5EA 1QNUA 4PNYA 4JK1C 2AQ3B 1PFNA 4XQQA 4QMGA 4XT1B 2JA5B 2EY5A 4K5XA 4CGYB 4F87A 1RTOA 1EY5A 4K6LA 1TIID 4KD3A 5CR3A 2KA7A 1ENCA 3NUCA 3T53B 3HGBA 5IT9L 2RVLA 1LTAD 1HCZA 4J1MA 4DXFA 3QB3A 3SK6A 5C3WA 1VMPA 2NBFA 1D5MC 1SNDA 3K7AB 5E4XA 3TZUA 1CFMA 1QWYA 1TWFB 1VF5C 1PYWD 3VYSA 1C48A 2WP8J 4RCNA 5JEAH 4XT3B 2O2LD 3NTKA 1CHPD 3NTHA 3Q23A 1RODA 1MBYA 2ICIA 2PMZB 1I4RA 1DOMA 5KRUA 4HEDA 2QDBA 2A6EC 2L1BA 1EOTA 2EYJA 4B9WA 1E2ZA 3I70A 3X3NA 1IL8A 3C46A 1DD2A 4OL7A 1PFMA 4X3UA 5ELDA 3MTSA 4CJ2C 2EYPA 2MP1A 4HTHA 1T5XD 1F9QA 3Q0AA 2TSSA 1FGBD 2JYOA 1M4VA 5C0XJ 4B08A 3SXHA 4B9XA 1S4ZA 2D5DA 1KLUD 2FHTA 2KECA 1DOKA 2B2YC 4IALA 4FXDA 4BBSB 2E76C 3GTQB 1A2TA 1HUNA 1AFPA 1NSNS 4P2CB 4PQXA 2NB0A 2HDLA 2HQEA 2X6LA 2XRSD 1JCKB 2JEAI 1HXYD 4J6HA 3DWAA 4ZLTF 3AU7A 3J7AV 1SMYD 3QG1A 4TQUS 1XTCD 1GOZA 4K2LA 3EROA 4DK0A 2G9HD 5I2YA 3HOYB 3K5LA 1B3AA 1PRTC 2RDFA 5KYLA 3I73A 3LNNA 3K59A 1ZYRD 2XWJB 2PPBC 1EY6A 5JEAJ 3M3YB 1SEBD 4YIJA 2K5WA 2ZXPA 1ESRA 4IUQA 1PLFA 2LKVA 1JORA 3NWSA 5ELEA 3R93A 4ILWA 2VNUD 1OXVA 3KBXA 1STNA 2NVYB 5D14A 4QUCA 1PTOH 3SE0A 2B63B 3ND9A 3NQIA 3S2HB 1ML0D 1IW7D 2F0WA 2NYZD 1TWAB 2Q8RE 1K8OA 2IPKD 2EYHA 2EJGC 1BF4A 1JE4A 3CKIB 4BBRB 5HURA 4A93B 1O78A 1TY2A 4WJWA 2K6AA 3KLSX 3PO3B 5EKIA 1H9SA 1IKLA 4FF4A 2E2IB 3CRKC 4I7ZC 2QKIC 2K03A 2PZWA 5I6YA 1BO0A 1CQFA 3M4YA 4KK7A 1D6EC 3BS1A 4KHVA 4KI0A 5A2QL 1I4QA 3GQBA 1LTTD 1VCIA 1F9SA 2PCFB 1SJHD 2XN9C 1H9MA 1Y1WB 1STEA 2L9HA 3EFXD 2F1MA 2B2TC 1B2TA 1EEFD 3FRPB 4OGQC 4DAYA 1LT5D 3H3VC 1GUTA 1I4XA 1I4HA 2JSOA 4FVMA 4MHEA 2DNCA 1HA5A 2F0SA 2QF7A 4FF1A 4A3FB 2E75C 1HFNA 2XWBB 2NUCA 3VA5A 4RGNA 5A35A 1Y69U 3HRZC 3LWUA 1BR9A 5E1FA 4ZQ3A 3KUPA 1TS3A 3Q22A 3J80E 2Q8IB 1PTOC 2DN8A 2EYOA 1G91A 1ENFA 5JOBA 4NKLA 1PTOB 3SK8A 2KJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IN3 A;  4WJW A; 
#chains in the Genus database with same CATH topology
 4IFD I;  1SNM A;  4DA2 A;  4NP5 A;  1IXR A;  1W3S A;  1EL0 A;  3D4W A;  2I07 B;  1EZ6 A;  4JI6 Q;  4MNO A;  4F88 A;  4C3H B;  1E1O A;  1X55 A;  1TWH B;  4RFB A;  1WFQ A;  4IPH A;  4DR3 L;  3NP8 A;  2F0T A;  2Q8T A;  3EA6 A;  3WOF A;  1KIX A;  1V1O A;  1B4O A;  3PUZ A;  1FNV A;  4CKE A;  1HNW L;  4IN3 A;  3AFQ A;  4EGV A;  2V4D A;  5C44 G;  5T1I A;  1ZXT A;  1PA6 A;  2B8F A;  5FLM G;  4ME3 A;  1I3Q B;  4HN7 A;  4N8X 1;  3KOJ A;  2MNA A;  1STB A;  1MD2 D;  5IYB H;  3DUZ A;  2FXQ A;  1EOV A;  5FO7 B;  5IGG A;  1L0Y B;  4A3D G;  4B3S L;  4L6T B;  4LFA Q;  5CV7 A;  3GV3 A;  3K5M A;  1J5E Q;  4DXG A;  1PZK D;  4GOP A;  4HSP A;  2EY1 A;  3DM3 A;  2RSO A;  1E2W A;  4JI3 L;  4LNQ A;  2HQL A;  4LF4 Q;  4OX9 L;  1WD1 A;  3P75 A;  1XTD A;  3HOX G;  3P1H A;  4X3T A;  5JJZ A;  1BCP B;  5I9O A;  2DY7 A;  3NWT A;  1HA6 A;  3LX0 A;  1VQF A;  2J0T D;  1STG A;  3OWF A;  1I4G A;  3CXC A;  1CSQ A;  5C5L A;  2UUB L;  4A3I B;  1Q1E A;  2L4N A;  3GD7 A;  5EQ0 A;  2UXC Q;  2EXD A;  2B2Y A;  4CHT B;  4H13 C;  2ZJP A;  2I46 A;  3A7L A;  2OTL A;  1WTV A;  1U5K A;  1KD1 C;  4HIM A;  1FVI A;  4G7H C;  1M90 C;  1VQ5 A;  4M8A A;  3CF5 A;  3HEJ A;  2QA4 A;  2Z0S A;  2IJ0 A;  5DAU A;  2ENB A;  2VUM H;  1N36 Q;  4G57 A;  3VR3 A;  4POG A;  4BY7 G;  3IL8 A;  1GHJ A;  4HJ8 A;  5C4X B;  2NN6 H;  3NQT A;  5IYD G;  4A3L G;  2K33 A;  4IUT A;  1KC8 C;  4DV1 Q;  1N9W A;  1Q7Y C;  2N49 A;  4LF7 L;  4CKC A;  3RLN A;  4OXP A;  1W2B A;  1R9T H;  1ICF B;  1Q8I A;  5M3M H;  2ATW A;  4A3B B;  3HOW G;  1I4P A;  1X9N A;  5CGK A;  2VQE L;  1K8A C;  4L5R C;  3C1F A;  3OW7 A;  3GTL H;  1UWV A;  3H15 A;  2R7D A;  3OIQ A;  1B50 A;  3L3O C;  1EIH A;  2Q2H A;  2LS0 1;  3KLR A;  4CDC C;  4FF3 A;  2JP1 A;  1M1K C;  4OO1 H;  5CV6 A;  2DUD A;  1X3P A;  4WJ3 M;  1YHA A;  3E9I A;  1A15 A;  1L1O A;  2IWH A;  2FMC A;  2A68 D;  3D6C A;  5IP9 G;  4KN4 C;  2KCM A;  3DMU A;  4N9T A;  1B1Z A;  4K6D A;  2F52 A;  2FJ2 A;  3QWN A;  2HUG A;  5BN4 A;  5IGE A;  1JWS D;  3C2P A;  2JA8 G;  3NXW A;  4DR5 L;  4H7B A;  3ZYY X;  3ULL A;  4DUY Q;  1EYD A;  4XYO A;  5AJ3 L;  2ZJR A;  5BN3 A;  2RHQ B;  4EX5 A;  1PDQ A;  2SDF A;  2VY3 A;  4A3G B;  2EVB A;  1WCM G;  3FKI G;  4DAM A;  5CBE E;  3PO2 G;  1Q90 A;  5DM6 3;  4LF7 Q;  1LV9 A;  2F4V L;  3R2T A;  2FFK B;  1TXY A;  3BVM A;  4HJA A;  3H91 A;  2HD3 A;  4HID A;  4WOR A;  5EGT A;  2C5C A;  3WDN A;  3GTJ H;  2D2C C;  4XQN A;  1WTH A;  1EY0 A;  3HKS A;  3HOZ G;  3JAM c;  2H5X A;  2B8G A;  4JI1 Q;  2A1A A;  3R3O A;  1R4Q B;  2VB3 X;  1NR2 A;  2BA0 A;  1JOO A;  4FO2 A;  1AW7 A;  2WV6 D;  4KJO A;  1PXU A;  1JOQ A;  1XNR L;  4JYA L;  1OTC A;  1PH7 A;  4EQP A;  1N8R C;  4YHH L;  5CC4 A;  4DV2 Q;  3X3M A;  3CC2 A;  2JQO A;  4FP5 D;  5LL6 X;  5CV9 A;  3I2Z A;  4QIW E;  1EQQ A;  1HNX L;  4P75 A;  2EY2 A;  4QL5 A;  1SFO B;  3KFU A;  2R92 G;  2EZV A;  1V43 A;  2VZA A;  1B3Q A;  2XRQ D;  1PTO F;  3M7G A;  4ZUI A;  3TRE A;  3L0O A;  2BH8 A;  2BE5 C;  4RG1 A;  