4IO3A

Crystal structure of the avglur1 ligand binding domain complex with aspartate at 1.66 angstrom resolution
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
248
structure length
242
Chain Sequence
GSARLKGITLRIGVIESVPFTIVANVNTTKLTGYVLDLIEYLRDKMGFVADVQLAPPNTSYTGLVLALANGDYDIAIGDITVTSARREIVAFSNSISDNSMRILMRKGTLIDGMDDLKNGKIPYNRIGIRIGTAGEDYYLREISGGSRNFYPLKSRQEMYDSLLAGIIDVSFMDIGTAEYVTNNIYCNLTLVGEDFDKSTFGIVTPKEWLYAKDLDVNILSLRETGILDNLKKKWFQTKACP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AvGluR1 ligand binding domain
publication title Anions Mediate Ligand Binding in Adineta vaga Glutamate Receptor Ion Channels.
pubmed doi rcsb
source organism Adineta vaga
molecule tags Membrane protein
total genus 74
structure length 242
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4io3A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4io3A02
3UA8A 1N3XA 1VSOA 3H4ZA 1MXVA 1FTLA 4GXSB 1YTVA 3LC8A 4NF8B 3UP9A 4QSEA 5FHNA 2B3BA 3SEYA 3CFXA 3BFUA 4FAJA 1MY4A 3C34A 3CRBA 3T93B 4KI0E 3PUXE 1F9BA 1MQGA 3MJNA 4QFNA 4PE5B 2PYYA 2B65A 4RA1A 1MM7A 1FQEA 1ZBMA 4JSDA 2REJA 4TQUQ 5H8HB 2O7UA 1MPBA 3CFLA 1WDNA 5DVJA 4RYAA 4YU0A 2O6AA 4JDFA 2NWJA 1ZU0A 3E9XA 3K4UA 3O6HA 5EYFA 3TTRA 3L6HA 1B0HA 2G93A 4RK2A 4BDNA 2XXWA 3EQ1A 1PB7A 1GGGA 4ESWA 2Z23A 3KN7A 1D3KA 3I5OA 2PT2A 1PEBA 1DOTA 1Z7NE 5H8FB 3FXRA 3TMGA 3PUYE 2QMXA 5I56B 5HPQA 2WKYA 3MVYA 3TQLA 2AYSA 4U21A 4ELPA 3VDFA 4ZEKA 3MQ9A 5I59A 3HPIA 4G4PA 4EDPA 3GLBA 2XXYA 3PUVE 4GQOA 1XT8A 3FVNA 4KPTA 4C1TA 4G8HA 3SETA 1MXWA 4H8JA 2P1SA 5DYHA 2Q2CA 4MLQA 2ZNUA 5JTYB 2DOJA 4ECFA 3TDJA 3OXNA 4RNSA 2PBWA 3MC2A 1B3FA 4ZEDA 4LP2B 5H8SA 1NNPA 1GV8A 4I1DA 1NFTA 1D9YA 1UTHB 2UXAA 1N7WA 1N84A 3LSWA 1HSEA 2H5YA 4TOZA 4UACA 2XXRA 3HHGA 5FTHA 4F1YA 3GBBA 3Q29A 2DYXA 1UIUA 3MP1A 4F22A 5AA2D 4U1OA 3JZJA 2ANJA 2F7BA 3P7IA 2HQ0A 3IORA 4IO2A 3O66A 4KCDA 4PFTA 3S9MC 4Q0CA 5H8FA 5I56A 4F18A 5JEIA 3O28A 4OZ9A 3M3KA 4R2BA 3UIFA 4YZZA 3OO6A 1BLFA 3SEVA 1LAFE 1QVSA 2Z8EA 1MY2A 1QW0A 2VHAA 3ONMA 1FQCA 5CBSA 3I6VA 5TPAB 4MF3A 5CBRA 1QKAA 2F8DA 4PFUA 2Y7PA 4IGRA 1RYXA 3EHSA 4IO3A 2XD2A 3OENA 3D4GA 3VFJA 1P1OA 2F5XA 3KZGA 5A5XB 2OWSA 1JQFA 1NKXA 4H5FA 2QS1A 2DVZA 4YB5A 4U2RA 1I69A 1R1NA 2BJJX 3ECRA 2I6EA 1VR5A 5FHMA 1TXFA 4MFIA 1NL5A 2KLFA 1PB8A 2UVGA 2V93A 4IY5A 3EN3A 2E1SA 3B6TA 2OJTA 3OSQA 3Q28A 3PPPA 1H3DA 4DXUA 3K1NA 4Z0IA 3PD9A 2P0SA 3R26A 2R6GE 4LQ5A 3D4CA 3PGFA 3O29A 5AA4A 1ZIUA 5ICQA 1TFAA 1IXIA 1FQDA 4X1BA 3V83A 3G7WA 3A3CA 4OFLA 3A09A 5ITPA 4K3FA 3RLFE 4XKPA 1SYIA 2R71A 4GD5A 2ZYMA 1P1WA 2D3IA 4LUBA 1LCFA 4ND9A 5FHOA 3EHTA 1EZ9A 3OOAA 2DSFA 3SESA 4G68A 2E0SA 1R6ZA 4EXKA 3H6VA 3UK4A 5I58B 3BKIB 4U22A 5CMBA 5AA3A 5AE4A 3T9UA 1MQHA 1MXZA 1PBQA 2DS9A 2V25A 4TLMB 1RYOA 3M3FA 2FYIA 4MBPA 3VVEA 4LA9A 5HBCA 3ZS6A 2O1MA 1B5JA 3MBPA 4R6KA 2ZYKA 1VE4A 1Q35A 5H8QA 1YAEA 4X48A 3PPQA 2I3VA 4EXLA 2XXXA 5ISUA 3KSXA 3SEWA 3A3UA 3TZAA 2LAOA 1XS5A 4DDDA 2ABHA 2XD3A 4ZE9A 1POY1 4ELQA 4YICA 3O97A 1CE2A 1FTJA 3IB1A 2Y84A 4L17A 2PVUA 2OK2A 2GRVA 3PPNA 3K01A 4MLVA 2O1LA 1EH3A 4ZZEA 2HZKA 1LSTA 3I3VA 4FECA 3V89B 2YLNA 2F34A 2ZNSA 3TCFA 4IO7A 3EHUA 1Y20A 3FJMA 3N6TA 1QULA 4DXCA 3RTWB 5L9OA 3KG2A 3QXMA 4LZ5A 3QUJA 3IX1A 4GL8A 4BDLA 4ZECA 2OLBA 2AL4A 1SW4A 3V8XB 3VLWA 3PUWE 5M2VA 4YKJA 4PETA 5TU0A 1URDA 5DEXB 5CM6A 2Z8FA 3KN3A 2Q2AA 2QPQA 2F6GA 3BBRA 1GR2A 4H1XA 5KCJB 1QJMA 3PMVA 4JBZA 1O63A 2CMOA 4IO6A 4F3PA 1B5IA 2THIA 3OO8A 1OVBA 4O3CA 3RUMA 3RT8A 5I2NB 1FTKA 2QS4A 4YKPA 1B2HA 5F1QA 3B6QA 3ILUB 3MP8A 4Q5TA 2VOZA 3K0VA 4M1VA 5CMKA 3LBSA 5AA2B 1JW1A 1P1UA 3TTNA 4OETA 3U92A 1SQYA 2ZXTA 4GLIA 4ZS9A 1B05A 4I62A 3UGWA 4NTLA 4EUOA 4OFJA 4QFLA 4R9FA 2PT1A 5TP9B 4NF5B 4HCYA 3TUSA 4JSOA 1HSLA 3EPEA 2FNCA 4NMYA 1AL3A 1FQBA 3FVGA 1LLSA 2Z8DA 3KJ7A 2HEUA 2ONKE 1N7XA 3T96B 1D4NA 3IK6B 2F7CA 3H7MA 1PC3A 1R9QA 1OVTA 4ZEBA 2XX7A 1MY1A 4F3SA 4KYDA 5FTIA 3H6WA 4RPNA 4WEDA 1BTJA 2Y7RA 4QRZA 1Y4TA 5KCJA 1O7TA 4GRKA 4MH5A 1B3GA 1CB6A 3RNNA 3K00A 4OQOA 2F78A 3IB0A 4F1VA 4N07A 3W9VA 1XC1A 3EF7A 3DP4A 1M5FA 1N0TA 3RY3A 4IY6A 3OELA 4YMBA 1L5TA 3TELA 1LAXA 4FIMA 3QYTA 1A8EA 1MDP1 3QIMA 5ICTA 5IAIA 3HV1A 5L9MA 3SEXA 4NF6B 2UYEA 2QL3A 4NF8A 4GF8A 2D5WA 3H03A 3CFZA 4OMBA 5DVFA 4GL0A 3W9WA 1B7UA 5B70A 2F36A 3UORA 1LFIA 4E0WA 4TLLB 4AQ4A 4NE4A 3KSJA 2YPNA 4N6PA 1OLAA 1RKMA 4I9DA 2V3UA 2I4BA 1B5HA 2RKMA 1SW2A 3E13X 1NNKA 2B3FA 5DTBA 5H8HA 3JV9A 1LGBC 2G29A 2QRYA 2O51A 4IGTA 3CG1A 3FJ7A 3V5AA 1MDQA 3LR1A 2X7PA 5LOMA 1OQHA 3CVGA 4XTCQ 2RINA 4ZEFA 1US4A 2I0CA 2RCBA 4DCXA 2IA4A 2ZMBA 1OIBA 4G68C 3IJOB 4LZ7A 1B51A 5I2KB 3RT6B 4FJPA 4F3GA 3R7XA 3CG3A 2O69A 2DWHA 3MUQA 2I48A 3G3GA 4O3BA 3M8UA 3GBAA 2DQVA 1EZOA 4U4XA 1EZPA 1WVJA 3E4RA 3FXUA 4POXA 1S50A 4F31B 4RY1A 1FQAA 4R6YA 4KFQA 1R9LA 1B7ZA 2IEEA 4LVQA 1LFHA 3FIRA 1O64A 5JTYA 1MY0A 1PB9A 1VFDA 2X26A 3VVDA 4DE8A 1B3EA 3RN8A 4OFOA 4F2OA 1UTHA 5CC2A 5H8NB 1P1QA 4G8MA 4O3AA 4DXBA 2DXYA 1A99A 2Y7WA 2HZLA 3C35A 2Y7KA 4XKNA 1IITA 4HTGA 3O9PA 2R9JA 1UTBB 3LUYA 3IOWA 3W15C 1AMFA 4U4SA 1Y9UA 1MM6A 1AIVA 3IOTA 4LZ8A 3VVFA 3USDA 1VFEA 3KOSA 4AB6A 5HM4B 1MH3A 1BP5A 4XXUA 2ESNA 2XX9A 3CI8A 3C36A 4ZDMA 1B32A 3KJTA 1P1NA 2DWJA 1UQWA 1XVYA 4YB7A 4H67A 4EF1A 4OEVA 3U8QA 3AXFA 1FTOA 3O6GA 4GWOA 5TPAA 1LAGE 1JVYA 2DWAA 1B3HA 4G77A 3K1PA 3TPAA 1SD3A 2HAUA 5A5XA 4IB2A 1II5A 1XVXA 2F35A 1ELJA 3N26A 3FVOA 2OCUA 4RXLA 3KEIA 1M5CA 1ATGA 4AB5A 1P99A 4YMAA 4JWXA 2H4IA 1PDAA 4GFRA 2A5TB 3FD3A 3WAFA 3TTMA 1B52A 1TFDA 1MXXA 4IO5A 3QAXA 1POTA 2PMSA 1FTMA 1M5BA 3OO7A 4THIA 4QF9A 5KZTA 1MQIA 1QUIA 3VV5A 3LSLA 2UVIA 3G3FA 4M4GA 4JWYA 3MVXA 2Y7IA 1UTBA 1H76A 3IO4A 1JW4A 2H99A 1B4ZA 2XXQA 3BFTA 3FGSA 3M3LA 4I8CA 1N76A 3K6VA 3PU5A 2F97A 4OERA 3OEMA 4JB7A 1Q1KA 4HS7A 3DELB 3L6GA 1J1NA 2VGQA 3PMWA 4DZ1A 5I57B 4BDQA 3MAMA 2GFEA 5K2XA 5CI5A 2I3WA 3MZ9A 4ESXA 4IO4A 3MPKA 3VE1B 5EHSA 5KDTB 1SI0A 1ZKBA 3TTKA 1DMBA 2OZZA 3IOUA 4LONB 3FV2A 1Y3NA 1MXYA 1IEJA 4F2QA 1S9TA 1URSA 2OBGA 4KD5A 2OWTA 2VP1A 3QK6A 4KYSA 3Q25A 2CZLA 4LATA 3R6UA 1BKAA 3KOTA 3RQTA 5CMMA 3S9EA 5I58A 3FV1A 3VLVA 3T9XB 4QFPA 4EQBA 1Y4CA 3PV0E 5JK4A 1OMPA 1I6AA 2A5TA 2ONRA 3N6UA 2I4CA 1I6QA 1ANFA 4U23A 4BDOA 2QMWA 4R2FA 4NF4B 4WKMA 4RJZA 1MH4A 5I84A 3TAJA 2D21A 2F6PA 3PPOA 3IOVA 1B6HA 1TT1A 5ELVA 1GVCA 1A54A 1JVXA 1Z7ME 4OHNA 1Y1ZA 4F1UA 3SERA 3HO7A 1NH8A 1US5A 4X1DA 3Q27A 2DXRA 2Q8JA 4PFWA 5I59B 2PX1A 2GH9A 3HHFA 1DPPA 1SVXB 3ILTB 4OESA 3TCHA 2ZYOA 4H8IA 4GOTA 1Y3PA 1Y1MA 5L9SA 4OEUA 2NXOA 3SEUA 3ODBA 4Q30B 2A5SA 4WEPA 4G2ZA 1ZMGA 4Q8RA 3KBRA 1T0KA 4BDRA 5KDTA 5AA1A 1JETA 2XXIA 4ISUA 3H3GA 1IIWA 3T9VA 4DCYA 3N94A 4P0GA 1USYE 2HCAA 4KHZE 1A8FA 2P2AA 5DVIA 2V84A 2RC9A 4R6HA 3HCQA 3U1OA 2REGA 4NEDA 4XIGQ 2H98A 1N04A 3OSRA 3FXQA 1LB9A 4BDMA 2VD3A 4HCWA 5B7DA 2H25A 5DEXA 3DM0A 4ZE8A 4GIZA 2XXHA 1M5DA 3S9NC 1SW1A 2ZNTA 1B9JA 3ZKKA 1MRPA 2UYFA 4NF4A 4R74A 1WODA 3RTFB 2HXWA 1XOCA 3LSFB 5EHMA 1MQDA 1IZ1A 1ZTYA 3OEKA 5I2NA 2VD2A 2V3QA 4WXJA 3PPRA 3TFLA 3H6TA 4OXVA 3CIJA 3S9LC 4YAHX 4NWDA 2UVHA 3IJXB 1IXGA 5AA2A 2FA7A 5J1DA 3IR1A 4F3BA 1SW5A 1MG1A 4F19A 3OD7A 3VLUA 4ZZAA 1MXUA 3TCGA 5TP9A 4NF5A 1DSNA 1GTKA 4UA8A 2Q88A 1DTZA 1JW5A 1DPEA 3FASA 3CSGA 2O84X 4H0WA 3TQWA 3C9HA 1UIVA 4QFOA 3HSTA 4GXAA 3QSLA 3O6IA 4H5GA 1N3WA 3GXAA 3ZSFA 1IUDA 3OMBA 3WAEA 3CR9A 3T9HB 4XKRA 4YKKA 3IB2A 4P11A 4PFYA 4ELOA 2I58A 3KFMA 1M5EA 4EF2A 1B7HA 4HW8A 1B0LA 1OLCA 3MVZA 4PQJA 2RC8A 3SDFA 3VXCA 2NVUB 4ONYA 5AA4B 3N5LA 3C31A 2RC7A 4N13A 4FE8A 3G3JA 1LAHE 3MPLA 3RPWA 1NH7A 3FATA 2AIXA 1SDXA 2O7IA 4QSCA 3C4MA 4EQ9A 1EU8A 1USYH 4KQPA 3MVWA 4X9TA 3U72A 1LB8A 4NF6A 3PUZE 4LQ2A 3DP8A 1JEVA 2NUVA 4OENA 4OVJA 3MZBA 2HFBA 3TTLA 4C0RA 3MZ1A 4PP0A 2NOOA 2AL5A 4G68B 1H43A 3O2AA 3G3KA 4E0XA 4KYEA 2DE2A 1URGA 1LCTA 1LBBA 1YCJA 3C32A 2QJEA 4QHQA 2I0BA 1FCKA 3G3HA 1B40A 4FORA 1QUJA 1DTGA 4POWA 1H45A 4Z7EA 2DP8A 2W7YA 1BIYA 3TODA 1MPCA 4NWCA 2GHBA 4F29A 4P0IA 1XHYA 2QSXA 1KWHA 5H8QB 5ITOA 1H44A 2DE4A 2QS3A 3UN6A 4ZEIA 3Q26A 2V3TA 2ALUA 5I2KA 3K6UA 4KCCA 2QS2A 4KR5A 2M8CA 4RK9A 2ONSA 3H6UA 5BWJA 1QUKA 4GVOA 2YJPA 1TWYA 4QSDA 2XXUA 2HAVA 5BUUA 1B4HA 2RF1A 3IAZA 2H9BA 1B1XA 3C33A 4H6DA 3CSBA 5CMCA 3QUFA 2DVCA 2XXVA 3JYRA 3U93A 3B6WA 3K1MA 1ZJLA 1B3LA 1FW0A 1JEUA 4DLDA 5H8NA 3U94A 4C1UA 3KGCA 4FEDA 2Q9TA 4DIGA 3RGYA 4OTEA 4H65A 2F7AA 4R72A 1SYHA 3MW0A 1MS7A 1B58A 3IL1B 1AOVA 1AH5A 3F11A 4R75A 3E3KA 2GHAA 3T66A 1SI1A 3FVKA 3MP6A 1NNTA 2ZYNA 1MPDA 3FZVA 1PBPA 2Z22A 4U1ZA 1YPNA 3SKPA 2XX8A 3GZGA 1D9VA 5IKBA 1IXCA 1A7LA 3TYHA 1MY3A 1FQFA 1SBPA 3K02A 3T22A 3DLNA 3S4UA 3FJGA 3FUZA 4OYVA 4JXIA 1LBCA 4ELRA 3IO6A 4BLAA 1A55A 1ZLQA 4RPOA 3TEPA 3ZKLA 1A40A 1MQJA 1Y3QA 2I49A 3HN0A 4R73A 1I6BA 4EQ7A 4G8NA 1S7YA 2DE3A 3K2DA 2X7QA 5K2YA 5CRYA 1OQGA 4JWOA 4YKIA 4FATA 3MWBA 3G3IA 4QFKA 4XKQA 4R9GA 5F7VA 3K6WA 2XHDA 3TKDA 1B46A 5L8DA 4YB6A 4FEBA 1IXHA 3B7DA 3DP6A 3H06B 3PMXA 2Q89A 1NMUA 3S2VA 2RCAA 3K6XA 2UVJA 2XXPA 1JNFA 1HSJA 2DWIA 4OWDA 2XXTA 1B1HA 3KN8A 1IQ7A 3THIA 1LFGA 3LSXA 3OO9A 5DT6A 4F39A 5I57A 3PD8A 2O68A 3VXBA 1QKBA 1NNFA
