4INZA

The crystal structure of m145a mutant of an epoxide hydrolase from bacillus megaterium
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
286
structure length
286
Chain Sequence
SKQYINVNGVNLHYISKGQGELMLFLHGFPDFSHIWRHQIDEFSNDFHTVALDLRGYNLSEKPSGLESYEIDVLVEDIRQVIEGLGYSSCTLVVHDWGAGIGWTFAYRYPEYVQKLIAFNGPHPYTFMRELRTNKNQQKASEYAKWFQKQEVQDYMERDNFSGLRKLVIDPGVKKGYLTADDVQAYMNSWENGSVLSMLSYYRNLKIFTEEDLRRKSLFPLEEEVLNIPVQIIWGNQDPTFMPENLDGIEEYVPNISVHRLAEASHAPQHEKPQEVNNVMWNFLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering of an epoxide hydrolase for efficient bioresolution of bulky pharmaco substrates.
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Hydrolase
molecule keywords Soluble epoxide hydrolase
total genus 106
structure length 286
sequence length 286
chains with identical sequence B
ec nomenclature ec 3.2.2.10: Pyrimidine-5'-nucleotide nucleosidase.
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4inzA00
2VJDA 1CUEA 5ISMA 3CXUA 2X8BA 4Q1VA 1UK8A 3F96A 1THGA 5JANA 5AI9A 5DTJA 4AO6A 3G0CA 3C6BA 2OGTA 3HACA 1X2BA 3DLTA 4DSAA 2BGRA 3C43A 2QJWA 4C4YA 3QZUA 5KWJA 1QIHA 5K3CA 4H0CA 2XQIA 5EHNA 2WG2A 2C7BA 2D5LA 2HU7A 3FYUB 4QE3A 4B84A 2HHAA 1C7IA 4OD0A 3WMRA 5JAPA 1UT6A 4X97A 5BOVA 3LS2A 1TAHA 2C5FA 1P0MA 1XZEA 3C6XA 2GZRA 2JEZA 2XQJA 1CUUA 2B20A 4QNNA 4G8BA 1HPLA 5HFNA 3HABA 3G9XA 2XMQA 3F98A 2XMBA 4W63A 2HA4A 3H2KA 3QH4A 3BIXA 5EIEA 3O4HA 2XQGA 2PX6A 5BWCA 2QUAA 3W9UA 2QKYA 1ZD4A 5AKIA 1ZICA 5AKGA 3FOBA 4XVCA 1SCIA 3WWOA 3KXPA 3O95A 3OPMA 3IB3A 1QLWA 2H1IA 5F4ZA 4HAIA 5HK8A 4P08A 1LPAB 1UKCA 3H17A 3AUKA 3LIIA 4ZGBA 2VJCA 3V1LA 4X94A 5AP9A 4JEIA 2DFPA 1HBJA 4AN1A 2OCIA 3DJYA 1XZHA 4DMCA 2O7VA 4PQEA 1QIKA 3I2FA 3I28A 1X2EA 3ESDA 1VOTA 1DQZA 2LIPA 2WHRA 4K5QA 4RGYA 2PL5A 3D2AA 1ZI9A 2Q0XA 1XKTA 4P92A 5ALMA 2C58A 1N5RA 4DNFA 4HXFB 4HS9A 5H3HA 3ESBA 3KD2A 1F6WA 3R3YA 2UZ0A 2FJ0A 3K9BA 4IH1A 3MUOA 3JYHA 3EBLA 2R11A 1XZCA 4Q82A 1XZDA 5D3KA 1NU8A 5AI5A 1JMYA 1YCDA 2VAXA 5AK5A 1QE3A 4UBJA 3W9BA 3FYUA 4ARBA 1FFAA 2XMRA 3O4JA 5A6VA 2QZPA 1BROA 1X70A 3R0VA 2DQYA 4X91A 2PSJA 1ZIXA 5HFAA 1AUOA 5DNVA 1KEZA 2YASA 3CCBA 3GELA 1GZ7A 4X6XA 3AIOA 5CT6A 1QTIA 1S8OA 3R3VA 4KAAA 1Y37A 3I2KA 5ALZA 4NZZA 5K3AA 2BFNA 3PFBA 4C4XA 3FWHA 2WTNA 4K6KA 1QO7A 1P0QA 4L72A 5AICA 1GKLA 3KWFA 2PSFA 4Q05A 2VJAA 5SYNA 2Z5GA 5FLKA 2VA9A 4CG1A 3R40A 3BXPA 4WY5A 5LZ5A 2XUKA 5HQ3B 4X00A 4UPDA 1CEXA 2CUTA 3GA7A 2HFJA 5DLPA 1BU8A 4IH9A 4C6HA 4E15A 3HZOA 5KBYA 5CMLA 5ALRA 1XZIA 2I03A 3NOXA 4EY5A 3MVEA 5JADA 3S2ZA 3I6MA 2ES4A 2WM2A 1J07A 1ODSA 3HSSA 5CXUA 4DNOA 1CVLA 1J2EA 1MNQA 2VQ6A 5AHXA 4RPCA 5IVIA 5JAHA 1QFMA 2V98A 3RK4A 2XDWA 4GI1A 4GECA 4UHBA 5CBKA 1U2EA 3HI4A 2WIFA 4QEKA 5HZGA 2WUFA 2VSQA 2ZYHA 2CBGA 2O2GA 4ZV7A 5ALEA 4YX9A 2PPLA 1WM1A 2PSEA 1QIMA 1XQYA 4G5XA 5IVHA 4EY8A 3PI6A 4RE6A 2HA0A 1R9MA 3IUNA 3WKDA 1BEEA 4FDMA 1CUBA 4BP8A 3H2GA 2BCEA 1JJBA 4BAZA 4QZVA 4U2EA 4B85A 3A2NA 2QXTA 3WYDA 1H2WA 5ALDA 5ALKA 4BDSA 2CKMA 4A23A 5D7BA 3M83A 3ZLUA 4ZREA 4KRXA 5JALA 1HL7A 1VZ3A 3BF8A 2HIHA 4X90A 1W1IA 3HYSA 3AZPA 1C4XA 1FSSA 3A2LA 5YASA 1Q84A 4AO7A 2OCKA 1HLGA 2PUHA 1FFDA 1H2ZA 2V9ZA 1YR2A 1ZD2P 3I1IA 4UBMA 5LKRA 3FLEA 1U4NA 3ESCA 1VA5A 4U2BA 4BTLA 2BUCA 1XQVA 4JNCA 4Y2VA 3UUEA 5ALLA 4H7JA 3C6YA 2WKWA 2QUBA 4Y7DA 5I8PA 1WCYA 3DL7A 2I3ZA 3BL8A 4CG3A 1MPXA 2CB9A 1K8QA 5AH0A 3HJUA 1BN6A 4AZ0A 4JH0A 2OAGA 4FOLA 4GEGA 1PFQA 4K2AA 4QLAA 1SCQA 4OU4A 4F21A 1O6FA 2ZSHA 3LCRA 4PSCA 1HDEA 2HFKA 2VTVA 3NUZA 4W1QA 3GUUA 1EH5A 3IA2A 2R8BA 3B3QA 4J0IA 4UBNA 3E3AA 4BC0A 2WIGA 3WZLA 4B82A 2DHCA 2RHWA 2JGJA 3L1HA 1SC9A 3LIPA 2V96A 3V48A 1XZAA 1LGYA 3STWA 1UXOA 3GBSA 1GKKA 5ALSA 4OCZA 4CFSA 2DHEA 1TCCA 1VE7A 2PSHA 2WIDA 1E5TA 4C88A 4DMHA 3FLAA 2QXUA 2B9VA 4GBGA 2E3JA 4NS4A 5AOCA 3D5EA 3G9ZA 3WQHA 2P8SA 2YXPX 4BE9A 2XUJA 1DT5A 5LZ2A 4N8SA 2XB6A 4LXGA 4H18A 1OXMA 2I78A 3C87A 5AKLA 1XRPA 4K6HA 4LYEA 5DWDA 3SC2A 1W52X 5C81A 2PSDA 4J0KA 1EX9A 1Q83A 2G4LA 4A5SA 4DGQA 3K6KA 5J3JA 4BZZA 2JGFA 2QVBA 1RP1A 1CUDA 2OLEA 3WL5A 4KE7A 2HA3A 3CN9A 3BWXA 3WA6A 5KREA 4CG2A 2Z8XA 4L0CA 3WJ1A 1QZ3A 5T4BA 3H18A 3TGLA 1A8UA 2H7CA 2JGLA 3D59A 3ED1A 2BJHA 4H7KA 3C8HA 1MO2A 4KRYA 3WWDA 1JMKC 3FSGA 1UFOA 2RIPA 1E3QA 1N8SA 5FDFA 3WIOA 5LZ4A 2AJCA 4CCWA 2ACKA 4AZ3A 3RARA 2B4KA 2JIDA 1CUJA 2PBLA 1L7QA 1Z68A 1ISPA 3W06A 1IUOA 4DYHA 1WPRA 3B5EA 1MX5A 3HRHA 2Z8ZA 4U2DA 5HQ3A 3WI7A 1LPOA 2AJDA 4C4ZA 1K6EA 4IQ4A 3G02A 3O0DA 4QDUA 3G0BA 3I2GA 5E2IA 1FJ2A 3ILSA 3SWWA 4BCDA 3FCYA 2XUOA 4BCCA 4X3CA 1SOMA 4ETWA 1XRRA 1ACJA 3HXKA 2G5PA 2RHTA 1BEZA 4UFNA 3ANTA 4WFKA 3PFCA 3O4GA 4FFWA 1DX4A 5AKJA 3BF7A 2Z3ZA 5K3DA 1NX9A 4UHCA 4MQLA 3Q8WA 5JATA 5LZ8A 1F0NA 1IZ8A 3D0KA 1JU3A 4U2GA 1QIDA 2DQZA 2WILA 5EHXA 2VT6A 1K4YA 2Y2VA 3IUMA 2XI4A 5ALFA 4B0OA 2ZJ7A 4N8DA 4IO0A 4OB7A 3F8SA 4H7HA 4BRSA 5AM4A 3AZQA 4WDRA 5HKAA 3BDVA 4IH4A 4H35A 2JGEA 4KR0A 5DYYA 1J1IA 3EIOA 4EBBA 2IX9A 5JARA 1GPNA 3FBWA 4EA6A 2ECFA 5IH7A 4MYSA 3TRDA 2AJ8A 2XUAA 4J0JA 2QR5A 2DHDA 3GFFA 1MAAA 1ZJ5A 2GBGA 4C89A 4DM7A 4FLEA 2J3QA 3GZJA 3L1IA 4KAJA 2VF2A 4X95A 3WWEA 4G9GA 4BAUA 2JF0A 2XMGA 4ZI5A 3ANSA 