4INBA

Crystal structure of the n-terminal domain of hiv-1 capsid in complex with benzodiazepine inhibitor
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
146
structure length
146
Chain Sequence
b'PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag protein
publication title Monitoring Binding of HIV-1 Capsid Assembly Inhibitors Using (19) F Ligand-and (15) N Protein-Based NMR and X-ray Crystallography: Early Hit Validation of a Benzodiazepine Series.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/viral protein inhibitor
total genus 47
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2013-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4inbA00
3H4EA 5HGMA 1D1DA 5JPAA 1EIAA 4XRQA 2XDEA 4J93A 4QNBA 4U0BA 3P05A 3BP9A 4NX4C 2M8LA 1EM9A 2KGFA 5HGLA 2LF4A 2V4XA 4U0DA 1GWPA 2JPRA 2PWOA 2X82A 1AFVA 5HGOA 1E6JP 1G03A 2Y4ZA 2XGYA 4DGAC 2WLVB 1M9XC 1QRJA 4WYMA 4XFYA 2X83A 4XFXA 1M9EC 2M8NA 1M9FC 4INBA 4XFZA 4U0AA 2GOLB 1L6NA 5HGNA 4LQWC 1AK4C 2XGVA 2EIAA 5HGKA 1P7NA 4E91A 3NTEA 2GONA 1M9YC 2WLVA 4PH0A 2M8PA 3MGEA 4XROA 1M9DC 4U0CA 1M9CC 4PH2A 4U0FA 2PWMA 4U0EA 2X2DD 1U7KA 2PXRC 3H47A 2XGUA 4HTWA 4PH3A 4DGEC 4E92A 4B4NA
chains in the Genus database with same CATH superfamily
3H4EA 5HGMA 1D1DA 5JPAA 1EIAA 4XRQA 2XDEA 4J93A 4QNBA 4U0BA 3P05A 3BP9A 4NX4C 2M8LA 1EM9A 2KGFA 5HGLA 2LF4A 2V4XA 4U0DA 1GWPA 2JPRA 2PWOA 2X82A 1AFVA 5HGOA 1E6JP 1G03A 2Y4ZA 2XGYA 4DGAC 2WLVB 1M9XC 1QRJA 4WYMA 4XFYA 2X83A 4XFXA 1M9EC 2M8NA 1M9FC 4INBA 4XFZA 4U0AA 2GOLB 1L6NA 5HGNA 4LQWC 1AK4C 2XGVA 2EIAA 5HGKA 1P7NA 4E91A 3NTEA 2GONA 1M9YC 2WLVA 4PH0A 2M8PA 3MGEA 4XROA 1M9DC 4U0CA 1M9CC 4PH2A 4U0FA 2PWMA 4U0EA 2X2DD 1U7KA 2PXRC 3H47A 2XGUA 4HTWA 4PH3A 4DGEC 4E92A 4B4NA
chains in the Genus database with same CATH topology
3H4EA 5HGMA 1D1DA 5JPAA 1EIAA 4XRQA 2XDEA 4J93A 4QNBA 4U0BA 3P05A 3BP9A 4NX4C 2M8LA 1EM9A 2KGFA 5HGLA 2LF4A 2V4XA 4U0DA 1GWPA 2JPRA 2PWOA 2X82A 1AFVA 5HGOA 1E6JP 1G03A 2Y4ZA 2XGYA 4DGAC 2WLVB 1M9XC 1QRJA 4WYMA 4XFYA 2X83A 4XFXA 1M9EC 2M8NA 1M9FC 4INBA 4XFZA 4U0AA 2GOLB 1L6NA 5HGNA 4LQWC 1AK4C 2XGVA 2EIAA 5HGKA 1P7NA 4E91A 3NTEA 2GONA 1M9YC 2WLVA 4PH0A 2M8PA 3MGEA 4XROA 1M9DC 4U0CA 1M9CC 4PH2A 4U0FA 2PWMA 4U0EA 2X2DD 1U7KA 2PXRC 3H47A 2XGUA 4HTWA 4PH3A 4DGEC 4E92A 4B4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H4E A;  5HGM A;  