chains in the Genus database with same CATH superfamily
3UA8A 1N3XA 1VSOA 3H4ZA 1MXVA 2CZHA 4HE2A 1FTLA 4GXSB 1YTVA 3LC8A 4NF8B 4XF5A 3UP9A 4QSEA 5FHNA 5EQAA 2B3BA 3SEYA 3CFXA 3BFUA 4FAJA 4FBPA 1MY4A 3C34A 2HPGA 3CRBA 1NV4A 3T93B 5IZZA 4KI0E 3PUXE 1F9BA 1MQGA 4NQ8A 3MJNA 4QFNA 3MSTA 4PE5B 2PYYA 2F3BA 2B65A 4RA1A 1MM7A 1FQEA 1ZBMA 4JSDA 4GWUA 2REJA 4TQUQ 5H8HB 2O7UA 1MPBA 3CFLA 1WDNA 4GX3A 5DVJA 4RYAA 4YU0A 2O6AA 4JDFA 2NWJA 1ZU0A 3E9XA 3K4UA 3O6HA 5EYFA 3TTRA 3L6HA 1B0HA 2G93A 4RK2A 4BDNA 2XXWA 3EQ1A 1PB7A 1GGGA 4ESWA 2Z23A 3KN7A 1D3KA 3I5OA 4GWXA 1NV7A 2PT2A 1PEBA 1DOTA 1Z7NE 5H8FB 3FXRA 3TMGA 3PUYE 2QMXA 5I56B 5HPQA 2WKYA 3MVYA 3TQLA 2AYSA 4U21A 4ELPA 4UABA 3VDFA 4ZEKA 3MQ9A 1D9QA 5I59A 3HPIA 4GWWA 4G4PA 4EDPA 3GLBA 2XXYA 3PUVE 4GQOA 1XT8A 1EYIA 3FVNA 4KPTA 4C1TA 4G8HA 3SETA 1MXWA 4H8JA 2P1SA 2Q74A 5DYHA 2Q2CA 4MLQA 2ZNUA 5JTYB 2DOJA 4ECFA 3TDJA 3OXNA 4RNSA 1FPBA 2PBWA 3MC2A 1B3FA 4ZEDA 4LP2B 5H8SA 1NNPA 3KC0A 1GV8A 4I1DA 1NFTA 5ET5A 1D9YA 1FPDA 1UTHB 2UXAA 1N7WA 1N84A 3LSWA 1HSEA 4O8MA 2H5YA 4TOZA 4UACA 2XXRA 3HHGA 5FTHA 2QVVA 4F1YA 3GBBA 1FSAA 3Q29A 2DYXA 1UIUA 5ESYA 3MP1A 4F22A 5AA2D 4U1OA 3JZJA 2ANJA 2F7BA 3P7IA 2HQ0A 3IORA 2XWKA 4OVQA 4OVTA 4IO2A 3O66A 4KCDA 4PFTA 3S9MC 4Q0CA 5H8FA 5J16A 3B50A 5I56A 4F18A 5JEIA 3O28A 4OZ9A 3M3KA 4R2BA 3UIFA 2WBDA 4YZZA 3OO6A 3RPLB 1BLFA 3SEVA 1LAFE 1QVSA 2Z8EA 1MY2A 1QW0A 2VHAA 1FTAA 3ONMA 1FQCA 4HE0A 5CBSA 3I6VA 5TPAB 1FBHA 4MF3A 5CBRA 1QKAA 2F8DA 4PFUA 2Y7PA 4IGRA 1RYXA 3EHSA 4IO3A 2XD2A 3OENA 3D4GA 3VFJA 1P1OA 2F5XA 3KZGA 5A5XB 2OWSA 1JQFA 1NKXA 4H5FA 2QS1A 4NF0A 4AS5A 2DVZA 4G61A 3SZPA 4YB5A 4U2RA 1I69A 1R1NA 2BJJX 3ECRA 2I6EA 3NOHA 1VR5A 5FHMA 1TXFA 4NGUA 4MFIA 1NL5A 2KLFA 1PB8A 2UVGA 2V93A 4IY5A 3EN3A 2E1SA 3B6TA 2OJTA 4HXVA 1DCUA 3OSQA 3Q28A 3PPPA 1H3DA 4DXUA 3K1NA 4Z0IA 2ZZXA 2PFYA 3PD9A 2P0SA 3R26A 2R6GE 1EYJA 4LQ5A 3D4CA 3PGFA 3O29A 5AA4A 1ZIUA 5ICQA 1TFAA 5A5LA 3E78A 1IXIA 1FQDA 4X1BA 3V83A 4PCDA 3G7WA 3A3CA 4OFLA 3A09A 4PFBA 5ITPA 4P3LA 4PGNA 4K3FA 3RLFE 4XKPA 1SYIA 2R71A 1G0HA 4GD5A 2ZYMA 1P1WA 2D3IA 4LUBA 2B4MA 1LCFA 5ET7A 4ND9A 5FHOA 3EHTA 4MEVA 4PF8A 1EZ9A 3OOAA 2DSFA 3SESA 4NN3A 4GBVA 5FBPA 4G68A 2E0SA 1R6ZA 4EXKA 3H6VA 3UK4A 4I3EA 5I58B 3BKIB 4MNIA 4U22A 5CMBA 5AA3A 1FJ9A 5AE4A 3T9UA 1MQHA 1MXZA 1PBQA 1LEVA 2DS9A 2QVRA 2V25A 4TLMB 1RYOA 3M3FA 2WYKA 2FYIA 4MBPA 2R8TA 3VVEA 4LA9A 5HBCA 3ZS6A 2O1MA 1G0IA 1B5JA 4OA4A 3MBPA 4R6KA 2ZYKA 4O94A 1VE4A 1Q35A 5H8QA 1YAEA 4X48A 4N17A 5EQ7A 3PPQA 3U65A 2I3VA 4EXLA 2XXXA 4N15A 5ISUA 4PAKA 2MKZA 2L5VA 3KSXA 3SEWA 3A3UA 3LUZA 3TZAA 2LAOA 1XS5A 4DDDA 2ABHA 2XD3A 4ZE9A 1POY1 4ELQA 4YICA 3O97A 2XWOA 1CE2A 1FTJA 3IB1A 2Y84A 4L17A 2PVUA 1NV5A 2GRVA 2OK2A 3PPNA 3K01A 4MLVA 2O1LA 1EH3A 2Q8MA 4ZZEA 2HZKA 1LSTA 3I3VA 4FECA 3V89B 2YLNA 2F34A 2ZNSA 3TCFA 2HXRA 4IO7A 3EHUA 1Y20A 3FJMA 3N6TA 1QULA 4NX1A 4DXCA 3RTWB 5L9OA 3KG2A 3QXMA 4LZ5A 3QUJA 3IX1A 4GL8A 4JVCA 4BDLA 4ZECA 2OLBA 2AL4A 1SW4A 4QBAA 3V8XB 3VLWA 3PUWE 5M2VA 4YKJA 4PETA 5TU0A 1URDA 5DEXB 5CM6A 2Z8FA 3KN3A 2Q2AA 2QPQA 2F6GA 3BBRA 1GR2A 4H1XA 5KCJB 1QJMA 3PMVA 4JBZA 1O63A 2CMOA 4IO6A 4F3PA 1B5IA 2THIA 3OO8A 1OVBA 4O3CA 3RUMA 4DI3D 3RT8A 5I2NB 3BIHA 1FTKA 2QS4A 4YKPA 4GWSA 1B2HA 5F1QA 3B6QA 3ILUB 3MP8A 1BK4A 4Q5TA 2VOZA 3K0VA 3FBPA 4M1VA 1CNQA 5CMKA 3LBSA 5AA2B 5I7IA 3ISPA 1FPFA 1JW1A 1P1UA 3TTNA 4OETA 3U92A 1SQYA 2ZXTA 4GLIA 4ZS9A 1B05A 4I62A 3UGWA 4NTLA 4EUOA 4OFJA 4QFLA 4R9FA 2PT1A 5TP9B 4NF5B 4HCYA 3TUSA 4JSOA 1HSLA 3EPEA 1YYZA 2FNCA 4GX4A 4NMYA 1AL3A 4N8GA 1FQBA 3FVGA 1LLSA 2Z8DA 3KJ7A 2HEUA 3EKIA 2KR0A 2ONKE 1N7XA 3T96B 1D4NA 3IK6B 5ET6A 2F7CA 3H7MA 1PC3A 1R9QA 1OVTA 4ZEBA 3A29A 2XX7A 1MY1A 4F3SA 4KYDA 4P9KA 5FTIA 3H6WA 4RPNA 4WEDA 1BTJA 2Y7RA 4QRZA 1Y4TA 5KCJA 1O7TA 4GRKA 4MH5A 1Q9DA 2PFZA 1B3GA 1CB6A 3RNNA 3K00A 4OQOA 2F78A 3IB0A 4F1VA 4N07A 3W9VA 1XC1A 2WYPA 1NV6A 1NV3A 3EF7A 4PE3A 3DP4A 1M5FA 1N0TA 3RY3A 4IY6A 3OELA 1KA1A 4YMBA 1L5TA 3TELA 1LAXA 5IZ3A 4AS4A 4FIMA 3QYTA 1A8EA 1MDP1 3QIMA 4OVRA 5ICTA 5IAIA 3HV1A 5L9MA 3T0JA 3SEXA 4NF6B 2UYEA 1IMFA 2QL3A 4NF8A 4GF8A 2D5WA 3H03A 3CFZA 4OMBA 4KXPA 5DVFA 4GL0A 3W9WA 1B7UA 5B70A 2F36A 3UORA 1LFIA 4E0WA 4TLLB 4AQ4A 4MX6A 3KC1A 4NE4A 3KSJA 2YPNA 4N6PA 2FIXA 1OLAA 1RKMA 4I9DA 2V3UA 2I4BA 1B5HA 2RKMA 1SW2A 3E13X 1NNKA 2B3FA 5DTBA 5H8HA 3JV9A 1LGBC 2G29A 2QRYA 2O51A 4IGTA 3CG1A 3FJ7A 4GBWA 3V5AA 1MDQA 2CEXA 3LR1A 2X7PA 2F3DA 5LOMA 5DW8A 1IMEA 4PFIA 4XFEA 1OQHA 3CVGA 4XTCQ 2RINA 2QVUA 4ZEFA 4N6DA 1US4A 4IR8A 2I0CA 2RCBA 4DCXA 2IA4A 1FPGA 2XWVA 2ZMBA 1OIBA 4G68C 3IJOB 4LZ7A 2XA5A 1B51A 4O7IA 5I2KB 3RT6B 4FJPA 4F3GA 3R7XA 3CG3A 2O69A 2DWHA 3MUQA 2I48A 3G3GA 4GX6A 1RDYA 4O3BA 3M8UA 3GBAA 2DQVA 2P3VA 1EZOA 4U4XA 1EZPA 5ET8A 1WVJA 3E4RA 3FXUA 4POXA 1S50A 4N4UA 4F31B 1AWBA 1LBWA 4RY1A 1FQAA 4R6YA 4KFQA 1R9LA 1B7ZA 2PCRA 2IEEA 1FBEA 4LVQA 4PF6A 1LFHA 3FIRA 1O64A 5JTYA 1MY0A 1PB9A 1VFDA 2X26A 3VVDA 4DE8A 5EQ8A 1B3EA 3BIGA 3RN8A 4OFOA 4F2OA 1UTHA 5CC2A 5H8NB 5IZ1A 2WBBA 1P1QA 4G8MA 4O3AA 4DXBA 2DXYA 2FIEA 1A99A 2Y7WA 1LBVA 1NI9A 2HZLA 4I3YA 3C35A 2Y7KA 4XKNA 1IITA 4HTGA 3O9PA 3GYYA 2FBPA 2R9JA 1UTBB 3LUYA 3IOWA 2KQZA 3W15C 1AMFA 2WX9A 4U4SA 1Y9UA 1MM6A 1AIVA 3IOTA 4LZ8A 3VVFA 3USDA 1VFEA 3KOSA 4AB6A 5HM4B 1MH3A 4P1LA 1BP5A 4LN5A 4XXUA 2ESNA 2XX9A 3CI8A 3C36A 4ZDMA 1B32A 3KJTA 3RYDA 1P1NA 2DWJA 1UQWA 1XVYA 4YB7A 4H67A 4EF1A 4OEVA 3RPLA 3U8QA 3AXFA 1FTOA 2VPOA 3O6GA 4GWOA 5TPAA 1LAGE 1JVYA 2DWAA 1FBFA 3FXBA 1B3HA 1FRPA 1FBPA 4G77A 2OX3A 3K1PA 3TPAA 1SD3A 2HAUA 5A5XA 3IFCA 4IB2A 4OVPA 1NV0A 1II5A 1XVXA 2F35A 1ELJA 3N26A 3FVOA 4PC9A 2OCUA 4RXLA 3KEIA 5EYGA 1M5CA 1ATGA 4AB5A 1P99A 4YMAA 4JWXA 2H4IA 1PDAA 4GFRA 2A5TB 3FD3A 3WAFA 3TTMA 1B52A 1TFDA 1MXXA 4IO5A 3QAXA 1POTA 2PMSA 1FTMA 1M5BA 3OO7A 4THIA 4QF9A 5KZTA 1MQIA 1QUIA 3VV5A 3LSLA 2UVIA 2CZKA 2CEYA 3G3FA 4M4GA 4JWYA 3MVXA 2CZIA 2Y7IA 1UTBA 1H76A 3IO4A 5IGAA 1JW4A 2H99A 1B4ZA 2XXQA 3BFTA 3FGSA 3M3LA 1SPIA 4H46A 3HFUA 4I8CA 1N76A 1NUWA 3K6VA 3PU5A 2F97A 4OERA 3OEMA 4JB7A 1FBCA 1Q1KA 4HS7A 3DELB 3L6GA 1LBXA 1QGXA 1YXIA 1J1NA 2VGQA 3PMWA 4DZ1A 5I57B 4BDQA 3CHGA 3MAMA 2GFEA 5K2XA 5CI5A 2I3WA 3MZ9A 4ESXA 4IO4A 3MPKA 2XWIA 4MIJA 4N8YA 3VE1B 5EHSA 5KDTB 2WEFA 1SI0A 1ZKBA 3TTKA 4P56A 1DMBA 2OZZA 3IOUA 4LONB 3FV2A 1Y3NA 1MXYA 1IEJA 4F2QA 1S9TA 1NUZA 1URSA 2OBGA 1NV1A 4KD5A 2OWTA 2VP1A 3QK6A 4KYSA 4MJOA 3Q25A 2CZLA 4LATA 3R6UA 1BKAA 3KOTA 3RQTA 5CMMA 3S9EA 5I58A 3FV1A 3VLVA 3T9XB 4QFPA 4EQBA 1Y4CA 3PV0E 5JK4A 1KZ8A 1OMPA 1I6AA 1FPEA 2A5TA 2ONRA 3N6UA 4QXDA 2I4CA 1I6QA 1ANFA 4U23A 4BDOA 2QMWA 4R2FA 4NF4B 4WKMA 4RJZA 1MH4A 2GQ1A 5I84A 4OANA 4PDHA 4N91A 3TAJA 2D21A 2F6PA 3PPOA 3IOVA 1B6HA 1TT1A 5EYHA 4OVSA 5ELVA 1GVCA 1A54A 1JVXA 1Z7ME 4OHNA 1Y1ZA 4F1UA 3SERA 3HO7A 1NH8A 1US5A 4X1DA 3Q27A 2DXRA 2Q8JA 4PFWA 5I59B 4I40A 2PX1A 2GH9A 3HHFA 1DBZA 1DPPA 1SVXB 3ILTB 4OESA 3D1RA 3TCHA 2ZYOA 4H8IA 4JVIA 4GOTA 1Y3PA 1Y1MA 5L9SA 4OEUA 2NXOA 3SEUA 3ODBA 4Q30B 4N81A 2A5SA 4WEPA 4G2ZA 4O7MA 1ZMGA 4Q8RA 3KBRA 1T0KA 1FPIA 4BDRA 5KDTA 5AA1A 1JETA 2XXIA 4ISUA 3H3GA 1IIWA 2ZZVA 3T9VA 4HE1A 4DCYA 4PTKA 2VPNA 3N94A 4P0GA 2ZZWA 1USYE 2HCAA 4KHZE 1A8FA 2P2AA 5DVIA 2V84A 1RDXA 2RC9A 4R6HA 4DI4B 3HCQA 1JP4A 3U1OA 2REGA 4NEDA 4XIGQ 2H98A 1N04A 3OSRA 3FXQA 1EYKA 1LB9A 4BDMA 2VD3A 4HCWA 1NUXA 5B7DA 2H25A 5DEXA 3DM0A 4ZE8A 2B4LA 4GIZA 2XXHA 1M5DA 3S9NC 1SW1A 2ZNTA 1B9JA 3ZKKA 1MRPA 2UYFA 4NF4A 4R74A 1WODA 5T3JA 3RTFB 2HXWA 1XOCA 3LSFB 5EHMA 1MQDA 1IZ1A 1ZTYA 3OEKA 5I2NA 2VD2A 2V3QA 1XI6A 4WXJA 3PPRA 3TFLA 3H6TA 4OXVA 3CIJA 3S9LC 4YAHX 4GWZA 4NWDA 2UVHA 3IJXB 1IXGA 5AA2A 2FA7A 5I3SA 1NV2A 5J1DA 1IMDA 3IR1A 4F3BA 1SW5A 1MG1A 4F19A 3OD7A 3VLUA 4ZZAA 1MXUA 4P47A 3TCGA 5TP9A 4NF5A 4JVDA 