1T2NA 1XFDA 3DOIA 5D6OA 4PO3X 3ICVA 5AKYA 4AQDA 2OQIA 4OUKX 3U1TA 4MYDA 1W76A 1LLFA 1UWCA 1MNAA 1QGED 3N0TA 3H2HA 4F60A 1DX6A 4WFJA 2VEOA 2J3DA 1SCKA 5CT8A 1UOOA 4AXBA 5LKAA 4KE9A 1K63A 3QPAA 4AMYA 5E4YA 1DWPA 4Y2JA 2JGKA 4YPVA 4N5HX 2ZYSA 1QO9A 4FFVA 2FUKA 2QJRA 1WHSA 3WYNA 4TGLA 4BVKA 4ZRDA 5HKBA 1H22A 4G4GA 3ZWQA 3G9UA 5LYYA 5HK9A 4I3FA 3C5WP 2BGNA 5CURA 3JW8A 1EHYA 2RGUA 1E8NA 4ITVA 1P0IA 5IKXA 5BV7A 3H04A 3I2IA 4DSZA 4PF1A 4OSEA 2GYVA 3M82A 4LIPD 2WFMA 5K3EA 1MTZA 3DNMA 4QDZA 3W05A 5K3FA 3T4UA 2WSLA 4UBIA 1CUXA 2O2IA 1EI9A 1ORWA 4W1SA 1XLVA 4B83A 5AK6A 2Y6UA 3R3XA 3OURA 3WKAA 1DTEA 1ORVA 4KE8A 5ALWA 2WHPB 3D4LA 2WUEA 1B6GA 4M0FA 1XZGA 1GPLA 2PM8A 2WFZA 3OG9A 3K2IA 1TCBA 3FLBA 2G63A 4DMFA 2HADA 5JZBA 3ICWA 4HVTA 1E89A 2PU5A 1HQDA 4JYPA 5CTAA 3PICA 3MGAA 2Z3WA 5D3ZA 1A88A 4B7ZA 3I2HA 3KSRA 3QM1A 3WWCA 3ZPXA 5LP1A 3C70A 3R3UA 4W1RA 3EQ9A 4TVKA 5FUMA 2C0QA 1WB6A 3T52A 5C7YA 4H7FA 4Q3KA 5C8VA 2EDAA 4N5IX 4J7AA 1QOZA 4FMPA 4Y9SA 5CH3A 1AMNA 5K3FB 2JGMA 1DWQA 1XZKA 1QIGA 4KE6A 2OQVA 5AI0A 5I7UA 5JD4A 4KYVA 2XLBA 2OG1A 4QDOA 2XQKA 4Y2YA 1YAJA 1N5MA 4MQMA 1XRNA 2AXEA 4J0GA 1EDDA 2OCGA 3MUNA 4ARAA 1EA5A 4X85A 3RKSA 1ODTC 2XUDA 1ZD5A 3YASA 3ESAA 1XZJA 4YASA 1YS2X 1XRLA 4BVLA 2JGIA 3JWEA 4LXHA 1Q0RA 4IHAA 1IUPA 3B12A 4GDMA 1A8SA 5AM2A 1JJFA 4UFOA 1BRTA 1VA4A 4OU5A 1PV1A 4BE4A 4XJVA 5IVKA 1UZAA 1OCEA 1CLEA 4G9EA 2RI6A 2XUPA 3BDIA 4W9RA 2WFLB 2IITA 4UHFA 3TEJA 5A7FA 3V1MA 1WOMA 1YS1X 4UBKA 3WK9A 2HU8A 5FV4A 3EF3A 1B41A 3BJMA 2X76A 1N1MA 1I6WA 1C7JA 3PUHA 2WFLA 3DKKA 2XUGA 3KDAA 5CT4A 5AO9A 3H2JA 1T4MA 4C87A 3G0IA 1EVQA 3QITA 1J06A 5DJ5A 3AJAA 1BS9A 5LZ9A 4UHDA 2OGZA 4L9AA 5DYTA 5DNWA 1XQWA 3HEAA 2BUAA 1TRHA 2D0DA 3KWJA 1BE0A 3H2IA 3OC0A 5A7HA 1CIJA 1LBTA 4FTWA 5ALUA 2DR0A 4N8EA 1F8UA 2PKYX 5JD6A 4B9EA 4WDQA 4BDTA 1M33A 3WA7A 1LPPA 3S8YA 4OPMA 2XUIA 4WY8A 5T4FA 3NWOA 3STYA 3AFIA 5AK3A 4QA9A 3AIKA 3FVRA 1ZJ4A 1G66A 3FAKA 1NU6A 2PU7A 4BCBA 4LKOA 3QBJA 4DNPA 2WQZA 3DDUA 1LPBB 4U2FA 1DWOA 4FNGA 5JYCA 3DQZA 4GWLA 2XUHA 4ZV9A 3I6ZA 2W22A 2WUGA 1EB9A 3LP5A 1RYYA 2ORYA 2RONA 1BCSA 4Y2XA 2QT9A 5AM1A 1CUAA 5KWIA 5HF9A 4Y2RA 3O4IA 5JAOA 3U0VA 3F9CA 4XWGA 4MJ3A 3WK5A 2J4FA 1G5FA 2HM7A 4B80A 3WK7A 4CCYA 3VJMA 2FX5A 4WJLA 5FP0A 4H7EA 2OPHA 3X3HA 4X6UA 4E46A 4RE5A 3TJMA 5DYWA 3D7RA 3A2MA 1XQXA 4B6GA 1D07A 1KU0A 1LPSA 1XRMA 1ACLA 2WU4A 3WLAA 4Y2TA 4LHEA 2ONCA 3F97A 5A2GA 1CUSA 3QYJA 1ZI6A 5EFZA 2XMZA 4FHZA 1MX9A 2GBIA 3UMJA 3H1AA 4FWBA 5ALVA 2ZSIA 2HU5A 2VAVA 2HRRA 3STVA 4I4CA 3P2MA 3QVMA 5LIPA 4FBLA 3WK4A 1TIBA 3R3ZA 1CV2A 4PNZA 3FSGD 5DNUA 4Z49A 1EVEA 1QJ4A 2GYUA 4X71A 1JKMA 1CUCA 5ALYA 3LLCA 3VVLA 1VE6A 4OYLA 1VJ5A 1LPMA 3HLKA 3FCXA 2WIKA 1ZD3A 4J03A 4MEAA 3DOHA 1XZLA 1YA8A 2X5XA 4LYDA 3V1NA 1CUYA 1A7UA 2HA7A 4UHHA 5ALOA 4DLNA 5FKJA 1JFRA 4BRZA 3FYUC 1QIJA 3WK8A 5FRDA 5AM3A 2YYSA 3BE8A 2WTMA 1EDEA 2WG0A 1EB8A 2K2QB 4KJXA 4HTAA 4FKBA 3R41A 1CUGA 1R50A 5T4EA 1YASA 2O2HA 3VJLA 1UK9A 1GPKA 4YK7A 4XIIA 3VDXA 2GYWA 1YA4A 3IIIA 1OILA 4BVJA 3VKFA 1CUHA 5EIAA 4MWSA 5DTIA 1IUNA 4HXEB 5CW2A 1AKNA 1GGVA 3OTQA 4FNMA 1LZLA 3V1KA 3ZI7A 5EI5A 3VVMA 4ROTA 5C8XA 2AJBA 2RAUA 4X7BA 1EK2A 1QONA 1MT3A 5K3BA 2ZJ6A 3G0DA 2BKLA 1IZ7A 1XKLA 4PSDA 3H0CA 4MEBA 1JI3A 5JIBA 4BYMA 4BAGA 5CT9A 3HC7A 4EB0A 2HA5A 1SFRA 2C0PA 5ALXA 4K6GA 1R9NA 4QWMA 3W04A 1VXOA 3IULA 3Q0TA 1EXWA 4J0CA 2CZQA 2XLCA 4G4JA 4HZGA 3WL7A 1QIIA 3DCNA 1XRQA 4W1PA 2J4CA 1F0PA 3STXA 1CUIA 2DSNA 1AX9A 4PW0A 3QMVA 1A8QA 4H77A 4O08A 4TPKA 1THTA 2AJLI 5JASA 4G4IA 5HF5A 3WIBA 3NGMA 4DTCA 2O7RA 4X6YA 1XZMA 4BATA 4CIAA 5CH8A 1H2YA 3C45A 2GBFA 2ZVDA 1FFCA 5HF8A 2VATA 3WL6A 4MWTA 2C4HA 4AB1A 3D3NA 1FFBA 4KEAA 3I2JA 4ZWNA 4OB6A 2XT0A 5ALPA 3M81A 5A62A 3WKEA 1O6GA 4UHEA 2V97A 4JUIA 2XUQA 2XMDA 1R4ZA 1U8EA 4NVRA 1WB4A 5A7GA 5CRIA 4C01A 4GXNA 2WU3A 2WJ3A 4HRYA 4DMKA 5JZ9A 3E4DA 4BB0A 4S0XA 5AKKA 1JJIA 3ZLVA 4BC1A 3DYIA 1TCAA 5BWBA 3C6ZA 4A16A 3H1BA 1CFJA 2Y2UA 4P93A 1QFSA 3AZOA 3CN7A 1HKHA 4ZXFA 3QMMA 2IIVA 3OM8A 4EUSA 5AM0A 4B81A 4UUQA 3G0GA 1IVYA 5AIBA 1ETHA 5ALIA 1UK7A 4E14A 3BJRA 1GXSA 2OCLA 1MJ5A 2H7YA 1R88A 3IBTA 3OOSA 1UK6A 2DCMA 2PVSA 1ODCA 2QMQA 3E0XA 1IMJA 3ZLTA 4Y2SA 3FYTA 5AJHA 4BP9A 4CIBA 4QDXA 3ZV7A 1G4HA 5E4JA 1CUFA 1VXRA 4I19A 3EQ7A 1LNSA 1MX1A 3DS8A 3WKCA 3R3WA 1QTRA 2WG1A 3H19A 2XE4A 1ZGBA 2W6CX 4XX1A 5E4TA 3RLIA 3DYVA 4G8CA 4EHBA 4EY4A 1XZFA 4E11A 3A70A 1LBSA 2CJPA 4QWWA 3PUIA 3IUQA 1LPNA 5EGNA 5EHQA 3CCCA 1DINA 1BN7A 4GHWA 3I6YA 1LZKA 1CUZA 4HXGA 3L1JA 3UUFA 2CMFA 4INZA 6YASA 4X92A 1BCRA 3N2ZB 1YB6A 4OYYA 2QM0A 1E66A 2HA2A 5EHZA 1XLWA 1MU0A 1TKRA 3D2CA 4QLOA 5ALQA 1VZ2A 1ZOIA 1L7RA 4CCYB 4L3WA 5CH5A 1Y7IA 3PE6A 1Y7HA 3QPCA 1YB7A 1W4LA 3WJ2A 5FPQA 4NMWA 3FNBA 1R1DA 1ZI8A 5AKEA 1EK1A 5ESRA 2JBWA 4HRXA 4Q3LA 5AI8A 4MXDA 4OB8A 2ZYRA 5SYMA 5LZ7A 5AI6A 2OGSA 2G5TA 1CR6A 4J3JA 3PF8A 4G1FA 4EZIA 2WLSA 2C5GA 1E8MA 1WPXA 3AINA 3AILA 2VJBA 4AO8A 3KOOA 4BZWA 4RNCA 4AX4A 2PUJA 4Y2QA 3FVTA 3RM3A 3STUA 3DL4A 1EINA 4JYMA 4UBOA 2HA6A 2HRQA 5K5EA 1VLQA 2ZJFA 4J0DA 1AC5A 2HL6A 3IUJA 4V2IA 4PSUA 3G7NA 4J0HA 2XQFA 3I1YA 4LXIA 3PDCA 2WJ4A 1XZBA 3AIMA 2GBCA 3G9TA 2YH2A 2ACEA 