1IKM A;  3HKZ B;  2K28 A;  1C8C A;  1QVC A;  4LFB L;  4R8I A;  1N32 L;  4O1N A;  2SNM A;  2EXZ A;  3KBG A;  1EIF A;  3U50 C;  2ID0 A;  4DF7 A;  1Y1V G;  2E2D C;  4JW0 A;  1MJE A;  4MTK A;  1SR3 A;  3NEN A;  3I8Z A;  4Q5V A;  1I6H B;  2M9V A;  2K7V A;  3GTL B;  1K83 B;  1D5Z C;  5IIF A;  3RLF A;  4BXX G;  2XSC A;  1WTR A;  2K5D A;  3J80 i;  4BBS H;  1V9P A;  5CV8 A;  3PQI A;  1UUP A;  4PZ8 A;  3RMH A;  4DR1 Q;  3KJP A;  4DV0 L;  1PYB A;  3MA2 B;  3HOV B;  2OQK A;  1KNE A;  3EIV A;  5EBD A;  5M5X H;  1X3G A;  1E2V A;  2WB1 G;  3SK5 A;  2A8V A;  2K01 A;  4DNR B;  3BZD B;  1IBM Q;  5HGQ A;  2AUJ D;  3VYU A;  1SNP A;  3I91 A;  3CCJ A;  2GA4 B;  3TEH B;  2F0J A;  1HQR D;  1B9M A;  1MGS A;  2HIX A;  4YHH Q;  1AN8 A;  1HTP A;  2B39 A;  3KF8 A;  2B2U C;  4QCL A;  1K3B C;  1G51 A;  1KDB A;  4KHZ A;  2XGT A;  1U4M A;  4AIM A;  4A3E G;  2GVB A;  1RJT A;  5JJL A;  5IT9 E;  1DZ1 A;  1HR0 Q;  4K5W A;  3BJU A;  4YY3 L;  3JC6 6;  2UU9 L;  1XPU A;  3HOY H;  1TT2 A;  1QNK A;  1EY9 A;  1Z6H A;  1PH1 A;  5EPL A;  2A69 C;  4DK6 C;  1LTI D;  4FF2 A;  1MJC A;  1XYI A;  4RGM A;  3TME A;  3BZC A;  1D7Q A;  3E6Z X;  3CC4 A;  3GTJ B;  3CRL C;  3S1N H;  4JI4 L;  2F0N A;  4DGZ A;  1VQ4 A;  1QUQ A;  2UUC Q;  2A6E D;  3QOJ A;  1YNN C;  1V1Q A;  2NN6 G;  2UUA Q;  2K5V A;  5J22 A;  3M3Y H;  3VYR A;  1PH5 A;  1SYG A;  4NXN Q;  1SNQ A;  2L0C A;  4LF5 L;  2WKD A;  3H0G B;  4UY8 C;  4RCO A;  3NBH A;  4B3M Q;  5IP7 G;  4S3S A;  2MFI A;  4L8J A;  2Z6B A;  2L11 A;  2K32 A;  2RSN A;  2CCZ A;  1TWC B;  1FR3 A;  1NUC A;  1C0A A;  2JA5 G;  3PUY A;  1YHQ A;  3PUV A;  2NVY H;  1LO5 D;  2M2L A;  4BY1 B;  5IGD A;  3SEB A;  2MGS A;  5M3F H;  2AKW B;  3UI2 A;  1WVL A;  1X3E A;  1D8L A;  3BU2 A;  1P8L A;  2R7Z H;  4UDU C;  4JCV E;  3S2H H;  2DJG C;  1AEX A;  4P74 A;  2KED A;  2A5H A;  1S3O A;  2GVA A;  5KYI A;  4NXM L;  4AYB B;  4MN3 A;  1YVC A;  2UU9 Q;  3CCV A;  4HAE A;  1X54 A;  4A93 H;  3DLL A;  3HOU H;  1XMO Q;  5D3I B;  1JQY D;  1BBU A;  1AE3 A;  2Z1C A;  3ERQ A;  2RQX A;  1BUV T;  4DV3 L;  1CI3 M;  1UEB A;  3PO3 H;  3R2I A;  2GN5 A;  1FJG L;  3T13 A;  5M5X B;  2E2I H;  1X65 A;  5EPK A;  2VW9 A;  2SEB D;  2F3I A;  1LT3 D;  3U9S A;  1SBB B;  1FYC A;  5EBC A;  3DWP A;  2OT2 A;  2WAQ B;  2DNE A;  1A3U A;  5G3L F;  4LF5 Q;  1H9J A;  3C1E A;  3ULP A;  2YTY A;  1O80 A;  2A19 A;  2OEO A;  1IHZ A;  1F77 A;  3K57 A;  2EYF A;  1ASZ A;  3PF5 A;  2VQF Q;  2KOL A;  4KTA A;  1LTB D;  3J81 L;  4HJ5 A;  1WTP A;  4GKK Q;  4DV5 Q;  1D1K A;  1QOH A;  1BVS A;  1EWC A;  3CAM A;  2EIF A;  1J9O A;  4DV7 L;  1EFI D;  1NNX A;  5I9P A;  1TKW B;  4J15 A;  2Y0S B;  3T4A C;  5IYC H;  5HY6 A;  1LLR D;  1F2L A;  4PZ6 A;  4B3R L;  2ES2 A;  1QCB D;  1XJV A;  3AEV A;  1XPR A;  1PRT D;  3MEH A;  1S5C D;  4TKO B;  5AFW A;  5C0X G;  1TU2 B;  3FP9 A;  3HP3 A;  1ET6 A;  3S1N B;  2NVX H;  1R4P B;  2JA7 G;  5H1S E;  1HUM A;  1CZW A;  4QJF A;  3S16 B;  3TZD A;  4A3J H;  4ABN A;  4CJ1 B;  3I4O A;  5FKA C;  3D0F A;  2QEJ C;  4E6I A;  1H9R A;  5D3D A;  3DWQ A;  1IBK L;  2Q2U A;  1HRJ A;  1ZKO A;  5GAE C;  1QIL A;  2KVM A;  3A5U A;  4DR7 Q;  5M9O A;  2DY8 A;  2MJ8 A;  3K5N A;  4QB4 A;  1ILP A;  1V8Q A;  4X64 Q;  4IZ8 A;  2E2J B;  1DOL A;  4KHP Q;  2VS1 A;  3MVV A;  1X32 A;  1TS2 A;  3DEO A;  4HIO A;  2E5L L;  5ELN A;  5M3F B;  4DNT B;  3D4D A;  1B53 A;  5ELF A;  5E7N A;  5KIX A;  1NMG A;  4LWC A;  4NDX A;  1HZA A;  1JOK A;  4JI8 L;  2UXD Q;  2FMM A;  2R7Z B;  3I3C A;  3IFT A;  1MIU A;  4OIJ A;  3SDZ A;  1EU4 A;  5IY0 A;  1CK1 A;  1SJE D;  1XWE A;  1KL9 A;  2PMZ E;  2RDG A;  4HJ7 A;  3IKJ A;  4IPG A;  4DN4 M;  4RHS A;  4BS9 A;  3T1H L;  2B3G A;  5DM7 3;  1B9N A;  1IBL L;  3L2P A;  1DXM A;  4O42 A;  3HOU B;  4CJ0 B;  2IW3 A;  4X65 L;  2KHS A;  5KND A;  4GKJ L;  4R4O A;  2RHS B;  3EVQ A;  5FK9 C;  3RUZ A;  3U4Z A;  3PUW A;  2MO1 A;  2CHB D;  2OCE A;  2MO0 A;  3Q6S A;  1I3Q H;  3SR1 A;  3F1Z A;  5JEA G;  2R6G A;  3KDF A;  2NWG A;  4V0B A;  1CKN A;  3JAM L;  4ALP A;  4O2D A;  4IQZ A;  3TBI B;  3BVG A;  1QG7 A;  4R4I A;  2JE6 I;  4DR6 Q;  4CKB A;  3H09 A;  1Y14 B;  4JI6 L;  1FD7 D;  3M7N A;  4BA2 I;  1YNJ C;  2Q2T A;  4IO9 A;  1GD7 A;  1RKN A;  3C3L A;  5C6A A;  4A75 A;  1EEI D;  1ONL A;  3N52 A;  4R1J A;  4GN3 B;  3IAY A;  2F0V A;  4YCW A;  4R4Q A;  1YNX A;  3L9A X;  5A2Q E;  1U4L A;  2F0U A;  3A74 A;  3GV6 A;  3I90 A;  5C3E G;  2NVX B;  4A3I H;  3STB C;  1SYC A;  1SAP A;  3VR2 A;  2F0Q A;  3M85 A;  2WAC A;  3NE5 B;  1LTS D;  1RTN A;  1II3 A;  2C35 B;  4A3J B;  2K04 A;  1EWI A;  2Z4H A;  3W3A A;  1E0B A;  2IHE A;  3KLS A;  4R4T A;  2B63 G;  1GUN A;  1LAC A;  4LFA L;  3H94 A;  1J5E L;  2B29 A;  4R9W A;  2N55 A;  3G71 A;  4CDE C;  2XNA C;  3FDT A;  4C3I H;  5C4X H;  4A3M H;  1B44 D;  2OXP A;  1PTO D;  4CBV A;  4DR2 Q;  2F0K A;  3RNU A;  1C9O A;  4JBW A;  3RR5 A;  4KV6 A;  4LF4 L;  4BBR G;  