1DSNA 1GTKA 4UA8A 1FPLA 2Y5KA 2Q88A 1DTZA 1JW5A 1DPEA 3FASA 3CSGA 2O84X 2V4CA 4H0WA 3TQWA 3C9HA 1UIVA 4QFOA 2FHYA 4P1EA 3HSTA 3B8BA 4NHBA 4GXAA 3QSLA 3O6IA 4H5GA 1N3WA 3GXAA 3ZSFA 1IUDA 3OMBA 3WAEA 3CR9A 3T9HB 4XKRA 4YKKA 3IB2A 4P11A 4PAIA 3IFAA 4PFYA 4ELOA 1LBYA 2I58A 1M5EA 3KFMA 4EF2A 1B7HA 4HW8A 1B0LA 1OLCA 4GWYA 3MVZA 4PQJA 2RC8A 3SDFA 3VXCA 4X8RA 2NVUB 4ONYA 5AA4B 1LBZA 3N5LA 3C31A 2RC7A 4N13A 4FE8A 3G3JA 1LAHE 3MPLA 3RPWA 1NH7A 2FVZA 3FATA 2AIXA 1SDXA 2HHMA 2O7IA 4QSCA 3T1BA 3C4MA 2OWZA 4EQ9A 4MMPA 1EU8A 1USYH 1FPKA 4KQPA 3MVWA 4X9TA 3U72A 1LB8A 3ROJA 4NF6A 3PUZE 1FJ6A 1FBDA 4LQ2A 3DP8A 1JEVA 2NUVA 4OENA 4OVJA 3MZBA 2HFBA 3TTLA 4C0RA 3MZ1A 1KA0A 4MCOA 4PP0A 2NOOA 2XXKA 2AL5A 4G68B 1H43A 3O2AA 3G3KA 4E0XA 4KYEA 2DE2A 1URGA 1LCTA 4MNPA 1LBBA 1K9YA 1YCJA 3PTYA 3C32A 2QJEA 4QHQA 1NUYA 2I0BA 1FCKA 3G3HA 1B40A 4FORA 1QUJA 1DTGA 3MYUA 4POWA 1H45A 4N6KA 4Z7EA 3KBZA 2DP8A 2W7YA 1BIYA 4NG7A 3TODA 1MPCA 4NWCA 2GHBA 4F29A 4P0IA 2BJIA 1XHYA 2QSXA 1KWHA 5H8QB 5ITOA 4P8BA 1IMBA 1H44A 2DE4A 2QS3A 3UN6A 4ZEIA 3Q26A 2V3TA 2ALUA 5I2KA 3K6UA 4KCCA 2QS2A 4KR5A 2M8CA 4RK9A 2ONSA 3H6UA 5BWJA 1QUKA 4GVOA 2YJPA 1TWYA 4QSDA 2XXUA 2HAVA 5BUUA 1B4HA 2RF1A 2P3NA 3IAZA 2DDKA 2H9BA 1B1XA 1IMCA 4H45A 3C33A 4H6DA 1K9ZA 3CSBA 1FPJA 5CMCA 3QUFA 2DVCA 2XXVA 3JYRA 3U93A 3B6WA 3K1MA 1ZJLA 1B3LA 1FW0A 1JEUA 4DLDA 5H8NA 3U94A 4C1UA 3KGCA 4MNCA 4FEDA 2Q9TA 4DIGA 3RGYA 4OTEA 4H65A 2F7AA 5I5PA 4MAGA 4R72A 1SYHA 3MW0A 1MS7A 1B58A 4X04A 3IL1B 1AOVA 1AH5A 3F11A 4R75A 3E3KA 2GHAA 3T66A 1SI1A 3FVKA 3MP6A 1NNTA 2ZYNA 1MPDA 5EQ9A 1DK4A 3FZVA 1PBPA 4PBQA 2Z22A 4U1ZA 1YPNA 3SKPA 2XX8A 3GZGA 4PGPA 1D9VA 5IKBA 1IXCA 1A7LA 3QMFA 4MHFA 3TYHA 1MY3A 1FQFA 1SBPA 3K02A 3T22A 3DLNA 3S4UA 3FJGA 4PAFA 4NAPA 3FUZA 4OYVA 4JXIA 1LBCA 4ELRA 5LDZA 3IO6A 4BLAA 1A55A 1ZLQA 4RPOA 2JJKA 4PFRA 3TEPA 3ZKLA 1A40A 1MQJA 1Y3QA 2I49A 3HN0A 4R73A 5IM2A 1I6BA 4EQ7A 4G8NA 1S7YA 2DE3A 2Y5LA 3K2DA 2QFLA 4PBHA 2X7QA 5K2YA 5CRYA 1OQGA 4JWOA 4YKIA 1FBGA 1RDZA 2VT5A 1VDWA 4FATA 3LV0A 3MWBA 3E79A 3G3IA 4QFKA 4XKQA 4R9GA 5F7VA 3K6WA 2XHDA 5F24A 3TKDA 1B46A 5L8DA 4YB6A 5LTCA 4FEBA 1IXHA 3B7DA 3DP6A 3H06B 4XEQA 3PMXA 2Q89A 1NMUA 3S2VA 2RCAA 3K6XA 1YZ0A 2UVJA 2XXPA 1JNFA 1INPA 1HSJA 2DWIA 4OWDA 2XXTA 1B1HA 3KN8A 4PDDA 1IQ7A 3THIA 1IMAA 1LFGA 3LSXA 3OO9A 5IZ3B 5DT6A 4F39A 5I57A 3PD8A 2O68A 3VXBA 1QKBA 1NNFA
chains in the Genus database with same CATH topology
3UA8A 1N3XA 1VSOA 3H4ZA 1MXVA 1FTLA 4GXSB 1YTVA 3LC8A 4NF8B 3UP9A 4QSEA 5FHNA 2B3BA 3SEYA 3CFXA 3BFUA 4FAJA 1MY4A 3C34A 3CRBA 3T93B 4KI0E 3PUXE 1F9BA 1MQGA 3MJNA 4QFNA 4PE5B 2PYYA 2B65A 4RA1A 1MM7A 1FQEA 1ZBMA 4JSDA 2REJA 4TQUQ 5H8HB 2O7UA 1MPBA 3CFLA 1WDNA 5DVJA 4RYAA 4YU0A 2O6AA 4JDFA 2NWJA 1ZU0A 3E9XA 3K4UA 3O6HA 5EYFA 3TTRA 3L6HA 1B0HA 2G93A 4RK2A 4BDNA 2XXWA 3EQ1A 1PB7A 1GGGA 4ESWA 2Z23A 3KN7A 1D3KA 3I5OA 2PT2A 1PEBA 1DOTA 1Z7NE 5H8FB 3FXRA 3TMGA 3PUYE 2QMXA 5I56B 5HPQA 2WKYA 3MVYA 3TQLA 2AYSA 4U21A 4ELPA 3VDFA 4ZEKA 3MQ9A 5I59A 3HPIA 4G4PA 4EDPA 3GLBA 2XXYA 3PUVE 4GQOA 1XT8A 3FVNA 4KPTA 4C1TA 4G8HA 3SETA 1MXWA 4H8JA 2P1SA 5DYHA 2Q2CA 4MLQA 2ZNUA 5JTYB 2DOJA 4ECFA 3TDJA 3OXNA 4RNSA 2PBWA 3MC2A 1B3FA 4ZEDA 4LP2B 5H8SA 1NNPA 1GV8A 4I1DA 1NFTA 1D9YA 1UTHB 2UXAA 1N7WA 1N84A 3LSWA 1HSEA 2H5YA 4TOZA 4UACA 2XXRA 3HHGA 5FTHA 4F1YA 3GBBA 3Q29A 2DYXA 1UIUA 3MP1A 4F22A 5AA2D 4U1OA 3JZJA 2ANJA 2F7BA 3P7IA 2HQ0A 3IORA 4IO2A 3O66A 4KCDA 4PFTA 3S9MC 4Q0CA 5H8FA 5I56A 4F18A 5JEIA 3O28A 4OZ9A 3M3KA 4R2BA 3UIFA 4YZZA 3OO6A 1BLFA 3SEVA 1LAFE 1QVSA 2Z8EA 1MY2A 1QW0A 2VHAA 3ONMA 1FQCA 5CBSA 3I6VA 5TPAB 4MF3A 5CBRA 1QKAA 2F8DA 4PFUA 2Y7PA 4IGRA 1RYXA 3EHSA 4IO3A 2XD2A 3OENA 3D4GA 3VFJA 1P1OA 2F5XA 3KZGA 5A5XB 2OWSA 1JQFA 1NKXA 4H5FA 2QS1A 2DVZA 4YB5A 4U2RA 1I69A 1R1NA 2BJJX 3ECRA 2I6EA 1VR5A 5FHMA 1TXFA 4MFIA 1NL5A 2KLFA 1PB8A 2UVGA 2V93A 4IY5A 3EN3A 2E1SA 3B6TA 2OJTA 3OSQA 3Q28A 3PPPA 1H3DA 4DXUA 3K1NA 4Z0IA 3PD9A 2P0SA 3R26A 2R6GE 4LQ5A 3D4CA 3PGFA 3O29A 5AA4A 1ZIUA 5ICQA 1TFAA 1IXIA 1FQDA 4X1BA 3V83A 3G7WA 3A3CA 4OFLA 3A09A 5ITPA 4K3FA 3RLFE 4XKPA 1SYIA 2R71A 4GD5A 2ZYMA 1P1WA 2D3IA 4LUBA 1LCFA 4ND9A 5FHOA 3EHTA 1EZ9A 3OOAA 2DSFA 3SESA 4G68A 2E0SA 1R6ZA 4EXKA 3H6VA 3UK4A 5I58B 3BKIB 4U22A 5CMBA 5AA3A 5AE4A 3T9UA 1MQHA 1MXZA 1PBQA 2DS9A 2V25A 4TLMB 1RYOA 3M3FA 2FYIA 4MBPA 3VVEA 4LA9A 5HBCA 3ZS6A 2O1MA 1B5JA 3MBPA 4R6KA 2ZYKA 1VE4A 1Q35A 5H8QA 1YAEA 4X48A 3PPQA 2I3VA 4EXLA 2XXXA 5ISUA 3KSXA 3SEWA 3A3UA 3TZAA 2LAOA 1XS5A 4DDDA 2ABHA 2XD3A 4ZE9A 1POY1 4ELQA 4YICA 3O97A 1CE2A 1FTJA 3IB1A 2Y84A 4L17A 2PVUA 2OK2A 2GRVA 3PPNA 3K01A 4MLVA 2O1LA 1EH3A 4ZZEA 2HZKA 1LSTA 3I3VA 4FECA 3V89B 2YLNA 2F34A 2ZNSA 3TCFA 4IO7A 3EHUA 1Y20A 3FJMA 3N6TA 1QULA 4DXCA 3RTWB 5L9OA 3KG2A 3QXMA 4LZ5A 3QUJA 3IX1A 4GL8A 4BDLA 4ZECA 2OLBA 2AL4A 1SW4A 3V8XB 3VLWA 3PUWE 5M2VA 4YKJA 4PETA 5TU0A 1URDA 5DEXB 5CM6A 2Z8FA 3KN3A 2Q2AA 2QPQA 2F6GA 3BBRA 1GR2A 4H1XA 5KCJB 1QJMA 3PMVA 4JBZA 1O63A 2CMOA 4IO6A 4F3PA 1B5IA 2THIA 3OO8A 1OVBA 4O3CA 3RUMA 3RT8A 5I2NB 1FTKA 2QS4A 4YKPA 1B2HA 5F1QA 3B6QA 3ILUB 3MP8A 4Q5TA 2VOZA 3K0VA 4M1VA 5CMKA 3LBSA 5AA2B 1JW1A 1P1UA 3TTNA 4OETA 3U92A 1SQYA 2ZXTA 4GLIA 4ZS9A 1B05A 4I62A 3UGWA 4NTLA 4EUOA 4OFJA 4QFLA 4R9FA 2PT1A 5TP9B 4NF5B 4HCYA 3TUSA 4JSOA 1HSLA 3EPEA 2FNCA 4NMYA 1AL3A 1FQBA 3FVGA 1LLSA 2Z8DA 3KJ7A 2HEUA 2ONKE 1N7XA 3T96B 1D4NA 3IK6B 2F7CA 3H7MA 1PC3A 1R9QA 1OVTA 4ZEBA 2XX7A 1MY1A 4F3SA 4KYDA 5FTIA 3H6WA 4RPNA 4WEDA 1BTJA 2Y7RA 4QRZA 1Y4TA 5KCJA 1O7TA 4GRKA 4MH5A 1B3GA 1CB6A 3RNNA 3K00A 4OQOA 2F78A 3IB0A 4F1VA 4N07A 3W9VA 1XC1A 3EF7A 3DP4A 1M5FA 1N0TA 3RY3A 4IY6A 3OELA 4YMBA 1L5TA 3TELA 1LAXA 4FIMA 3QYTA 1A8EA 1MDP1 3QIMA 5ICTA 5IAIA 3HV1A 5L9MA 3SEXA 4NF6B 2UYEA 2QL3A 4NF8A 4GF8A 2D5WA 3H03A 3CFZA 4OMBA 5DVFA 4GL0A 3W9WA 1B7UA 5B70A 2F36A 3UORA 1LFIA 4E0WA 4TLLB 4AQ4A 4NE4A 3KSJA 2YPNA 4N6PA 1OLAA 1RKMA 4I9DA 2V3UA 2I4BA 1B5HA 2RKMA 1SW2A 3E13X 1NNKA 2B3FA 5DTBA 5H8HA 3JV9A 1LGBC 2G29A 2QRYA 2O51A 4IGTA 3CG1A 3FJ7A 3V5AA 1MDQA 3LR1A 2X7PA 5LOMA 1OQHA 3CVGA 4XTCQ 2RINA 4ZEFA 1US4A 2I0CA 2RCBA 4DCXA 2IA4A 2ZMBA 1OIBA 4G68C 3IJOB 4LZ7A 1B51A 5I2KB 3RT6B 4FJPA 4F3GA 3R7XA 3CG3A 2O69A 2DWHA 3MUQA 2I48A 3G3GA 4O3BA 3M8UA 3GBAA 2DQVA 1EZOA 4U4XA 1EZPA 1WVJA 3E4RA 3FXUA 4POXA 1S50A 4F31B 4RY1A 1FQAA 4R6YA 4KFQA 1R9LA 1B7ZA 2IEEA 4LVQA 1LFHA 3FIRA 1O64A 5JTYA 1MY0A 1PB9A 1VFDA 2X26A 3VVDA 4DE8A 1B3EA 3RN8A 4OFOA 4F2OA 1UTHA 5CC2A 5H8NB 1P1QA 4G8MA 4O3AA 4DXBA 2DXYA 1A99A 2Y7WA 2HZLA 3C35A 2Y7KA 4XKNA 1IITA 4HTGA 3O9PA 2R9JA 1UTBB 3LUYA 3IOWA 3W15C 1AMFA 4U4SA 1Y9UA 1MM6A 1AIVA 3IOTA 4LZ8A 3VVFA 3USDA 1VFEA 3KOSA 4AB6A 5HM4B 1MH3A 1BP5A 4XXUA 2ESNA 2XX9A 3CI8A 3C36A 4ZDMA 1B32A 3KJTA 1P1NA 2DWJA 1UQWA 1XVYA 4YB7A 4H67A 4EF1A 4OEVA 3U8QA 3AXFA 1FTOA 3O6GA 4GWOA 5TPAA 1LAGE 1JVYA 2DWAA 1B3HA 4G77A 3K1PA 3TPAA 1SD3A 2HAUA 5A5XA 4IB2A 1II5A 1XVXA 2F35A 1ELJA 3N26A 3FVOA 2OCUA 4RXLA 3KEIA 1M5CA 1ATGA 4AB5A 1P99A 4YMAA 4JWXA 2H4IA 1PDAA 4GFRA 2A5TB 3FD3A 3WAFA 3TTMA 1B52A 1TFDA 1MXXA 4IO5A 3QAXA 1POTA 2PMSA 1FTMA 1M5BA 3OO7A 4THIA 4QF9A 5KZTA 1MQIA 1QUIA 3VV5A 3LSLA 2UVIA 3G3FA 4M4GA 4JWYA 3MVXA 2Y7IA 1UTBA 1H76A 3IO4A 1JW4A 2H99A 1B4ZA 2XXQA 3BFTA 3FGSA 3M3LA 4I8CA 1N76A 3K6VA 3PU5A 2F97A 4OERA 3OEMA 4JB7A 1Q1KA 4HS7A 3DELB 3L6GA 1J1NA 2VGQA 3PMWA 4DZ1A 5I57B 4BDQA 3MAMA 2GFEA 5K2XA 5CI5A 2I3WA 3MZ9A 4ESXA 4IO4A 3MPKA 3VE1B 5EHSA 5KDTB 1SI0A 1ZKBA 3TTKA 1DMBA 2OZZA 3IOUA 4LONB 3FV2A 1Y3NA 1MXYA 1IEJA 4F2QA 1S9TA 1URSA 2OBGA 4KD5A 2OWTA 2VP1A 3QK6A 4KYSA 3Q25A 2CZLA 4LATA 3R6UA 1BKAA 3KOTA 3RQTA 5CMMA 3S9EA 5I58A 3FV1A 3VLVA 3T9XB 4QFPA 4EQBA 1Y4CA 3PV0E 5JK4A 1OMPA 1I6AA 2A5TA 2ONRA 3N6UA 2I4CA 1I6QA 1ANFA 4U23A 4BDOA 2QMWA 4R2FA 4NF4B 4WKMA 4RJZA 1MH4A 5I84A 3TAJA 2D21A 2F6PA 3PPOA 3IOVA 1B6HA 1TT1A 5ELVA 1GVCA 1A54A 1JVXA 1Z7ME 4OHNA 1Y1ZA 4F1UA 3SERA 3HO7A 1NH8A 1US5A 4X1DA 3Q27A 2DXRA 2Q8JA 4PFWA 5I59B 2PX1A 2GH9A 3HHFA 1DPPA 1SVXB 3ILTB 4OESA 3TCHA 2ZYOA 4H8IA 4GOTA 1Y3PA 1Y1MA 5L9SA 4OEUA 2NXOA 3SEUA 3ODBA 4Q30B 2A5SA 4WEPA 4G2ZA 1ZMGA 4Q8RA 3KBRA 1T0KA 4BDRA 5KDTA 5AA1A 1JETA 2XXIA 4ISUA 3H3GA 1IIWA 3T9VA 4DCYA 3N94A 4P0GA 1USYE 2HCAA 4KHZE 1A8FA 2P2AA 5DVIA 2V84A 2RC9A 4R6HA 3HCQA 3U1OA 2REGA 4NEDA 4XIGQ 2H98A 1N04A 3OSRA 3FXQA 1LB9A 4BDMA 2VD3A 4HCWA 5B7DA 2H25A 5DEXA 3DM0A 4ZE8A 4GIZA 2XXHA 1M5DA 3S9NC 1SW1A 2ZNTA 1B9JA 