4WCVA 5CXXA 1AURA 1P0PA 4Y2UA 4PV7A 4AN0A 1Q0ZA 5AKXA 3VISA 3IVMA 4D9JA 3WWPA 4KACA 1QIEA 2ROQA 2GZSA 2OXEA 1GT6A 3IDAA 1W75A 1KU6A 1JU4A 3O9VA 2WUDA 1H2XA 5HF6A 4Q34A 5EIHA 1AZWA 5HCUA 1TK3A 3W2TA 2B61A 3QPDA 4B0PA 3QMWA 4F5ZA 4H7IA 3PF9A 5AKZA 5AIAA 2VT7A 1CPYA 3V9AA 1EDBA 1CUWA 2XUFA 5IVDA 2HDWA 1TQHA 5T4HA 2Y1KA 4GLBA 1E8DA 3DD5A 2I3DA 5C8ZA 1ZIYA 5AI4A 3WL8A 5FOQA 4X93A 4B9AA 3SX4A 4UFPA 2Y6VA 4Q3OA 5I9IA 2OAEA 3G8YA 5ALNA 2QS9A 2XMSA 3VXKA 3DKRA 5AKHA 1PJAA 3M3DA 1K5PA 1L7AA 2EEPA 1W6RA 2BUBA 4KAFA 2QRUA 4BBZA 2NW6A 1JT2A 5JAUA 1YSCA 5ALHA 1GQRA 3C8DA 4WFIA 3IURA 5JZSA 1VKHA 2QOEA 3DEAA 1CUVA 1RWQA 5ALGA 2WHQA 5AOBA 1H23A 2H7XA 4FLMA 2WHPA 4H7DA 4EY6A 1FFEA 3O9MA 1CRLA 1CQZA 1MAHA 2JEYA 4EY7A 2EDCA 4Y2PA 1CQWA 3C5VA 1DT3A 1MN6A 1QIFA 4FBMA 4QDTA 4GW3A 1UOPA 5JD5A 5AM5A 1WHTA 4U2CA 5ALJA 3SK0A 2XMCA 3D2BA 4G8DA 1YAHA 5LLSA 1UKBA 3WK6A 3GROA 1XLUA 3EQ8A 5FPPA 2WJ6A 1USWA 4DNQA 2ZYIA 1XROA 2FJPA 3E1GA 4M0MA 5AK4A 4DIUA 3WZMA 7YASA 3STTA 2BAGA 4UBLA 3A6ZA 3F67A 4P9NA 4F0JA 5CT5A 1UOQA 1GQSA 1DU4A 2H9YA 5A71A 3VJKA 5AOAA 1R3DA 1AQLA 2CEKA 1U65A 4FLFA 1UKAA 5ALTA 1ZGCA 1AGYA 4BTVA 2WIJA 1G42A 4AMZA 1DQYA 5FXMA 1WB5A 3BIWA 3WKBA 4CI9A 4M0EA 2QTBA
chains in the Genus database with same CATH superfamily
1V43A 1GAQA 1ZJZA 2C9YA 2O0JA 1OXXK 4KSYA 1AN0A 1Q3TA 2CVPA 4FX2A 4HFJA 3SXUA 4DJJA 2X8BA 1NYTA 1UK8A 3DL2A 2PIDA 2QD2A 1THGA 1PQYA 3KTAA 4F06A 3DBIA 4O4JA 4HUTA 3KSBC 1OX5A 2RHGB 2JHAA 3HDGA 3OIYA 1JSXA 1XWFA 2H52A 1K5DA 1KZYC 2WINI 2LVBA 3KAKA 3MJDA 3WRXA 2WF6A 3PXAA 3CZAA 4CCAA 2CUZA 3HACA 2V55B 3QTTA 4MP3A 4TTQA 4DSAA 3NHSA 4LNUA 2XBUA 2QJWA 5A9SB 3EXEA 3A4TA 1I2AA 4C4YA 4AC9A 2DWQA 1CVRA 1VBMA 4MINA 2OP1A 1EWYA 2XBLA 3QU9A 5AUQA 3W5VA 4ENVA 3G7SA 1JEQB 3EHEA 4GI5A 4UNIA 1XMIA 1P2UA 3QV1A 4CF6A 5U4QA 1L1EA 2A7QA 1XU9A 2C7BA 3NOVA 4I46A 1EBUA 1T13A 4U6NA 3SYNA 1YMQA 3NP9A 3PGXA 3IP7A 3FGPA 1C7IA 4EARA 2OSVA 5JAPA 3DBLA 3QNMA 4OFBA 5DDIP 1UT6A 3R8CA 3T7RA 5HR5A 1Q0HA 4X97A 2RGWA 5J4HA 4L4RA 4NFHA 3OZBA 4RF2A 1PK9A 4NONA 2R8XA 2R86A 4RIEA 1FJGB 1XZEA 3HXPA 3KQQA 2VDWA 2ERXA 4MGEA 1JG1A 2RC6A 3H9CA 4P53A 5G02A 4BN4A 5LMCA 1QV9A 3CGGA 5BQ5A 2GOYA 3C39A 3LYHA 3EXHC 4KWEA 5LBUA 3TKAA 3ZHBA 1PEKE 3NWEA 3ABZA 3G9XA 2Q3LA 2D59A 2DSTA 2RGNC 3L7IA 2NU8B 1HQYE 4JBHA 1QE5A 4H3KB 4CLDA 2VRNA 3F98A 3I9JA 5TGZA 1W6UA 3EGDB 4RHTA 4RPJA 5E1MA 3UUWA 3WRWA 2CNNA 2O8BB 2NSDA 3SZ3A 2OZVA 3TL6A 4L8LA 2D5BA 3H2KA 4NL4H 3IAHA 1B6SA 2VCYA 4L7QA 1D6SA 4Q1CA 4X84A 3A6JA 1AZSC 3MWYW 3ETLA 4LK2A 4YAEA 4WBSA 5I9MA 1XDGA 4L7VA 3BZUA 5T41A 4KRFA 1EMDA 1WZCA 1T91A 2A0XA 1Y89A 2YCLA 1SA0A 3DWFA 4QXRA 5AJUA 1NF8A 2F8LA 3BWCA 4GUAA 2XCRB 1PGPA 3GJTA 2EFCB 3AKCA 2X1VA 1NFQA 3FOBA 4FK8A 1QK4A 4DPLA 1SCIA 2H06A 2D74A 4FI3C 3SHOA 3ZD8A 3D5TA 2CNBA 2R9VA 2YS6A 3DFUA 3L7CA 3OIGA 4UQOA 3U49A 4ETMA 3O95A 3TBFA 4MUXA 4MLPA 1JJAA 2H1IA 3T4PA 4DG8A 1YZUA 4PG5A 1V41E 5A6SB 3O91A 1R64A 5HK8A 1E1QD 1QTNA 4P08A 4RZUA 3R0IA 5I6DA 3ZS9A 1VHQA 4P4UA 1SQ5A 1QO0D 4DR1B 1NQUA 3T1YB 2WYVA 4YP7A 2IYTA 1LPAB 1T3HA 3RYTC 2JDID 5H7XA 4TVOA 3H17A 1Z25A 2IGTA 2JCBA 2X0RA 4ND2A 1SVOA 2GWRA 2IYUA 3BULA 3SPXA 3GL9A 1N3BA 4URYR 5JO9A 1YMVA 2X9GA 2AR7A 2Y1FA 2DFPA 4LTMA 4AY3A 4JKOA 4K26A 4D80A 1GCGA 1S1CA 4QTTB 3AJDA 4MWCA 2QZZA 1NAIA 4IO1A 4G0UA 3O3OB 2OV2A 3TH5A 4OXQA 2GCEA 5ECYA 1ZSYA 1CHNA 1JDSA 1XZHA 4C2AA 2IEBA 1ES9A 3H65A 4OHMA 4PYRA 3RBXA 4DMCA 3FGNA 5JECA 2HK8A 4JLKA 1DX9A 1NUHA 5AVYA 3I2FA 4BUCA 1XE3A 2BMWA 4YYEA 1C9EA 4C4OA 4OSPA 1U4OA 2QMOA 3ESDA 1KI9A 5DLQC 5CFRA 3V9PA 2YZMA 4QU8A 4BGEA 1VM6A 3OOJA 4X61A 1SVWA 4Y3UA 5H9VA 3GLFB 4BQRA 2GHRA 1Z4NA 3QVGA 4HEA6 1KYVA 2G0AA 4MGIR 1A4XA 3GUHA 1I32A 1F9AA 3D8BA 5DCYA 5I4IA 3OQOA 5D5PA 4ZTUB 3K0CA 4DNFA 4IW3B 1H0KA 1E6KA 1RXEA 3A6LA 3LVRE 4HXFB 5JHGB 1AQUA 4UDXX 3A2KA 2V6IA 2P79A 2I66A 3PYXA 4OQYA 4E5DA 1ML4A 3NIFB 3BHIA 1YVDA 4LAFA 4US2R 3EIWA 3R3YA 1RXWA 3DZIA 5DBEX 3ENVA 4MTLA 2CGEA 3AXSA 3DHYA 2AXQA 3LY8A 4IH1A 4D97A 3AR8A 3ZBQA 3NT5A 4XZ3A 3K30A 1XZCA 5K0BA 3LLMA 4ZVUA 4GP7A 1J9EA 5LQAA 2C1EA 2Q0SA 2Y0EA 1SBQA 3ONWA 5LSAA 2R7LA 1YCDA 3OPYI 2VAXA 5TS3A 1K86A 3BFXA 4RIFA 4B7AA 5GVSA 2AUMA 1FZTA 2HRDA 3HDVA 1M5TA 3K5WA 1VHJA 4LRQA 4B40A 3G8DA 4MYHA 4EF5A 3LDUA 3VNRA 4UBJA 1U0JA 3I83A 3WIUA 4D3DA 5H02A 2MYNA 5TVGA 1KO4A 1X19A 3X2SA 1T4CA 3KXKA 2FTKE 3ZTYA 5JY1A 2WAOA 4JP2A 4MUHA 5L7YA 3KB6A 3H83A 4OKNA 4H08A 4KX5A 2IVFA 4ZYTA 4U6QA 2QNIA 2XPCA 5TEVA 3RHZA 2O20A 5M04A 3TG2A 4URHA 3EK2A 2ZSFA 3PTLA 1EGQA 4D8XA 2XHZA 4G56A 4GLLA 2HOQA 1KEZA 1II8A 4UAGA 1OVMA 3AT1A 3U4AA 4D43A 4DY4A 4UTVA 3SR3A 3KSAC 4X6XA 2NXWA 4LFBB 3UAVA 1KY2A 1S8OA 2DRIA 2ZCVA 3CB4A 4GKBA 2OOSA 4LXQA 5NLLA 4EGJA 5ALZA 2XHEA 4EJSA 5A4MS 4L28A 2NP6A 4QSMA 4DPKA 3ZZ1A 3UH1A 2Z58A 2E48A 2HJRA 3WLMA 3ZY5A 1GIAA 1S2NA 3GEDA 4LXYA 4RANA 4F1WA 5B4UA 5TMDA 3AEYA 2BFNA 3GH1A 5IT0A 2WUWE 3MG9A 3PFBA 4C4XA 3BSWA 1YBVA 3G2JA 4K6KA 2NPIA 5G41A 1J25A 2A9PA 3NOQA 4ZO9A 3WYFA 2GERA 1P0QA 3MUEA 3BD8A 4GNKA 4NENA 4OP2A 1NVMB 3S2SA 3SF8A 1ZGJA 1MH1A 1NVVQ 4II2A 1GKLA 3C3EA 5AVVA 1QHSA 2FPMA 3BB4A 5SYNA 1DFHA 4N3NA 1KMHA 4ZOEA 1JQ5A 1U5AA 3ELDA 