5GAG C;  3PIO 3;  1BOS A;  1U4P A;  4WJ4 A;  2B2U A;  4C2M B;  1CZG A;  4V19 0;  2N8N A;  2QEX A;  3B6Y A;  3AFP A;  4XXE A;  3PO3 G;  1CT1 D;  1EYC A;  1QZG A;  5T1G A;  1Q1B A;  5ELO A;  1K0S A;  4Q0F A;  5FOB B;  1YIT A;  2HHH L;  2UXC L;  2JN4 A;  5GRO A;  4C3J G;  2EOT A;  1A3T A;  4PG3 A;  4F7X A;  2F3W A;  1U9R A;  3TP5 A;  4A3K G;  2LMC B;  3A54 A;  5LMU Q;  4ZK9 B;  2WKC A;  1N36 L;  2KUM A;  2HCI A;  2EQS A;  4BY7 B;  5JPM C;  1Y1W G;  3CPW A;  1SLJ A;  4FXK C;  2YTX A;  2NVT B;  1G6Z A;  4DV1 L;  1N34 L;  1YZ6 A;  4WFN 3;  4EQ5 A;  2EPB A;  2IX3 A;  5IYC G;  2K14 A;  4DFA A;  3CPF A;  3MFY A;  5IWA Q;  1DYQ A;  2ZTC A;  5GQO A;  3BDO A;  3CHB D;  5NUC A;  1K9M C;  2DGY A;  4X6A H;  1VQJ A;  4X3K A;  2CW0 C;  4A3G H;  4ZYS A;  4G4K A;  4G7Z C;  5M5W B;  1BCP C;  4A3F G;  1GUS A;  1LAB A;  1MHW C;  2F0H A;  3ERS X;  1M8A A;  2AQ1 B;  5E3F A;  2JA6 H;  2EJM A;  4AH6 A;  5C0X I;  4H44 C;  2IY5 B;  2ZTD A;  2H1E A;  1UEA B;  2HHH Q;  3K58 A;  4X3S A;  1YHB A;  2D62 A;  4LMQ D;  3J81 c;  5LMN Q;  2E2H H;  3Q24 A;  1SRU A;  2R93 H;  2CQA A;  4RA8 A;  3S2D B;  4DUY L;  1A8V A;  2WFW A;  3V96 A;  1A3V A;  4K8I A;  1N33 Q;  2K75 A;  2PW5 A;  2B2W C;  3S9W A;  3A8J E;  2F0I A;  4MZ9 A;  4C3H G;  3D4R A;  4P73 A;  3FKI B;  3TP6 A;  4C3I B;  1SFO H;  4C1N K;  4A3M B;  2Z6K C;  5IGB A;  1N34 Q;  5KNB A;  1HJP A;  5FLX L;  4NPS A;  1UE5 A;  2LY7 A;  1K3R A;  1O7Y A;  4PMW A;  1S72 A;  3PMF A;  3K80 C;  1EU3 A;  3NBI A;  3S1Q B;  3NHH A;  3OOC A;  1JJ2 A;  2QW7 A;  4KY5 A;  5K5P A;  2F0G A;  4HR7 B;  1L2F A;  1VQH A;  4LJZ C;  1LT6 D;  3KK7 A;  3ND8 A;  1I6H H;  4JI1 L;  3T1Y Q;  3I4N B;  1K83 H;  2A73 B;  1HQM C;  3I55 A;  3MAQ A;  3F2B A;  1NAP A;  1VQ6 A;  1F9R A;  2A6H C;  1PFS A;  5ISR A;  2ZXR A;  3TS0 A;  1T9H A;  4RH6 A;  2XVS A;  1Q8K A;  3HOV H;  3A0J A;  4DV2 L;  3CP0 A;  3KJO A;  4PZ7 A;  4KKS A;  1F2Z A;  5BN5 A;  3D8G A;  1SYF A;  1PH3 A;  1X56 A;  5G3L D;  3GTG B;  3DHQ A;  4NMZ A;  4LK1 C;  2NTS A;  4QY7 A;  2F0O A;  1UNS A;  4FXG C;  3FPP A;  1YJ9 A;  3PIP 3;  4IFD H;  4N9P A;  1Y1V B;  3A56 A;  2A68 C;  3MZ5 A;  4A3I G;  4JBJ A;  4LW1 A;  2AWO A;  1IL2 A;  1G2T A;  2IL8 A;  3K0Y A;  1F2M A;  4ODG A;  4LF8 Q;  1OXU A;  5COY A;  1S5B D;  5D65 A;  3OTO Q;  4DAP A;  2JA6 B;  3P7J A;  1EY4 A;  4DR1 L;  2TMP A;  4KKU A;  4KY6 A;  3GTM B;  1QVF A;  2CWP A;  3UE1 A;  3F2C A;  2SNS A;  3CW2 C;  2I5L X;  1RF2 D;  3I4M B;  2WB1 B;  4ID6 A;  2OF1 A;  2E2H B;  2R93 B;  5FJ8 G;  4KY7 A;  1IBM L;  4RKL A;  3H0G H;  1S5F D;  2L55 A;  2BCO A;  4QUF A;  5LHY 1;  4A3B G;  1Q3L A;  1RD9 D;  3NEL A;  5EJW A;  1S5E D;  1PH9 A;  3T51 B;  1Z7T A;  4JI5 Q;  1TWC H;  3KF6 B;  4A3E B;  3MXN B;  4K14 A;  3D3R A;  3AB9 A;  3K6O A;  4GZY C;  5J1Z A;  1HR0 L;  4BY1 H;  1DCZ A;  2Z4I A;  5C4J H;  5TSS A;  2FIN B;  2BE5 D;  1H9S B;  2RA4 A;  1VQD A;  2UXB Q;  3RN5 A;  2ZM6 Q;  3EJI A;  5JJI A;  1KHI A;  1SE2 A;  3MWY W;  3CCQ A;  1Z47 A;  1SNO A;  5FO9 B;  2YYZ A;  1HTL D;  1SNC A;  1AZP A;  2R61 A;  1PVO A;  3IRB A;  1U0L A;  3G4S A;  3VR6 A;  2UUC L;  1W6K A;  2B2T A;  3AMU A;  3CD6 A;  2K05 A;  3TN2 A;  2UUA L;  5C3X A;  4EVO A;  1L0X B;  2HCC A;  5IYB G;  1GUO A;  3TS2 A;  2PQE A;  1JR0 D;  1CUK A;  4NXN L;  1IYV A;  2IX1 A;  5I6W A;  4A4I A;  1WTX A;  1GHK A;  1BDO A;  4B3M L;  3G7L A;  1BXT A;  2RCN A;  3KLW A;  3TQY A;  3PV0 A;  1GO3 E;  1ET9 A;  1OO9 B;  2PQA A;  4HCE A;  3LGJ A;  5KNC A;  1K8G A;  3QJY A;  1EIG A;  4NB3 A;  3QIA A;  3L7Z C;  1D5X C;  4YCV A;  1BNZ A;  1YEZ A;  1SN8 A;  1Y8O B;  2VL6 A;  3VYT A;  3H3V I;  3GTK B;  2X6G A;  4B3T Q;  2KQ3 A;  4A3C H;  1XMQ Q;  1DJR D;  3A8K E;  1K28 A;  3E0J A;  3PGZ A;  3SHL A;  3OYY A;  1OXX K;  2A74 C;  1KTK A;  1B8A A;  4JPB W;  1E24 A;  2RDH A;  2F0E A;  1BCP F;  4H02 A;  1LM0 A;  2R3Z A;  1XMO L;  2A69 D;  1V1P B;  4JI7 Q;  1L0W A;  2VUM G;  2CVR A;  5IGC A;  2HT1 A;  1A63 A;  1Q82 C;  3F8T A;  4IFD J;  3F2U A;  1VS0 A;  1YNN D;  1C7Y A;  1BKB A;  1TY0 A;  3RZO H;  4OWT B;  3S16 H;  2E74 C;  1EQT A;  4MTN A;  1NBW A;  1OXT A;  3J81 j;  3CMA A;  2VXW A;  3HKZ G;  2AWN A;  3E5S A;  2WII B;  5JPN C;  5M3M G;  4GLA C;  3S14 H;  4KMU C;  3FVQ A;  2VQF L;  4LF6 Q;  1SYD A;  4X62 Q;  2KHI A;  1NY4 A;  4IUV A;  4GKK L;  5E4W C;  5J39 A;  4DV5 L;  2E2J H;  2PO4 A;  1OXS C;  4HSV A;  4UP7 A;  4OO1 G;  1ENA A;  2D0P A;  5C4J B;  4CDF C;  1KDA A;  2O5J C;  3FPU B;  3W1B A;  3M9B A;  1UAP A;  5KGU A;  1U4R A;  1TVX A;  4GNX C;  1WD0 A;  4BWG B;  1LTL A;  5JVG 3;  1QVG A;  1KQS A;  3CCE A;  2JA7 B;  1E3P A;  5ELC A;  3BDL A;  3OHX C;  1SE4 A;  4GNX B;  1PH6 A;  4XYQ A;  5BR8 Q;  1I6V C;  4YWL A;  4GOP B;  1PZI D;  1STA A;  1S5D D;  1EQV A;  2AMC B;  5FLX c;  4A76 A;  3U9O A;  2L15 A;  4DR7 L;  2O4X A;  5IE8 A;  1P16 A;  4ULL A;  1ILQ A;  3W2D A;  1K73 C;  4IFD G;  