3ZKKA 1MRPA 2UYFA 4NF4A 4R74A 1WODA 3RTFB 2HXWA 1XOCA 3LSFB 5EHMA 1MQDA 1IZ1A 1ZTYA 3OEKA 5I2NA 2VD2A 2V3QA 4WXJA 3PPRA 3TFLA 3H6TA 4OXVA 3CIJA 3S9LC 4YAHX 4NWDA 2UVHA 3IJXB 1IXGA 5AA2A 2FA7A 5J1DA 3IR1A 4F3BA 1SW5A 1MG1A 4F19A 3OD7A 3VLUA 4ZZAA 1MXUA 3TCGA 5TP9A 4NF5A 1DSNA 1GTKA 4UA8A 2Q88A 1DTZA 1JW5A 1DPEA 3FASA 3CSGA 2O84X 4H0WA 3TQWA 3C9HA 1UIVA 4QFOA 3HSTA 4GXAA 3QSLA 3O6IA 4H5GA 1N3WA 3GXAA 3ZSFA 1IUDA 3OMBA 3WAEA 3CR9A 3T9HB 4XKRA 4YKKA 3IB2A 4P11A 4PFYA 4ELOA 2I58A 3KFMA 1M5EA 4EF2A 1B7HA 4HW8A 1B0LA 1OLCA 3MVZA 4PQJA 2RC8A 3SDFA 3VXCA 2NVUB 4ONYA 5AA4B 3N5LA 3C31A 2RC7A 4N13A 4FE8A 3G3JA 1LAHE 3MPLA 3RPWA 1NH7A 3FATA 2AIXA 1SDXA 2O7IA 4QSCA 3C4MA 4EQ9A 1EU8A 1USYH 4KQPA 3MVWA 4X9TA 3U72A 1LB8A 4NF6A 3PUZE 4LQ2A 3DP8A 1JEVA 2NUVA 4OENA 4OVJA 3MZBA 2HFBA 3TTLA 4C0RA 3MZ1A 4PP0A 2NOOA 2AL5A 4G68B 1H43A 3O2AA 3G3KA 4E0XA 4KYEA 2DE2A 1URGA 1LCTA 1LBBA 1YCJA 3C32A 2QJEA 4QHQA 2I0BA 1FCKA 3G3HA 1B40A 4FORA 1QUJA 1DTGA 4POWA 1H45A 4Z7EA 2DP8A 2W7YA 1BIYA 3TODA 1MPCA 4NWCA 2GHBA 4F29A 4P0IA 1XHYA 2QSXA 1KWHA 5H8QB 5ITOA 1H44A 2DE4A 2QS3A 3UN6A 4ZEIA 3Q26A 2V3TA 2ALUA 5I2KA 3K6UA 4KCCA 2QS2A 4KR5A 2M8CA 4RK9A 2ONSA 3H6UA 5BWJA 1QUKA 4GVOA 2YJPA 1TWYA 4QSDA 2XXUA 2HAVA 5BUUA 1B4HA 2RF1A 3IAZA 2H9BA 1B1XA 3C33A 4H6DA 3CSBA 5CMCA 3QUFA 2DVCA 2XXVA 3JYRA 3U93A 3B6WA 3K1MA 1ZJLA 1B3LA 1FW0A 1JEUA 4DLDA 5H8NA 3U94A 4C1UA 3KGCA 4FEDA 2Q9TA 4DIGA 3RGYA 4OTEA 4H65A 2F7AA 4R72A 1SYHA 3MW0A 1MS7A 1B58A 3IL1B 1AOVA 1AH5A 3F11A 4R75A 3E3KA 2GHAA 3T66A 1SI1A 3FVKA 3MP6A 1NNTA 2ZYNA 1MPDA 3FZVA 1PBPA 2Z22A 4U1ZA 1YPNA 3SKPA 2XX8A 3GZGA 1D9VA 5IKBA 1IXCA 1A7LA 3TYHA 1MY3A 1FQFA 1SBPA 3K02A 3T22A 3DLNA 3S4UA 3FJGA 3FUZA 4OYVA 4JXIA 1LBCA 4ELRA 3IO6A 4BLAA 1A55A 1ZLQA 4RPOA 3TEPA 3ZKLA 1A40A 1MQJA 1Y3QA 2I49A 3HN0A 4R73A 1I6BA 4EQ7A 4G8NA 1S7YA 2DE3A 3K2DA 2X7QA 5K2YA 5CRYA 1OQGA 4JWOA 4YKIA 4FATA 3MWBA 3G3IA 4QFKA 4XKQA 4R9GA 5F7VA 3K6WA 2XHDA 3TKDA 1B46A 5L8DA 4YB6A 4FEBA 1IXHA 3B7DA 3DP6A 3H06B 3PMXA 2Q89A 1NMUA 3S2VA 2RCAA 3K6XA 2UVJA 2XXPA 1JNFA 1HSJA 2DWIA 4OWDA 2XXTA 1B1HA 3KN8A 1IQ7A 3THIA 1LFGA 3LSXA 3OO9A 5DT6A 4F39A 5I57A 3PD8A 2O68A 3VXBA 1QKBA 1NNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UA8 A;  1N3X A;  1VSO A;  3H4Z A;  1MXV A;  1FTL A;  4GXS B;  1YTV A;  3LC8 A;  4NF8 B;  3UP9 A;  4QSE A;  5FHN A;  2B3B A;  3SEY A;  3CFX A;  3BFU A;  4FAJ A;  1MY4 A;  3C34 A;  3CRB A;  3T93 B;  4KI0 E;  3PUX E;  1F9B A;  1MQG A;  3MJN A;  4QFN A;  4PE5 B;  2PYY A;  2B65 A;  4RA1 A;  1MM7 A;  1FQE A;  1ZBM A;  4JSD A;  2REJ A;  4TQU Q;  5H8H B;  2O7U A;  1MPB A;  3CFL A;  1WDN A;  5DVJ A;  4RYA A;  4YU0 A;  2O6A A;  4JDF A;  2NWJ A;  1ZU0 A;  3E9X A;  3K4U A;  3O6H A;  5EYF A;  3TTR A;  3L6H A;  1B0H A;  2G93 A;  4RK2 A;  4BDN A;  2XXW A;  3EQ1 A;  1PB7 A;  1GGG A;  4ESW A;  2Z23 A;  3KN7 A;  1D3K A;  3I5O A;  2PT2 A;  1PEB A;  1DOT A;  1Z7N E;  5H8F B;  3FXR A;  3TMG A;  3PUY E;  2QMX A;  5I56 B;  5HPQ A;  2WKY A;  3MVY A;  3TQL A;  2AYS A;  4U21 A;  4ELP A;  3VDF A;  4ZEK A;  3MQ9 A;  5I59 A;  3HPI A;  4G4P A;  4EDP A;  3GLB A;  2XXY A;  3PUV E;  4GQO A;  1XT8 A;  3FVN A;  4KPT A;  4C1T A;  4G8H A;  3SET A;  1MXW A;  4H8J A;  2P1S A;  5DYH A;  2Q2C A;  4MLQ A;  2ZNU A;  5JTY B;  2DOJ A;  4ECF A;  3TDJ A;  3OXN A;  4RNS A;  2PBW A;  3MC2 A;  1B3F A;  4ZED A;  4LP2 B;  5H8S A;  1NNP A;  1GV8 A;  4I1D A;  1NFT A;  1D9Y A;  1UTH B;  2UXA A;  1N7W A;  1N84 A;  3LSW A;  1HSE A;  2H5Y A;  4TOZ A;  4UAC A;  2XXR A;  3HHG A;  5FTH A;  4F1Y A;  3GBB A;  3Q29 A;  2DYX A;  1UIU A;  3MP1 A;  4F22 A;  5AA2 D;  4U1O A;  3JZJ A;  2ANJ A;  2F7B A;  3P7I A;  2HQ0 A;  3IOR A;  4IO2 A;  3O66 A;  4KCD A;  4PFT A;  3S9M C;  4Q0C A;  5H8F A;  5I56 A;  4F18 A;  5JEI A;  3O28 A;  4OZ9 A;  3M3K A;  4R2B A;  3UIF A;  4YZZ A;  3OO6 A;  1BLF A;  3SEV A;  1LAF E;  1QVS A;  2Z8E A;  1MY2 A;  1QW0 A;  2VHA A;  3ONM A;  1FQC A;  5CBS A;  3I6V A;  5TPA B;  4MF3 A;  5CBR A;  1QKA A;  2F8D A;  4PFU A;  2Y7P A;  4IGR A;  1RYX A;  3EHS A;  4IO3 A;  2XD2 A;  3OEN A;  3D4G A;  3VFJ A;  1P1O A;  2F5X A;  3KZG A;  5A5X B;  2OWS A;  1JQF A;  1NKX A;  4H5F A;  2QS1 A;  2DVZ A;  4YB5 A;  4U2R A;  1I69 A;  1R1N A;  2BJJ X;  3ECR A;  2I6E A;  1VR5 A;  5FHM A;  1TXF A;  4MFI A;  1NL5 A;  2KLF A;  1PB8 A;  2UVG A;  2V93 A;  4IY5 A;  3EN3 A;  2E1S A;  3B6T A;  2OJT A;  3OSQ A;  3Q28 A;  3PPP A;  1H3D A;  4DXU A;  3K1N A;  4Z0I A;  3PD9 A;  2P0S A;  3R26 A;  2R6G E;  4LQ5 A;  3D4C A;  3PGF A;  3O29 A;  5AA4 A;  1ZIU A;  5ICQ A;  1TFA A;  1IXI A;  1FQD A;  4X1B A;  3V83 A;  3G7W A;  3A3C A;  4OFL A;  3A09 A;  5ITP A;  4K3F A;  3RLF E;  4XKP A;  1SYI A;  2R71 A;  4GD5 A;  2ZYM A;  1P1W A;  2D3I A;  4LUB A;  1LCF A;  4ND9 A;  5FHO A;  3EHT A;  1EZ9 A;  3OOA A;  2DSF A;  3SES A;  4G68 A;  2E0S A;  1R6Z A;  4EXK A;  3H6V A;  3UK4 A;  5I58 B;  3BKI B;  4U22 A;  5CMB A;  5AA3 A;  5AE4 A;  3T9U A;  1MQH A;  1MXZ A;  1PBQ A;  2DS9 A;  2V25 A;  4TLM B;  1RYO A;  3M3F A;  2FYI A;  4MBP A;  3VVE A;  4LA9 A;  5HBC A;  3ZS6 A;  2O1M A;  1B5J A;  3MBP A;  4R6K A;  2ZYK A;  1VE4 A;  1Q35 A;  5H8Q A;  1YAE A;  4X48 A;  3PPQ A;  2I3V A;  4EXL A;  2XXX A;  5ISU A;  3KSX A;  3SEW A;  3A3U A;  3TZA A;  2LAO A;  1XS5 A;  4DDD A;  2ABH A;  2XD3 A;  4ZE9 A;  1POY 1;  4ELQ A;  4YIC A;  3O97 A;  1CE2 A;  1FTJ A;  3IB1 A;  2Y84 A;  4L17 A;  2PVU A;  2OK2 A;  2GRV A;  3PPN A;  3K01 A;  4MLV A;  2O1L A;  1EH3 A;  4ZZE A;  2HZK A;  1LST A;  3I3V A;  4FEC A;  3V89 B;  2YLN A;  2F34 A;  2ZNS A;  3TCF A;  4IO7 A;  3EHU A;  1Y20 A;  3FJM A;  3N6T A;  1QUL A;  4DXC A;  3RTW B;  5L9O A;  3KG2 A;  3QXM A;  4LZ5 A;  3QUJ A;  3IX1 A;  4GL8 A;  4BDL A;  4ZEC A;  2OLB A;  2AL4 A;  1SW4 A;  3V8X B;  3VLW A;  3PUW E;  5M2V A;  4YKJ A;  4PET A;  5TU0 A;  1URD A;  5DEX B;  5CM6 A;  2Z8F A;  3KN3 A;  2Q2A A;  2QPQ A;  2F6G A;  3BBR A;  1GR2 A;  4H1X A;  5KCJ B;  1QJM A;  3PMV A;  4JBZ A;  1O63 A;  2CMO A;  4IO6 A;  4F3P A;  1B5I A;  2THI A;  3OO8 A;  1OVB A;  4O3C A;  3RUM A;  3RT8 A;  5I2N B;  1FTK A;  2QS4 A;  4YKP A;  1B2H A;  5F1Q A;  3B6Q A;  3ILU B;  3MP8 A;  4Q5T A;  2VOZ A;  3K0V A;  4M1V A;  5CMK A;  3LBS A;  5AA2 B;  1JW1 A;  1P1U A;  3TTN A;  4OET A;  3U92 A;  1SQY A;  2ZXT A;  4GLI A;  4ZS9 A;  1B05 A;  4I62 A;  3UGW A;  4NTL A;  4EUO A;  4OFJ A;  4QFL A;  4R9F A;  2PT1 A;  5TP9 B;  4NF5 B;  4HCY A;  3TUS A;  4JSO A;  1HSL A;  3EPE A;  2FNC A;  4NMY A;  1AL3 A;  1FQB A;  3FVG A;  1LLS A;  2Z8D A;  3KJ7 A;  2HEU A;  2ONK E;  1N7X A;  3T96 B;  1D4N A;  3IK6 B;  2F7C A;  3H7M A;  1PC3 A;  1R9Q A;  1OVT A;  4ZEB A;  2XX7 A;  1MY1 A;  4F3S A;  4KYD A;  5FTI A;  3H6W A;  4RPN A;  4WED A;  1BTJ A;  2Y7R A;  4QRZ A;  1Y4T A;  5KCJ A;  1O7T A;  4GRK A;  4MH5 A;  1B3G A;  1CB6 A;  3RNN A;  3K00 A;  4OQO A;  2F78 A;  3IB0 A;  4F1V A;  4N07 A;  3W9V A;  1XC1 A;  3EF7 A;  3DP4 A;  1M5F A;  1N0T A;  3RY3 A;  4IY6 A;  3OEL A;  4YMB A;  1L5T A;  3TEL A;  1LAX A;  4FIM A;  3QYT A;  1A8E A;  1MDP 1;  3QIM A;  5ICT A;  5IAI A;  3HV1 A;  5L9M A;  3SEX A;  4NF6 B;  2UYE A;  2QL3 A;  4NF8 A;  4GF8 A;  2D5W A;  3H03 A;  3CFZ A;  4OMB A;  5DVF A;  4GL0 A;  3W9W A;  1B7U A;  5B70 A;  2F36 A;  3UOR A;  1LFI A;  4E0W A;  4TLL B;  4AQ4 A;  4NE4 A;  3KSJ A;  2YPN A;  4N6P A;  1OLA A;  1RKM A;  4I9D A;  2V3U A;  2I4B A;  1B5H A;  2RKM A;  1SW2 A;  3E13 X;  1NNK A;  2B3F A;  5DTB A;  5H8H A;  3JV9 A;  1LGB C;  2G29 A;  2QRY A;  2O51 A;  4IGT A;  3CG1 A;  3FJ7 A;  3V5A A;  1MDQ A;  3LR1 A;  2X7P A;  5LOM A;  1OQH A;  3CVG A;  4XTC Q;  2RIN A;  4ZEF A;  1US4 A;  2I0C A;  2RCB A;  4DCX A;  2IA4 A;  2ZMB A;  1OIB A;  4G68 C;  3IJO B;  4LZ7 A;  1B51 A;  5I2K B;  3RT6 B;  4FJP A;  4F3G A;  3R7X A;  3CG3 A;  2O69 A;  2DWH A;  3MUQ A;  2I48 A;  3G3G A;  4O3B A;  3M8U A;  3GBA A;  2DQV A;  1EZO A;  4U4X A;  1EZP A;  1WVJ A;  3E4R A;  3FXU A;  4POX A;  1S50 A;  4F31 B;  4RY1 A;  1FQA A;  4R6Y A;  4KFQ A;  1R9L A;  1B7Z A;  2IEE A;  4LVQ A;  1LFH A;  3FIR A;  1O64 A;  5JTY A;  1MY0 A;  1PB9 A;  1VFD A;  2X26 A;  3VVD A;  4DE8 A;  1B3E A;  3RN8 A;  4OFO A;  4F2O A;  1UTH A;  5CC2 A;  5H8N B;  1P1Q A;  4G8M A;  4O3A A;  4DXB A;  2DXY A;  1A99 A;  2Y7W A;  2HZL A;  3C35 A;  2Y7K A;  4XKN A;  1IIT A;  4HTG A;  