4INBA

Crystal structure of the n-terminal domain of hiv-1 capsid in complex with benzodiazepine inhibitor
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
146
structure length
146
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Monitoring Binding of HIV-1 Capsid Assembly Inhibitors Using (19) F Ligand-and (15) N Protein-Based NMR and X-ray Crystallography: Early Hit Validation of a Benzodiazepine Series.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/viral protein inhibitor
molecule keywords Gag protein
total genus 47
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2013-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4inbA00
4B4NA 2X83A 1D1DA 5JPAA 1EM9A 2GOLB 1E6JP 4WYMA 4E91A 4E92A 2Y4ZA 3NTEA 2M8PA 5HGOA 2WLVB 4U0AA 2EIAA 1AFVA 1M9CC 2WLVA 2XDEA 2XGVA 3H4EA 4LQWC 5HGMA 4PH0A 4DGAC 1G03A 2KGFA 3MGEA 3P05A 4QNBA 4U0CA 4XROA 2X82A 4XFYA 1U7KA 2GONA 2LF4A 2XGYA 3BP9A 1P7NA 4XFZA 4XRQA 1M9YC 3H47A 1L6NA 4U0EA 4INBA 4PH2A 5HGKA 1EIAA 2V4XA 1M9DC 2JPRA 2PXRC 4NX4C 4U0BA 1QRJA 2M8NA 5HGNA 4U0DA 4DGEC 4J93A 2PWMA 2X2DD 2M8LA 4PH3A 4HTWA 4U0FA 1M9FC 4XFXA 2XGUA 1M9XC 1M9EC 1GWPA 2PWOA 1AK4C 5HGLA
chains in the Genus database with same CATH superfamily
4B4NA 2X83A 1D1DA 5JPAA 1EM9A 2GOLB 1E6JP 4WYMA 4E91A 4E92A 2Y4ZA 3NTEA 2M8PA 5HGOA 2WLVB 4U0AA 2EIAA 1AFVA 1M9CC 2WLVA 2XDEA 2XGVA 3H4EA 4LQWC 5HGMA 4PH0A 4DGAC 1G03A 2KGFA 3MGEA 3P05A 4QNBA 4U0CA 4XROA 2X82A 4XFYA 1U7KA 2GONA 2LF4A 2XGYA 3BP9A 1P7NA 4XFZA 4XRQA 1M9YC 3H47A 1L6NA 4U0EA 4INBA 4PH2A 5HGKA 1EIAA 2V4XA 1M9DC 2JPRA 2PXRC 4NX4C 4U0BA 1QRJA 2M8NA 5HGNA 4U0DA 4DGEC 4J93A 2PWMA 2X2DD 2M8LA 4PH3A 4HTWA 4U0FA 1M9FC 4XFXA 2XGUA 1M9XC 1M9EC 1GWPA 2PWOA 1AK4C 5HGLA
chains in the Genus database with same CATH topology
4B4NA 2X83A 1D1DA 5JPAA 1EM9A 2GOLB 1E6JP 4WYMA 4E91A 4E92A 2Y4ZA 3NTEA 2M8PA 5HGOA 2WLVB 4U0AA 2EIAA 1AFVA 1M9CC 2WLVA 2XDEA 2XGVA 3H4EA 4LQWC 5HGMA 4PH0A 4DGAC 1G03A 2KGFA 3MGEA 3P05A 4QNBA 4U0CA 4XROA 2X82A 4XFYA 1U7KA 2GONA 2LF4A 2XGYA 3BP9A 1P7NA 4XFZA 4XRQA 1M9YC 3H47A 1L6NA 4U0EA 4INBA 4PH2A 5HGKA 1EIAA 2V4XA 1M9DC 2JPRA 2PXRC 4NX4C 4U0BA 1QRJA 2M8NA 5HGNA 4U0DA 4DGEC 4J93A 2PWMA 2X2DD 2M8LA 4PH3A 4HTWA 4U0FA 1M9FC 4XFXA 2XGUA 1M9XC 1M9EC 1GWPA 2PWOA 1AK4C 5HGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B4N A;  2X83 A;  1D1D A;  