2YU9 B;  3TSS A;  2QGQ A;  3MXU A;  4X64 L;  1FNU A;  1CM9 A;  4KLK A;  4KHP L;  1BBX C;  2ALY B;  1KLG D;  4K5V A;  3CU7 A;  2NVQ B;  3S15 H;  5J3B A;  3G6E A;  2B2W A;  3A8I E;  3EN2 A;  3S1M H;  2UXD L;  1VF7 A;  4KJN A;  4NW2 A;  3J7A 5;  3HZX A;  1Y8N B;  3N6R A;  3DM1 A;  1HZC A;  2Z6K A;  4G7O C;  3HKZ E;  5C4H A;  4LFC Q;  2EY6 A;  1GUG A;  2B2V C;  4AQY Q;  1Q86 C;  3MFG A;  1EY7 A;  3A5Z B;  4JI0 Q;  3IFD A;  4IUN A;  5IOC A;  3M4O B;  4H0L C;  1NCV A;  1WI5 A;  1QE6 A;  4ZKC B;  4OIK A;  1WJJ A;  2ASB A;  1PMR A;  1KAW A;  1SMY C;  4BA1 I;  3H6M A;  2ZJQ A;  3BYT B;  5I4D A;  3J81 E;  2MPM A;  4GLX A;  5FLM H;  3A55 A;  3OWE B;  3RZO B;  4I65 A;  5FO8 B;  1SMX A;  1LYL A;  2HDM A;  2RBM A;  4A3D H;  4TSS A;  1S40 A;  1CA5 A;  3S14 B;  4JOI C;  1D2B A;  1SSO A;  1G2S A;  1ICW A;  4DR6 L;  4LF9 Q;  1HHV A;  4TRD A;  1PRT B;  3I4L A;  3M4P A;  1TWG H;  1ZYR C;  3FHW A;  4ZKB B;  2PW7 A;  2NZ1 D;  4X66 Q;  1A2U A;  4DPG A;  1UE6 A;  4C2M H;  4BBS G;  1F2Y A;  1HPC A;  2YTV A;  2I5M X;  5LL6 S;  4DV6 L;  5C3E B;  1GXD C;  2C9O A;  1XXG A;  3V2T A;  3TDQ A;  5L37 A;  1QJO A;  3E3X A;  4RGT A;  2IHF A;  1H95 A;  3E9H A;  4RAU C;  2WAQ G;  1HR0 W;  1VQA A;  1I94 Q;  3ICE A;  2EYM A;  1XX8 A;  4R8N A;  1NMF A;  4IUU A;  2OWO A;  1KRT A;  4RGO S;  4DK1 A;  1IW7 C;  1MI2 A;  3GO5 A;  3J7Z C;  4BY7 H;  1TS5 A;  1MSG A;  4A3L H;  4U68 A;  2NVT H;  4DR2 L;  3P20 A;  3UE0 A;  4OHJ A;  1Q46 A;  2Z8L A;  3HOY G;  1FNW A;  2LFN A;  3MXN A;  3MXG A;  2BDO A;  1PFB A;  2H4O A;  1A62 A;  3S15 B;  3HOW H;  1PH8 A;  4DV4 L;  1DGS A;  2IT1 A;  2Q2I A;  3S1M B;  1PZJ D;  3MHB A;  3UDF A;  4L5T A;  2PYK A;  4O0A A;  1QB5 D;  3U4V A;  4ZUJ A;  1IYU A;  1YNJ D;  4MIU A;  4DU9 A;  1DON A;  1VQP A;  1VDZ A;  4C3J B;  5M5W H;  4DUZ L;  3RZD B;  4ME5 A;  4OWX B;  1BQQ T;  1JIC A;  5EAY A;  1MSH A;  3JAM E;  2BA1 A;  4A3K B;  2QIL A;  3S1R H;  1AP0 A;  1D1I A;  4AYB E;  3LWE A;  3MC0 B;  5LMU L;  2LXK A;  1EYA A;  5C44 B;  4DV6 Q;  4RHR A;  2NN6 I;  5CMD A;  1HFG A;  3G6J B;  2PZU A;  4JBM A;  1G29 1;  3STB D;  4R4C A;  5IP9 H;  4QF4 A;  2K50 A;  2O5I C;  1SDF A;  3OPO A;  2JA8 H;  5JJK A;  5M3F G;  5IT9 c;  3S2D H;  2PZT A;  4A3D B;  2AQ2 B;  2K5N A;  2ICE C;  3URY A;  1O7Z A;  3W1G A;  5GAD C;  5IWA L;  4EQN A;  3O13 A;  2R7Z G;  2JXM B;  3OSO A;  2WAQ E;  3CME A;  3J80 L;  3FKI H;  4Y7N B;  2YV5 A;  5KEE A;  4OO1 I;  1TWG B;  3RLO A;  1RIP A;  3MXP A;  5IGF A;  1EY8 A;  4U67 3;  2EDG A;  4A93 G;  3HOX B;  3HOU G;  1G6P A;  2CFM A;  2WIN B;  4DV4 Q;  2L12 A;  3SK4 A;  3AQQ A;  4PV1 C;  3S1Q H;  2CH4 W;  3QO2 A;  3BVZ A;  1EWH A;  1Z9F A;  3DXJ C;  2Y0S E;  4XTC S;  3HOZ H;  3V05 A;  1E7Z A;  2MUY A;  5CBA E;  3E0E A;  3I4N H;  4J8Q A;  1ASY A;  1V1P A;  3UDI A;  4DUZ Q;  4IPD A;  5JVH 3;  3KF8 B;  5LMN L;  3RD4 A;  3G48 A;  4JI2 L;  1ESF A;  3OIP A;  3GP7 A;  1GUW A;  2JJQ A;  5HGT A;  4LUV A;  1XNQ Q;  1N33 L;  1Q81 C;  3U58 A;  1X3F A;  1AZQ A;  4IJH A;  2P5Z X;  1RCV D;  3HS0 C;  2EE1 A;  2R92 H;  1J8I A;  2EJF C;  3EQL C;  2NTT A;  2RCF A;  3GTG H;  4OEL B;  3OW2 A;  1EFW A;  2PNR C;  5K36 H;  4UPA A;  1QUQ B;  3QOL A;  3T56 B;  3AYH B;  3DEP A;  5COR A;  3HOW B;  2JK8 A;  1VQE A;  4KD4 A;  1JB3 A;  4KN7 C;  1VQI A;  1GKH A;  1SRO A;  1Y1V H;  2D0O A;  2RKS A;  2CW0 D;  5C5M A;  5M5Y B;  4ZAI A;  3NBH B;  1PH4 A;  1HNZ Q;  3T1Y L;  1BCP D;  4A3J G;  3TRZ A;  4DAV A;  4BXX H;  3ITP A;  1VQO A;  3NTI A;  3BDC A;  4QIW B;  2F0L A;  3J7Y W;  4L5S A;  4K0K Q;  4GNX A;  4DR4 Q;  3S1R B;  2K4K A;  2X69 A;  1TQO A;  2BDN A;  4IOA A;  3T16 A;  3GTM H;  5C4Z A;  1UE7 A;  4KKT A;  3R8B A;  3HG9 A;  3NK9 A;  2MHV A;  1J6Q A;  3CQZ H;  4N8F A;  3I4M H;  1LTR D;  5F2D A;  4JI2 Q;  3S24 A;  2N78 A;  1LTG D;  2JA8 B;  1VQN A;  1CSP A;  5ELB A;  2AUK A;  1JE5 A;  4XIG S;  2OQ0 A;  4HJ9 A;  1EZ8 A;  1NTG A;  1CTM A;  5GAH C;  2J7Z A;  3BYY B;  2F0P A;  3SGI A;  1CHQ D;  5EPJ A;  2KCN A;  3PIP A;  1PRT F;  1PYS B;  4Z9C B;  4A3E H;  1Y8P B;  1WCM B;  2KEE A;  4LUO A;  2KCT A;  2EYL A;  3GTO B;  3PO2 B;  3VR4 A;  4FNF A;  4DR3 Q;  4LF8 L;  3ONA B;  3J81 i;  2K1B A;  1LT4 D;  2QDL A;  3TP7 A;  4C1N I;  1YJW A;  3OTO L;  1HNW Q;  3KYH C;  2F4I A;  1VMC A;  5CV5 A;  4XQJ A;  4I7A A;  3FEW X;  1KDC A;  2Z9H A;  2F03 A;  3HOZ B;  2B2V A;  1VQB A;  5DEH A;  1YJN A;  1SE8 A;  4FYD A;  3TP8 A;  3S17 H;  4K8J A;  4JBK A;  1SXT A;  5EKL A;  1I50 B;  1Q12 A;  1KAA A;  5FLX E;  1UE1 A;  4UHV A;  5CYU A;  2A6H D;  2I0Q A;  3GTP B;  4B3S Q;  5IP7 H;  1GJX A;  2VB2 X;  3OMC A;  4WRD A;  2D9U A;  1KAB A;  2HIV A;  4F8M A;  3PUX A;  1SE3 A;  4JI5 L;  1F9P A;  1HZB A;  4HCS A;  4RWS C;  2JA5 H;  2R92 B;  4L63 B;  3D31 A;  1PV4 A;  4JI3 Q;  1FGU A;  4IUP A;  4OX9 Q;  4K2K A;  1SYB A;  1TR5 A;  2F0D A;  4JOI A;  2J4X A;  1X3Q A;  2UXB L;  2NZO A;  3GTK