3O9P A;  2R9J A;  1UTB B;  3LUY A;  3IOW A;  3W15 C;  1AMF A;  4U4S A;  1Y9U A;  1MM6 A;  1AIV A;  3IOT A;  4LZ8 A;  3VVF A;  3USD A;  1VFE A;  3KOS A;  4AB6 A;  5HM4 B;  1MH3 A;  1BP5 A;  4XXU A;  2ESN A;  2XX9 A;  3CI8 A;  3C36 A;  4ZDM A;  1B32 A;  3KJT A;  1P1N A;  2DWJ A;  1UQW A;  1XVY A;  4YB7 A;  4H67 A;  4EF1 A;  4OEV A;  3U8Q A;  3AXF A;  1FTO A;  3O6G A;  4GWO A;  5TPA A;  1LAG E;  1JVY A;  2DWA A;  1B3H A;  4G77 A;  3K1P A;  3TPA A;  1SD3 A;  2HAU A;  5A5X A;  4IB2 A;  1II5 A;  1XVX A;  2F35 A;  1ELJ A;  3N26 A;  3FVO A;  2OCU A;  4RXL A;  3KEI A;  1M5C A;  1ATG A;  4AB5 A;  1P99 A;  4YMA A;  4JWX A;  2H4I A;  1PDA A;  4GFR A;  2A5T B;  3FD3 A;  3WAF A;  3TTM A;  1B52 A;  1TFD A;  1MXX A;  4IO5 A;  3QAX A;  1POT A;  2PMS A;  1FTM A;  1M5B A;  3OO7 A;  4THI A;  4QF9 A;  5KZT A;  1MQI A;  1QUI A;  3VV5 A;  3LSL A;  2UVI A;  3G3F A;  4M4G A;  4JWY A;  3MVX A;  2Y7I A;  1UTB A;  1H76 A;  3IO4 A;  1JW4 A;  2H99 A;  1B4Z A;  2XXQ A;  3BFT A;  3FGS A;  3M3L A;  4I8C A;  1N76 A;  3K6V A;  3PU5 A;  2F97 A;  4OER A;  3OEM A;  4JB7 A;  1Q1K A;  4HS7 A;  3DEL B;  3L6G A;  1J1N A;  2VGQ A;  3PMW A;  4DZ1 A;  5I57 B;  4BDQ A;  3MAM A;  2GFE A;  5K2X A;  5CI5 A;  2I3W A;  3MZ9 A;  4ESX A;  4IO4 A;  3MPK A;  3VE1 B;  5EHS A;  5KDT B;  1SI0 A;  1ZKB A;  3TTK A;  1DMB A;  2OZZ A;  3IOU A;  4LON B;  3FV2 A;  1Y3N A;  1MXY A;  1IEJ A;  4F2Q A;  1S9T A;  1URS A;  2OBG A;  4KD5 A;  2OWT A;  2VP1 A;  3QK6 A;  4KYS A;  3Q25 A;  2CZL A;  4LAT A;  3R6U A;  1BKA A;  3KOT A;  3RQT A;  5CMM A;  3S9E A;  5I58 A;  3FV1 A;  3VLV A;  3T9X B;  4QFP A;  4EQB A;  1Y4C A;  3PV0 E;  5JK4 A;  1OMP A;  1I6A A;  2A5T A;  2ONR A;  3N6U A;  2I4C A;  1I6Q A;  1ANF A;  4U23 A;  4BDO A;  2QMW A;  4R2F A;  4NF4 B;  4WKM A;  4RJZ A;  1MH4 A;  5I84 A;  3TAJ A;  2D21 A;  2F6P A;  3PPO A;  3IOV A;  1B6H A;  1TT1 A;  5ELV A;  1GVC A;  1A54 A;  1JVX A;  1Z7M E;  4OHN A;  1Y1Z A;  4F1U A;  3SER A;  3HO7 A;  1NH8 A;  1US5 A;  4X1D A;  3Q27 A;  2DXR A;  2Q8J A;  4PFW A;  5I59 B;  2PX1 A;  2GH9 A;  3HHF A;  1DPP A;  1SVX B;  3ILT B;  4OES A;  3TCH A;  2ZYO A;  4H8I A;  4GOT A;  1Y3P A;  1Y1M A;  5L9S A;  4OEU A;  2NXO A;  3SEU A;  3ODB A;  4Q30 B;  2A5S A;  4WEP A;  4G2Z A;  1ZMG A;  4Q8R A;  3KBR A;  1T0K A;  4BDR A;  5KDT A;  5AA1 A;  1JET A;  2XXI A;  4ISU A;  3H3G A;  1IIW A;  3T9V A;  4DCY A;  3N94 A;  4P0G A;  1USY E;  2HCA A;  4KHZ E;  1A8F A;  2P2A A;  5DVI A;  2V84 A;  2RC9 A;  4R6H A;  3HCQ A;  3U1O A;  2REG A;  4NED A;  4XIG Q;  2H98 A;  1N04 A;  3OSR A;  3FXQ A;  1LB9 A;  4BDM A;  2VD3 A;  4HCW A;  5B7D A;  2H25 A;  5DEX A;  3DM0 A;  4ZE8 A;  4GIZ A;  2XXH A;  1M5D A;  3S9N C;  1SW1 A;  2ZNT A;  1B9J A;  3ZKK A;  1MRP A;  2UYF A;  4NF4 A;  4R74 A;  1WOD A;  3RTF B;  2HXW A;  1XOC A;  3LSF B;  5EHM A;  1MQD A;  1IZ1 A;  1ZTY A;  3OEK A;  5I2N A;  2VD2 A;  2V3Q A;  4WXJ A;  3PPR A;  3TFL A;  3H6T A;  4OXV A;  3CIJ A;  3S9L C;  4YAH X;  4NWD A;  2UVH A;  3IJX B;  1IXG A;  5AA2 A;  2FA7 A;  5J1D A;  3IR1 A;  4F3B A;  1SW5 A;  1MG1 A;  4F19 A;  3OD7 A;  3VLU A;  4ZZA A;  1MXU A;  3TCG A;  5TP9 A;  4NF5 A;  1DSN A;  1GTK A;  4UA8 A;  2Q88 A;  1DTZ A;  1JW5 A;  1DPE A;  3FAS A;  3CSG A;  2O84 X;  4H0W A;  3TQW A;  3C9H A;  1UIV A;  4QFO A;  3HST A;  4GXA A;  3QSL A;  3O6I A;  4H5G A;  1N3W A;  3GXA A;  3ZSF A;  1IUD A;  3OMB A;  3WAE A;  3CR9 A;  3T9H B;  4XKR A;  4YKK A;  3IB2 A;  4P11 A;  4PFY A;  4ELO A;  2I58 A;  3KFM A;  1M5E A;  4EF2 A;  1B7H A;  4HW8 A;  1B0L A;  1OLC A;  3MVZ A;  4PQJ A;  2RC8 A;  3SDF A;  3VXC A;  2NVU B;  4ONY A;  5AA4 B;  3N5L A;  3C31 A;  2RC7 A;  4N13 A;  4FE8 A;  3G3J A;  1LAH E;  3MPL A;  3RPW A;  1NH7 A;  3FAT A;  2AIX A;  1SDX A;  2O7I A;  4QSC A;  3C4M A;  4EQ9 A;  1EU8 A;  1USY H;  4KQP A;  3MVW A;  4X9T A;  3U72 A;  1LB8 A;  4NF6 A;  3PUZ E;  4LQ2 A;  3DP8 A;  1JEV A;  2NUV A;  4OEN A;  4OVJ A;  3MZB A;  2HFB A;  3TTL A;  4C0R A;  3MZ1 A;  4PP0 A;  2NOO A;  2AL5 A;  4G68 B;  1H43 A;  3O2A A;  3G3K A;  4E0X A;  4KYE A;  2DE2 A;  1URG A;  1LCT A;  1LBB A;  1YCJ A;  3C32 A;  2QJE A;  4QHQ A;  2I0B A;  1FCK A;  3G3H A;  1B40 A;  4FOR A;  1QUJ A;  1DTG A;  4POW A;  1H45 A;  4Z7E A;  2DP8 A;  2W7Y A;  1BIY A;  3TOD A;  1MPC A;  4NWC A;  2GHB A;  4F29 A;  4P0I A;  1XHY A;  2QSX A;  1KWH A;  5H8Q B;  5ITO A;  1H44 A;  2DE4 A;  2QS3 A;  3UN6 A;  4ZEI A;  3Q26 A;  2V3T A;  2ALU A;  5I2K A;  3K6U A;  4KCC A;  2QS2 A;  4KR5 A;  2M8C A;  4RK9 A;  2ONS A;  3H6U A;  5BWJ A;  1QUK A;  4GVO A;  2YJP A;  1TWY A;  4QSD A;  2XXU A;  2HAV A;  5BUU A;  1B4H A;  2RF1 A;  3IAZ A;  2H9B A;  1B1X A;  3C33 A;  4H6D A;  3CSB A;  5CMC A;  3QUF A;  2DVC A;  2XXV A;  3JYR A;  3U93 A;  3B6W A;  3K1M A;  1ZJL A;  1B3L A;  1FW0 A;  1JEU A;  4DLD A;  5H8N A;  3U94 A;  4C1U A;  3KGC A;  4FED A;  2Q9T A;  4DIG A;  3RGY A;  4OTE A;  4H65 A;  2F7A A;  4R72 A;  1SYH A;  3MW0 A;  1MS7 A;  1B58 A;  3IL1 B;  1AOV A;  1AH5 A;  3F11 A;  4R75 A;  3E3K A;  2GHA A;  3T66 A;  1SI1 A;  3FVK A;  3MP6 A;  1NNT A;  2ZYN A;  1MPD A;  3FZV A;  1PBP A;  2Z22 A;  4U1Z A;  1YPN A;  3SKP A;  2XX8 A;  3GZG A;  1D9V A;  5IKB A;  1IXC A;  1A7L A;  3TYH A;  1MY3 A;  1FQF A;  1SBP A;  3K02 A;  3T22 A;  3DLN A;  3S4U A;  3FJG A;  3FUZ A;  4OYV A;  4JXI A;  1LBC A;  4ELR A;  3IO6 A;  4BLA A;  1A55 A;  1ZLQ A;  4RPO A;  3TEP A;  3ZKL A;  1A40 A;  1MQJ A;  1Y3Q A;  2I49 A;  3HN0 A;  4R73 A;  1I6B A;  4EQ7 A;  4G8N A;  1S7Y A;  2DE3 A;  3K2D A;  2X7Q A;  5K2Y A;  5CRY A;  1OQG A;  4JWO A;  4YKI A;  4FAT A;  3MWB A;  3G3I A;  4QFK A;  4XKQ A;  4R9G A;  5F7V A;  3K6W A;  2XHD A;  3TKD A;  1B46 A;  5L8D A;  4YB6 A;  4FEB A;  1IXH A;  3B7D A;  3DP6 A;  3H06 B;  3PMX A;  2Q89 A;  1NMU A;  3S2V A;  2RCA A;  3K6X A;  2UVJ A;  2XXP A;  1JNF A;  1HSJ A;  2DWI A;  4OWD A;  2XXT A;  1B1H A;  3KN8 A;  1IQ7 A;  3THI A;  1LFG A;  3LSX A;  3OO9 A;  5DT6 A;  4F39 A;  5I57 A;  3PD8 A;  2O68 A;  3VXB A;  1QKB A;  1NNF A; 
#chains in the Genus database with same CATH topology
 3UA8 A;  1N3X A;  1VSO A;  3H4Z A;  1MXV A;  2CZH A;  4HE2 A;  1FTL A;  4GXS B;  1YTV A;  3LC8 A;  4NF8 B;  4XF5 A;  3UP9 A;  4QSE A;  5FHN A;  5EQA A;  2B3B A;  3SEY A;  3CFX A;  3BFU A;  4FAJ A;  4FBP A;  1MY4 A;  3C34 A;  2HPG A;  3CRB A;  1NV4 A;  3T93 B;  5IZZ A;  4KI0 E;  3PUX E;  1F9B A;  1MQG A;  4NQ8 A;  3MJN A;  4QFN A;  3MST A;  4PE5 B;  2PYY A;  2F3B A;  2B65 A;  4RA1 A;  1MM7 A;  1FQE A;  1ZBM A;  4JSD A;  4GWU A;  2REJ A;  4TQU Q;  5H8H B;  2O7U A;  1MPB A;  3CFL A;  1WDN A;  4GX3 A;  5DVJ A;  4RYA A;  4YU0 A;  2O6A A;  4JDF A;  2NWJ A;  1ZU0 A;  3E9X A;  3K4U A;  3O6H A;  5EYF A;  3TTR A;  3L6H A;  1B0H A;  2G93 A;  4RK2 A;  4BDN A;  2XXW A;  3EQ1 A;  1PB7 A;  1GGG A;  4ESW A;  2Z23 A;  3KN7 A;  1D3K A;  3I5O A;  4GWX A;  1NV7 A;  2PT2 A;  1PEB A;  1DOT A;  1Z7N E;  5H8F B;  3FXR A;  3TMG A;  3PUY E;  2QMX A;  5I56 B;  5HPQ A;  2WKY A;  3MVY A;  3TQL A;  2AYS A;  4U21 A;  4ELP A;  4UAB A;  3VDF A;  4ZEK A;  3MQ9 A;  1D9Q A;  5I59 A;  3HPI A;  4GWW A;  4G4P A;  4EDP A;  3GLB A;  2XXY A;  3PUV E;  4GQO A;  1XT8 A;  1EYI A;  3FVN A;  4KPT A;  4C1T A;  4G8H A;  3SET A;  1MXW A;  4H8J A;  2P1S A;  2Q74 A;  5DYH A;  2Q2C A;  4MLQ A;  2ZNU A;  5JTY B;  2DOJ A;  4ECF A;  3TDJ A;  3OXN A;  4RNS A;  1FPB A;  2PBW A;  3MC2 A;  1B3F A;  4ZED A;  4LP2 B;  5H8S A;  1NNP A;  3KC0 A;  1GV8 A;  4I1D A;  1NFT A;  5ET5 A;  1D9Y A;  1FPD A;  1UTH B;  2UXA A;  1N7W A;  1N84 A;  3LSW A;  1HSE A;  4O8M A;  2H5Y A;  4TOZ A;  4UAC A;  2XXR A;  3HHG A;  5FTH A;  2QVV A;  4F1Y A;  3GBB A;  1FSA A;  3Q29 A;  2DYX A;  1UIU A;  5ESY A;  3MP1 A;  4F22 A;  5AA2 D;  4U1O A;  3JZJ A;  2ANJ A;  2F7B A;  3P7I A;  2HQ0 A;  3IOR A;  2XWK A;  4OVQ A;  4OVT A;  4IO2 A;  3O66 A;  4KCD A;  4PFT A;  3S9M C;  4Q0C A;  5H8F A;  5J16 A;  3B50 A;  5I56 A;  4F18 A;  5JEI A;  3O28 A;  4OZ9 A;  3M3K A;  4R2B A;  3UIF A;  2WBD A;  4YZZ A;  3OO6 A;  3RPL B;  1BLF A;  3SEV A;  1LAF E;  1QVS A;  2Z8E A;  1MY2 A;  1QW0 A;  2VHA A;  1FTA A;  3ONM A;  1FQC A;  4HE0 A;  5CBS A;  3I6V A;  5TPA B;  1FBH A;  4MF3 A;  5CBR A;  1QKA A;  2F8D A;  4PFU A;  2Y7P A;  4IGR A;  1RYX A;  3EHS A;  4IO3 A;  2XD2 A;  3OEN A;  3D4G A;  3VFJ A;  1P1O A;  2F5X A;  3KZG A;  5A5X B;  2OWS A;  1JQF A;  1NKX A;  4H5F A;  2QS1 A;  4NF0 A;  4AS5 A;  2DVZ A;  4G61 A;  3SZP A;  4YB5 A;  4U2R A;  1I69 A;  1R1N A;  2BJJ X;  3ECR A;  2I6E A;  3NOH A;  1VR5 A;  5FHM A;  1TXF A;  4NGU A;  4MFI A;  1NL5 A;  2KLF A;  1PB8 A;  2UVG A;  2V93 A;  4IY5 A;  3EN3 A;  2E1S A;  3B6T A;  2OJT A;  4HXV A;  1DCU A;  3OSQ A;  3Q28 A;  3PPP A;  1H3D A;  4DXU A;  3K1N A;  4Z0I A;  2ZZX A;  2PFY A;  3PD9 A;  2P0S A;  3R26 A;  2R6G E;  1EYJ A;  4LQ5 A;  3D4C A;  3PGF A;  3O29 A;  5AA4 A;  1ZIU A;  5ICQ A;  1TFA A;  5A5L A;  3E78 A;  1IXI A;  1FQD A;  4X1B A;  3V83 A;  4PCD A;  3G7W A;  3A3C A;  4OFL A;  3A09 A;  4PFB A;  5ITP A;  4P3L A;  4PGN A;  4K3F A;  3RLF E;  4XKP A;  1SYI A;  2R71 A;  1G0H A;  4GD5 A;  2ZYM A;  1P1W A;  2D3I A;  4LUB A;  2B4M A;  1LCF A;  5ET7 A;  4ND9 A;  5FHO A;  3EHT A;  4MEV A;  4PF8 A;  1EZ9 A;  3OOA A;  2DSF A;  3SES A;  4NN3 A;  4GBV A;  5FBP A;  4G68 A;  2E0S A;  1R6Z A;  4EXK A;  3H6V A;  3UK4 A;  4I3E A;  5I58 B;  3BKI B;  4MNI A;  4U22 A;  5CMB A;  5AA3 A;  1FJ9 A;  5AE4 A;  3T9U A;  1MQH A;  1MXZ A;  1PBQ A;  1LEV A;  2DS9 A;  2QVR A;  2V25 A;  4TLM B;  1RYO A;  3M3F A;  2WYK A;  2FYI A;  4MBP A;  2R8T A;  3VVE A;  4LA9 A;  5HBC A;  3ZS6 A;  2O1M A;  1G0I A;  1B5J A;  4OA4 A;  3MBP A;  4R6K A;  2ZYK A;  4O94 A;  1VE4 A;  1Q35 A;  5H8Q A;  1YAE A;  4X48 A;  4N17 A;  5EQ7 A;  3PPQ A;  3U65 A;  2I3V A;  4EXL A;  2XXX A;  4N15 A;  5ISU A;  4PAK A;  2MKZ A;  2L5V A;  3KSX A;  3SEW A;  3A3U A;  3LUZ A;  3TZA A;  2LAO A;  1XS5 A;  4DDD A;  2ABH A;  2XD3 A;  4ZE9 A;  1POY 1;  4ELQ A;  4YIC A;  3O97 A;  2XWO A;  1CE2 A;  1FTJ A;  3IB1 A;  2Y84 A;  4L17 A;  2PVU A;  1NV5 A;  2GRV A;  2OK2 A;  3PPN A;  3K01 A;  4MLV A;  2O1L A;  1EH3 A;  2Q8M A;  4ZZE A;  2HZK A;  1LST A;  3I3V A;  4FEC A;  3V89 B;  2YLN A;  2F34 A;  2ZNS A;  3TCF A;  2HXR A;  4IO7 A;  3EHU A;  1Y20 A;  3FJM A;  3N6T A;  1QUL A;  4NX1 A;  4DXC A;  3RTW B;  5L9O A;  3KG2 A;  3QXM A;  4LZ5 A;  3QUJ A;  3IX1 A;  4GL8 A;  4JVC A;  4BDL A;  4ZEC A;  2OLB A;  2AL4 A;  1SW4 A;  4QBA A;  3V8X B;  3VLW A;  3PUW E;  5M2V A;  4YKJ A;  4PET A;  5TU0 A;  1URD A;  5DEX B;  5CM6 A;  2Z8F A;  3KN3 A;  2Q2A A;  2QPQ A;  2F6G A;  3BBR A;  1GR2 A;  4H1X A;  5KCJ B;  1QJM A;  3PMV A;  4JBZ A;  1O63 A;  2CMO A;  4IO6 A;  4F3P A;  1B5I A;  2THI A;  3OO8 A;  1OVB A;  4O3C A;  3RUM A;  4DI3 D;  3RT8 A;  5I2N B;  3BIH A;  1FTK A;  2QS4 A;  4YKP A;  4GWS A;  1B2H A;  5F1Q A;  3B6Q A;  3ILU B;  3MP8 A;  1BK4 A;  4Q5T A;  2VOZ A;  3K0V A;  3FBP A;  4M1V A;  1CNQ A;  5CMK A;  3LBS A;  5AA2 B;  5I7I A;  3ISP A;  1FPF A;  1JW1 A;  1P1U A;  3TTN A;  4OET A;  3U92 A;  1SQY A;  2ZXT A;  4GLI A;  4ZS9 A;  1B05 A;  4I62 A;  3UGW A;  4NTL A;  4EUO A;  4OFJ A;  4QFL A;  4R9F A;  2PT1 A;  5TP9 B;  4NF5 B;  4HCY A;  3TUS A;  4JSO A;  1HSL A;  3EPE A;  1YYZ A;  2FNC A;  4GX4 A;  4NMY A;  1AL3 A;  4N8G A;  1FQB A;  3FVG A;  1LLS A;  2Z8D A;  3KJ7 A;  2HEU A;  3EKI A;  2KR0 A;  2ONK E;  1N7X A;  3T96 B;  1D4N A;  3IK6 B;  5ET6 A;  2F7C A;  3H7M A;  1PC3 A;  1R9Q A;  1OVT A;  4ZEB A;  3A29 A;  2XX7 A;  1MY1 A;  4F3S A;  4KYD A;  4P9K A;  5FTI A;  3H6W A;  4RPN A;  4WED A;  1BTJ A;  2Y7R A;  4QRZ A;  1Y4T A;  5KCJ A;  1O7T A;  4GRK A;  4MH5 A;  1Q9D A;  2PFZ A;  1B3G A;  1CB6 A;  3RNN A;  3K00 A;  4OQO A;  2F78 A;  3IB0 A;  4F1V A;  4N07 A;  3W9V A;  1XC1 A;  2WYP A;  1NV6 A;  1NV3 A;  3EF7 A;  4PE3 A;  3DP4 A;  1M5F A;  1N0T A;  3RY3 A;  4IY6 A;  3OEL A;  1KA1 A;  4YMB A;  1L5T A;  3TEL A;  1LAX A;  5IZ3 A;  4AS4 A;  4FIM A;  3QYT A;  1A8E A;  1MDP 1;  3QIM A;  4OVR A;  5ICT A;  5IAI A;  3HV1 A;  5L9M A;  3T0J A;  3SEX A;  4NF6 B;  2UYE A;  1IMF A;  2QL3 A;  4NF8 A;  4GF8 A;  2D5W A;  3H03 A;  3CFZ A;  4OMB A;  4KXP A;  5DVF A;  4GL0 A;  3W9W A;  1B7U A;  5B70 A;  2F36 A;  3UOR A;  1LFI A;  4E0W A;  4TLL B;  4AQ4 A;  4MX6 A;  3KC1 A;  4NE4 A;  3KSJ A;  2YPN A;  4N6P A;  2FIX A;  1OLA A;  1RKM A;  4I9D A;  2V3U A;  2I4B A;  1B5H A;  2RKM A;  1SW2 A;  3E13 X;  1NNK A;  2B3F A;  5DTB A;  5H8H A;  3JV9 A;  1LGB C;  2G29 A;  2QRY A;  2O51 A;  4IGT A;  3CG1 A;  3FJ7 A;  4GBW A;  3V5A A;  1MDQ A;  2CEX A;  3LR1 A;  2X7P A;  2F3D A;  5LOM A;  5DW8 A;  1IME A;  4PFI A;  4XFE A;  1OQH A;  3CVG A;  4XTC Q;  2RIN A;  2QVU A;  4ZEF A;  4N6D A;  1US4 A;  4IR8 A;  2I0C A;  2RCB A;  4DCX A;  2IA4 A;  1FPG A;  2XWV A;  2ZMB A;  1OIB A;  4G68 C;  3IJO B;  4LZ7 A;  2XA5 A;  1B51 A;  4O7I A;  5I2K B;  3RT6 B;  4FJP A;  4F3G A;  3R7X A;  3CG3 A;  2O69 A;  2DWH A;  3MUQ A;  2I48 A;  3G3G A;  4GX6 A;  1RDY A;  4O3B A;  3M8U A;  3GBA A;  2DQV A;  2P3V A;  1EZO A;  4U4X A;  1EZP A;  5ET8 A;  1WVJ A;  3E4R A;  3FXU A;  4POX A;  1S50 A;  4N4U A;  4F31 B;  1AWB A;  1LBW A;  4RY1 A;  1FQA A;  4R6Y A;  4KFQ A;  1R9L A;  1B7Z A;  2PCR A;  2IEE A;  1FBE A;  4LVQ A;  4PF6 A;  1LFH A;  3FIR A;  1O64 A;  5JTY A;  1MY0 A;  1PB9 A;  1VFD A;  2X26 A;  3VVD A;  4DE8 A;  5EQ8 A;  1B3E A;  3BIG A;  3RN8 A;  4OFO A;  4F2O A;  1UTH A;  5CC2 A;  5H8N B;  5IZ1 A;  2WBB A;  1P1Q A;  4G8M A;  4O3A A;  4DXB A;  2DXY A;  2FIE A;  1A99 A;  2Y7W A;  1LBV A;  1NI9 A;  2HZL A;  4I3Y A;  3C35 A;  2Y7K A;  4XKN A;  1IIT A;  4HTG A;  3O9P A;  3GYY A;  2FBP A;  2R9J A;  1UTB B;  3LUY A;  3IOW A;  2KQZ A;  3W15 C;  1AMF A;  2WX9 A;  4U4S A;  1Y9U A;  1MM6 A;  1AIV A;  3IOT A;  4LZ8 A;  3VVF A;  3USD A;  1VFE A;  3KOS A;  4AB6 A;  5HM4 B;  1MH3 A;  4P1L A;  1BP5 A;  4LN5 A;  4XXU A;  2ESN A;  2XX9 A;  3CI8 A;  3C36 A;  4ZDM A;  1B32 A;  3KJT A;  3RYD A;  1P1N A;  2DWJ A;  1UQW A;  1XVY A;  4YB7 A;  4H67 A;  4EF1 A;  4OEV A;  3RPL A;  3U8Q A;  3AXF A;  1FTO A;  2VPO A;  3O6G A;  4GWO A;  5TPA A;  1LAG E;  1JVY A;  2DWA A;  1FBF A;  3FXB A;  1B3H A;  1FRP A;  1FBP A;  4G77 A;  2OX3 A;  3K1P A;  3TPA A;  1SD3 A;  2HAU A;  5A5X A;  3IFC A;  4IB2 A;  4OVP A;  1NV0 A;  1II5 A;  1XVX A;  2F35 A;  1ELJ A;  3N26 A;  3FVO A;  4PC9 A;  2OCU A;  4RXL A;  3KEI A;  5EYG A;  1M5C A;  1ATG A;  4AB5 A;  1P99 A;  4YMA A;  4JWX A;  2H4I A;  1PDA A;  4GFR A;  2A5T B;  3FD3 A;  3WAF A;  3TTM A;  1B52 A;  1TFD A;  1MXX A;  4IO5 A;  3QAX A;  1POT A;  2PMS A;  1FTM A;  1M5B A;  3OO7 A;  4THI A;  4QF9 A;  5KZT A;  1MQI A;  1QUI A;  3VV5 A;  3LSL A;  2UVI A;  2CZK A;  2CEY A;  3G3F A;  4M4G A;  4JWY A;  3MVX A;  2CZI A;  2Y7I A;  1UTB A;  1H76 A;  3IO4 A;  5IGA A;  1JW4 A;  2H99 A;  1B4Z A;  2XXQ A;  3BFT A;  3FGS A;  3M3L A;  1SPI A;  4H46 A;  3HFU A;  4I8C A;  1N76 A;  1NUW A;  3K6V A;  3PU5 A;  2F97 A;  4OER A;  3OEM A;  4JB7 A;  1FBC A;  1Q1K A;  4HS7 A;  3DEL B;  3L6G A;  1LBX A;  1QGX A;  1YXI A;  1J1N A;  2VGQ A;  3PMW A;  4DZ1 A;  5I57 B;  4BDQ A;  3CHG A;  3MAM A;  2GFE A;  5K2X A;  5CI5 A;  2I3W A;  3MZ9 A;  4ESX A;  4IO4 A;  3MPK A;  2XWI A;  4MIJ A;  4N8Y A;  3VE1 B;  5EHS A;  5KDT B;  2WEF A;  1SI0 A;  1ZKB A;  3TTK A;  4P56 A;  1DMB A;  2OZZ A;  3IOU A;  4LON B;  3FV2 A;  1Y3N A;  1MXY A;  1IEJ A;  4F2Q A;  1S9T A;  1NUZ A;  1URS A;  2OBG A;  1NV1 A;  4KD5 A;  2OWT A;  2VP1 A;  3QK6 A;  4KYS A;  4MJO A;  3Q25 A;  2CZL A;  4LAT A;  3R6U A;  1BKA A;  3KOT A;  3RQT A;  5CMM A;  3S9E A;  5I58 A;  3FV1 A;  3VLV A;  3T9X B;  4QFP A;  4EQB A;  1Y4C A;  3PV0 E;  5JK4 A;  1KZ8 A;  1OMP A;  1I6A A;  1FPE A;  2A5T A;  2ONR A;  3N6U A;  4QXD A;  2I4C A;  1I6Q A;  1ANF A;  4U23 A;  4BDO A;  2QMW A;  4R2F A;  4NF4 B;  4WKM A;  4RJZ A;  1MH4 A;  2GQ1 A;  5I84 A;  4OAN A;  4PDH A;  4N91 A;  3TAJ A;  2D21 A;  2F6P A;  3PPO A;  3IOV A;  1B6H A;  1TT1 A;  5EYH A;  4OVS A;  5ELV A;  1GVC A;  1A54 A;  1JVX A;  1Z7M E;  4OHN A;  1Y1Z A;  4F1U A;  3SER A;  3HO7 A;  1NH8 A;  1US5 A;  4X1D A;  3Q27 A;  2DXR A;  2Q8J A;  4PFW A;  5I59 B;  4I40 A;  2PX1 A;  2GH9 A;  3HHF A;  1DBZ A;  1DPP A;  1SVX B;  3ILT B;  4OES A;  3D1R A;  3TCH A;  2ZYO A;  4H8I A;  4JVI A;  4GOT A;  1Y3P A;  1Y1M A;  5L9S A;  4OEU A;  2NXO A;  3SEU A;  3ODB A;  4Q30 B;  4N81 A;  2A5S A;  4WEP A;  4G2Z A;  4O7M A;  1ZMG A;  4Q8R A;  3KBR A;  1T0K A;  1FPI A;  4BDR A;  5KDT A;  5AA1 A;  1JET A;  2XXI A;  4ISU A;  3H3G A;  1IIW A;  2ZZV A;  3T9V A;  4HE1 A;  4DCY A;  4PTK A;  2VPN A;  3N94 A;  4P0G A;  2ZZW A;  1USY E;  2HCA A;  