1D1D A;  5JPA A;  1EIA A;  4XRQ A;  2XDE A;  4J93 A;  4QNB A;  4U0B A;  3P05 A;  3BP9 A;  4NX4 C;  2M8L A;  1EM9 A;  2KGF A;  5HGL A;  2LF4 A;  2V4X A;  4U0D A;  1GWP A;  2JPR A;  2PWO A;  2X82 A;  1AFV A;  5HGO A;  1E6J P;  1G03 A;  2Y4Z A;  2XGY A;  4DGA C;  2WLV B;  1M9X C;  1QRJ A;  4WYM A;  4XFY A;  2X83 A;  4XFX A;  1M9E C;  2M8N A;  1M9F C;  4INB A;  4XFZ A;  4U0A A;  2GOL B;  1L6N A;  5HGN A;  4LQW C;  1AK4 C;  2XGV A;  2EIA A;  5HGK A;  1P7N A;  4E91 A;  3NTE A;  2GON A;  1M9Y C;  2WLV A;  4PH0 A;  2M8P A;  3MGE A;  4XRO A;  1M9D C;  4U0C A;  1M9C C;  4PH2 A;  4U0F A;  2PWM A;  4U0E A;  2X2D D;  1U7K A;  2PXR C;  3H47 A;  2XGU A;  4HTW A;  4PH3 A;  4DGE C;  4E92 A;  4B4N A; 
#chains in the Genus database with same CATH topology
 3H4E A;  5HGM A;  1D1D A;  5JPA A;  1EIA A;  4XRQ A;  2XDE A;  4J93 A;  4QNB A;  4U0B A;  3P05 A;  3BP9 A;  4NX4 C;  2M8L A;  1EM9 A;  2KGF A;  5HGL A;  2LF4 A;  2V4X A;  4U0D A;  1GWP A;  2JPR A;  2PWO A;  2X82 A;  1AFV A;  5HGO A;  1E6J P;  1G03 A;  2Y4Z A;  2XGY A;  4DGA C;  2WLV B;  1M9X C;  1QRJ A;  4WYM A;  4XFY A;  2X83 A;  4XFX A;  1M9E C;  2M8N A;  1M9F C;  4INB A;  4XFZ A;  4U0A A;  2GOL B;  1L6N A;  5HGN A;  4LQW C;  1AK4 C;  2XGV A;  2EIA A;  5HGK A;  1P7N A;  4E91 A;  3NTE A;  2GON A;  1M9Y C;  2WLV A;  4PH0 A;  2M8P A;  3MGE A;  4XRO A;  1M9D C;  4U0C A;  1M9C C;  4PH2 A;  4U0F A;  2PWM A;  4U0E A;  2X2D D;  1U7K A;  2PXR C;  3H47 A;  2XGU A;  4HTW A;  4PH3 A;  4DGE C;  4E92 A;  4B4N A; 
#chains in the Genus database with same CATH homology
 3H4E A;  5HGM A;  1D1D A;  5JPA A;  1EIA A;  4XRQ A;  2XDE A;  4J93 A;  4QNB A;  4U0B A;  3P05 A;  3BP9 A;  4NX4 C;  2M8L A;  1EM9 A;  2KGF A;  5HGL A;  2LF4 A;  2V4X A;  4U0D A;  1GWP A;  2JPR A;  2PWO A;  2X82 A;  1AFV A;  5HGO A;  1E6J P;  1G03 A;  2Y4Z A;  2XGY A;  4DGA C;  2WLV B;  1M9X C;  1QRJ A;  4WYM A;  4XFY A;  2X83 A;  4XFX A;  1M9E C;  2M8N A;  1M9F C;  4INB A;  4XFZ A;  4U0A A;  2GOL B;  1L6N A;  5HGN A;  4LQW C;  1AK4 C;  2XGV A;  2EIA A;  5HGK A;  1P7N A;  4E91 A;  3NTE A;  2GON A;  1M9Y C;  2WLV A;  4PH0 A;  2M8P A;  3MGE A;  4XRO A;  1M9D C;  4U0C A;  1M9C C;  4PH2 A;  4U0F A;  2PWM A;  4U0E A;  2X2D D;  1U7K A;  2PXR C;  3H47 A;  2XGU A;  4HTW A;  4PH3 A;  4DGE C;  4E92 A;  4B4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...