4INBA

Crystal structure of the n-terminal domain of hiv-1 capsid in complex with benzodiazepine inhibitor
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
146
structure length
146
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag protein
publication title Monitoring Binding of HIV-1 Capsid Assembly Inhibitors Using (19) F Ligand-and (15) N Protein-Based NMR and X-ray Crystallography: Early Hit Validation of a Benzodiazepine Series.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/viral protein inhibitor
total genus 47
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2013-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4inbA00
4XROA 4NX4C 1AK4C 1D1DA 4U0EA 1M9DC 2X83A 1U7KA 2X82A 2M8NA 2XGUA 4U0FA 2PWMA 1M9YC 4U0DA 4E92A 4XFXA 2V4XA 2LF4A 2PXRC 4LQWC 3MGEA 1GWPA 3BP9A 4XFYA 1EM9A 1P7NA 2M8PA 2GONA 2JPRA 4U0CA 3NTEA 1M9EC 2XGVA 5HGMA 5JPAA 1QRJA 2GOLB 1EIAA 4PH0A 2KGFA 4QNBA 4XRQA 4B4NA 4J93A 3H4EA 2WLVA 4E91A 4XFZA 3P05A 4WYMA 1M9CC 4DGEC 4DGAC 2X2DD 2Y4ZA 5HGOA 1E6JP 2M8LA 2EIAA 4PH3A 2XGYA 4HTWA 5HGLA 1G03A 2PWOA 1L6NA 1AFVA 4U0BA 3H47A 4PH2A 2WLVB 5HGNA 4U0AA 4INBA 2XDEA 5HGKA 1M9XC 1M9FC
chains in the Genus database with same CATH superfamily
4XROA 4NX4C 1AK4C 1D1DA 4U0EA 1M9DC 2X83A 1U7KA 2X82A 2M8NA 2XGUA 4U0FA 2PWMA 1M9YC 4U0DA 4E92A 4XFXA 2V4XA 2LF4A 2PXRC 4LQWC 3MGEA 1GWPA 3BP9A 4XFYA 1EM9A 1P7NA 2M8PA 2GONA 2JPRA 4U0CA 3NTEA 1M9EC 2XGVA 5HGMA 5JPAA 1QRJA 2GOLB 1EIAA 4PH0A 2KGFA 4QNBA 4XRQA 4B4NA 4J93A 3H4EA 2WLVA 4E91A 4XFZA 3P05A 4WYMA 1M9CC 4DGEC 4DGAC 2X2DD 2Y4ZA 5HGOA 1E6JP 2M8LA 2EIAA 4PH3A 2XGYA 4HTWA 5HGLA 1G03A 2PWOA 1L6NA 1AFVA 4U0BA 3H47A 4PH2A 2WLVB 5HGNA 4U0AA 4INBA 2XDEA 5HGKA 1M9XC 1M9FC
chains in the Genus database with same CATH topology
4XROA 4NX4C 1AK4C 1D1DA 4U0EA 1M9DC 2X83A 1U7KA 2X82A 2M8NA 2XGUA 4U0FA 2PWMA 1M9YC 4U0DA 4E92A 4XFXA 2V4XA 2LF4A 2PXRC 4LQWC 3MGEA 1GWPA 3BP9A 4XFYA 1EM9A 1P7NA 2M8PA 2GONA 2JPRA 4U0CA 3NTEA 1M9EC 2XGVA 5HGMA 5JPAA 1QRJA 2GOLB 1EIAA 4PH0A 2KGFA 4QNBA 4XRQA 4B4NA 4J93A 3H4EA 2WLVA 4E91A 4XFZA 3P05A 4WYMA 1M9CC 4DGEC 4DGAC 2X2DD 2Y4ZA 5HGOA 1E6JP 2M8LA 2EIAA 4PH3A 2XGYA 4HTWA 5HGLA 1G03A 2PWOA 1L6NA 1AFVA 4U0BA 3H47A 4PH2A 2WLVB 5HGNA 4U0AA 4INBA 2XDEA 5HGKA 1M9XC 1M9FC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XRO A;  4NX4 C;  1AK4 C;  