1RYHA 4CG1A 2C3UA 3G82C 4TM7A 3W5DA 4LJYA 4WY5A 3CWCA 4MWBA 5IWAB 5TRTA 1VKJA 2PLWA 4MGZR 4XASA 4X00A 2IZ7A 2WAAA 3U4MA 3U7QA 3GA7A 1XO1A 2PR7A 5F2NA 5DTMA 3T1OA 1YTLA 2GF0A 4C6HA 1VSBA 2BE7A 2YVKA 3E48A 3IEXA 3N7TA 4KQ9A 4Y1EA 5ALRA 3WIEA 2I03A 2FK7A 1C1HA 3TLXA 1U8ZA 3FZEA 3HYTA 1MX3A 3V97A 1HQCA 1DTWA 1LUAA 2UZ1B 1JQLB 4R1MA 1C0KA 2G0NA 2OWDA 3UNXA 4DLBA 1P45A 5LA6F 2R87A 2Y1CA 4RJLA 2VZLA 4I5IA 1J07A 4XYGA 3HSSA 5I9TA 3A10A 3IR6A 1J2EA 4MB6A 2OO7A 4EVQA 4X3PA 3UMGA 1XYGA 3V8PA 5DNYB 4M1QA 2IDJA 5JMTA 3CO0S 1JPVA 4ZP1A 1X92A 2O4UX 1QFMA 1B7GO 2V98A 1Q0LA 1T2CA 3JAKB 4BMVA 5I3CA 1BHO1 1UFRA 2W2LD 5JWHA 2A94A 2XDWA 4XARA 1WF6A 3TIGA 1H4VB 1FDSA 2WJWA 4EVSA 1IN7A 2XSZA 4JJ8A 2EERA 2KLBA 1HNXB 1CDEA 2C83A 4HB0A 4HDCA 3ANMA 3N5KA 4LE1A 3X1MA 1M72A 5KYXA 2WPNA 4EHFA 3GT7A 2NUTA 1VCNA 4OKIA 1Y5RA 4LSMA 4D0RA 3JTMA 2VSQA 3EGXB 4FMBB 2XOXA 1R0LA 1YR9A 4MKXA 2OHGA 3TI7A 3TQSA 2QMZA 4WGGA 1UWLA 3KR0A 2JIQA 3LUGA 1E9SA 4Q7LA 4ZV7A 3RSOA 1ECBA 1WA5A 3CX8A 2QG6A 1PJ4A 1RAFA 2FSIA 1POXA 3KQMA 4OLHA 3IJ5A 4G5XA 1E9CA 4YMVA 4WK2B 2G04A 1J0CA 3N76A 1AV6A 4EY8A 2A78A 2YXNA 3TQHA 4ALLA 4BZQA 5LQRA 3NV9A 1RHUA 3T0FA 1W25A 1R9MA 4M9ZA 1X1TA 3O83A 3GRUA 5K6RA 4GU5A 2I4OA 3QJ5A 1FLAA 4OI4A 4RTJA 5LQNA 4S2UA 1L4MA 3FYHA 1W35A 1GU0A 3RNLA 3V8EA 2Q9CA 2JFVA 1CY7A 1L2TA 4BAZA 3O38A 3M9WA 4GMHA 3REGA 4TKUA 5L4NA 2RGCA 3JQ9C 4K6FA 2AMYA 1NXXA 3W8RA 1H2WA 5KCZA 3AO0B 4RA9B 4BDSA 2A30A 3IMKA 2NU7B 3M83A 4KGZA 2JW5A 4NS1A 3TTWA 4HJXA 3AR5A 3SBEA 2DCUA 1I8TA 3EISA 4N5NA 4DHWA 3UT5A 5CXQA 4RWEA 1MGPA 4WXEA 2GCGA 3TW0A 3UAYA 3LDFA 2RAFA 1S8NA 2B2XA 2PUGA 2OWEA 1R5BA 1C4OA 3AZPA 1EUDB 2YVUA 1C4XA 4YAGA 5EVCA 2CV1A 1CR4A 4AY4A 1W4RA 4AO7A 2VWHA 1JDBC 3A1TA 5ILQA 2NSYA 4OY3A 3HVRA 3STHA 1YC5A 5TSDA 1D0SA 3LCJA 4AKIA 3DO6A 4TL6A 1OLSB 4X41A 1KS2A 4DLZA 1JSRA 1OXBB 1YR2A 2D3WA 2G8NA 3GFOA 4B71A 2XX3A 3HVJA 2HTEA 4MR7A 4MUKA 4LJ8A 3SE7A 5CB4A 4J9VA 3PQ4A 3N8IA 2PRZA 4NLLA 4EFLA 4TZ6A 4EVIA 4OHXA 3FGZA 1CY2A 4UBMA 5LKRA 4AL4A 2ZTMA 3U5ZB 3FLEA 2NTVA 2H4XA 1EYZA 2PGAA 3CKMA 3PIIA 5TPWA 4BZXA 3CRVA 2JLCA 4GAEA 3ZCVA 4JLAA 2VP2A 1LQUA 1SKAA 3LXMA 4G0MA 4NBVA 4WY2A 4BTLA 4EPYA 3OCJA 2CVOA 3IAUA 5K8VA 1ZMTA 4R3NA 2Z98A 3ZUPA 3HY6A 1QE0A 4GX0A 2AFIA 1TCVA 1R0XA 3N7AA 2AC4A 5KSPA 2WYIA 1H1LA 3UUEA 5ALLA 1RE0A 5CFMA 1DLIA 1N92A 3C6YA 3KPUA 2XA2A 1SY7A 1P61B 1E1RA 4JVOA 1FXWF 4KYUA 2XTMA 1HZZC 1JTEA 3MA0A 4GPEA 4RU1A 4IDNA 1O3YA 1SZCA 5CK4A 4RHYA 4GL2A 3I73A 2B0CA 2PAAA 2IHZA 2I3ZA 3FMFA 5JXGA 1N3LA 5IJ9A 1E6LA 1K89A 1GUYA 1BKDR 2FQXA 3W5BA 3SMVA 5M3BA 5TVKA 5BSVA 3HGQA 2FOLA 3MQFA 1ZUWA 4EX7A 1TGVA 3KHUA 4FMCF 4M53A 2HHHB 2BGWA 1EM8B 4BFTA 1BN6A 2CSXA 1B23P 2PA0A 5BUZA 3G23A 3DL0A 3I9V1 2YJNA 2ZB7A 1PP4A 2H08A 3TIIA 3DMTA 4BO6A 4KI0A 4E32A 4XSHA 3T7TA 4LDNA 1H85A 3CJRA 1T5DX 5JSYA 5LP6C 4QBKA 4C9BA 3QSYA 2Z0MA 1D6NA 3CLSD 2HJSA 3HP7A 5B3JA 2JAQA 4HEQA 5LB4A 3FJYA 1P60A 2PL1A 4K2AA 1MRNA 4M1OA 4ERXA 2QRVB 1QK3A 4L07A 3QUSA 2DUNA 3CPSA 5BR7A 2POQX 2P2ZA 3BCHA 1O6FA 3BMNA 3D64A 3DEFA 3P9KA 4JA0A 2PRKA 1XNGA 4Y9TA 2R1TB 4FOPA 1K3UB 1SIBE 1ZQ9A 3H8JA 3FTFA 3ABIA 5IC4A 1TEXA 3TR6A 4I5GA 4J0IA 4M1YA 3OWHA 3ZI0A 1Z5ZA 1QVVA 2IZ5A 4UBNA 3W5UA 1G8GA 2V7GA 1R5OA 5FR1A 5BOSB 1ZM2A 4B82A 2C8JA 3PFFA 2DHCA 4QYWA 3MN1A 4TUYF 2JGJA 3ITNA 1DHTA 4X7MA 5IDVA 5CDTA 1VIYA 3ENWA 1ZL2A 1APBA 3AUFA 3NZEA 2WJGA 1SC9A 5FQOA 1E9AA 2CXUA 3RANA 4BRWA 4BO7A 5LL6P 2V96A 5JJLA 3F3MA 3P52A 3RSSA 3OLYA 4TRMA 4E07A 2D06A 1O94A 1BH2A 1UXOA 3KPYA 3GBSA 4FR5A 1QH8B 3THXA 5ANRB 4CFSA 4XAQA 5CB6A 2DHEA 2WDZA 4PCVA 4JJEA 1NVVR 1NOIA 2C8LA 2IPXA 1W9MA 4QBGB 3RRNA 4BBAA 2R6DA 4B7XA 4DMHA 5FO0A 4B4VA 4GBGA 1U7PA 1NP3A 2X4LA 1MORA 3ZE8A 5E9QA 3HBNA 1IU9A 3VR2D 4RKWA 3DULA 3ND9A 5JWOA 3BGDA 5KYXB 1GD1O 2YXPX 3IBGA 3H8SA 4BE9A 1PZHA 1P0CA 2QN6A 3ZJTA 3OTGA 5F64A 1XP5A 2SKCA 2Q5OA 3GLIE 4MCAA 4EG3A 3H5WA 4P5PA 4YBRA 1DT5A 5A5GA 1WL8A 3D3KA 4BX2A 1A97A 1A5BB 1FL9A 1XEXA 2JH9A 3LNTA 4PR3A 3JQAA 2LPMA 2ETVA 3SX0A 9ABPA 1NVTA 1JSZA 1R12A 1U1CA 3I3OA 4LXGA 2YKGA 4U5XA 1K6IA 2I78A 3FTNA 2J5KA 3VPDA 1P2TA 2J0VA 3EMDA 1X3SA 4C7OB 1CLUA 5BV0A 3SC2A 1W52X 5FAXA 3N2YA 1YZHA 1OOEA 3QE4A 4O0LA 4HQLA 1X8LA 4HLUC 1Y5LA 1FQKA 1Z6ZA 1BWQA 1NKTA 1RAAA 1WB9A 1KVRA 5K0CA 3O82A 3HL0A 4PLVA 4S04A 1QTQA 1KYIA 1JQAA 3NBKA 3NPMA 4QDJA 1QPZA 1Q83A 2PIAA 2H4JA 3SI7A 2DP4E 2G4LA 1S96A 3ABOB 4M0DA 4A5SA 3D8RA 3VSCA 2F1IA 3PI7A 1E1MA 3G59A 2XYVA 3NC0C 4KZKA 3GCGA 4QHYA 5F12A 1LWNA 2GA8A 1A8HA 1J0DA 3WL5A 3GZ4A 4KE7A 2DFKB 3ZE0B 3P97A 4FZVA 4XKJA 1RKQA 3SZMA 3FHLA 3IQDB 3CV3A 1NR5A 1JNYA 2O0LA 2XZTA 3GVXA 4KUGA 4L02A 4EHAA 4CG2A 4IJUA 1V5EA 3CX6A 2Z8XA 3ASUA 4HNGA 3RG2A 3JVEA 4C7VA 4D9NA 1JBQA 3AFHA 2BBTA 1B0UA 3EA4A 1HFWA 1RCUA 2B8NA 4KFCA 2FP4B 4C30A 5T57A 2JGLA 3CRW1 1QP7A 1HV8A 4FYKA 3E7PA 2QLFA 3OEWA 2QLBA 3D59A 3MJTA 2P9CA 4MCIA 5CW1A 3VC3A 2CFCA 1GGNA 2A59A 2BJHA 2V6BA 2PH3A 2XTZA 2XECA 3ROFA 3FZQA 3T7IA 4ZJPA 1QRUA 3L6BA 4XB2A 2H54A 5CYFA 3FTQA 3OAAD 5J2TF 3KUDA 1Q95A 4E2XA 1KPHA 1PFUA 1LI5A 4V1CB 4AKTA 3O4FA 2GSWA 2TECE 3ZHZA 4A0SA 2C77A 1WY7A 3M6WA 2GVNA 1QBKC 4NK5A 4YJ3F 1DRJA 1UFOA 2RIPA 