5JPA A;  1EM9 A;  2GOL B;  1E6J P;  4WYM A;  4E91 A;  4E92 A;  2Y4Z A;  3NTE A;  2M8P A;  5HGO A;  2WLV B;  4U0A A;  2EIA A;  1AFV A;  1M9C C;  2WLV A;  2XDE A;  2XGV A;  3H4E A;  4LQW C;  5HGM A;  4PH0 A;  4DGA C;  1G03 A;  2KGF A;  3MGE A;  3P05 A;  4QNB A;  4U0C A;  4XRO A;  2X82 A;  4XFY A;  1U7K A;  2GON A;  2LF4 A;  2XGY A;  3BP9 A;  1P7N A;  4XFZ A;  4XRQ A;  1M9Y C;  3H47 A;  1L6N A;  4U0E A;  4INB A;  4PH2 A;  5HGK A;  1EIA A;  2V4X A;  1M9D C;  2JPR A;  2PXR C;  4NX4 C;  4U0B A;  1QRJ A;  2M8N A;  5HGN A;  4U0D A;  4DGE C;  4J93 A;  2PWM A;  2X2D D;  2M8L A;  4PH3 A;  4HTW A;  4U0F A;  1M9F C;  4XFX A;  2XGU A;  1M9X C;  1M9E C;  1GWP A;  2PWO A;  1AK4 C;  5HGL A; 
#chains in the Genus database with same CATH topology
 4B4N A;  2X83 A;  1D1D A;  5JPA A;  1EM9 A;  2GOL B;  1E6J P;  4WYM A;  4E91 A;  4E92 A;  2Y4Z A;  3NTE A;  2M8P A;  5HGO A;  2WLV B;  4U0A A;  2EIA A;  1AFV A;  1M9C C;  2WLV A;  2XDE A;  2XGV A;  3H4E A;  4LQW C;  5HGM A;  4PH0 A;  4DGA C;  1G03 A;  2KGF A;  3MGE A;  3P05 A;  4QNB A;  4U0C A;  4XRO A;  2X82 A;  4XFY A;  1U7K A;  2GON A;  2LF4 A;  2XGY A;  3BP9 A;  1P7N A;  4XFZ A;  4XRQ A;  1M9Y C;  3H47 A;  1L6N A;  4U0E A;  4INB A;  4PH2 A;  5HGK A;  1EIA A;  2V4X A;  1M9D C;  2JPR A;  2PXR C;  4NX4 C;  4U0B A;  1QRJ A;  2M8N A;  5HGN A;  4U0D A;  4DGE C;  4J93 A;  2PWM A;  2X2D D;  2M8L A;  4PH3 A;  4HTW A;  4U0F A;  1M9F C;  4XFX A;  2XGU A;  1M9X C;  1M9E C;  1GWP A;  2PWO A;  1AK4 C;  5HGL A; 
#chains in the Genus database with same CATH homology
 4B4N A;  2X83 A;  1D1D A;  5JPA A;  1EM9 A;  2GOL B;  1E6J P;  4WYM A;  4E91 A;  4E92 A;  2Y4Z A;  3NTE A;  2M8P A;  5HGO A;  2WLV B;  4U0A A;  2EIA A;  1AFV A;  1M9C C;  2WLV A;  2XDE A;  2XGV A;  3H4E A;  4LQW C;  5HGM A;  4PH0 A;  4DGA C;  1G03 A;  2KGF A;  3MGE A;  3P05 A;  4QNB A;  4U0C A;  4XRO A;  2X82 A;  4XFY A;  1U7K A;  2GON A;  2LF4 A;  2XGY A;  3BP9 A;  1P7N A;  4XFZ A;  4XRQ A;  1M9Y C;  3H47 A;  1L6N A;  4U0E A;  4INB A;  4PH2 A;  5HGK A;  1EIA A;  2V4X A;  1M9D C;  2JPR A;  2PXR C;  4NX4 C;  4U0B A;  1QRJ A;  2M8N A;  5HGN A;  4U0D A;  4DGE C;  4J93 A;  2PWM A;  2X2D D;  2M8L A;  4PH3 A;  4HTW A;  4U0F A;  1M9F C;  4XFX A;  2XGU A;  1M9X C;  1M9E C;  1GWP A;  2PWO A;  1AK4 C;  5HGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...