1D1D A;  4U0E A;  1M9D C;  2X83 A;  1U7K A;  2X82 A;  2M8N A;  2XGU A;  4U0F A;  2PWM A;  1M9Y C;  4U0D A;  4E92 A;  4XFX A;  2V4X A;  2LF4 A;  2PXR C;  4LQW C;  3MGE A;  1GWP A;  3BP9 A;  4XFY A;  1EM9 A;  1P7N A;  2M8P A;  2GON A;  2JPR A;  4U0C A;  3NTE A;  1M9E C;  2XGV A;  5HGM A;  5JPA A;  1QRJ A;  2GOL B;  1EIA A;  4PH0 A;  2KGF A;  4QNB A;  4XRQ A;  4B4N A;  4J93 A;  3H4E A;  2WLV A;  4E91 A;  4XFZ A;  3P05 A;  4WYM A;  1M9C C;  4DGE C;  4DGA C;  2X2D D;  2Y4Z A;  5HGO A;  1E6J P;  2M8L A;  2EIA A;  4PH3 A;  2XGY A;  4HTW A;  5HGL A;  1G03 A;  2PWO A;  1L6N A;  1AFV A;  4U0B A;  3H47 A;  4PH2 A;  2WLV B;  5HGN A;  4U0A A;  4INB A;  2XDE A;  5HGK A;  1M9X C;  1M9F C; 
#chains in the Genus database with same CATH topology
 4XRO A;  4NX4 C;  1AK4 C;  1D1D A;  4U0E A;  1M9D C;  2X83 A;  1U7K A;  2X82 A;  2M8N A;  2XGU A;  4U0F A;  2PWM A;  1M9Y C;  4U0D A;  4E92 A;  4XFX A;  2V4X A;  2LF4 A;  2PXR C;  4LQW C;  3MGE A;  1GWP A;  3BP9 A;  4XFY A;  1EM9 A;  1P7N A;  2M8P A;  2GON A;  2JPR A;  4U0C A;  3NTE A;  1M9E C;  2XGV A;  5HGM A;  5JPA A;  1QRJ A;  2GOL B;  1EIA A;  4PH0 A;  2KGF A;  4QNB A;  4XRQ A;  4B4N A;  4J93 A;  3H4E A;  2WLV A;  4E91 A;  4XFZ A;  3P05 A;  4WYM A;  1M9C C;  4DGE C;  4DGA C;  2X2D D;  2Y4Z A;  5HGO A;  1E6J P;  2M8L A;  2EIA A;  4PH3 A;  2XGY A;  4HTW A;  5HGL A;  1G03 A;  2PWO A;  1L6N A;  1AFV A;  4U0B A;  3H47 A;  4PH2 A;  2WLV B;  5HGN A;  4U0A A;  4INB A;  2XDE A;  5HGK A;  1M9X C;  1M9F C; 
#chains in the Genus database with same CATH homology
 4XRO A;  4NX4 C;  1AK4 C;  1D1D A;  4U0E A;  1M9D C;  2X83 A;  1U7K A;  2X82 A;  2M8N A;  2XGU A;  4U0F A;  2PWM A;  1M9Y C;  4U0D A;  4E92 A;  4XFX A;  2V4X A;  2LF4 A;  2PXR C;  4LQW C;  3MGE A;  1GWP A;  3BP9 A;  4XFY A;  1EM9 A;  1P7N A;  2M8P A;  2GON A;  2JPR A;  4U0C A;  3NTE A;  1M9E C;  2XGV A;  5HGM A;  5JPA A;  1QRJ A;  2GOL B;  1EIA A;  4PH0 A;  2KGF A;  4QNB A;  4XRQ A;  4B4N A;  4J93 A;  3H4E A;  2WLV A;  4E91 A;  4XFZ A;  3P05 A;  4WYM A;  1M9C C;  4DGE C;  4DGA C;  2X2D D;  2Y4Z A;  5HGO A;  1E6J P;  2M8L A;  2EIA A;  4PH3 A;  2XGY A;  4HTW A;  5HGL A;  1G03 A;  2PWO A;  1L6N A;  1AFV A;  4U0B A;  3H47 A;  4PH2 A;  2WLV B;  5HGN A;  4U0A A;  4INB A;  2XDE A;  5HGK A;  1M9X C;  1M9F C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...