3WGGA 5JI3E 1P39A 1F48A 1XPJA 4OV6B 1N8SA 3VPCA 4KR7A 5IJXA 1E3TA 3D43A 3EXFA 4Q3AA 5DULA 1OLXB 1S3GA 3C7DB 4PC6A 4IMIB 4JGIA 3GJRA 5LZ4A 4IIHA 4I1RA 4HZUB 3GI1A 3GP8A 3OVMA 1PT7A 4WZ6A 5CM2Z 4B6OA 3SXUB 2GJKA 3EVTA 4G01B 1Y6GA 4AZ3A 3RARA 2P7IA 2FMHA 1U1IA 4EW6A 4EELA 4H3SA 4D74A 4D9MA 5EC8A 3D81A 1PJZA 1VL0A 1X38A 1A72A 1LS6A 3R24A 3A6EA 3HGTA 1TADA 1YK0A 4I14A 1TAUA 2OXRA 2W6JD 3R3SA 4JC5A 3K6SB 4F9FA 5EIXA 1PDOA 4X8LA 4J16C 1E96A 1H69A 3N28A 3U3XA 1UM8A 3BDAA 1CJTC 3H9UA 3OESA 4DYHA 1D1QA 1Z0FA 2WMDA 1LFAA 2ZQ5A 4PXAA 1L7XA 3B5EA 4GYWA 1EXNA 3I8XA 3FZGA 3I9V6 4TN5A 3PDUA 4YROA 4AJJA 4JU8A 1SBNE 4OQLA 4A27A 4JR2A 4U2DA 5CG2A 3Q2OA 1Y9EA 2QN3A 4O4IF 1D2NA 2XA9A 4ZKDA 1V7ZA 5BWLA 5B6PA 1A2QA 3OHPA 5DHRA 4D9KA 3COSA 7GPBA 5A4KA 4RO0A 4A92A 4CI9A 1KY3A 3M3HA 1SXGA 2IYQA 5KO2A 3OOYA 3HR4A 2GFHA 1VI5A 2FFRA 2X0IA 3CFYA 4QEZA 1FF9A 1MVNA 3G0BA 5CVTA 1A9ZA 1UINA 2JNWA 1FJ2A 2OLKA 3ILSA 3AI2A 3O03A 1FTQA 2HRCA 2DUWA 5C8YB 4LYJA 3FCYA 2XUOA 4RSGA 1Y80A 1F9EA 3UK6A 3NGXA 1L6IA 3VU9A 1WCV1 1P8AA 1XRRA 4C21A 1ACJA 1SBIA 2QP9X 1C1DB 4RNDB 2X5JO 4FOTA 4C29A 5CBPA 3ZDAA 4V3BA 3CO5A 5H80A 4BNHA 4BE7B 5G0WA 5BWMA 2QMHA 2IUUA 3PUXA 1KOFA 3KOWA 1T5OA 3OUZA 2ZW9A 4WFKA 2E4YA 3A9RA 1Y48E 3UPDA 4XWOA 2RHHA 3HJRA 1E2KA 2FZLA 2QTWB 1EM6A 2I4MA 3OFSA 5FEUA 1Z28A 1PG5A 4YP6A 1J09A 1HORA 4Y0VA 3TEFA 2JI9A 3BH0A 5AJZA 3TCXB 1I10A 2QPAA 2ZUUA 4W5RA 3HJNA 1C1YA 5FFMA 1TM4E 2BI4A 2JFPA 4R84A 1XXHA 4V02A 4GWKA 3G2MA 3NDRA 4MW6A 5DRYA 5LJIA 3MT0A 1AQYA 3WMFA 3UGTA 2YWCA 2WILA 5DGDA 1WVIA 1E2IA 3HRKA 4F6CA 3MTJA 4BFYA 2VT6A 1K4YA 4DLSA 1DIRA 3CVUA 2FNAA 4FYPA 3UBTA 2W42A 2O3SA 5K1ZA 1HLFA 1OAAA 4A7PA 4CDRA 4RKQA 5A02A 5KYYB 1VHLA 4YJ2A 2A0WA 5EMNA 3G2HA 1NBMD 2L42A 2C7OA 1EXDA 3F78A 1ZX1A 1ZN9A 3E2PA 5BQ3A 5LDDC 1EXVA 2L82A 1A71A 3QWBA 4FSXA 1S2DA 3H5LA 1HDCA 2I65A 3D5QA 3M2PA 2JAOA 3AZQA 4PU0A 3I9LA 1Z33A 2XWBF 5EJIA 5JLJA 3BDVA 3OPYB 1QBGA 4KLRA 4BO4A 1EG7A 1M1NB 1FUIA 2CLOB 1WXWA 2BH9A 2C4VA 2JGEA 3GXOA 2O7SA 3MMZA 4MKFA 4MVCA 4UVHA 4UXJA 3BTUA 3EXIA 5DYYA 4D9BA 4EUNA 3OIDA 5AUPB 1G6OA 1ZS9A 2QR3A 2Y99A 4TMVA 3UOWA 4E7PA 1N33B 2NX2A 5AVXA 4N3GA 1F17A 4KBGA 1YBAA 1L5HB 1VECA 3NNDA 5DX1A 5HUHA 3LO8A 2B5VA 1YR7A 2I4NA 2D13A 1PX0A 4EA6A 1FC0A 1IL0A 1JHDA 5D86A 4XPIA 3UPUA 2C2YA 4M1EA 1SUAA 3EFOB 2XUAA 1IJEA 4J0JA 1MJGA 1ESDA 2GM3A 2DHDA 2XWPA 1LTHR 3KEGA 1W4CA 3E9MA 3GFFA 1MAAA 5DI3A 3RC8A 1A82A 4N1AA 1B6RA 2ZRKA 4Q4AA 1PJ2A 4L2IA 1VTKA 2BDTA 3QG5A 3ZVNA 1GAWA 3DDCA 5DKFA 2F2TA 3AFOA 2XT6A 1KS9A 4K6CA 2VF2A 1NBME 2FZ5A 2BMAA 3SE0A 5LP6B 3CX7A 2ZRBA 2YZNA 2JF0A 4LRXA 1GPYA 2DT8A 4ZYWA 3ZDCA 2XMGA 4QG3A 4RGQA 3DW1X 2AGVA 3ANSA 3LOUA 1P29A 1W5EA 4BNMA 3RVMA 2GTIA 4FE3A 3I6QA 2QDXA 3T5MA 2PWAA 1I4LD 1SCDA 4IINA 1QYCA 5B53A 3MW8A 2F3TA 5AKYA 4IEFB 4CM9D 4OUKX 3DUFA 1NP7A 1EVYA 1P5HA 2Q2QA 5ESDA 1Z47A 5DM70 3KPJA 3Q7TA 4UMVA 1LLFA 1NKSA 1MC5A 2GZHA 2PJDA 3C97A 2I3BA 2FSVA 1V9LA 1MQ9A 1WO8A 2I7XA 1Y4AE 1QGED 3TPCA 1XEAA 4OJQA 2JEOA 5IM4A 3IVAA 3J81k 2ZJ1A 1WV1A 2ZKIA 4NZYA 1VL2A 3IUYA 1GL3A 1Z8DA 2OHXA 4BVFA 1GRRA 1LDMA 5CT8A 1T24A 1Z5WA 4UZEA 3DFIA 4BVBA 4P83A 4AXBA 4CKYA 1FRZA 7MDHA 4C0HA 1E60A 4KE9A 2R7KA 4YJFB 2ARKA 3HU1A 1JIQA 4QASA 1KE1A 4MPRA 4XUEA 1R6AA 4B6QA 5M29A 3QE0A 4G0ZA 4F9EA 3QX3A 4LFAB 4Q4CA 3OF3A 1QUFA 1GZSA 2EF1A 4ZIRB 5C52B 2AKAB 2Y0DA 4QL3A 1JS1X 1GLGA 2JI7A 2P1ZA 2B21A 2O2JA 1D6JA 2GZ2A 3PGKA 2FUKA 1RXVA 4B3TB 3R7NA 2V7VA 3O1IC 1O1YA 5DLEA 3ID6C 1WHSA 2ZRPA 4TGLA 5FOVA 2NUAA 4BVKA 4MKIA 1WUTA 5C7LO 2G9NA 3A9WA 5EJ9A 1KEEA 3KB8A 1AUQA 3FJOA 3ZWQA 5FA5A 4DW8A 2E87A 1M1XB 2C59A 1ZHHA 4EHNA 3QYFA 3WGOA 1LEHA 1LRJA 2FGJA 4I3FA 4NOLA 3RREA 5J23A 4KRGA 4QGBA 5CURA 3JW8A 1TT7A 4V39A 3VPHA 3BRWD 1EFKA 1XK7A 2RGUA 1ATZA 5FTLA 1ZUNB 3GJQA 5JI2E 3RI3A 2V1UA 2PZGA 4ITVA 4BNJA 1QX3A 2ZS9A 4P7FA 2DBRA 1N2EA 1GKYA 1UC4B 4WKNA 1P0IA 1VL5A 2P2LA 3GPBA 2UV8A 3N2KB 1DFIA 3H04A 3I2IA 4R8RA 4ZO6A 1I80A 3SHVA 3FNQA 4ZK2A 1MQ8B 1G2QA 2OGWA 5ESWA 5EXXA 1QQ7A 4WBNF 2GYVA 2J33A 4LIPD 1U2PA 1KGDA 3GDGA 1IM5A 2ACVA 2VPZA 3E9RA 4ZFNA 4UEKA 4EABA 3B1VA 1K7FB 5AVZA 1RWVA 1ZD8A 2MTBA 1E7QA 4QDZA 2BRUC 2W4QA 3C1AA 1Z35A 1C80A 4X0EA 1NNSA 3DTYA 5CYGA 5F9HA 2O52A 2QUKA 5A5EA 1DCKA 2FEMA 3ITKA 2ATXA 4HDMA 2GPSA 4Y1RA 5GJVC 2WSLA 2ET6A 3LL4A 5ADWA 2KSQA 5C5EA 4UBIA 2YWXA 3FWNA 4JS0A 3TSYA 1QDUA 1NRWA 1VIMA 2QSUA 3RTGA 4UATA 3T3OA 1W96A 1XTTA 3R9KA 1XZ8A 3WJAA 4KIFA 4B83A 3A06A 4R31A 1GLVA 3FN4A 1DJPA 3E3OA 1THMA 1GN9A 1TM2A 1OHHD 2V4ZA 3QELB 2BKAA 2Q1XA 3I52A 3CH7A 4PVDA 3WKAA 1ORVA 2L18A 5A9TA 5BY2A 1OH6A 5FH9A 2C9BA 1RQLA 2A3RA 4WEOA 2WHPB 4IF4A 1H8HD 4MS4B 2LRHA 4M1ZA 3U9LA 1U28C 1PR0A 3M89A 3AR6A 4Q12A 3FHJA 2J3JA 2B3TA 2F9MA 2P0EA 2FK8A 3L0ZA 4OG2A 4PG7A 5JHHB 4UM8B 1T43A 1YL5A 3NEAA 1RQ2A 1S0UA 3N6VA 2XD9A 1CVIA 2N3ZA 3KSMA 2L17A 2VDMB 2R6FA 4ZVKA 1WXGA 4IIEA 1N5IA 3K2IA 3FLBA 3RHFA 3PC3A 4JT8A 5DYGA 3FCOA 3WDLA 3LX8A 3WXBA 1YE3A 2OZLA 3S4YA 1U9YA 4BEJA 2FF7A 1QQ6A 3MRSA 5JZBA 4ML3A 1E89A 3KUCA 4JYPA 1YKFA 2I87A 2Z3WA 1K08A 4M9CA 1JWBB 4MX8A 1AKEA 3SS7X 4JFRA 3I2HA 1OZAA 3R6WA 4M7PA 2SCUA 4C6TB 1LV7A 2WJJA 4NCXA 2H1LA 3LZDA 