H;  2ZM6 L;  2I5H A;  1IZ6 A;  1JC7 A;  1SYE A;  3WOE A;  2ZXO A;  2UUB Q;  2N88 A;  4PMB A;  2K5Q A;  5CV4 A;  4ZRZ A;  3K7U C;  2M00 A;  3VA7 A;  1VQ9 A;  2BOS A;  3K7A H;  4HMJ A;  1VQL A;  1KXL A;  1NR4 A;  1W6J A;  5DNF A;  4DNI A;  4LAA A;  2IX0 A;  1STH A;  1RDP D;  1JWM D;  1TWF H;  4EQO A;  1CQV A;  3BG3 A;  3VR5 A;  4C3I G;  5IOD A;  1E1T A;  5C4X G;  4A3M G;  2F0F A;  3CQZ B;  4XDX A;  3UDG A;  1YI2 A;  2RF4 A;  4C56 C;  1VQK A;  3I7F A;  3OMG A;  3FMC A;  2JEB I;  2F0M A;  1RHP A;  2VQE Q;  4PMC A;  1WTQ A;  1JWU D;  3K8A A;  1ZEQ X;  2XIW A;  2K52 A;  4UAI A;  4YWM A;  3ULJ A;  1CA6 A;  4B3T L;  4M1U B;  2KEN A;  1CKO A;  3J7A F;  1A6X A;  1DM0 B;  1XMQ L;  3JAM i;  2OTJ A;  3Q8D A;  3I4N G;  3SVM A;  2F3V A;  2ZT9 C;  5JAV A;  1JT8 A;  1WTO A;  4JVZ A;  2G9D A;  1C4Q A;  3A7A B;  2L5T A;  2KCC A;  5I2X A;  3CCM A;  1AH9 A;  1G8Z D;  3NSW A;  5EKK A;  3KDF B;  4JI7 L;  5C0X H;  2VUM B;  1KNA A;  2QCP X;  1STY A;  1CKN B;  1H9K A;  2JA7 H;  4OEM B;  3M4Q A;  1O7L A;  3D6W A;  3S17 B;  4IUR A;  4RKB A;  4DK3 C;  1WTW A;  1TS4 A;  3NPP A;  2SOB A;  3I72 A;  3K5O A;  3J80 c;  4DR5 Q;  5K36 G;  3W5O A;  4P71 A;  5AJ3 Q;  5M3M B;  1R9T B;  4HMI A;  1K8M A;  1T5E A;  1QNU A;  4PNY A;  4LF6 L;  4JK1 C;  2AQ3 B;  4X62 L;  3WWV A;  3RN2 A;  1PFN A;  2YU9 H;  4A3G G;  1QZH A;  4XQQ A;  4DAY B;  4QMG A;  4XT1 B;  2JA5 B;  2EY5 A;  2F4V Q;  4GS3 A;  4K5X A;  4CGY B;  1PH2 A;  2KHJ A;  4TVA B;  4F87 A;  5LMN W;  2NVQ H;  1RTO A;  1EY5 A;  4K6L A;  1EQR A;  2JA6 G;  1TII D;  4KD3 A;  5CR3 A;  2KA7 A;  2NZH A;  1ENC A;  3NUC A;  3T53 B;  3GTQ H;  1VQ8 A;  1YBY A;  3HGB A;  5IT9 L;  2RVL A;  1LTA D;  1JJG A;  4GN4 B;  1HCZ A;  3I4M G;  1JB7 A;  4J1M A;  3GDE A;  4DXF A;  3QB3 A;  5BR8 L;  2R93 G;  3SK6 A;  1CKM A;  5C3W A;  3M4O H;  1VMP A;  1XNR Q;  4JYA Q;  2NBF A;  1D5M C;  1SND A;  3K7A B;  4UP9 A;  5E4X A;  3TZU A;  1CFM A;  1QWY A;  3I56 A;  3CC7 A;  1VQG A;  1TWF B;  1VF5 C;  1PYW D;  3VYS A;  1HNX Q;  1C48 A;  2WP8 J;  4RCN A;  5JEA H;  4XT3 B;  2O2L D;  3NTK A;  3PF4 A;  1CHP D;  3NTH A;  3Q23 A;  1ROD A;  1MBY A;  3NEM A;  4APV A;  2ICI A;  2PI2 E;  2PMZ B;  3K0X A;  4LFB Q;  1N32 Q;  1I4R A;  1EIY B;  1DOM A;  5KRU A;  4FDB A;  1GM5 A;  3QR8 A;  3MEF A;  4HED A;  2QDB A;  2A6E C;  2ZTE A;  2V1C C;  4LFC L;  2L1B A;  1EOT A;  2N3S A;  2EYJ A;  4OWW B;  4B9W A;  4POF A;  4AQY L;  1JJC B;  1E2Z A;  1B7Y B;  4JI0 L;  1A0I A;  3I70 A;  3X3N A;  1IL8 A;  4DV0 Q;  3C46 A;  1DD2 A;  1HH2 P;  2LSS A;  3HOV G;  4OL7 A;  1PFM A;  4X3U A;  1FL0 A;  1HZ9 A;  5C3E H;  5ELD A;  3MTS A;  4CJ2 C;  2EYP A;  2MP1 A;  4GOP C;  4IOC A;  4HTH A;  2BH2 A;  1T5X D;  3EBE A;  1F9Q A;  3Q0A A;  3VDY A;  2TSS A;  2AHO B;  2B63 H;  1FGB D;  2WB1 E;  2JYO A;  4JV5 L;  1M4V A;  1VQ7 A;  4DKA C;  4YWK A;  5C0X J;  1TWA H;  4B08 A;  3SXH A;  4LF9 L;  4QQB X;  4B9X A;  1VQM A;  3CCU A;  1S4Z A;  2D5D A;  4YY3 Q;  1KLU D;  2FHT A;  2KEC A;  1DOK A;  2B2Y C;  4BBR H;  4X66 L;  4IAL A;  1EYG A;  4RMF A;  4FXD A;  1GVP A;  4BBS B;  3CCR A;  2PNH A;  4HIK A;  2E76 C;  3GTQ B;  4JI4 Q;  1A2T A;  1HUN A;  1AFP A;  1NSN S;  2CQO A;  4P2C B;  4PQX A;  2NB0 A;  4C3J H;  3RZD H;  2HDL A;  2HQE A;  2X6L A;  2XRS D;  1JCK B;  1YIJ A;  2JEA I;  1JMC A;  1I94 L;  1HXY D;  4J6H A;  3H0G G;  3DWA A;  2K5H A;  4ZLT F;  4A3K H;  3AU7 A;  3J7A V;  4UP8 A;  1SMY D;  5C44 H;  4OON A;  3QG1 A;  4TQU S;  1Y1W H;  1XTC D;  2CWA A;  1GOZ A;  1RL2 A;  3PCO B;  4K2L A;  4YCU A;  3ERO A;  4GLV B;  4BY1 G;  4DK0 A;  2KBN A;  2G9H D;  5I2Y A;  3HOY B;  2PI2 A;  1WOC A;  3K5L A;  1B3A A;  5DLQ E;  1PRT C;  4JV5 Q;  2RDF A;  5KYL A;  3H3V H;  3I73 A;  3LNN A;  1L1O C;  3K59 A;  4NXM Q;  4Y7N H;  4AYB G;  1ZYR D;  2XWJ B;  2PPB C;  3F2D A;  1EY6 A;  5JEA J;  4A3F H;  3M3Y B;  1L1O B;  1LUZ A;  1SEB D;  4YIJ A;  1AE2 A;  2K5W A;  3HOX H;  2ZXP A;  1ESR A;  3K81 C;  4L5Q A;  4IUQ A;  1PLF A;  2LKV A;  1JOR A;  4IJL A;  3NWS A;  4DV3 Q;  2CH4 A;  5ELE A;  1FJG Q;  3R93 A;  4ZCK A;  1WYD A;  4ILW A;  2R7F A;  2VNU D;  1OXV A;  3PSI A;  3KBX A;  1STN A;  2NVY B;  5D14 A;  4JG2 A;  1NE3 A;  1NJI C;  1IYJ B;  4QUC A;  1PTO H;  4P72 A;  3SE0 A;  2B63 B;  3ND9 A;  3NQI A;  2LXJ A;  3S2H B;  1ML0 D;  1IW7 D;  2XTI A;  2F0W A;  2NYZ D;  1TWA B;  4A3C G;  1K0R A;  2Q8R E;  4C3H H;  5IYD H;  4DV7 Q;  1K8O A;  2IPK D;  1TWH H;  2EJG C;  2EYH A;  1BF4 A;  1JE4 A;  3CKI B;  4BBR B;  2Y0S G;  3KF6 A;  5HUR A;  4A93 B;  1O78 A;  1B70 B;  4B3R Q;  3PIO A;  1TY2 A;  3ZJY C;  4CDD C;  4WJW A;  2CKZ B;  2G5D A;  3UDX A;  2K6A A;  3KLS X;  3PO3 B;  5EKI A;  3BZK A;  1H9S A;  1E22 A;  5M5Y H;  1IKL A;  4FF4 A;  2E2I B;  3CRK C;  4I7Z C;  2QKI C;  2K03 A;  2PZW A;  5I6Y A;  1BO0 A;  1CQF A;  3M4Y A;  4KK7 A;  1D6E C;  3BS1 A;  4Y52 H;  4KHV A;  1O7I A;  1IBK Q;  4KI0 A;  5A2Q