4KHZ E;  1A8F A;  2P2A A;  5DVI A;  2V84 A;  1RDX A;  2RC9 A;  4R6H A;  4DI4 B;  3HCQ A;  1JP4 A;  3U1O A;  2REG A;  4NED A;  4XIG Q;  2H98 A;  1N04 A;  3OSR A;  3FXQ A;  1EYK A;  1LB9 A;  4BDM A;  2VD3 A;  4HCW A;  1NUX A;  5B7D A;  2H25 A;  5DEX A;  3DM0 A;  4ZE8 A;  2B4L A;  4GIZ A;  2XXH A;  1M5D A;  3S9N C;  1SW1 A;  2ZNT A;  1B9J A;  3ZKK A;  1MRP A;  2UYF A;  4NF4 A;  4R74 A;  1WOD A;  5T3J A;  3RTF B;  2HXW A;  1XOC A;  3LSF B;  5EHM A;  1MQD A;  1IZ1 A;  1ZTY A;  3OEK A;  5I2N A;  2VD2 A;  2V3Q A;  1XI6 A;  4WXJ A;  3PPR A;  3TFL A;  3H6T A;  4OXV A;  3CIJ A;  3S9L C;  4YAH X;  4GWZ A;  4NWD A;  2UVH A;  3IJX B;  1IXG A;  5AA2 A;  2FA7 A;  5I3S A;  1NV2 A;  5J1D A;  1IMD A;  3IR1 A;  4F3B A;  1SW5 A;  1MG1 A;  4F19 A;  3OD7 A;  3VLU A;  4ZZA A;  1MXU A;  4P47 A;  3TCG A;  5TP9 A;  4NF5 A;  4JVD A;  1DSN A;  1GTK A;  4UA8 A;  1FPL A;  2Y5K A;  2Q88 A;  1DTZ A;  1JW5 A;  1DPE A;  3FAS A;  3CSG A;  2O84 X;  2V4C A;  4H0W A;  3TQW A;  3C9H A;  1UIV A;  4QFO A;  2FHY A;  4P1E A;  3HST A;  3B8B A;  4NHB A;  4GXA A;  3QSL A;  3O6I A;  4H5G A;  1N3W A;  3GXA A;  3ZSF A;  1IUD A;  3OMB A;  3WAE A;  3CR9 A;  3T9H B;  4XKR A;  4YKK A;  3IB2 A;  4P11 A;  4PAI A;  3IFA A;  4PFY A;  4ELO A;  1LBY A;  2I58 A;  1M5E A;  3KFM A;  4EF2 A;  1B7H A;  4HW8 A;  1B0L A;  1OLC A;  4GWY A;  3MVZ A;  4PQJ A;  2RC8 A;  3SDF A;  3VXC A;  4X8R A;  2NVU B;  4ONY A;  5AA4 B;  1LBZ A;  3N5L A;  3C31 A;  2RC7 A;  4N13 A;  4FE8 A;  3G3J A;  1LAH E;  3MPL A;  3RPW A;  1NH7 A;  2FVZ A;  3FAT A;  2AIX A;  1SDX A;  2HHM A;  2O7I A;  4QSC A;  3T1B A;  3C4M A;  2OWZ A;  4EQ9 A;  4MMP A;  1EU8 A;  1USY H;  1FPK A;  4KQP A;  3MVW A;  4X9T A;  3U72 A;  1LB8 A;  3ROJ A;  4NF6 A;  3PUZ E;  1FJ6 A;  1FBD A;  4LQ2 A;  3DP8 A;  1JEV A;  2NUV A;  4OEN A;  4OVJ A;  3MZB A;  2HFB A;  3TTL A;  4C0R A;  3MZ1 A;  1KA0 A;  4MCO A;  4PP0 A;  2NOO A;  2XXK A;  2AL5 A;  4G68 B;  1H43 A;  3O2A A;  3G3K A;  4E0X A;  4KYE A;  2DE2 A;  1URG A;  1LCT A;  4MNP A;  1LBB A;  1K9Y A;  1YCJ A;  3PTY A;  3C32 A;  2QJE A;  4QHQ A;  1NUY A;  2I0B A;  1FCK A;  3G3H A;  1B40 A;  4FOR A;  1QUJ A;  1DTG A;  3MYU A;  4POW A;  1H45 A;  4N6K A;  4Z7E A;  3KBZ A;  2DP8 A;  2W7Y A;  1BIY A;  4NG7 A;  3TOD A;  1MPC A;  4NWC A;  2GHB A;  4F29 A;  4P0I A;  2BJI A;  1XHY A;  2QSX A;  1KWH A;  5H8Q B;  5ITO A;  4P8B A;  1IMB A;  1H44 A;  2DE4 A;  2QS3 A;  3UN6 A;  4ZEI A;  3Q26 A;  2V3T A;  2ALU A;  5I2K A;  3K6U A;  4KCC A;  2QS2 A;  4KR5 A;  2M8C A;  4RK9 A;  2ONS A;  3H6U A;  5BWJ A;  1QUK A;  4GVO A;  2YJP A;  1TWY A;  4QSD A;  2XXU A;  2HAV A;  5BUU A;  1B4H A;  2RF1 A;  2P3N A;  3IAZ A;  2DDK A;  2H9B A;  1B1X A;  1IMC A;  4H45 A;  3C33 A;  4H6D A;  1K9Z A;  3CSB A;  1FPJ A;  5CMC A;  3QUF A;  2DVC A;  2XXV A;  3JYR A;  3U93 A;  3B6W A;  3K1M A;  1ZJL A;  1B3L A;  1FW0 A;  1JEU A;  4DLD A;  5H8N A;  3U94 A;  4C1U A;  3KGC A;  4MNC A;  4FED A;  2Q9T A;  4DIG A;  3RGY A;  4OTE A;  4H65 A;  2F7A A;  5I5P A;  4MAG A;  4R72 A;  1SYH A;  3MW0 A;  1MS7 A;  1B58 A;  4X04 A;  3IL1 B;  1AOV A;  1AH5 A;  3F11 A;  4R75 A;  3E3K A;  2GHA A;  3T66 A;  1SI1 A;  3FVK A;  3MP6 A;  1NNT A;  2ZYN A;  1MPD A;  5EQ9 A;  1DK4 A;  3FZV A;  1PBP A;  4PBQ A;  2Z22 A;  4U1Z A;  1YPN A;  3SKP A;  2XX8 A;  3GZG A;  4PGP A;  1D9V A;  5IKB A;  1IXC A;  1A7L A;  3QMF A;  4MHF A;  3TYH A;  1MY3 A;  1FQF A;  1SBP A;  3K02 A;  3T22 A;  3DLN A;  3S4U A;  3FJG A;  4PAF A;  4NAP A;  3FUZ A;  4OYV A;  4JXI A;  1LBC A;  4ELR A;  5LDZ A;  3IO6 A;  4BLA A;  1A55 A;  1ZLQ A;  4RPO A;  2JJK A;  4PFR A;  3TEP A;  3ZKL A;  1A40 A;  1MQJ A;  1Y3Q A;  2I49 A;  3HN0 A;  4R73 A;  5IM2 A;  1I6B A;  4EQ7 A;  4G8N A;  1S7Y A;  2DE3 A;  2Y5L A;  3K2D A;  2QFL A;  4PBH A;  2X7Q A;  5K2Y A;  5CRY A;  1OQG A;  4JWO A;  4YKI A;  1FBG A;  1RDZ A;  2VT5 A;  1VDW A;  4FAT A;  3LV0 A;  3MWB A;  3E79 A;  3G3I A;  4QFK A;  4XKQ A;  4R9G A;  5F7V A;  3K6W A;  2XHD A;  5F24 A;  3TKD A;  1B46 A;  5L8D A;  4YB6 A;  5LTC A;  4FEB A;  1IXH A;  3B7D A;  3DP6 A;  3H06 B;  4XEQ A;  3PMX A;  2Q89 A;  1NMU A;  3S2V A;  2RCA A;  3K6X A;  1YZ0 A;  2UVJ A;  2XXP A;  1JNF A;  1INP A;  1HSJ A;  2DWI A;  4OWD A;  2XXT A;  1B1H A;  3KN8 A;  4PDD A;  1IQ7 A;  3THI A;  1IMA A;  1LFG A;  3LSX A;  3OO9 A;  5IZ3 B;  5DT6 A;  4F39 A;  5I57 A;  3PD8 A;  2O68 A;  3VXB A;  1QKB A;  1NNF A; 
#chains in the Genus database with same CATH homology
 3UA8 A;  1N3X A;  1VSO A;  3H4Z A;  1MXV A;  1FTL A;  4GXS B;  1YTV A;  3LC8 A;  4NF8 B;  3UP9 A;  4QSE A;  5FHN A;  2B3B A;  3SEY A;  3CFX A;  3BFU A;  4FAJ A;  1MY4 A;  3C34 A;  3CRB A;  3T93 B;  4KI0 E;  3PUX E;  1F9B A;  1MQG A;  3MJN A;  4QFN A;  4PE5 B;  2PYY A;  2B65 A;  4RA1 A;  1MM7 A;  1FQE A;  1ZBM A;  4JSD A;  2REJ A;  4TQU Q;  5H8H B;  2O7U A;  1MPB A;  3CFL A;  1WDN A;  5DVJ A;  4RYA A;  4YU0 A;  2O6A A;  4JDF A;  2NWJ A;  1ZU0 A;  3E9X A;  3K4U A;  3O6H A;  5EYF A;  3TTR A;  3L6H A;  1B0H A;  2G93 A;  4RK2 A;  4BDN A;  2XXW A;  3EQ1 A;  1PB7 A;  1GGG A;  4ESW A;  2Z23 A;  3KN7 A;  1D3K A;  3I5O A;  2PT2 A;  1PEB A;  1DOT A;  1Z7N E;  5H8F B;  3FXR A;  3TMG A;  3PUY E;  2QMX A;  5I56 B;  5HPQ A;  2WKY A;  3MVY A;  3TQL A;  2AYS A;  4U21 A;  4ELP A;  3VDF A;  4ZEK A;  3MQ9 A;  5I59 A;  3HPI A;  4G4P A;  4EDP A;  3GLB A;  2XXY A;  3PUV E;  4GQO A;  1XT8 A;  3FVN A;  4KPT A;  4C1T A;  4G8H A;  3SET A;  1MXW A;  4H8J A;  2P1S A;  5DYH A;  2Q2C A;  4MLQ A;  2ZNU A;  5JTY B;  2DOJ A;  4ECF A;  3TDJ A;  3OXN A;  4RNS A;  2PBW A;  3MC2 A;  1B3F A;  4ZED A;  4LP2 B;  5H8S A;  1NNP A;  1GV8 A;  4I1D A;  1NFT A;  1D9Y A;  1UTH B;  2UXA A;  1N7W A;  1N84 A;  3LSW A;  1HSE A;  2H5Y A;  4TOZ A;  4UAC A;  2XXR A;  3HHG A;  5FTH A;  4F1Y A;  3GBB A;  3Q29 A;  2DYX A;  1UIU A;  3MP1 A;  4F22 A;  5AA2 D;  4U1O A;  3JZJ A;  2ANJ A;  2F7B A;  3P7I A;  2HQ0 A;  3IOR A;  4IO2 A;  3O66 A;  4KCD A;  4PFT A;  3S9M C;  4Q0C A;  5H8F A;  5I56 A;  4F18 A;  5JEI A;  3O28 A;  4OZ9 A;  3M3K A;  4R2B A;  3UIF A;  4YZZ A;  3OO6 A;  1BLF A;  3SEV A;  1LAF E;  1QVS A;  2Z8E A;  1MY2 A;  1QW0 A;  2VHA A;  3ONM A;  1FQC A;  5CBS A;  3I6V A;  5TPA B;  4MF3 A;  5CBR A;  1QKA A;  2F8D A;  4PFU A;  2Y7P A;  4IGR A;  1RYX A;  3EHS A;  4IO3 A;  2XD2 A;  3OEN A;  3D4G A;  3VFJ A;  1P1O A;  2F5X A;  3KZG A;  5A5X B;  2OWS A;  1JQF A;  1NKX A;  4H5F A;  2QS1 A;  2DVZ A;  4YB5 A;  4U2R A;  1I69 A;  1R1N A;  2BJJ X;  3ECR A;  2I6E A;  1VR5 A;  5FHM A;  1TXF A;  4MFI A;  1NL5 A;  2KLF A;  1PB8 A;  2UVG A;  2V93 A;  4IY5 A;  3EN3 A;  2E1S A;  3B6T A;  2OJT A;  3OSQ A;  3Q28 A;  3PPP A;  1H3D A;  4DXU A;  3K1N A;  4Z0I A;  3PD9 A;  2P0S A;  3R26 A;  2R6G E;  4LQ5 A;  3D4C A;  3PGF A;  3O29 A;  5AA4 A;  1ZIU A;  5ICQ A;  1TFA A;  1IXI A;  1FQD A;  4X1B A;  3V83 A;  3G7W A;  3A3C A;  4OFL A;  3A09 A;  5ITP A;  4K3F A;  3RLF E;  4XKP A;  1SYI A;  2R71 A;  4GD5 A;  2ZYM A;  1P1W A;  2D3I A;  4LUB A;  1LCF A;  4ND9 A;  5FHO A;  3EHT A;  1EZ9 A;  3OOA A;  2DSF A;  3SES A;  4G68 A;  2E0S A;  1R6Z A;  4EXK A;  3H6V A;  3UK4 A;  5I58 B;  3BKI B;  4U22 A;  5CMB A;  5AA3 A;  5AE4 A;  3T9U A;  1MQH A;  1MXZ A;  1PBQ A;  2DS9 A;  2V25 A;  4TLM B;  1RYO A;  3M3F A;  2FYI A;  4MBP A;  3VVE A;  4LA9 A;  5HBC A;  3ZS6 A;  2O1M A;  1B5J A;  3MBP A;  4R6K A;  2ZYK A;  1VE4 A;  1Q35 A;  5H8Q A;  1YAE A;  4X48 A;  3PPQ A;  2I3V A;  4EXL A;  2XXX A;  5ISU A;  3KSX A;  3SEW A;  3A3U A;  3TZA A;  2LAO A;  1XS5 A;  4DDD A;  2ABH A;  2XD3 A;  4ZE9 A;  1POY 1;  4ELQ A;  4YIC A;  3O97 A;  1CE2 A;  1FTJ A;  3IB1 A;  2Y84 A;  4L17 A;  2PVU A;  2OK2 A;  2GRV A;  3PPN A;  3K01 A;  4MLV A;  2O1L A;  1EH3 A;  4ZZE A;  2HZK A;  1LST A;  3I3V A;  4FEC A;  3V89 B;  2YLN A;  2F34 A;  2ZNS A;  3TCF A;  4IO7 A;  3EHU A;  1Y20 A;  3FJM A;  3N6T A;  1QUL A;  4DXC A;  3RTW B;  5L9O A;  3KG2 A;  3QXM A;  4LZ5 A;  3QUJ A;  3IX1 A;  4GL8 A;  4BDL A;  4ZEC A;  2OLB A;  2AL4 A;  1SW4 A;  3V8X B;  3VLW A;  3PUW E;  5M2V A;  4YKJ A;  4PET A;  5TU0 A;  1URD A;  5DEX B;  5CM6 A;  2Z8F A;  3KN3 A;  2Q2A A;  2QPQ A;  2F6G A;  3BBR A;  1GR2 A;  4H1X A;  5KCJ B;  1QJM A;  3PMV A;  4JBZ A;  1O63 A;  2CMO A;  4IO6 A;  4F3P A;  1B5I A;  2THI A;  3OO8 A;  1OVB A;  4O3C A;  3RUM A;  3RT8 A;  