2B36A 4ZQCB 2IU4A 1ULBA 2APJA 3UM9A 4TVKA 1I3LA 5FUMA 3L82B 2C0QA 1Y8AA 1U99A 1WMEA 3TSWA 3A1DA 3EASA 5ICFA 1CEEA 4PPYA 3GEBA 1UQTA 3B20A 2VN8A 2IV2X 2DETA 5FJJA 4BASA 1LVGA 1RPNA 4KQFA 4NV1A 2E6KA 4ZVNA 3RUPA 1X80B 3KSDO 4R9NA 5CLQA 3CNLA 3JD1A 1R0KA 1E5LA 1HYBA 2JB9A 2FW0A 3G3EA 3KC2A 5C7YA 3CRRA 2FMUA 5HJ5A 3QV2A 4LK3A 3TFWA 5J40A 5C8VA 1TVEA 1W34A 1WSDA 3K7EA 4RMHA 3U6KA 1N5DA 3AHEA 1HF3A 3PK0A 5DU2A 4BX9A 4YMLA 1LSUA 1R6XA 2WIAA 5IP5A 5LQUA 4O3MA 4MUAA 1KXJA 4N5IX 5IJWA 4R9UC 5LMNB 3GAFA 5HTKA 1G8KA 4FMPA 5K3FB 1MB3A 3PNYA 3REOA 1XZKA 3I42A 2W6IA 4YLGA 3QKTA 2G3YA 2I8CA 3L9WA 1QIGA 4KE6A 3SS9X 1IXKA 4K28A 1JMVA 3AF3A 1EP1B 4Z53A 5KYWB 2GCNA 5FUYA 1W30A 5JD4A 1Q22A 2XLBA 4R54A 4LF8B 2AZTA 1V7CA 2AI3A 3EZ6A 1E0KA 2WD7B 1I94B 2YFKA 3EDRA 4KDCA 1CQPA 3W4KA 1YFJA 3JQBA 1A9TA 2GTHA 2YIVX 1QH9A 1USIA 4RDIA 4B35A 1WULS 5U9CA 1E1CB 2V3WA 4J0GA 4TZTA 3WAJA 2W2LA 1OW3B 1VG9B 4LC9A 4LHZA 3MUNA 2B4QA 1RJFA 2GUGA 4D3XA 3MWGA 2C07A 2VUSA 3RKSA 2NUTB 5E7JA 5HHTA 1TFUA 2UZ3A 3Q4GA 3WO1A 1KK1A 1PR9A 2BGKA 3A0UA 3D6MA 3R8XA 1RLJA 3LUKA 1TJ5A 4OLAA 1XRLA 4RTLA 3BREA 4G5GA 4MIKA 1X7HA 3H16A 1UOEA 5FYDA 2ATEA 1V5GA 4LXHA 6REQA 1Q0RA 1T6ZA 4JYCA 1E9VA 1IUPA 5ESXA 1JIKA 1QZZA 3IMEA 2E49A 1DADA 2JLRA 3T9FA 3EPHA 1SD5A 5CHYA 1ODIA 1HFJA 1VA4A 3PR2B 4KODA 3ELWA 1ST2A 4EI8A 5FWXB 5L3VA 1L5FA 1PV1A 2XYHA 3GK3A 1L5HA 2AMLA 4XJVA 5KQSA 5IVKA 2A1TR 4YDSA 4OHPA 2WU0A 4R7TA 1O54A 1V71A 4IMPA 3U44A 1ENYA 4IDEA 4DB4A 3HKDA 1CLEA 4KXLA 4PHGA 1NHGA 2QYHA 4W9RA 1V6AA 3F73A 1EBBA 2VXOA 3PQ5A 2Y27A 4D4GA 2GBLC 3VUFA 2IOFA 5IVPA 2OBBA 1VMAA 3EG9B 3V1MA 3WNBA 3WAGA 1N57A 1YS1X 3WK9A 1Q0PA 1GTRA 1Y3DE 4JFAA 5CIYA 1S1MA 3IAEA 4CYMA 5KNDA 4NESA 2VH2A 3O3MB 2WV7A 2V03A 3R6LA 5TPZA 1B41A 4G41A 4KPUB 3KEOA 5EPEA 1EFPA 2E6UX 2Q4RA 3FOWA 5K0GA 5JLAA 3GY0A 2JHGA 1YHZA 4LV6A 2V74B 4HN9A 1RZRA 4YUXA 5MHTA 2CFRA 3SVZA 5EE1A 4A0QA 3KVRA 3IJEB 2A86A 3T5DA 3KDAA 2XUGA 4FOSA 4GPTA 2ZBVA 2Z9BA 4I50A 1JLSA 3IR7A 3DAPA 1H3EA 4JT9A 3DTVD 1VMKA 3IOEA 2QP3A 4MVWA 4XWWA 1JQKA 1BYIA 5JJBA 1JB9A 3OD5A 3QU5A 1HURA 1NYQA 3BC1A 1TA0A 1BZYA 2JGDA 1XFAA 1Z7GA 5IT4A 3A7DA 3QE2A 1U3DA 1Y8QB 1YE5A 2KB0A 3G0IA 3TMYA 1CZHA 4DA8A 2E5LB 4NULA 2JFBA 2H29A 2IEIA 5FFFA 2VCEA 1EVQA 5BNWA 4I1UA 2QD1A 5DJ5A 3HYLA 3QVJA 4E70A 1TYAE 5EJAA 3IPRA 5IK2A 1Y0BA 3QEMB 1N9KA 1H4TA 2FEOA 3D7LA 5CP8A 2FUEA 3KJIA 2HYIC 4UHDA 2AQKA 1FMTA 4M9QA 3D8UA 2OGZA 4P3NA 2LKCA 4E51A 1WLSA 4CUKA 2K87A 2GEDA 2OHFA 1LTKA 2CXOA 4ZHQA 1E3WA 4P36A 1DAPA 3NB0A 3G1TA 1QDEA 3OE1A 4AKEA 4IDQA 3CGWA 2R66A 4IDOA 3B70A 3EGEA 4QAQA 1KE2A 3WLFA 1PG0A 4DV7B 1BE0A 1G3IA 4AQYB 5A7HA 3L2OB 3TO5A 1CIJA 2OD2A 1LBTA 1G3UA 1RIIA 3DXYA 4FTWA 4IXMA 4KO8A 4MRMA 5CB8A 2AFIE 2EJUA 3LVQE 3EW9A 2PKYX 4R8MA 1RYDA 4L5BA 4WDQA 4ZO8A 4DV0B 2AWOA 3LCMA 4J16A 3WA7A 2H85A 1HDGO 1SOAA 5KNCH 3S8YA 4OPMA 3GZNA 3DYBA 3OX4A 1R9JA 4ENTA 1J8YF 2GD2A 3WB9A 5CCBA 5CB0A 1H2RS 4ZC1A 2ZUTA 1U9CA 4OLJA 3SFVA 4BFXA 2OUKA 3SEFA 1BHJA 1WD7A 5AW5A 4G67A 4ABTA 1KIFA 4RTSA 3NWOA 1G18A 2HWYA 5DTRA 4H16A 2DQKA 1YVUA 4DMRA 3IQZA 1KVTA 3STYA 4OEHA 1G5RA 1N2JA 4L8WB 1PLLA 3SIWA 4JBIA 3PYMA 4BOYA 5EWJA 2HK6A 1RWPA 2ZAGA 3FVRA 1XXHB 2ZIEA 4ZV4A 3FAKA 3A26A 1UBCA 4C2TA 3X1YA 4URZR 3QBJA 1H6BA 3RIHA 2FWPA 3EZLA 4O1MA 4UREA 5FWDA 3NH9A 4HRAA 4CKEA 5JVDF 1QG6A 3DDUA 3F5SA 3W6OA 1OH8A 2NU9B 4ARUA 1DBSA 4Q47A 1MO3A 4CEIB 2C92A 3PUYA 3NANA 1DWOA 4CL8A 1H1LB 3AHHA 5JS6A 4INOA 1Q2XA 1RIFA 2P62A 2YV3A 3G7UA 3ZHOA 1QHIA 2W22A 4IPTA 1T8SA 1F3OA 2RD2A 2JJ1D 4QFMA 1CT9A 2JZCA 1GZVA 3EULA 2RONA 2XKBA 3B3GA 5EXPA 4TV8B 5LXTA 2YJ3A 1EAYA 3N8NA 3A6PC 1QH1A 2F7SA 2CFTA 1D9ZA 1T0UA 2OFWA 3BCSA 4G1BA 2I0FA 4ZCSA 4NZ9A 2DB3A 3GJ3A 1XHFA 3WB0A 2QN1A 4MGKR 3VNSA 5A03A 2IUYA 4KK4A 3TLGB 5LOVB 3ZWVA 5IUNC 4F6LA 3BL6A 4MQFB 4Y8VA 3HYRA 3WK7A 3KWMA 4IIFA 2EQAA 4YCAA 2QY6A 4U8GA 1CWUA 2FX5A 4QECA 4KR9A 2FSUA 5F21A 2PWYA 2CN1A 2KE5A 3DPIA 2V6MA 3T1QA 5J9FA 4RY2A 5C9ZA 4RZSA 2RH8A 3L8DA 3PV0A 2VHXA 5K9ZA 5E9WA 1OIWA 4X6UA 4E46A 4RE5A 2R60A 1P7YA 1KBZA 4GPIB 4KDFA 4NZPA 5H4HA 3UHAA 1GRQA 3TJMA 3ZIUA 3KX2A 1XTRA 4MW4A 2PQ0A 5A0TA 5DYWA 3BCRA 3JTEA 3D7RA 3PUKA 4NBNA 5T6MA 2P2DA 1ISJA 2JATA 3JQFC 5EXEA 2WPDD 3WDMA 4H31A 1D07A 3LX4A 2W6ZA 5KOHB 3VPSA 1H94A 1UBRS 3C8MA 3U3JA 1JIJA 4MA5A 2WU4A 3A31A 4LHEA 5GOZA 3SM9A 1X87A 2OAP1 3GLVA 1EFTA 1NJSA 4DLTA 2ZSUA 4LRTB 1E1QA 4PRZA 2WP8J 4QQ8A 1YO6A 2C2XA 3EGWA 3QYJA 2R6AA 1FLDA 3F8TA 3AYZB 1CG6A 2GBIA 4IOMA 1MUUA 3H1AA 4FWBA 3OTOB 2ZSIA 4GD3Q 2HRRA 1YU9A 3STVA 2ZIXB 4I4CA 3WYAA 4JV5B 2JRLA 3CZ9A 2JIPA 1VCIA 5TF4A 3R7LA 4US1R 3PX7A 2V59A 5I7RA 4ZU3A 5BQFA 3RFCA 1Y9JA 1KMHB 3QFTA 4FHEA 3WK4A 5B3KA 1TIBA 621PA 5MDHA 2RDMA 3M4YA 2EGHA 1E4VA 2ZTSA 4IGKA 3FSGD 4G07A 4K9MA 1AY0A 4PNZA 5D3MB 3TAHA 5DNUA 1EVEA 3GGSA 1NHWA 1NSYA 1Z8FA 2M1XA 3L4SO 3P5SA 2PUAA 1QYDA 3T35A 1J1ZA 4JELA 1O95D 4CQNA 2IS6A 2ZYGA 1V1MA 1JKMA 4I9FA 1ZNQO 3E18A 3ZR4B 5ALYA 5AMXA 5F7OA 1ZJ6A 1XDZA 4WVLA 2C78A 1SOUA 3B5IA 1G5QA 2VNJA 4EG7A 1HLDA 1BMDA 1P9OA 3I01A 4FQ8A 4KO3S 1WXHA 1XI2A 5LQSA 3CUTA 3WHKA 2WIKA 3EPJA 1OZHA 1BVYF 1YF3A 3UIEA 4Y9DA 5IF9A 2OOKA 4H7PA 1YA8A 