L;  1I4Q A;  3GQB A;  1LTT D;  1VCI A;  1XNQ L;  1F9S A;  2DJF C;  1EUJ A;  4GN5 A;  2PCF B;  1SJH D;  2XN9 C;  3ER0 A;  1H9M A;  1Y1W B;  2E8G A;  1STE A;  2L9H A;  3EFX D;  2F1M A;  2B2T C;  1B2T A;  2E5L Q;  1EEF D;  1BBW A;  3FRP B;  4IPC A;  4OGQ C;  3HFZ B;  4DAY A;  1LT5 D;  3H3V C;  4JI8 Q;  1GUT A;  1X6O A;  1I4X A;  1PHJ A;  1I4H A;  2JSO A;  1VQC A;  4FVM A;  4MHE A;  1WCM H;  3T1H Q;  3GTO H;  2DNC A;  1HA5 A;  3CCL A;  1HNZ L;  2F0S A;  2QF7 A;  3PO2 H;  4FF1 A;  4A3F B;  1IBL Q;  2E75 C;  1HFN A;  2JA9 A;  4X65 Q;  2XWB B;  2NUC A;  4GKJ Q;  2PQA B;  3VA5 A;  4QGU A;  4JC0 A;  4RGN A;  5A35 A;  4K0K L;  4DR4 L;  1Y69 U;  3HRZ C;  3LWU A;  1BR9 A;  5E1F A;  4ZQ3 A;  1KRS A;  3KUP A;  4LUZ A;  1TS3 A;  3Q22 A;  3J80 E;  2Q8I B;  1PTO C;  2DN8 A;  2MQH A;  3CCS A;  1I50 H;  1XPO A;  2EYO A;  5FJ8 H;  1G91 A;  1I5F A;  1ENF A;  1MKH A;  5JOB A;  4NKL A;  1PTO B;  3SK8 A;  3GTP H;  4A3B H;  2KJX A; 
#chains in the Genus database with same CATH homology
 4IFD I;  1SNM A;  4DA2 A;  4NP5 A;  1EL0 A;  3D4W A;  2I07 B;  1EZ6 A;  4F88 A;  4C3H B;  1TWH B;  4RFB A;  3NP8 A;  2F0T A;  2Q8T A;  3EA6 A;  3WOF A;  1V1O A;  1B4O A;  3PUZ A;  1FNV A;  4CKE A;  4IN3 A;  4EGV A;  2V4D A;  5T1I A;  1ZXT A;  2B8F A;  1I3Q B;  4HN7 A;  1STB A;  1MD2 D;  3DUZ A;  5FO7 B;  5IGG A;  1L0Y B;  4L6T B;  5CV7 A;  3GV3 A;  3K5M A;  4DXG A;  1PZK D;  4HSP A;  2EY1 A;  2RSO A;  1E2W A;  1WD1 A;  3P75 A;  3P1H A;  4X3T A;  5JJZ A;  1BCP B;  5I9O A;  2DY7 A;  3NWT A;  1HA6 A;  3LX0 A;  2J0T D;  1STG A;  3OWF A;  1I4G A;  5C5L A;  4A3I B;  1Q1E A;  2L4N A;  3GD7 A;  5EQ0 A;  2B2Y A;  4CHT B;  4H13 C;  2I46 A;  3A7L A;  1WTV A;  4G7H C;  4M8A A;  3HEJ A;  2IJ0 A;  5DAU A;  2ENB A;  4G57 A;  3VR3 A;  3IL8 A;  1GHJ A;  5C4X B;  2NN6 H;  3NQT A;  2K33 A;  4IUT A;  4CKC A;  4A3B B;  1Q8I A;  1I4P A;  5CGK A;  3C1F A;  3OW7 A;  3OIQ A;  1B50 A;  3L3O C;  1EIH A;  2LS0 1;  3KLR A;  4FF3 A;  2JP1 A;  4OO1 H;  5CV6 A;  1X3P A;  1A15 A;  2IWH A;  2FMC A;  2A68 D;  3D6C A;  4KN4 C;  3DMU A;  4N9T A;  1B1Z A;  4K6D A;  2FJ2 A;  3QWN A;  2HUG A;  5BN4 A;  5IGE A;  1JWS D;  3C2P A;  3NXW A;  4H7B A;  3ZYY X;  1EYD A;  4XYO A;  5BN3 A;  1PDQ A;  2SDF A;  4A3G B;  2EVB A;  5CBE E;  1Q90 A;  5DM6 3;  1LV9 A;  3R2T A;  2FFK B;  3BVM A;  3H91 A;  4WOR A;  5EGT A;  2C5C A;  3WDN A;  2D2C C;  4XQN A;  1EY0 A;  2B8G A;  3R3O A;  1R4Q B;  2VB3 X;  1NR2 A;  2BA0 A;  1JOO A;  4FO2 A;  1AW7 A;  4KJO A;  2WV6 D;  1PXU A;  1JOQ A;  4EQP A;  5CC4 A;  3X3M A;  4FP5 D;  5LL6 X;  5CV9 A;  1SFO B;  2EY2 A;  2EZV A;  1V43 A;  2XRQ D;  1PTO F;  3M7G A;  4ZUI A;  2BE5 C;  1IKM A;  3HKZ B;  2K28 A;  1C8C A;  4R8I A;  4O1N A;  2SNM A;  2EXZ A;  3KBG A;  4DF7 A;  2ID0 A;  2E2D C;  3I8Z A;  4Q5V A;  1I6H B;  2M9V A;  2K7V A;  3GTL B;  1K83 B;  1D5Z C;  5IIF A;  3RLF A;  2XSC A;  1WTR A;  2K5D A;  5CV8 A;  1UUP A;  3RMH A;  3MA2 B;  3HOV B;  1KNE A;  5EBD A;  1E2V A;  3SK5 A;  2K01 A;  4DNR B;  3BZD B;  2AUJ D;  3VYU A;  1SNP A;  3I91 A;  2GA4 B;  2F0J A;  1HQR D;  1B9M A;  1MGS A;  1AN8 A;  1HTP A;  2B39 A;  3KF8 A;  2B2U C;  4QCL A;  1KDB A;  4KHZ A;  1U4M A;  1RJT A;  5IT9 E;  1DZ1 A;  4K5W A;  1TT2 A;  1QNK A;  1EY9 A;  1Z6H A;  5EPL A;  2A69 C;  1LTI D;  4FF2 A;  1XYI A;  4RGM A;  3TME A;  3E6Z X;  3GTJ B;  3CRL C;  2F0N A;  4DGZ A;  2A6E D;  3QOJ A;  1YNN C;  2NN6 G;  5J22 A;  3VYR A;  1SYG A;  1SNQ A;  2L0C A;  2WKD A;  3H0G B;  4RCO A;  3NBH A;  4S3S A;  4L8J A;  2L11 A;  2K32 A;  2RSN A;  1TWC B;  1FR3 A;  1NUC A;  3PUY A;  3PUV A;  1LO5 D;  2M2L A;  4BY1 B;  5IGD A;  3SEB A;  2MGS A;  3UI2 A;  1WVL A;  4UDU C;  1AEX A;  2KED A;  2A5H A;  5KYI A;  4AYB B;  4MN3 A;  4HAE A;  5D3I B;  1JQY D;  2Z1C A;  3ERQ A;  2RQX A;  1BUV T;  1CI3 M;  3R2I A;  3T13 A;  5M5X B;  5EPK A;  2SEB D;  1LT3 D;  3U9S A;  1SBB B;  1FYC A;  5EBC A;  3DWP A;  2OT2 A;  2WAQ B;  2DNE A;  1A3U A;  5G3L F;  1H9J A;  3C1E A;  1O80 A;  2OEO A;  1IHZ A;  1F77 A;  3K57 A;  2EYF A;  2KOL A;  4KTA A;  1LTB D;  3J81 L;  1WTP A;  1D1K A;  1QOH A;  1EWC A;  1J9O A;  1EFI D;  5I9P A;  1TKW B;  2Y0S B;  3T4A C;  1LLR D;  1F2L A;  1QCB D;  1PRT D;  3MEH A;  1S5C D;  4TKO B;  5AFW A;  5C0X G;  1TU2 B;  3HP3 A;  1ET6 A;  3S1N B;  1R4P B;  1HUM A;  1CZW A;  3S16 B;  3TZD A;  4ABN A;  4CJ1 B;  5FKA C;  2QEJ C;  4E6I A;  5D3D A;  1H9R A;  3DWQ A;  1HRJ A;  1ZKO A;  1QIL A;  2KVM A;  5M9O A;  2DY8 A;  2MJ8 A;  3K5N A;  4QB4 A;  1ILP A;  1V8Q A;  4IZ8 A;  2E2J B;  1DOL A;  3MVV A;  1X32 A;  1TS2 A;  3DEO A;  5M3F B;  4DNT B;  3D4D A;  1B53 A;  5ELF A;  5KIX A;  4NDX A;  1JOK A;  2FMM A;  2R7Z B;  3I3C A;  3IFT A;  4OIJ A;  3SDZ A;  1EU4 A;  1CK1 A;  1SJE D;  1XWE A;  2RDG A;  3IKJ A;  4DN4 M;  4RHS A;  4BS9 A;  5DM7 3;  1B9N A;  1DXM A;  4O42 A;  3HOU B;  4CJ0 B;  2IW3 A;  2KHS A;  5KND A;  3EVQ A;  5FK9 C;  3RUZ A;  3PUW A;  2CHB D;  3Q6S A;  3SR1 A;  5JEA G;  2R6G A;  2NWG A;  4V0B A;  3JAM L;  4IQZ A;  3TBI B;  3BVG A;  1QG7 A;  2JE6 I;  4CKB A;  3H09 A;  1FD7 D;  3M7N A;  4BA2 I;  1YNJ C;  1RKN A;  3C3L A;  5C6A A;  1EEI D;  1ONL A;  3N52 A;  3IAY A;  2F0V A;  3L9A X;  5A2Q E;  1U4L A;  2F0U A;  3GV6 A;  3I90 A;  2NVX B;  1SYC A;  1SAP A;  3VR2 A;  2F0Q A;  3M85 A;  2WAC A;  3NE5 B;  1LTS D;  1RTN A;  1II3 A;  4A3J B;  2K04 A;  2Z4H A;  3W3A A;  1E0B A;  3KLS A;  1GUN A;  1LAC A;  3H94 A;  4R9W A;  2N55 A;  2XNA C;  3FDT A;  1B44 D;  2OXP A;  1PTO D;  4CBV A;  2F0K A;  4JBW A;  4KV6 A;  3PIO 3;  1BOS A;  1U4P A;  2B2U A;  4C2M B;  1CZG A;  4V19 0;  4XXE A;  1CT1 D;  1EYC A;  5T1G A;  1Q1B A;  4Q0F A;  5FOB B;  4C3J G;  2EOT A;  1A3T A;  4F7X A;  2F3W A;  1U9R A;  3TP5 A;  2LMC B;  3A54 A;  4ZK9 B;  2WKC A;  2KUM A;  2HCI A;  4BY7 B;  5JPM C;  4FXK C;  2NVT B;  1G6Z A;  4WFN 3;  2EPB A;  2IX3 A;  4DFA A;  3MFY A;  1DYQ A;  3BDO A;  3CHB D;  5NUC A;  4X3K A;  2CW0 C;  4ZYS A;  4G4K A;  4G7Z C;  5M5W B;  1BCP C;  1GUS A;  1LAB A;  2F0H A;  1M8A A;  2AQ1 B;  5E3F A;  2EJM A;  5C0X I;  4H44 C;  2H1E A;  1UEA B;  3K58 A;  4X3S A;  2D62 A;  4LMQ D;  3Q24 A;  2CQA A;  4RA8 A;  3S2D B;  3V96 A;  1A3V A;  4K8I A;  2PW5 A;  2B2W C;  3S9W A;  3A8J E;  2F0I A;  4C3H G;  3D4R A;  3FKI B;  3TP6 A;  4C3I B;  4C1N K;  4A3M B;  5IGB A;  5KNB A;  5FLX L;  2LY7 A;  1O7Y A;  4PMW A;  3PMF A;  1EU3 A;  3NBI A;  3S1Q B;  3NHH A;  3OOC A;  4KY5 A;  5K5P A;  2F0G A;  4HR7 B;  4LJZ C;  1LT6 D;  3KK7 A;  3ND8 A;  3I4N B;  2A73 B;  1HQM C;  3MAQ A;  1NAP A;  1F9R A;  2A6H C;  5ISR A;  2ZXR A;  4RH6 A;  2XVS A;  4KKS A;  1F2Z A;  5BN5 A;  3D8G A;  1SYF A;  5G3L D;  3GTG B;  3DHQ A;  4NMZ A;  4LK1 C;  2NTS A;  2F0O A;  1UNS A;  4FXG C;  3FPP A;  3PIP 3;  4IFD H;  4N9P A;  1Y1V B;  3A56 A;  2A68 C;  3MZ5 A;  2AWO A;  1G2T A;  2IL8 A;  3K0Y A;  1F2M A;  4ODG A;  1OXU A;  5COY A;  1S5B D;  5D65 A;  4DAP A;  2JA6 B;  3P7J A;  1EY4 A;  2TMP A;  4KKU A;  4KY6 A;  3GTM B;  2SNS A;  1RF2 D;  3I4M B;  2WB1 B;  4ID6 A;  2OF1 A;  2E2H B;  2R93 B;  4KY7 A;  4RKL A;  1S5F D;  2L55 A;  2BCO A;  4QUF A;  5LHY 1;  1Q3L A;  1RD9 D;  5EJW A;  1S5E D;  3T51 B;  1Z7T A;  4A3E B;  4K14 A;  3D3R A;  3AB9 A;  3K6O A;  4GZY C;  5J1Z A;  1DCZ A;  2Z4I A;  5TSS A;  2FIN B;  2BE5 D;  1H9S B;  2RA4 A;  3EJI A;  1SE2 A;  3MWY W;  1Z47 A;  5FO9 B;  1SNO A;  2YYZ A;  1HTL D;  1SNC A;  1AZP A;  2R61 A;  3VR6 A;  1W6K A;  2B2T A;  3AMU A;  2K05 A;  3TN2 A;  5C3X A;  4EVO A;  1L0X B;  2HCC A;  1GUO A;  2PQE A;  1JR0 D;  1IYV A;  2IX1 A;  5I6W A;  1WTX A;  1GHK A;  1BDO A;  3G7L A;  1BXT A;  3PV0 A;  1ET9 A;  1OO9 B;  4HCE A;  5KNC A;  3QJY A;  1EIG A;  3QIA A;  3L7Z C;  1D5X C;  1BNZ A;  1Y8O B;  3VYT A;  3GTK B;  2X6G A;  2KQ3 A;  1DJR D;  3A8K E;  3E0J A;  3SHL A;  1OXX K;  2A74 C;  1KTK A;  2RDH A;  2F0E A;  1BCP F;  2R3Z A;  2A69 D;  1V1P B;  2CVR A;  5IGC A;  4IFD J;  3F2U A;  1YNN D;  1TY0 A;  2E74 C;  1EQT A;  1OXT A;  2VXW A;  2AWN A;  3E5S A;  2WII B;  5JPN C;  4KMU C;  3FVQ A;  1SYD A;  4IUV A;  5E4W C;  5J39 A;  2PO4 A;  1OXS C;  4HSV A;  4OO1 G;  1ENA A;  5C4J B;  1KDA A;  2O5J C;  3FPU B;  1UAP A;  5KGU A;  1U4R A;  1TVX A;  1WD0 A;  4BWG B;  5JVG 3;  2JA7 B;  5ELC A;  3BDL A;  3OHX C;  1SE4 A;  4XYQ A;  1I6V C;  1PZI D;  1STA A;  1S5D D;  1EQV A;  3U9O A;  2O4X A;  4IFD G;  4ULL A;  1ILQ A;  3W2D A;  2YU9 B;  3TSS A;  3MXU A;  1FNU A;  1CM9 A;  1BBX C;  1KLG D;  4K5V A;  3CU7 A;  2NVQ B;  2B2W A;  3A8I E;  1VF7 A;  4KJN A;  4NW2 A;  3HZX A;  1Y8N B;  3N6R A;  3DM1 A;  4G7O C;  5C4H A;  2EY6 A;  1GUG A;  2B2V C;  3MFG A;  1EY7 A;  3IFD A;  4IUN A;  5IOC A;  3M4O B;  4H0L C;  1NCV A;  1QE6 A;  4ZKC B;  4OIK A;  1PMR A;  1SMY C;  4BA1 I;  3H6M A;  3BYT B;  5I4D A;  3J81 E;  2MPM A;  3A55 A;  3OWE B;  3RZO B;  4I65 A;  5FO8 B;  2HDM A;  2RBM A;  4TSS A;  1CA5 A;  3S14 B;  1D2B A;  1SSO A;  1G2S A;  1ICW A;  1HHV A;  4TRD A;  1PRT B;  3I4L A;  1ZYR C;  4ZKB B;  2PW7 A;  2NZ1 D;  1A2U A;  1F2Y A;  1HPC A;  5LL6 S;  5C3E B;  1GXD C;  2C9O A;  1XXG A;  3V2T A;  3TDQ A;  1QJO A;  4RGT A;  4RAU C;  2EYM A;  1XX8 A;  4R8N A;  4IUU A;  4RGO S;  4DK1 A;  1IW7 C;  1MI2 A;  3GO5 A;  1TS5 A;  1MSG A;  4U68 A;  3P20 A;  4OHJ A;  2Z8L A;  1FNW A;  2LFN A;  3MXN A;  3MXG A;  2BDO A;  1PFB A;  2H4O A;  3S15 B;  2IT1 A;  3S1M B;  1PZJ D;  3MHB A;  2PYK A;  1QB5 D;  4ZUJ A;  1IYU A;  1YNJ D;  4MIU A;  4DU9 A;  1DON A;  1VDZ A;  4C3J B;  3RZD B;  4ME5 A;  1BQQ T;  1JIC A;  1MSH A;  3JAM E;  2BA1 A;  4A3K B;  2QIL A;  1AP0 A;  1D1I A;  3LWE A;  3MC0 B;  5C44 B;  1EYA A;  4RHR A;  2NN6 I;  5CMD A;  1HFG A;  3G6J B;  2PZU A;  1G29 1;  4QF4 A;  2O5I C;  1SDF A;  3OPO A;  2PZT A;  4A3D B;  2AQ2 B;  2ICE C;  3URY A;  1O7Z A;  4EQN A;  3O13 A;  2JXM B;  3OSO