5I2N B;  1FTK A;  2QS4 A;  4YKP A;  1B2H A;  5F1Q A;  3B6Q A;  3ILU B;  3MP8 A;  4Q5T A;  2VOZ A;  3K0V A;  4M1V A;  5CMK A;  3LBS A;  5AA2 B;  1JW1 A;  1P1U A;  3TTN A;  4OET A;  3U92 A;  1SQY A;  2ZXT A;  4GLI A;  4ZS9 A;  1B05 A;  4I62 A;  3UGW A;  4NTL A;  4EUO A;  4OFJ A;  4QFL A;  4R9F A;  2PT1 A;  5TP9 B;  4NF5 B;  4HCY A;  3TUS A;  4JSO A;  1HSL A;  3EPE A;  2FNC A;  4NMY A;  1AL3 A;  1FQB A;  3FVG A;  1LLS A;  2Z8D A;  3KJ7 A;  2HEU A;  2ONK E;  1N7X A;  3T96 B;  1D4N A;  3IK6 B;  2F7C A;  3H7M A;  1PC3 A;  1R9Q A;  1OVT A;  4ZEB A;  2XX7 A;  1MY1 A;  4F3S A;  4KYD A;  5FTI A;  3H6W A;  4RPN A;  4WED A;  1BTJ A;  2Y7R A;  4QRZ A;  1Y4T A;  5KCJ A;  1O7T A;  4GRK A;  4MH5 A;  1B3G A;  1CB6 A;  3RNN A;  3K00 A;  4OQO A;  2F78 A;  3IB0 A;  4F1V A;  4N07 A;  3W9V A;  1XC1 A;  3EF7 A;  3DP4 A;  1M5F A;  1N0T A;  3RY3 A;  4IY6 A;  3OEL A;  4YMB A;  1L5T A;  3TEL A;  1LAX A;  4FIM A;  3QYT A;  1A8E A;  1MDP 1;  3QIM A;  5ICT A;  5IAI A;  3HV1 A;  5L9M A;  3SEX A;  4NF6 B;  2UYE A;  2QL3 A;  4NF8 A;  4GF8 A;  2D5W A;  3H03 A;  3CFZ A;  4OMB A;  5DVF A;  4GL0 A;  3W9W A;  1B7U A;  5B70 A;  2F36 A;  3UOR A;  1LFI A;  4E0W A;  4TLL B;  4AQ4 A;  4NE4 A;  3KSJ A;  2YPN A;  4N6P A;  1OLA A;  1RKM A;  4I9D A;  2V3U A;  2I4B A;  1B5H A;  2RKM A;  1SW2 A;  3E13 X;  1NNK A;  2B3F A;  5DTB A;  5H8H A;  3JV9 A;  1LGB C;  2G29 A;  2QRY A;  2O51 A;  4IGT A;  3CG1 A;  3FJ7 A;  3V5A A;  1MDQ A;  3LR1 A;  2X7P A;  5LOM A;  1OQH A;  3CVG A;  4XTC Q;  2RIN A;  4ZEF A;  1US4 A;  2I0C A;  2RCB A;  4DCX A;  2IA4 A;  2ZMB A;  1OIB A;  4G68 C;  3IJO B;  4LZ7 A;  1B51 A;  5I2K B;  3RT6 B;  4FJP A;  4F3G A;  3R7X A;  3CG3 A;  2O69 A;  2DWH A;  3MUQ A;  2I48 A;  3G3G A;  4O3B A;  3M8U A;  3GBA A;  2DQV A;  1EZO A;  4U4X A;  1EZP A;  1WVJ A;  3E4R A;  3FXU A;  4POX A;  1S50 A;  4F31 B;  4RY1 A;  1FQA A;  4R6Y A;  4KFQ A;  1R9L A;  1B7Z A;  2IEE A;  4LVQ A;  1LFH A;  3FIR A;  1O64 A;  5JTY A;  1MY0 A;  1PB9 A;  1VFD A;  2X26 A;  3VVD A;  4DE8 A;  1B3E A;  3RN8 A;  4OFO A;  4F2O A;  1UTH A;  5CC2 A;  5H8N B;  1P1Q A;  4G8M A;  4O3A A;  4DXB A;  2DXY A;  1A99 A;  2Y7W A;  2HZL A;  3C35 A;  2Y7K A;  4XKN A;  1IIT A;  4HTG A;  3O9P A;  2R9J A;  1UTB B;  3LUY A;  3IOW A;  3W15 C;  1AMF A;  4U4S A;  1Y9U A;  1MM6 A;  1AIV A;  3IOT A;  4LZ8 A;  3VVF A;  3USD A;  1VFE A;  3KOS A;  4AB6 A;  5HM4 B;  1MH3 A;  1BP5 A;  4XXU A;  2ESN A;  2XX9 A;  3CI8 A;  3C36 A;  4ZDM A;  1B32 A;  3KJT A;  1P1N A;  2DWJ A;  1UQW A;  1XVY A;  4YB7 A;  4H67 A;  4EF1 A;  4OEV A;  3U8Q A;  3AXF A;  1FTO A;  3O6G A;  4GWO A;  5TPA A;  1LAG E;  1JVY A;  2DWA A;  1B3H A;  4G77 A;  3K1P A;  3TPA A;  1SD3 A;  2HAU A;  5A5X A;  4IB2 A;  1II5 A;  1XVX A;  2F35 A;  1ELJ A;  3N26 A;  3FVO A;  2OCU A;  4RXL A;  3KEI A;  1M5C A;  1ATG A;  4AB5 A;  1P99 A;  4YMA A;  4JWX A;  2H4I A;  1PDA A;  4GFR A;  2A5T B;  3FD3 A;  3WAF A;  3TTM A;  1B52 A;  1TFD A;  1MXX A;  4IO5 A;  3QAX A;  1POT A;  2PMS A;  1FTM A;  1M5B A;  3OO7 A;  4THI A;  4QF9 A;  5KZT A;  1MQI A;  1QUI A;  3VV5 A;  3LSL A;  2UVI A;  3G3F A;  4M4G A;  4JWY A;  3MVX A;  2Y7I A;  1UTB A;  1H76 A;  3IO4 A;  1JW4 A;  2H99 A;  1B4Z A;  2XXQ A;  3BFT A;  3FGS A;  3M3L A;  4I8C A;  1N76 A;  3K6V A;  3PU5 A;  2F97 A;  4OER A;  3OEM A;  4JB7 A;  1Q1K A;  4HS7 A;  3DEL B;  3L6G A;  1J1N A;  2VGQ A;  3PMW A;  4DZ1 A;  5I57 B;  4BDQ A;  3MAM A;  2GFE A;  5K2X A;  5CI5 A;  2I3W A;  3MZ9 A;  4ESX A;  4IO4 A;  3MPK A;  3VE1 B;  5EHS A;  5KDT B;  1SI0 A;  1ZKB A;  3TTK A;  1DMB A;  2OZZ A;  3IOU A;  4LON B;  3FV2 A;  1Y3N A;  1MXY A;  1IEJ A;  4F2Q A;  1S9T A;  1URS A;  2OBG A;  4KD5 A;  2OWT A;  2VP1 A;  3QK6 A;  4KYS A;  3Q25 A;  2CZL A;  4LAT A;  3R6U A;  1BKA A;  3KOT A;  3RQT A;  5CMM A;  3S9E A;  5I58 A;  3FV1 A;  3VLV A;  3T9X B;  4QFP A;  4EQB A;  1Y4C A;  3PV0 E;  5JK4 A;  1OMP A;  1I6A A;  2A5T A;  2ONR A;  3N6U A;  2I4C A;  1I6Q A;  1ANF A;  4U23 A;  4BDO A;  2QMW A;  4R2F A;  4NF4 B;  4WKM A;  4RJZ A;  1MH4 A;  5I84 A;  3TAJ A;  2D21 A;  2F6P A;  3PPO A;  3IOV A;  1B6H A;  1TT1 A;  5ELV A;  1GVC A;  1A54 A;  1JVX A;  1Z7M E;  4OHN A;  1Y1Z A;  4F1U A;  3SER A;  3HO7 A;  1NH8 A;  1US5 A;  4X1D A;  3Q27 A;  2DXR A;  2Q8J A;  4PFW A;  5I59 B;  2PX1 A;  2GH9 A;  3HHF A;  1DPP A;  1SVX B;  3ILT B;  4OES A;  3TCH A;  2ZYO A;  4H8I A;  4GOT A;  1Y3P A;  1Y1M A;  5L9S A;  4OEU A;  2NXO A;  3SEU A;  3ODB A;  4Q30 B;  2A5S A;  4WEP A;  4G2Z A;  1ZMG A;  4Q8R A;  3KBR A;  1T0K A;  4BDR A;  5KDT A;  5AA1 A;  1JET A;  2XXI A;  4ISU A;  3H3G A;  1IIW A;  3T9V A;  4DCY A;  3N94 A;  4P0G A;  1USY E;  2HCA A;  4KHZ E;  1A8F A;  2P2A A;  5DVI A;  2V84 A;  2RC9 A;  4R6H A;  3HCQ A;  3U1O A;  2REG A;  4NED A;  4XIG Q;  2H98 A;  1N04 A;  3OSR A;  3FXQ A;  1LB9 A;  4BDM A;  2VD3 A;  4HCW A;  5B7D A;  2H25 A;  5DEX A;  3DM0 A;  4ZE8 A;  4GIZ A;  2XXH A;  1M5D A;  3S9N C;  1SW1 A;  2ZNT A;  1B9J A;  3ZKK A;  1MRP A;  2UYF A;  4NF4 A;  4R74 A;  1WOD A;  3RTF B;  2HXW A;  1XOC A;  3LSF B;  5EHM A;  1MQD A;  1IZ1 A;  1ZTY A;  3OEK A;  5I2N A;  2VD2 A;  2V3Q A;  4WXJ A;  3PPR A;  3TFL A;  3H6T A;  4OXV A;  3CIJ A;  3S9L C;  4YAH X;  4NWD A;  2UVH A;  3IJX B;  1IXG A;  5AA2 A;  2FA7 A;  5J1D A;  3IR1 A;  4F3B A;  1SW5 A;  1MG1 A;  4F19 A;  3OD7 A;  3VLU A;  4ZZA A;  1MXU A;  3TCG A;  5TP9 A;  4NF5 A;  1DSN A;  1GTK A;  4UA8 A;  2Q88 A;  1DTZ A;  1JW5 A;  1DPE A;  3FAS A;  3CSG A;  2O84 X;  4H0W A;  3TQW A;  3C9H A;  1UIV A;  4QFO A;  3HST A;  4GXA A;  3QSL A;  3O6I A;  4H5G A;  1N3W A;  3GXA A;  3ZSF A;  1IUD A;  3OMB A;  3WAE A;  3CR9 A;  3T9H B;  4XKR A;  4YKK A;  3IB2 A;  4P11 A;  4PFY A;  4ELO A;  2I58 A;  3KFM A;  1M5E A;  4EF2 A;  1B7H A;  4HW8 A;  1B0L A;  1OLC A;  3MVZ A;  4PQJ A;  2RC8 A;  3SDF A;  3VXC A;  2NVU B;  4ONY A;  5AA4 B;  3N5L A;  3C31 A;  2RC7 A;  4N13 A;  4FE8 A;  3G3J A;  1LAH E;  3MPL A;  3RPW A;  1NH7 A;  3FAT A;  2AIX A;  1SDX A;  2O7I A;  4QSC A;  3C4M A;  4EQ9 A;  1EU8 A;  1USY H;  4KQP A;  3MVW A;  4X9T A;  3U72 A;  1LB8 A;  4NF6 A;  3PUZ E;  4LQ2 A;  3DP8 A;  1JEV A;  2NUV A;  4OEN A;  4OVJ A;  3MZB A;  2HFB A;  3TTL A;  4C0R A;  3MZ1 A;  4PP0 A;  2NOO A;  2AL5 A;  4G68 B;  1H43 A;  3O2A A;  3G3K A;  4E0X A;  4KYE A;  2DE2 A;  1URG A;  1LCT A;  1LBB A;  1YCJ A;  3C32 A;  2QJE A;  4QHQ A;  2I0B A;  1FCK A;  3G3H A;  1B40 A;  4FOR A;  1QUJ A;  1DTG A;  4POW A;  1H45 A;  4Z7E A;  2DP8 A;  2W7Y A;  1BIY A;  3TOD A;  1MPC A;  4NWC A;  2GHB A;  4F29 A;  4P0I A;  1XHY A;  2QSX A;  1KWH A;  5H8Q B;  5ITO A;  1H44 A;  2DE4 A;  2QS3 A;  3UN6 A;  4ZEI A;  3Q26 A;  2V3T A;  2ALU A;  5I2K A;  3K6U A;  4KCC A;  2QS2 A;  4KR5 A;  2M8C A;  4RK9 A;  2ONS A;  3H6U A;  5BWJ A;  1QUK A;  4GVO A;  2YJP A;  1TWY A;  4QSD A;  2XXU A;  2HAV A;  5BUU A;  1B4H A;  2RF1 A;  3IAZ A;  2H9B A;  1B1X A;  3C33 A;  4H6D A;  3CSB A;  5CMC A;  3QUF A;  2DVC A;  2XXV A;  3JYR A;  3U93 A;  3B6W A;  3K1M A;  1ZJL A;  1B3L A;  1FW0 A;  1JEU A;  4DLD A;  5H8N A;  3U94 A;  4C1U A;  3KGC A;  4FED A;  2Q9T A;  4DIG A;  3RGY A;  4OTE A;  4H65 A;  2F7A A;  4R72 A;  1SYH A;  3MW0 A;  1MS7 A;  1B58 A;  3IL1 B;  1AOV A;  1AH5 A;  3F11 A;  4R75 A;  3E3K A;  2GHA A;  3T66 A;  1SI1 A;  3FVK A;  3MP6 A;  1NNT A;  2ZYN A;  1MPD A;  3FZV A;  1PBP A;  2Z22 A;  4U1Z A;  1YPN A;  3SKP A;  2XX8 A;  3GZG A;  1D9V A;  5IKB A;  1IXC A;  1A7L A;  3TYH A;  1MY3 A;  1FQF A;  1SBP A;  3K02 A;  3T22 A;  3DLN A;  3S4U A;  3FJG A;  3FUZ A;  4OYV A;  4JXI A;  1LBC A;  4ELR A;  3IO6 A;  4BLA A;  1A55 A;  1ZLQ A;  4RPO A;  3TEP A;  3ZKL A;  1A40 A;  1MQJ A;  1Y3Q A;  2I49 A;  3HN0 A;  4R73 A;  1I6B A;  4EQ7 A;  4G8N A;  1S7Y A;  2DE3 A;  3K2D A;  2X7Q A;  5K2Y A;  5CRY A;  1OQG A;  4JWO A;  4YKI A;  4FAT A;  3MWB A;  3G3I A;  4QFK A;  4XKQ A;  4R9G A;  5F7V A;  3K6W A;  2XHD A;  3TKD A;  1B46 A;  5L8D A;  4YB6 A;  4FEB A;  1IXH A;  3B7D A;  3DP6 A;  3H06 B;  3PMX A;  2Q89 A;  1NMU A;  3S2V A;  2RCA A;  3K6X A;  2UVJ A;  2XXP A;  1JNF A;  1HSJ A;  2DWI A;  4OWD A;  2XXT A;  1B1H A;  3KN8 A;  1IQ7 A;  3THI A;  1LFG A;  3LSX A;  3OO9 A;  5DT6 A;  4F39 A;  5I57 A;  3PD8 A;  2O68 A;  3VXB A;  1QKB A;  1NNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...