4BFSA 3CQ9A 2X5XA 4ZVRA 2QVLA 4IZOA 1XEWX 2C2HA 1P18A 1MMFB 2WVHA 5AQ1A 4UHHA 5ALOA 3NRCA 4RVOA 2Z3VA 4Q4JA 3UZUA 4DLNA 4LZJA 4C06A 1WXFA 1JFRA 5KNCD 4BRZA 1XSEA 1RXCA 1UP7A 2OBYA 2QX4A 3FYUC 4HH0A 1YV9A 4M38A 3KR2A 3QWFA 4NIMA 2P8JA 3AI7A 4MIYA 1RZVA 1Q7RA 1Q0SA 1I24A 3FWZA 3M70A 1RMYA 5DN6A 4CEJA 2Q4TA 4R68A 5NULA 1ZR4A 3JQFA 1V3TA 4X8OA 5LM3A 3GAZA 2WG0A 1I7PA 4E5SA 4Z4FA 1SM4A 2F4VB 3D6HA 1U0RA 3NKFA 2ZJ3A 2FRDA 1E9DA 1XL1A 1EG2A 3UBMA 4EYGA 5KKNB 3ABSB 2ZKLA 2MR6A 4UCWA 5D1NA 4ZRNA 1UK9A 2O0MA 2DPMA 1OT5A 3DNFA 1M1YA 3KYDA 4RMJA 1C1XB 5I45A 3N87A 3U7FB 1P2BA 1CERA 1V8ZA 3LI2A 3MMPA 5EIBD 1JG3A 4GXRA 1M5RA 3SY8A 3RYIA 3EEFA 3HH8A 2QVGA 2BFBB 4LWOA 2N1MA 3MJHA 1H05A 3D3EA 4PNHA 1CEQA 5CLHA 3VMMA 2QRMA 5EIAA 4GBJA 5FBLB 2WM3A 3H11B 2JPDA 3KBBA 4FHCA 3T7DA 4MWSA 4YBZA 1QFXA 2OV6A 5K6AA 3GC6A 1MIOB 2AT1A 5DTIA 2OB1A 5CW2A 2PUCA 1AKNA 3CT4A 2W2VA 1GGVA 1JQ3A 4BWGA 1G6KA 3S2YA 1HMPA 3IDFA 2F62A 2ZU6A 3DD1A 1R10A 4HQNA 1Z6PA 4L3OA 5FPSA 2D62A 5CD1A 1RPAA 3ZU5A 3T7SA 4O1IA 3ZI7A 2QMYA 2ORIA 2CLDX 1GQ2A 5C8XA 5TJ9A 1SBYA 1WDKA 3FIJA 3CLHA 3R74A 3ETHA 3UA3A 3V7WA 1SGWA 3IIKA 3X1ZA 4JDPA 1ISGA 1AJEA 1TQ2A 2SKEA 2HQRA 2EZ4A 2YV2A 1XTZA 4NFLA 5I3ZA 1NJ5A 3RJZA 1RJ9B 2NVUA 1PNTA 4FFOA 4MRVA 3W8FA 1PZNA 1XJ5A 3VBCA 5EWMA 3R5KA 4EYSA 1RWBA 4RGVA 4YRCA 3HJHA 4DC0A 2BM1A 4EH1A 2O2YA 4MHOA 5LP6F 2O8FA 1N2BA 2MSKA 1A2KC 5AQEA 2NZWA 3TM5A 3OM9A 5A3JA 2IBTA 1HG0A 1MPTA 1VPWA 4YUVA 5GJBA 3OLCX 4DCMA 4QUJA 3PKIA 5LU9A 4K2HA 1YBMA 3VZSA 2E18A 2NIPA 3DP9A 1XCJA 3VHLB 4BAGA 4EJ0A 2HA5A 5IKEA 4MVYA 5K0JA 1K3FA 5ALXA 1YL7A 3LX6A 1BCSB 2IHYA 2GI4A 4K6GA 1R9NA 4G0QA 4KN6A 4PGFA 5GMOA 4CIYA 3RO7A 2C31A 1V4NA 5JRDS 4I6EA 3IULA 1PV4A 2NZXA 1FFWA 4HGNA 4W6QA 1VCMA 1EXWA 1BTOA 1O5TA 3JWJA 4HWRA 4CV1A 4QPZA 3AVXA 4JUCA 4C78A 5T3YA 2X6QA 3N53A 4MQEA 3OCVA 4QRDA 3ME5A 1SULA 3G8BA 3AOEA 2BSXA 5HDBB 1QIIA 3B7GA 3GN1A 3NJRA 3DCNA 4F84A 4RHFA 2IEDA 2W8BA 1XRQA 2YXEA 3NEJA 3ZW9A 3D6AA 5DBGA 2W2XA 1XBTA 3RUDA 4LYYA 5HE9A 1XTQA 3G5MA 4O4LB 2O8DB 1C0LA 3KO8A 3VR2A 2NV6A 3SSNA 4D0NA 1N5OX 1NRXA 4ZDKA 4QYIA 1M1NA 3EWAA 2GZDA 2CE7A 3BXZA 4TMTA 3STXA 4IGFA 3CSDA 4OOEA 4RL6A 2YYYA 3NHJA 3DLHA 2NYRA 2CE2X 2ZUCA 4H60A 5K0FA 3QF4B 3ZXYA 5COQA 4D1YA 4BIMA 1LXCA 1N0IA 4WESB 4CRWB 5MN4A 2WOJA 3JQ8B 1YB1A 4TPKA 3VOBA 4GEKA 1YQWA 5AFSA 1HDOA 1P75A 6LDHA 5L3QB 1E18A 2AJLI 5L53A 1WP9A 3IDOA 3OQ6A 3QGMA 3SXPA 2BISA 1FTWA 4G4IA 1E6EA 3FDXA 3FWPA 2C5SA 4KSCA 3MUFA 5HRUA 2QSJA 3NGMA 3OEEA 4IZ6A 5FIUA 2R8ZA 4P35A 1ND5A 4WZBE 2O7RA 1H1TA 4CMIA 1A96A 3LBHA 1TQ8A 5CH8A 3W9YA 1E5DA 1ZO8A 4MYCA 3AKYA 1LD3A 2G9RA 5JXHA 1DQRA 1UDAA 10MHA 2GN2A 3KT6A 2IYNA 1X39A 3N39C 2YZ2A 4QYTA 2RBGA 5EZSA 4D02A 4BQIA 4QTXA 4W5QA 4EB6B 1F51E 3HKEB 5EKTA 5DASA 3BMOA 5L3SA 4OHVA 3O94A 4PO8A 1RI2A 3CF2A 3UJ8A 3V7FA 4DEVA 5JFGA 3GMDA 1PJBA 3KOMA 4QG7A 3K3PA 2BEWA 2GSDA 2BLLA 4KEAA 1MXHA 3FM9A 4J9UE 4ESVA 4BQEA 2VZ0A 3B6EA 2AZXA 4ZWNA 4E13A 2OXCA 2A9FA 4O2AB 1FYWA 2HIAA 1E98A 5KPJA 3JAMA 1JHRA 3E22A 1ZY2A 3M81A 3RC7A 5JDIA 1L7MA 4TSFD 4B3FX 2Q5FA 4EZEA 1A9RA 1AQ6A 2PQ2A 2HWXA 3DBHA 1AD2A 4ZOAA 1OPRA 2AG5A 3KVNA 5GV7A 3F6SA 3KDSE 3SQXA 1VKOA 3FNEA 2XUQA 4AJPA 2EL7A 3MLEA 4C0AC 1XB2A 4C4TA 3AP2A 3WTCA 5CDYA 3EPKA 1L9XA 1V3VA 2ZBUA 2POCA 2X2EA 4D3ZA 4Q03A 4JU9A 1QGUA 3FPBA 4LBWA 4YRTA 1KZ9A 2F59A 3U7GA 1PEAA 2H1SA 2NTNA 5DIFA 5A7GA 4HN4B 4KUHA 1W49A 4D3YA 2HNBA 2ZT7A 1Q1BA 5B1DA 1T3TA 2WJ3A 3TEMA 1QS0B 2XTNA 4YCNA 1GG5A 4DMKA 4DVJA 3IQGX 4C5BA 4CLRB 2GASA 3R5HA 3NLLA 4DDTA 5KSOA 2XXBA 3TX2A 2ZS7A 4TYWA 3DDZX 1OGIA 4MRMB 1RQPA 2H6EA 2J7PD 2PQMA 1BXRA 4HFNA 1E1RD 3QIVA 4J8PA 1FDUA 2FPRA 5C0OE 4IYRA 2VHZA 1ZYUA 1OFIA 1IBCA 4LRYA 3C2QA 3QPWA 3T94A 2B25A 3I4FA 3ZWDA 4TSRA 2X7HA 4TKUB 1Z2EA 3IHTA 1TCAA 4Z7NB 2GKOA 5KWVA 1O8CA 3KALA 3L7DA 5LC1A 3RS8A 1CFJA 1RRVA 1ECJA 2IXFA 3GIDA 1HY3A 1QYWA 2BGTA 4QGHA 1P1JA 4V1CA 4F4IA 2PK3A 4XSGA 2W5UA 3NHRA 3ZE9A 5JCOC 4PLZA 2YW9A 3CG4A 2QYSA 4R41A 2IIVA 4OBWA 2A33A 3PA8A 5CX1B 4PN3A 2YJ6A 1K0FA 2ZGVA 3V1TC 3GPDG 4MO2A 1WDMA 1JEQA 3K09A 1RR6A 2ZI4A 5AESA 2JK0A 3ZWYA 3R23A 4OO3A 4Q15A 3MJSA 1P7CA 3DCIA 1OTHA 1YRBA 4NHOA 4OJYA 1KI3A 1UK7A 2MINB 3EZ2A 4FW8A 4E14A 3PLAE 5BUQA 1CRWG 4EJSC 2PANA 1NNEA 3BXEA 2LGJA 3JYPA 2H7YA 3MSXA 1R88A 3AB7A 1NSFA 2IZ1A 3F9IA 4XCQA 3UJAA 3DH0A 3UWDA 2B4AA 4KFSA 4O5OA 4X1OA 5BSMA 4GKVA 3E7FA 1EESA 2P5SA 1YDHA 2C94A 2QMQA 2BR4A 1IMJA 1X9HA 3DWEX 2NZJA 2J0UA 1K9SA 3HWWA 1SHUX 4J1QA 4LNAA 3W5SA 2WBLC 4CIBA 2B30A 4KO1S 4PONA 2Q2NA 4WFQA 1O03A 2GH1A 1AB6A 4PPFA 1WEHA 4ZMRA 3BMNB 3ZV7A 4JI0B 2H17A 2GN1A 2ZRLA 5TC4A 3QXCA 1WPGA 4Y6LA 3EQ7A 3RKRA 1WWKA 5CCEA 4Q7MB 4S05A 2VT2A 3AKEA 3C24A 3DFFA 3G17A 2HMAA 4J7XA 1G5IA 1QTRA 1X1QA 4FFNA 1CP2A 2WG1A 2XNSA 2RBKA 1N8KA 4NV0A 1DL5A 1G8YA 2VPQA 4Q3CA 1ZH0A 5BSHA 2PT7A 4X1YA 5CITA 5ICMA 1XXLA 1Z4IA 3CKLA 3RLIA 4P0PB 1M0WA 3LF2A 2RKOA 4EY4A 1XZFA 4BMDA 4E11A 4S1OA 1K6JA 3A70A 3BWMA 4AYTA 4GR9A 3CMMA 1TX4B 1FK8A 3MWDA 2BEUB 4QWWA 4DQLA 1AK9A 2FRXA 4W7SA 2BC9A 4IOKA 1TMKA 3D6NB 3WQRA 1DKLA 3R9WA 4M89A 3CCCA 1G7RA 2ZRCA 3KYCB 3NT2A 5GONF 3LUDA 3OQBA 1SVMA 2YC2C 2Q3CA 1EX1A 1V45E 