A;  3J80 L;  4Y7N B;  5KEE A;  4OO1 I;  1TWG B;  3MXP A;  5IGF A;  1EY8 A;  4U67 3;  2EDG A;  3HOX B;  2WIN B;  2L12 A;  3SK4 A;  4PV1 C;  3QO2 A;  3BVZ A;  1EWH A;  3DXJ C;  4XTC S;  3V05 A;  2MUY A;  5CBA E;  4J8Q A;  1V1P A;  5JVH 3;  3RD4 A;  1ESF A;  3OIP A;  3GP7 A;  1GUW A;  5HGT A;  1AZQ A;  1RCV D;  2EE1 A;  3HS0 C;  1J8I A;  2EJF C;  3EQL C;  2NTT A;  2PNR C;  5K36 H;  3QOL A;  3T56 B;  3DEP A;  5COR A;  3HOW B;  4KD4 A;  1JB3 A;  4KN7 C;  2RKS A;  5C5M A;  2CW0 D;  5M5Y B;  4ZAI A;  1BCP D;  4DAV A;  3ITP A;  3NTI A;  3BDC A;  4QIW B;  2F0L A;  3J7Y W;  3S1R B;  2X69 A;  1TQO A;  2BDN A;  3T16 A;  5C4Z A;  4KKT A;  3R8B A;  3HG9 A;  3NK9 A;  2MHV A;  1LTR D;  5F2D A;  1LTG D;  2JA8 B;  5ELB A;  2AUK A;  4XIG S;  1EZ8 A;  1CTM A;  2J7Z A;  3BYY B;  2F0P A;  1CHQ D;  5EPJ A;  2KCN A;  1PRT F;  4Z9C B;  1Y8P B;  1WCM B;  2KEE A;  2EYL A;  3GTO B;  3PO2 B;  3VR4 A;  4FNF A;  3ONA B;  2K1B A;  1LT4 D;  3TP7 A;  4C1N I;  2F4I A;  1VMC A;  5CV5 A;  4XQJ A;  3FEW X;  1KDC A;  2F03 A;  3HOZ B;  2B2V A;  5DEH A;  4FYD A;  3TP8 A;  4K8J A;  1SXT A;  5EKL A;  1I50 B;  1Q12 A;  1KAA A;  5FLX E;  5CYU A;  2A6H D;  3GTP B;  1GJX A;  2VB2 X;  3OMC A;  4WRD A;  2D9U A;  1KAB A;  4F8M A;  3PUX A;  1SE3 A;  1F9P A;  4HCS A;  4RWS C;  2R92 B;  4L63 B;  3D31 A;  4IUP A;  4K2K A;  1SYB A;  1TR5 A;  2F0D A;  2J4X A;  1X3Q A;  1JC7 A;  1SYE A;  3WOE A;  2ZXO A;  2N88 A;  4PMB A;  2K5Q A;  5CV4 A;  4ZRZ A;  2M00 A;  3VA7 A;  2BOS A;  4HMJ A;  1NR4 A;  1W6J A;  5DNF A;  4LAA A;  2IX0 A;  1STH A;  1RDP D;  1JWM D;  4EQO A;  1CQV A;  3BG3 A;  3VR5 A;  4C3I G;  5IOD A;  2F0F A;  3CQZ B;  4XDX A;  4C56 C;  3OMG A;  3FMC A;  2JEB I;  2F0M A;  1RHP A;  4PMC A;  1WTQ A;  1JWU D;  1ZEQ X;  2XIW A;  4UAI A;  1CA6 A;  4M1U B;  3J7A F;  1A6X A;  1DM0 B;  3SVM A;  2F3V A;  2ZT9 C;  5JAV A;  1WTO A;  2G9D A;  1C4Q A;  3A7A B;  2L5T A;  2KCC A;  5I2X A;  1G8Z D;  3NSW A;  5EKK A;  5C0X H;  2VUM B;  1KNA A;  2QCP X;  1STY A;  1H9K A;  1O7L A;  3D6W A;  3S17 B;  4IUR A;  4RKB A;  1WTW A;  1TS4 A;  3NPP A;  2SOB A;  3I72 A;  3K5O A;  5K36 G;  1R9T B;  5M3M B;  4HMI A;  1K8M A;  1T5E A;  1QNU A;  4PNY A;  4JK1 C;  2AQ3 B;  1PFN A;  4XQQ A;  4QMG A;  4XT1 B;  2JA5 B;  2EY5 A;  4K5X A;  4CGY B;  4F87 A;  1RTO A;  1EY5 A;  4K6L A;  1TII D;  4KD3 A;  5CR3 A;  2KA7 A;  1ENC A;  3NUC A;  3T53 B;  3HGB A;  5IT9 L;  2RVL A;  1LTA D;  1HCZ A;  4J1M A;  4DXF A;  3QB3 A;  3SK6 A;  5C3W A;  1VMP A;  2NBF A;  1D5M C;  1SND A;  3K7A B;  5E4X A;  3TZU A;  1CFM A;  1QWY A;  1TWF B;  1VF5 C;  1PYW D;  3VYS A;  1C48 A;  2WP8 J;  4RCN A;  5JEA H;  4XT3 B;  2O2L D;  3NTK A;  1CHP D;  3NTH A;  3Q23 A;  1ROD A;  1MBY A;  2ICI A;  2PMZ B;  1I4R A;  1DOM A;  5KRU A;  4HED A;  2QDB A;  2A6E C;  2L1B A;  1EOT A;  2EYJ A;  4B9W A;  1E2Z A;  3I70 A;  3X3N A;  1IL8 A;  3C46 A;  1DD2 A;  4OL7 A;  1PFM A;  4X3U A;  5ELD A;  3MTS A;  4CJ2 C;  2EYP A;  2MP1 A;  4HTH A;  1T5X D;  1F9Q A;  3Q0A A;  2TSS A;  1FGB D;  2JYO A;  1M4V A;  5C0X J;  4B08 A;  3SXH A;  4B9X A;  1S4Z A;  2D5D A;  1KLU D;  2FHT A;  2KEC A;  1DOK A;  2B2Y C;  4IAL A;  4FXD A;  4BBS B;  2E76 C;  3GTQ B;  1A2T A;  1HUN A;  1AFP A;  1NSN S;  4P2C B;  4PQX A;  2NB0 A;  2HDL A;  2HQE A;  2X6L A;  2XRS D;  1JCK B;  2JEA I;  1HXY D;  4J6H A;  3DWA A;  4ZLT F;  3AU7 A;  3J7A V;  1SMY D;  3QG1 A;  4TQU S;  1XTC D;  1GOZ A;  4K2L A;  3ERO A;  4DK0 A;  2G9H D;  5I2Y A;  3HOY B;  3K5L A;  1B3A A;  1PRT C;  2RDF A;  5KYL A;  3I73 A;  3LNN A;  3K59 A;  1ZYR D;  2XWJ B;  2PPB C;  1EY6 A;  5JEA J;  3M3Y B;  1SEB D;  4YIJ A;  2K5W A;  2ZXP A;  1ESR A;  4IUQ A;  1PLF A;  2LKV A;  1JOR A;  3NWS A;  5ELE A;  3R93 A;  4ILW A;  2VNU D;  1OXV A;  3KBX A;  1STN A;  2NVY B;  5D14 A;  4QUC A;  1PTO H;  3SE0 A;  2B63 B;  3ND9 A;  3NQI A;  3S2H B;  1ML0 D;  1IW7 D;  2F0W A;  2NYZ D;  1TWA B;  2Q8R E;  1K8O A;  2IPK D;  2EYH A;  2EJG C;  1BF4 A;  1JE4 A;  3CKI B;  4BBR B;  5HUR A;  4A93 B;  1O78 A;  1TY2 A;  4WJW A;  2K6A A;  3KLS X;  3PO3 B;  5EKI A;  1H9S A;  1IKL A;  4FF4 A;  2E2I B;  3CRK C;  4I7Z C;  2QKI C;  2K03 A;  2PZW A;  5I6Y A;  1BO0 A;  1CQF A;  3M4Y A;  4KK7 A;  1D6E C;  3BS1 A;  4KHV A;  4KI0 A;  5A2Q L;  1I4Q A;  3GQB A;  1LTT D;  1VCI A;  1F9S A;  2PCF B;  1SJH D;  2XN9 C;  1H9M A;  1Y1W B;  1STE A;  2L9H A;  3EFX D;  2F1M A;  2B2T C;  1B2T A;  1EEF D;  3FRP B;  4OGQ C;  4DAY A;  1LT5 D;  3H3V C;  1GUT A;  1I4X A;  1I4H A;  2JSO A;  4FVM A;  4MHE A;  2DNC A;  1HA5 A;  2F0S A;  2QF7 A;  4FF1 A;  4A3F B;  2E75 C;  1HFN A;  2XWB B;  2NUC A;  3VA5 A;  4RGN A;  5A35 A;  1Y69 U;  3HRZ C;  3LWU A;  1BR9 A;  5E1F A;  4ZQ3 A;  3KUP A;  1TS3 A;  3Q22 A;  3J80 E;  2Q8I B;  1PTO C;  2DN8 A;  2EYO A;  1G91 A;  1ENF A;  5JOB A;  4NKL A;  1PTO B;  3SK8 A;  2KJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...