3ZWWA 2ZREA 3GH3A 4HXGA 4HB4A 1T9CA 4CBVA 1HL3A 2B4TO 2FEKA 4K81B 1OI3A 3OWOA 3FROA 2CMFA 4INZA 1MEOA 1PR5A 1G17A 4RQUA 3UK0A 1IFXA 1ZMXA 2WMNB 5F9FA 4N9WA 4BKQA 3OLWA 4UD6A 4X92A 4I55A 1SQ0A 1X1AA 4Q7QA 3DAFA 3PJEA 2EX1A 3H2BA 1ZOPA 2BTQB 1YB6A 2NZ8A 4N3AA 1A76A 4L73A 1GUFA 4HX9A 4D2IA 2VI5A 2H8KA 1V16B 4GZMA 3K0KA 2RCNA 2P9YA 3NHBA 3UXMA 1CF2O 2ZCUA 2ZE6A 5EUQB 1XLWA 2BFEA 3K1JA 2J30A 1KQPA 1NBIA 3LJKA 4YQZA 3K6JA 1PEYA 1O87A 2JZNA 2P6UA 4I9GA 4CCYB 4BGUA 4L3WA 3RABA 4ODIA 2YFYA 4U39A 3U39A 4IX9A 4OVKA 4D6YA 1G7SA 1HO3A 1Y7IA 4V0QA 1X1EA 4ZYYA 4EEXA 4TXHA 1XDDA 3E9DA 1YB7A 4H15A 4R2WA 1GRVA 2KQUA 3PVCA 1BSVA 3UMYA 5KWSA 3JARA 3O3CA 1XP8A 4FHDA 1QF9A 4XSVA 2GNAA 1FFHA 1RAGA 4A8JC 4KIJA 5IN4A 2CKDA 5FPQA 4NMWA 4DR2B 1R1DA 2D1QA 4JI8B 3QF7A 4AMUA 1EK1A 3B1ZA 5ESRA 2YZKA 1XD2A 2BFCB 1UC8A 3RDPA 3ZGLA 1QCDA 3HB1A 4IIDA 5DWVA 5AI8A 1LRLA 2CMHA 1OIVA 3R75A 5HNKA 1JDNA 2H1WA 3S28A 1YR3A 3EPPA 3OZDA 5SYMA 3TKLA 4AW9A 4KN9S 1U98A 3UC5A 1JDVA 1JQBA 4GX2A 4MW2A 1SVUA 5LZ7A 2W6QA 5AI6A 2DR3A 4KBFA 1ZGAA 1YTUA 1X0VA 1QQBA 3EIQA 1U1EA 5K2MA 4WN9A 3I12A 2G72A 3COWA 1T2VA 1CR6A 2QQGA 3ET4A 1Z18A 3OZTA 1FPMA 1GTJ1 4RVUA 1RRCA 1O94D 1QOPB 3BTOA 3R4CA 1UBOS 4G1FA 3RSQA 2WLSA 2BSQA 2AHRA 1JBKA 2DVMA 3DW3X 1YB2A 1R6VA 1WZNA 3AILA 3DTVA 2FSPA 1N7GA 3IVRA 4YJHA 2V7XA 4YRZA 1Z2DA 2J9GA 1TUBA 4RENA 3T34A 2CBZA 1B8VA 3A6HA 3EGOA 3JY6A 3ZQKA 4JJ4A 1UBTS 1VP3A 4F3YA 5IXYA 3KOOA 4B3SB 3G88A 4BZWA 1PNVA 1R6BX 2GJ8A 5AJXA 3DE4X 1GU7A 2VRBA 2D8AA 1K7YA 3P9RA 3KCNA 4RKRA 2N47A 1TMYA 4Z4QA 2QTCA 2VNIA 1QP0A 2H1VA 3F5FA 2O2ZA 2A5FA 3QW4B 4MYRA 1I33A 3OHMA 1RS0A 2PX2A 3PE3A 2B34A 3DV0B 3STUA 5IK2D 1I4EB 2PMCA 3RU3A 1Q1QA 4TM8A 4Z9AA 2QTLA 3WDKA 5FI0B 2ZUFA 4QRHA 2O8VA 1E7SA 1Z17A 2IL1A 1IJBA 2HREA 3OQIB 5K5EA 3QLUC 1LF0A 1WTCA 1EIZA 4DZRA 4CLOA 2G6TA 1VLQA 4XM1A 4YAJA 3LUHA 1TIPA 4WXPA 2HL6A 2BTQA 2DUJA 2QMUA 4PSUA 2ZM6B 1E2HA 2XQFA 1TL7C 1URPA 3NDJA 4K9SA 3HYCA 2ZAYA 3KYBA 1Z82A 4R1NA 4U0KA 4TYYA 3P27A 1EHIA 2BFFA 4W8OA 3NBUA 2PLFA 1QP4A 3LA8A 2AOTB 1TEZA 3VR6D 1ZUD1 2F3PA 1NUPA 1S7GA 2GTPA 2XB9A 2Y9PB 3AIMA 3NRJA 1J8DA 1PR1A 4H4EA 5JBNA 1W93A 2XXAA 3B82A 3BG5A 4G6ZA 1JKJB 2GBCA 1U7TA 1GZ6A 2YH2A 3S8MA 3NTUA 4M37A 2ACEA 4GZLA 4WCVA 5I9BA 2OMEA 4BNKA 1T9AA 2IOQA 4MCHA 5B2EA 4Y2UA 4ZQIA 4E31A 5BP7A 1K9VF 5KX5A 2QX9A 4U02A 4PV7A 2YWBA 4RHUA 3OBIA 4G23A 3GJXC 4N01A 1T5LA 4D9JA 4E03A 4C6RA 3JQAD 4TV8F 3N8DA 4E5NA 1VBKA 4QXMA 5KWIA 3TIVA 1SQ6A 1IB6A 2AW5A 3IQEA 3B3FA 3L7YA 4XGNA 1DPGA 4PE5B 2OZKA 4UKDA 4NMXB 5DHQA 3ASZA 3R3HA 2QVCA 1B8OA 3DV2A 1BAPA 1V8OA 3EPRA 4R6WA 1CY8A 1UZUA 1YZGA 2DU8A 2RGYA 2XDQA 4N39A 4CMCA 3CBQA 1K98A 3ZQJA 3NTVA 3U48A 3H4IA 1AKRA 1P19A 1W75A 1JT9A 2AOVA 3L40A 4WCDA 4CM8A 2A2ZA 5JW6A 1SHZA 3RFTA 4OX9Y 1Y4UA 1CRPA 1QCYA 4CDGA 4RVDA 2J0UB 4O2BA 2WUDA 2PRIA 3TLAA 1H2XA 2PG3A 3O8NA 4IJ5A 4TLLB 5HF6A 4AG5A 4DYVA 3H99A 1MKYA 1GITA 1ZM9A 3VM6A 3BIOA 3MFQA 4DJEC 3UK7A 4XVHA 3PEEA 2GK6A 2NQTA 4NATA 3ETDA 1UBFA 2H1CA 4JASB 4WZAA 3WIDA 4YMSA 1L6RA 3LXXA 4OXKA 4PGMA 1E9FA 1YZNA 2QT1A 5AKZA 5AIAA 4TLCA 1CPYA 1LBEA 5J1TB 3ZN2A 2JBAB 3W2IA 4EPVA 2HGSA 3L02A 2WWYA 1M7HA 1N2HA 1WW2A 2QRGA 3T41A 1E77A 1Z13A 2P2YA 4KLNA 3CR8A 1TQHA 5IRCD 4PPQA 5T4HA 3RVOA 1U1DA 2H5JA 2VJMA 2XB8A 4F4DA 5IZCC 1F14A 2VLIA 3IC5A 1FNMA 1K6XA 2ZRFA 5FD8A 5BSEA 3MOIA 4K9QA 5CGQB 3M34A 4ZI7A 1DAFA 3HCFA 4B9AA 4EHLA 1PKXA 2RG7A 1P3Y1 4UAJA 4UFPA 3NTRA 4I2VA 3SC4A 4Q3OA 1E2MA 1GQQA 2PA3A 3SFTA 1G7TA 3ECCA 2AF4C 1QO0A 3QSGA 1RC0A 4GQIA 4A26A 4D26A 3G2PA 3HYNA 4F85A 1CR2A 4XYLA 2PZJA 2SKDA 3F90A 4ZYXA 5T64A 1BW9B 1CNMA 2ID4A 4RLSA 1DELA 5JH7F 2NO0A 1M76A 2FHPA 4CKCA 4KZPA 3TSCA 4QQKA 1PJAA 4XI9A 2X2FA 3OIVA 3T15A 3DZ8A 5BXQC 3OX2A 3U3MA 3ZU6A 4JJ6A 1DIHA 4IKPA 2WU8A 3CZPA 4WN9B 2FDCA 4UULA 1L1RA 1XCGB 2YBDA 2ZVPX 1IY0A 4LQDA 4D4HA 4EG8A 1NUUA 1G55A 2NUBA 4ZAVA 4AIRA 2BUBA 1IXSB 2BMJA 3UATA 1NVEA 2WTEA 2PH1A 5DFAA 3WQBA 2ERYA 3B2QA 4CTMA 3T3PB 4KQMA 1TYCA 2DUMA 3NIDB 4DQUA 4OI0A 2P30A 2CDRA 4FEYA 1QGAA 3S29A 1RXSA 5IX8A 3HDTA 1I1NA 3JR7A 4YAWA 5J4KA 2BFDB 3Q2KA 1PL6A 2EKZA 1JRLA 2TSYB 2X4DA 1XNQB 1GQRA 1TYEB 2J3EA 1R0YA 3F8WA 2OT3B 4P84A 2J08A 4XCVA 1T0HB 4YRFA 4I8XA 2JARA 4PLGA 1XTKA 3INNA 3AB3A 4MWDA 2FH5B 4M86A 1N7IA 1KH2A 4ZODA 2FWAA 1C14A 1U3FA 3ZJVA 2VHJA 3GJ8A 5IBPA 1GEEA 1NQTA 1WHSB 1C9NA 2XOKD 2PWPA 4ZVOA 5F98A 1TM5E 2Y9MB 3IALA 5AOBA 1T5IA 4LYGA 3HVKA 4OUDB 3VAZA 2VBFA 4FLMA 4CEHB 2WJHA 2RC5A 1CRLA 5EZYF 1CQZA 1MAHA 2JEYA 1T8RA 1F38A 5EMJA 5JMOA 2DHRA 3P2OA 4Q3NA 4I66A 3SHWA 4EY7A 2W83A 4AG6A 2P1DA 2C7GA 1WJGA 2HY7A 1CQWA 3C48A 3MK31 3C5VA 3DZGA 4LCJA 2EW8A 3WICA 5CFQA 1HEYA 1BVUA 1MN6A 4GMKA 5MFZA 3F3YA 1PN3A 1U3WA 3LLVA 5G4KB 1IHUA 3QOYA 2V7TA 4GW3A 1J0XO 3IT1A 4H0FA 3CW8X 1IHXA 3TRIA 1T8PA 4U6SA 5JD5A 1WHTA 3GVIA 4U2CA 2JHCA 3THSA 3SK0A 1CNFA 4NXMB 1BQEA 3L0BA 5HOQA 3ZJ4A 4G8DA 2V6JA 2FN4A 5LLSA 3WK6A 5KPDA 3VH4A 3ZK7A 1TB4A 3HXOA 1I9CA 3HZRA 5IABA 1LSSA 2B37A 3LP8A 3RVDA 4EO4A 3DP7A 2WJ6A 1W581 4WCFC 4FDLA 2D5CA 1GVHA 3CTPA 3L46A 2ZYIA 1X7WA 4KP7A 1XROA 4DQDA 1I7DA 1JSCA 2P4EA 1XMJA 1EHCA 2GPTA 3IAS6 4UE2A 1AHNA 4DIEA 3KQYA